F225222

General Info

Members Datasets Scaffolds Average Seq Length
156 91 312 129

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10010983|Ga0307410_100109839
Length 140
Sequence MAGSAPIAAEELRAVLAPVLPWLAGEAEQPPRAVVGAAVKTTARWLAQQVPGHSVEVRVPPHVAVQCVPGPRHTRGTPPNVVETDALTWLRLASGQLAWGTAVADGKVVASGNRADMSGYLPLSPLSPSGRPRRQESSPG

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
9 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
10 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
18 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
19 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
20 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
21 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
22 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
23 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
24 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
25 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
26 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
27 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
31 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
32 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
33 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
34 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
35 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
36 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
37 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
38 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
39 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
40 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
41 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
42 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
43 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
59 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
60 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
61 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
62 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
72 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
73 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
76 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
77 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
78 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
79 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
82 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
84 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
85 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
86 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
87 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
88 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
89 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
90 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
91 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.87
Metatranscriptomes 0
Isolates 5.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 3.21
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10010983 3300031852 Bacteria 5158
2 Ga0070658_11452296 3300005327 Bacteria 595
3 Ga0070682_100818015 3300005337 Bacteria 758
4 Ga0070691_10748987 3300005341 Bacteria 591
5 Ga0070693_100859371 3300005547 Bacteria 677
6 Ga0075365_10202808 3300006038 Bacteria 1390
7 Ga0075364_10000830 3300006051 Bacteria 16299
8 Ga0075364_10290212 3300006051 Bacteria 1113
9 Ga0075362_10075575 3300006177 Bacteria 1545
10 Ga0075369_10000684 3300006186 Bacteria 10833
11 Ga0097621_102070896 3300006237 Bacteria 544
12 Ga0114129_12165367 3300009147 Bacteria 670
13 Ga0105243_10010017 3300009148 Bacteria 7208
14 Ga0105243_12118667 3300009148 Bacteria 598
15 Ga0105249_10946218 3300009553 Bacteria 929
16 Ga0157369_10285268 3300013105 Bacteria 1719
17 Ga0207709_10013842 3300025935 Bacteria 4453
