F221515

General Info

Members Datasets Scaffolds Average Seq Length
155 125 310 261

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100000209|Ga0070659_10000020949
Length 260
Sequence MSGAGKIRFGIGGWTFEPWRGVFYPPGLKHADELAYAASHLTAIEINGTYYSSFKPDSWAKWRAATPDGFRFAVKASRFCTNRRVLGEMGESMGKFLNQGLSPILWQFMATKKFDPDDFEAFLKLLPKSQDGLPLAHVVEPRHSSFMTPEFIALSRKYGVTVCLADHFEYPLIPDVSGDIVYARLQTGSDDVATAYPPEKLDLWADRFKTYSAGGAPHDLPAVDAAHPAPKTPRDVYAFVIHEGKVRAPAAAMALIERVA

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
26 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
28 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
29 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
41 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
59 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
60 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
61 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
62 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
69 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
72 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
73 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
74 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
75 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
76 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
77 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
81 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
82 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
83 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
84 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
85 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
86 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
87 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
88 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
89 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
90 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
93 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
94 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
104 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
105 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
106 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
107 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
112 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
113 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
114 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
115 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
116 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
117 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
118 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
119 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
120 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
121 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
122 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
123 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
124 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
125 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0
Isolates 7.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.68
Nodule 0
Rhizoplane 2.58
Rhizosphere 53.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100000209 3300005366 Bacteria 45573
2 JGI24739J22299_10005156 3300001989 Bacteria 4974
3 JGI25165J46597_1000010 3300003214 Bacteria 442113
4 Ga0068869_100025958 3300005334 Bacteria 4074
5 Ga0070689_100360088 3300005340 Bacteria 1222
6 Ga0070668_100383106 3300005347 Bacteria 1197
7 Ga0068853_100027338 3300005539 Bacteria 4793
8 Ga0068854_100008216 3300005578 Bacteria 6698
9 Ga0068852_100382437 3300005616 Bacteria 1381
10 Ga0068859_100534512 3300005617 Bacteria 1267
11 Ga0068858_100000274 3300005842 Bacteria 55319