18 Ga0207669_11769670 3300025937 Bacteria 528
19 Ga0307408_100687616 3300031548 Bacteria 918
20 Ga0307408_101261090 3300031548 Bacteria 691
21 Ga0307405_10578460 3300031731 Bacteria 913
22 Ga0307405_10912494 3300031731 Bacteria 744
23 Ga0307413_10206806 3300031824 Bacteria 1422
24 Ga0307410_10054634 3300031852 Bacteria 2708
25 Ga0307410_10456732 3300031852 Bacteria 1043
26 Ga0307410_10474388 3300031852 Bacteria 1025
27 Ga0307410_10723050 3300031852 Bacteria 841
28 Ga0307410_10902937 3300031852 Bacteria 757
29 Ga0307410_11044818 3300031852 Bacteria 706
30 Ga0307406_10056404 3300031901 Bacteria 2515
31 Ga0307406_11036533 3300031901 Bacteria 705
32 Ga0307407_10078273 3300031903 Bacteria 1991
33 Ga0307407_10266742 3300031903 Bacteria 1180
34 Ga0307407_10538671 3300031903 Bacteria 861
35 Ga0307407_11048577 3300031903 Bacteria 632
36 Ga0307412_10084607 3300031911 Bacteria 2202
37 Ga0307412_11656679 3300031911 Bacteria 585
38 Ga0307409_100022083 3300031995 Bacteria 4379
39 Ga0307409_100046035 3300031995 Bacteria 3299
40 Ga0307409_100223181 3300031995 Bacteria 1702
41 Ga0307409_100284880 3300031995 Bacteria 1529
42 Ga0307409_100623806 3300031995 Bacteria 1068
43 Ga0307409_100678441 3300031995 Bacteria 1027
44 Ga0307409_100741866 3300031995 Bacteria 985
45 Ga0307409_100904718 3300031995 Bacteria 896
46 Ga0307409_100963921 3300031995 Bacteria 869
47 Ga0307409_101218093 3300031995 Bacteria 776
48 Ga0307409_101514824 3300031995 Bacteria 698
49 Ga0307409_102375677 3300031995 Bacteria 559
50 Ga0307416_100066709 3300032002 Bacteria 2964
51 Ga0307416_100103659 3300032002 Bacteria 2484
52 Ga0307416_100142778 3300032002 Bacteria 2179
53 Ga0307416_100148383 3300032002 Bacteria 2146
54 Ga0307416_100243787 3300032002 Bacteria 1744
55 Ga0307416_100568767 3300032002 Bacteria 1209
56 Ga0307416_100842570 3300032002 Bacteria 1015
57 Ga0307416_101516781 3300032002 Bacteria 776
58 Ga0307416_101574694 3300032002 Bacteria 762
59 Ga0307416_102496045 3300032002 Bacteria 615
60 Ga0307414_10040529 3300032004 Bacteria 3147
61 Ga0307414_10850505 3300032004 Bacteria 834
62 Ga0307414_11337340 3300032004 Bacteria 665
63 Ga0307411_10062270 3300032005 Bacteria 2488
64 Ga0307411_10407025 3300032005 Bacteria 1126
65 Ga0307411_10938675 3300032005 Bacteria 771
66 Ga0307411_11251209 3300032005 Bacteria 674
67 Ga0307415_100011906 3300032126 Bacteria 5004
68 Ga0307415_100026649 3300032126 Bacteria 3650
69 Ga0307415_100088955 3300032126 Bacteria 2229
70 Ga0307415_100301996 3300032126 Bacteria 1326
71 Ga0307415_100329144 3300032126 Bacteria 1277
72 Ga0307415_100346505 3300032126 Bacteria 1249
73 Ga0307415_100690810 3300032126 Bacteria 920
74 Ga0307415_100995741 3300032126 Bacteria 779
75 Ga0395899_0660491 3300037312 Bacteria 660
76 Ga0395901_0518823 3300038443 Bacteria 1211
77 Ga0436365_1833781 3300039437 Bacteria 32006
78 Ga0436361_0210447 3300039447 Bacteria 670
79 Ga0436363_0869722 3300039450 Bacteria 604
80 Ga0436362_0993096 3300039453 Bacteria 654
81 Ga0439461_0025858 3300041410 Bacteria 1194
82 Ga0439466_0008297 3300041411 Bacteria 3915
83 Ga0439465_0003290 3300041413 Bacteria 5278
84 Ga0439465_0007793 3300041413 Bacteria 3395
85 Ga0439465_0009058 3300041413 Bacteria 3137
86 Ga0451841_0298096 3300041498 Bacteria 696
87 Ga0439431_0007051 3300041997 Bacteria 2500
88 Ga0439442_016051 3300042002 Bacteria 1544
89 Ga0439445_0013877 3300042004 Bacteria 1955
90 Ga0439446_0078416 3300042156 Bacteria 1020
91 Ga0439434_0000529 3300042435 Bacteria 10897
92 Ga0439434_0086705 3300042435 Bacteria 998
93 Ga0439459_0078472 3300042438 Bacteria 775
94 Ga0466972_0246303 3300044658 Bacteria 836
95 Ga0466972_0495986 3300044658 Bacteria 575
96 Ga0466965_0043116 3300044683 Bacteria 2227
97 Ga0466966_0211568 3300044684 Bacteria 1172
98 Ga0466961_0197337 3300044693 Bacteria 1246