12 Ga0068858_100000723 3300005842 Bacteria 34436
13 Ga0081539_10089141 3300005985 Bacteria 1598
14 Ga0075368_10008281 3300006042 Bacteria 3696
15 Ga0075363_100003387 3300006048 Bacteria 6776
16 Ga0075364_10339068 3300006051 Bacteria 1024
17 Ga0075362_10000978 3300006177 Bacteria 8730
18 Ga0075367_10000028 3300006178 Bacteria 31226
19 Ga0075367_10009239 3300006178 Bacteria 5146
20 Ga0075369_10042189 3300006186 Bacteria 1955
21 Ga0097620_100534573 3300006931 Bacteria 1267
22 Ga0105245_10001668 3300009098 Bacteria 20218
23 Ga0105242_10139017 3300009176 Bacteria 2105
24 Ga0105248_10052443 3300009177 Bacteria 4577
25 Ga0157378_10163712 3300013297 Bacteria 2082
26 Ga0163162_10020926 3300013306 Bacteria 6434
27 Ga0163162_10158385 3300013306 Bacteria 2385
28 Ga0183363_1015 3300015690 Bacteria 74376
29 Ga0209437_102256 3300025233 Bacteria 3809
30 Ga0209026_1009030 3300025250 Bacteria 2007
31 Ga0209233_1000044 3300025261 Bacteria 489783
32 Ga0207697_10013506 3300025315 Bacteria 3406
33 Ga0207705_10285695 3300025909 Bacteria 1263
34 Ga0207687_10003018 3300025927 Bacteria 11413
35 Ga0207706_10044495 3300025933 Bacteria 3935
36 Ga0207709_10139190 3300025935 Bacteria 1666
37 Ga0207711_10060560 3300025941 Bacteria 3263
38 Ga0207689_10041109 3300025942 Bacteria 3826
39 Ga0207640_10075354 3300025981 Bacteria 2286
40 Ga0207703_10001033 3300026035 Bacteria 26717
41 Ga0207703_10004091 3300026035 Bacteria 12030
42 Ga0207639_10079956 3300026041 Bacteria 2585
43 Ga0207698_10667319 3300026142 Bacteria 1031
44 Ga0209813_10000410 3300027866 Bacteria 10474
45 Ga0209813_10000459 3300027866 Bacteria 9879
46 Ga0209974_10011074 3300027876 Bacteria 3036
47 Ga0265337_1004219 3300028556 Bacteria 6016
48 Ga0265334_10005305 3300028573 Bacteria 5635
49 Ga0265339_10001392 3300031249 Bacteria 18003
50 Ga0265327_10003866 3300031251 Bacteria 13804
51 Ga0265316_10261836 3300031344 Bacteria 1268
52 Ga0307513_10000077 3300031456 Bacteria 134167
53 Ga0307513_10021142 3300031456 Bacteria 7688
54 Ga0265313_10011281 3300031595 Bacteria 5567
55 Ga0307508_10000011 3300031616 Bacteria 248001
56 Ga0307405_10070951 3300031731 Bacteria 2240
57 Ga0307412_10057222 3300031911 Bacteria 2602
58 Ga0307412_10135056 3300031911 Bacteria 1798
59 Ga0307414_10046694 3300032004 Bacteria 2975
60 Ga0307414_10083324 3300032004 Bacteria 2348
61 Ga0307510_10000248 3300033180 Bacteria 48764
62 Ga0307510_10149303 3300033180 Bacteria 1961
63 Ga0436361_0027550 3300039447 Bacteria 11259
64 Ga0436361_0524560 3300039447 Bacteria 2819
65 Ga0436361_1093346 3300039447 Bacteria 2219
66 Ga0436363_0235496 3300039450 Bacteria 1280
67 Ga0495638_0001117 3300046460 Bacteria 26096
68 Ga0495638_0236379 3300046460 Bacteria 1014
69 Ga0495583_0026123 3300046506 Bacteria 2902
70 Ga0495648_0006183 3300046524 Bacteria 9811
71 Ga0495648_0064767 3300046524 Bacteria 2152
72 Ga0495663_0020269 3300046525 Bacteria 1907
73 Ga0495668_0013937 3300046616 Bacteria 4726
74 Ga0495625_0000094 3300046660 Bacteria 144517
75 Ga0495625_0002964 3300046660 Bacteria 17643
76 Ga0495625_0107811 3300046660 Bacteria 1906
77 Ga0495686_0008787 3300047472 Bacteria 7362
78 Ga0495686_0048994 3300047472 Bacteria 2661
79 Ga0496102_0000100 3300048905 Bacteria 123531
80 Ga0496103_0000070 3300048906 Bacteria 121077
81 Ga0496115_0273552 3300048918 Bacteria 1387
82 Ga0496116_0001752 3300048919 Bacteria 23645
83 Ga0496117_0000194 3300048920 Bacteria 123531
84 Ga0496118_0000146 3300048921 Bacteria 123531
85 Ga0496119_0068394 3300048922 Bacteria 2091
86 Ga0496121_0000163 3300048924 Bacteria 145648
87 Ga0496121_0069082 3300048924 Bacteria 2854
88 Ga0496123_0086390 3300048926 Bacteria 1882
89 Ga0496124_0000185 3300048927 Bacteria 123531
90 Ga0496125_0149896 3300048928 Bacteria 1604
91 Ga0495678_066260 3300049459 Bacteria 1338