99 Ga0466961_0399363 3300044693 Bacteria 834
100 Ga0466961_0408681 3300044693 Bacteria 823
101 Ga0466963_0164602 3300044694 Bacteria 1545
102 Ga0466963_0358151 3300044694 Bacteria 1028
103 Ga0466971_0095666 3300044719 Bacteria 1362
104 Ga0466970_0069663 3300044765 Bacteria 1891
105 Ga0466970_0463416 3300044765 Bacteria 727
106 Ga0466957_0316439 3300044842 Bacteria 1052
107 Ga0466957_0318608 3300044842 Bacteria 1049
108 Ga0466960_0038821 3300044901 Bacteria 2242
109 Ga0466960_0078362 3300044901 Bacteria 1659
110 Ga0466959_0069706 3300045049 Bacteria 2547
111 Ga0466959_0684389 3300045049 Bacteria 688
112 Ga0466959_0870206 3300045049 Bacteria 601
113 Ga0466958_0270236 3300045836 Bacteria 1089
114 Ga0466958_0843875 3300045836 Bacteria 598
115 Ga0466967_0375661 3300045976 Bacteria 1379
116 Ga0466967_0569774 3300045976 Bacteria 1115
117 Ga0495580_1102668 3300046472 Bacteria 502
118 Ga0495606_0515591 3300046507 Bacteria 601
119 Ga0495663_0075001 3300046525 Bacteria 1082
120 Ga0495665_0017928 3300046531 Bacteria 3805
121 Ga0495656_0236196 3300046615 Bacteria 919
122 Ga0495588_0614097 3300046674 Bacteria 569
123 Ga0495593_0052190 3300047673 Bacteria 2162
124 Ga0496100_0004442 3300048903 Bacteria 7436
125 Ga0496101_0000031 3300048904 Bacteria 195195
126 Ga0496102_0000065 3300048905 Bacteria 161370
127 Ga0496103_0000048 3300048906 Bacteria 160911
128 Ga0496106_0216264 3300048909 Bacteria 1527
129 Ga0496116_0000125 3300048919 Bacteria 160885
130 Ga0496117_0000111 3300048920 Bacteria 184570
131 Ga0496118_0000083 3300048921 Bacteria 184570
132 Ga0496119_0052871 3300048922 Bacteria 2485
133 Ga0496119_0103061 3300048922 Bacteria 1598
134 Ga0496120_0013212 3300048923 Bacteria 5572
135 Ga0496120_0234355 3300048923 Bacteria 870
136 Ga0496121_0000728 3300048924 Bacteria 60874
137 Ga0496126_0000220 3300048929 Bacteria 124547
138 Ga0501069_0338246 3300049585 Bacteria 886
139 Ga0501243_056810 3300049675 Bacteria 718
140 nmdc:mga03683_66880_c1 3300050489 Bacteria 1529
141 nmdc:mga03n38_18265_c1 3300050490 Bacteria 2765
142 nmdc:mga00v17_2758_c1 3300050491 Bacteria 9012
143 nmdc:mga06z11_392080_c1 3300050494 Bacteria 835
144 nmdc:mga05p37_1024131_c1 3300050507 Bacteria 874
145 nmdc:mga0sz30_108882_c1 3300050516 Bacteria 1213
146 nmdc:mga0sz30_328569_c1 3300050516 Bacteria 683
147 nmdc:mga0sz30_4196_c1 3300050516 Bacteria 5190
148 Ga0466962_0708177 3300061719 Bacteria 517
149 2623497910 2622736605 Bacteria 4992138
150 2738888703 2738541308 Bacteria 7020677
151 2739237904 2738543011 Bacteria 5731169
152 2753039041 2751185725 Bacteria 5740550
153 2753327402 2751185792 Bacteria 5739090
154 2889303583 2889300758 Bacteria 5690814
155 2956942099 2956939328 Bacteria 3474458
156 3001119449 3001119090 Bacteria 3449530
157 Ga0307410_10010983
158 Ga0070658_11452296
159 Ga0070682_100818015
160 Ga0070691_10748987
161 Ga0070693_100859371
162 Ga0075365_10202808
163 Ga0075364_10000830
164 Ga0075364_10290212
165 Ga0075362_10075575
166 Ga0075369_10000684
167 Ga0097621_102070896
168 Ga0114129_12165367
169 Ga0105243_10010017
170 Ga0105243_12118667
171 Ga0105249_10946218
172 Ga0157369_10285268
173 Ga0207709_10013842
174 Ga0207669_11769670
175 Ga0307408_100687616
176 Ga0307408_101261090
177 Ga0307405_10578460
178 Ga0307405_10912494
179 Ga0307413_10206806
180 Ga0307410_10054634
181 Ga0307410_10456732
182 Ga0307410_10474388
183 Ga0307410_10723050
184 Ga0307410_10902937
185 Ga0307410_11044818
186 Ga0307406_10056404
187 Ga0307406_11036533
188 Ga0307407_10078273
189 Ga0307407_10266742
190 Ga0307407_10538671
191 Ga0307407_11048577
192 Ga0307412_10084607
193 Ga0307412_11656679
194 Ga0307409_100022083
195 Ga0307409_100046035
196 Ga0307409_100223181
197 Ga0307409_100284880
198 Ga0307409_100623806
199 Ga0307409_100678441
200 Ga0307409_100741866
201 Ga0307409_100904718
202 Ga0307409_100963921
203 Ga0307409_101218093