92 Ga0501292_001230 3300049515 Bacteria 3150
93 Ga0501294_000865 3300049517 Bacteria 3274
94 Ga0501300_000545 3300049523 Bacteria 5637
95 Ga0501033_0000190 3300049570 Bacteria 58924
96 Ga0501071_0066732 3300049587 Bacteria 2616
97 Ga0501206_002058 3300049653 Bacteria 2539
98 Ga0501222_001034 3300049662 Bacteria 3946
99 Ga0501224_004265 3300049664 Bacteria 2023
100 Ga0501235_005134 3300049669 Bacteria 2844
101 Ga0501257_006553 3300049686 Bacteria 2584
102 Ga0501259_000126 3300049688 Bacteria 11165
103 Ga0501261_000160 3300049690 Bacteria 9689
104 Ga0501245_000208 3300049708 Bacteria 6585
105 Ga0501279_000076 3300049775 Bacteria 16624
106 Ga0501280_000112 3300049776 Bacteria 21155
107 Ga0501281_00529 3300049777 Bacteria 3511
108 Ga0501035_0001475 3300049822 Bacteria 24081
109 nmdc:mga03683_170_c1 3300050489 Bacteria 21777
110 nmdc:mga03n38_50594_c1 3300050490 Bacteria 1853
111 nmdc:mga03n38_6100_c1 3300050490 Bacteria 4164
112 nmdc:mga00v17_217187_c1 3300050491 Bacteria 1238
113 nmdc:mga00v17_9784_c1 3300050491 Bacteria 5208
114 nmdc:mga0yw44_31997_c1 3300050492 Bacteria 3063
115 nmdc:mga06z11_102_c1 3300050494 Bacteria 36010
116 nmdc:mga06z11_255_c1 3300050494 Bacteria 20756
117 nmdc:mga04h51_454_c1 3300050495 Bacteria 9859
118 nmdc:mga04h51_62_c1 3300050495 Bacteria 34326
119 nmdc:mga07m45_116666_c1 3300050496 Bacteria 1540
120 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
121 nmdc:mga0sz30_106888_c1 3300050516 Bacteria 1225
122 nmdc:mga0sz30_20250_c1 3300050516 Bacteria 2683
123 Ga0495619_0343020 3300053085 Bacteria 1034
124 Ga0500643_001703 3300053087 Bacteria 12216
125 Ga0500641_0002496 3300053096 Bacteria 6503
126 Ga0500641_0008313 3300053096 Bacteria 3701
127 Ga0500641_0015670 3300053096 Bacteria 2817
128 Ga0500641_0110758 3300053096 Bacteria 1182
129 Ga0500562_017948 3300053108 Bacteria 1826
130 Ga0500562_024781 3300053108 Bacteria 1568
131 Ga0500562_052776 3300053108 Bacteria 1089
132 Ga0500562_067229 3300053108 Bacteria 966
133 Ga0500595_008319 3300053119 Bacteria 4245
134 Ga0500597_000216 3300053120 Bacteria 11891
135 Ga0500652_055172 3300053131 Bacteria 1628
136 Ga0500559_0000456 3300053136 Bacteria 29143
137 Ga0500559_0021129 3300053136 Bacteria 2756
138 Ga0500568_0019798 3300053139 Bacteria 2919
139 Ga0500573_0145475 3300053140 Bacteria 1302
140 Ga0500616_0054504 3300053153 Bacteria 2094
141 Ga0500624_000041 3300053157 Bacteria 90321
142 Ga0500637_0000206 3300053178 Bacteria 21961
143 Ga0500645_002690 3300053730 Bacteria 7730
144 2600201949 2599185354 Bacteria 4398675
145 2644087072 2643221614 Bacteria 4260023
146 2644342026 2643221661 Bacteria 4267604
147 2644368313 2643221666 Bacteria 4265935
148 2753766527 2751185897 Bacteria 5322941
149 2830076007 2830075706 Bacteria 3855215
150 2885432687 2885429604 Bacteria 3642894
151 2891051526 2891048133 Bacteria 4447501
152 2946790367 2946787523 Bacteria 4366789
153 2989778805 2989776772 Bacteria 4843317
154 2995393616 2995392953 Bacteria 4539380
155 8057105110 8057101203 Bacteria 5034064
156 Ga0070659_100000209
157 JGI24739J22299_10005156
158 JGI25165J46597_1000010
159 Ga0068869_100025958
160 Ga0070689_100360088
161 Ga0070668_100383106
162 Ga0068853_100027338
163 Ga0068854_100008216
164 Ga0068852_100382437
165 Ga0068859_100534512
166 Ga0068858_100000274
167 Ga0068858_100000723
168 Ga0081539_10089141
169 Ga0075368_10008281
170 Ga0075363_100003387
171 Ga0075364_10339068
172 Ga0075362_10000978
173 Ga0075367_10000028
174 Ga0075367_10009239
175 Ga0075369_10042189
176 Ga0097620_100534573
177 Ga0105245_10001668
178 Ga0105242_10139017
179 Ga0105248_10052443
180 Ga0157378_10163712
181 Ga0163162_10020926
182 Ga0163162_10158385
183 Ga0183363_1015
184 Ga0209437_102256
185 Ga0209026_1009030
186 Ga0209233_1000044
187 Ga0207697_10013506
188 Ga0207705_10285695
189 Ga0207687_10003018