204 Ga0307409_101514824
205 Ga0307409_102375677
206 Ga0307416_100066709
207 Ga0307416_100103659
208 Ga0307416_100142778
209 Ga0307416_100148383
210 Ga0307416_100243787
211 Ga0307416_100568767
212 Ga0307416_100842570
213 Ga0307416_101516781
214 Ga0307416_101574694
215 Ga0307416_102496045
216 Ga0307414_10040529
217 Ga0307414_10850505
218 Ga0307414_11337340
219 Ga0307411_10062270
220 Ga0307411_10407025
221 Ga0307411_10938675
222 Ga0307411_11251209
223 Ga0307415_100011906
224 Ga0307415_100026649
225 Ga0307415_100088955
226 Ga0307415_100301996
227 Ga0307415_100329144
228 Ga0307415_100346505
229 Ga0307415_100690810
230 Ga0307415_100995741
231 Ga0395899_0660491
232 Ga0395901_0518823
233 Ga0436365_1833781
234 Ga0436361_0210447
235 Ga0436363_0869722
236 Ga0436362_0993096
237 Ga0439461_0025858
238 Ga0439466_0008297
239 Ga0439465_0003290
240 Ga0439465_0007793
241 Ga0439465_0009058
242 Ga0451841_0298096
243 Ga0439431_0007051
244 Ga0439442_016051
245 Ga0439445_0013877
246 Ga0439446_0078416
247 Ga0439434_0000529
248 Ga0439434_0086705
249 Ga0439459_0078472
250 Ga0466972_0246303
251 Ga0466972_0495986
252 Ga0466965_0043116
253 Ga0466966_0211568
254 Ga0466961_0197337
255 Ga0466961_0399363
256 Ga0466961_0408681
257 Ga0466963_0164602
258 Ga0466963_0358151
259 Ga0466971_0095666
260 Ga0466970_0069663
261 Ga0466970_0463416
262 Ga0466957_0316439
263 Ga0466957_0318608
264 Ga0466960_0038821
265 Ga0466960_0078362
266 Ga0466959_0069706
267 Ga0466959_0684389
268 Ga0466959_0870206
269 Ga0466958_0270236
270 Ga0466958_0843875
271 Ga0466967_0375661
272 Ga0466967_0569774
273 Ga0495580_1102668
274 Ga0495606_0515591
275 Ga0495663_0075001
276 Ga0495665_0017928
277 Ga0495656_0236196
278 Ga0495588_0614097
279 Ga0495593_0052190
280 Ga0496100_0004442
281 Ga0496101_0000031
282 Ga0496102_0000065
283 Ga0496103_0000048
284 Ga0496106_0216264
285 Ga0496116_0000125
286 Ga0496117_0000111
287 Ga0496118_0000083
288 Ga0496119_0052871
289 Ga0496119_0103061
290 Ga0496120_0013212
291 Ga0496120_0234355
292 Ga0496121_0000728
293 Ga0496126_0000220
294 Ga0501069_0338246
295 Ga0501243_056810
296 nmdc:mga03683_66880_c1
297 nmdc:mga03n38_18265_c1
298 nmdc:mga00v17_2758_c1
299 nmdc:mga06z11_392080_c1
300 nmdc:mga05p37_1024131_c1
301 nmdc:mga0sz30_108882_c1
302 nmdc:mga0sz30_328569_c1
303 nmdc:mga0sz30_4196_c1
304 Ga0466962_0708177
305 2623497910
306 2738888703
307 2739237904
308 2753039041
309 2753327402
310 2889303583
311 2956942099
312 3001119449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17844

SCP_3

Bacterial SCP ortholog

31

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zy7-assembly2.cif.gz_B crystal structure of a mycobacterial protein 0.92 3 126
4nss-assembly1.cif.gz_A a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.9173 6 126
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.9107 6 126
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.9035 6 126
4nss-assembly2.cif.gz_B a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.8944 6 126
ID Description Score Start End Superfamily
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.9527 1 121 3.30.1050.40
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.9092 1 121 3.30.1050.40
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8944 6 126 3.30.1050.40
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8651 6 126 3.30.1050.40
1mqvB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7385 8 46 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A4Y9PDE9-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9949 1 126
AF-A0A0L8QGA8-F1-model_v4 deleted 0.9888 40 121
AF-A0A543PAI4-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9875 1 126
AF-A0A4Y9PDE9-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9871 1 126
AF-A0A7W0FRM6-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9866 50 121

Map