190 Ga0207706_10044495
191 Ga0207709_10139190
192 Ga0207711_10060560
193 Ga0207689_10041109
194 Ga0207640_10075354
195 Ga0207703_10001033
196 Ga0207703_10004091
197 Ga0207639_10079956
198 Ga0207698_10667319
199 Ga0209813_10000410
200 Ga0209813_10000459
201 Ga0209974_10011074
202 Ga0265337_1004219
203 Ga0265334_10005305
204 Ga0265339_10001392
205 Ga0265327_10003866
206 Ga0265316_10261836
207 Ga0307513_10000077
208 Ga0307513_10021142
209 Ga0265313_10011281
210 Ga0307508_10000011
211 Ga0307405_10070951
212 Ga0307412_10057222
213 Ga0307412_10135056
214 Ga0307414_10046694
215 Ga0307414_10083324
216 Ga0307510_10000248
217 Ga0307510_10149303
218 Ga0436361_0027550
219 Ga0436361_0524560
220 Ga0436361_1093346
221 Ga0436363_0235496
222 Ga0495638_0001117
223 Ga0495638_0236379
224 Ga0495583_0026123
225 Ga0495648_0006183
226 Ga0495648_0064767
227 Ga0495663_0020269
228 Ga0495668_0013937
229 Ga0495625_0000094
230 Ga0495625_0002964
231 Ga0495625_0107811
232 Ga0495686_0008787
233 Ga0495686_0048994
234 Ga0496102_0000100
235 Ga0496103_0000070
236 Ga0496115_0273552
237 Ga0496116_0001752
238 Ga0496117_0000194
239 Ga0496118_0000146
240 Ga0496119_0068394
241 Ga0496121_0000163
242 Ga0496121_0069082
243 Ga0496123_0086390
244 Ga0496124_0000185
245 Ga0496125_0149896
246 Ga0495678_066260
247 Ga0501292_001230
248 Ga0501294_000865
249 Ga0501300_000545
250 Ga0501033_0000190
251 Ga0501071_0066732
252 Ga0501206_002058
253 Ga0501222_001034
254 Ga0501224_004265
255 Ga0501235_005134
256 Ga0501257_006553
257 Ga0501259_000126
258 Ga0501261_000160
259 Ga0501245_000208
260 Ga0501279_000076
261 Ga0501280_000112
262 Ga0501281_00529
263 Ga0501035_0001475
264 nmdc:mga03683_170_c1
265 nmdc:mga03n38_50594_c1
266 nmdc:mga03n38_6100_c1
267 nmdc:mga00v17_217187_c1
268 nmdc:mga00v17_9784_c1
269 nmdc:mga0yw44_31997_c1
270 nmdc:mga06z11_102_c1
271 nmdc:mga06z11_255_c1
272 nmdc:mga04h51_454_c1
273 nmdc:mga04h51_62_c1
274 nmdc:mga07m45_116666_c1
275 nmdc:mga07m45_7_c1
276 nmdc:mga0sz30_106888_c1
277 nmdc:mga0sz30_20250_c1
278 Ga0495619_0343020
279 Ga0500643_001703
280 Ga0500641_0002496
281 Ga0500641_0008313
282 Ga0500641_0015670
283 Ga0500641_0110758
284 Ga0500562_017948
285 Ga0500562_024781
286 Ga0500562_052776
287 Ga0500562_067229
288 Ga0500595_008319
289 Ga0500597_000216
290 Ga0500652_055172
291 Ga0500559_0000456
292 Ga0500559_0021129
293 Ga0500568_0019798
294 Ga0500573_0145475
295 Ga0500616_0054504
296 Ga0500624_000041
297 Ga0500637_0000206
298 Ga0500645_002690
299 2600201949
300 2644087072
301 2644342026
302 2644368313
303 2753766527
304 2830076007
305 2885432687
306 2891051526
307 2946790367
308 2989778805
309 2995393616
310 8057105110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

24

258

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7573 5 258
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7359 5 258
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.6733 6 262
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.6658 4 256
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.655 6 262
ID Description Score Start End Superfamily
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7802 6 262 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7573 5 258 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7554 6 262 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7512 70 263 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7359 5 258 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A4S0Q4C1-F1-model_v4 DUF72 domain-containing protein 0.9953 45 141
AF-A0A511Q0C2-F1-model_v4 deleted 0.9917 1 262
AF-A0A3N7HPC3-F1-model_v4 DUF72 domain-containing protein 0.9917 2 263
AF-D4XBB2-F1-model_v4 DUF72 domain-containing protein 0.9902 1 261
AF-A0A849BFM1-F1-model_v4 DUF72 domain-containing protein 0.9896 6 263

Map