F220777

General Info

Members Datasets Scaffolds Average Seq Length
154 111 308 255

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_86761_c1|nmdc:mga0rr50_86761_c1_423_1259
Length 271
Sequence MGTSSFFAPEAAAMPFAPVVRIARYQSPQGVAWGRLDGEDLIRLDGPPWAGGRERGGRDRLAEVRLLAPTVPTKIVCVGLNYRAHIAESQSVAPGAEPPKEPLIFLKPPSAAIGHDQPILYPAGVTRLDPEAELAVVIARRARRVSEAEAPACIAGLTCFNDVSARNYQRGDGQWTRAKGFDTFAPMGPWIAAGLDPSNLTVECRVNGERRQQARTSDLLFPVPHLVSFISRVMTLEPGDVIATGTPAGIAPEVEVEGVGVLRNRVEASEA

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
108 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
110 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 5.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_86761_c1 3300050513 Bacteria 2428
2 Ga0065712_10016318 3300005290 Bacteria 1936
3 Ga0065715_10089616 3300005293 Bacteria 9225
4 Ga0065707_10001522 3300005295 Bacteria 8991
5 Ga0065707_10178656 3300005295 Bacteria 1433
6 Ga0070670_100440154 3300005331 Bacteria 1154
7 Ga0070680_100042691 3300005336 Bacteria 3680
8 Ga0070680_100506438 3300005336 Bacteria 1033
9 Ga0070680_100637759 3300005336 Bacteria 915
10 Ga0070675_100186966 3300005354 Bacteria 1793
11 Ga0070674_100646445 3300005356 Bacteria 899
12 Ga0070688_100008545 3300005365 Bacteria 5566
13 Ga0070688_100019076 3300005365 Bacteria 3970
14 Ga0070688_100026969 3300005365 Bacteria 3419
15 Ga0070703_10035372 3300005406 Bacteria 1529
16 Ga0070705_100571057 3300005440 Bacteria 870
17 Ga0070662_100078953 3300005457 Bacteria 2446
18 Ga0070662_100226214 3300005457 Bacteria 1495
19 Ga0070681_10079706 3300005458 Bacteria 3230
20 Ga0068867_100336162 3300005459 Bacteria 1256
21 Ga0070685_10154807 3300005466 Unclassified 1456
22 Ga0070706_100219649 3300005467 Unclassified 1774
23 Ga0070706_100584440 3300005467 Bacteria 1038
24 Ga0070707_100047221 3300005468 Bacteria 4122
25 Ga0070707_100168122 3300005468 Bacteria 2137
26 Ga0070707_100244289 3300005468 Bacteria 1747
27 Ga0070698_100520390 3300005471 Bacteria 1128
28 Ga0070679_100266516 3300005530 Bacteria 1668
29 Ga0070672_100244908 3300005543 Unclassified 1509
30 Ga0070695_100104204 3300005545 Bacteria 1915
31 Ga0070696_100549254 3300005546 Bacteria 925
32 Ga0070704_100169444 3300005549 Bacteria 1735
33 Ga0068852_100299202 3300005616 Bacteria 1557
34 Ga0068859_100018112 3300005617 Bacteria 7079
35 Ga0068864_100375660 3300005618 Unclassified 1346
36 Ga0075367_10258830 3300006178 Bacteria 1092
37 Ga0075428_100000030 3300006844 Bacteria 119551
38 Ga0075431_100116695 3300006847 Bacteria 2755
39 Ga0075431_100143489 3300006847 Unclassified 2461
40 Ga0075433_10000303 3300006852 Bacteria 29660
41 Ga0075433_10023263 3300006852 Bacteria 5213
42 Ga0075434_100282652 3300006871 Bacteria 1679
43 Ga0075429_100233287 3300006880 Unclassified 1612
44 Ga0097620_100018112 3300006931 Bacteria 7079
45 Ga0075435_100074276 3300007076 Bacteria 2781
46 Ga0075435_100133273 3300007076 Bacteria 2080
47 Ga0111539_10000015 3300009094 Bacteria 296576
48 Ga0111539_10044804 3300009094 Bacteria 5297
49 Ga0111539_10096435 3300009094 Bacteria 3473
50 Ga0114129_10000392 3300009147 Bacteria 51114
51 Ga0114129_10267219 3300009147 Bacteria 2290
52 Ga0105249_10041855 3300009553 Bacteria 4165
53 Ga0157379_10342074 3300014968 Bacteria 1368
54 Ga0197907_11211718 3300020069 Bacteria 959
55 Ga0197907_11218711 3300020069 Bacteria 908
56 Ga0206356_10330593 3300020070 Bacteria 1072
57 Ga0206349_1437166 3300020075 Bacteria 897
58 Ga0206351_10381251 3300020077 Bacteria 916
59 Ga0206350_10899526 3300020080 Bacteria 1044
60 Ga0206350_11315266 3300020080 Bacteria 913
61 Ga0224712_10128717 3300022467 Bacteria 1104
62 Ga0207653_10047220 3300025885 Bacteria 1425
63 Ga0207645_10146034 3300025907 Bacteria 1542
64 Ga0207684_10201879 3300025910 Unclassified 1715
65 Ga0207684_10321756 3300025910 Bacteria 1333
66 Ga0207684_10418224 3300025910 Bacteria 1152
67 Ga0207707_10053742 3300025912 Bacteria 3507
68 Ga0207660_10422311 3300025917 Bacteria 1076
69 Ga0207646_10083651 3300025922 Bacteria 2854
70 Ga0207650_10208699 3300025925 Bacteria 1568
71 Ga0207650_10589547 3300025925 Unclassified 934
72 Ga0207659_10117727 3300025926 Bacteria 2031
73 Ga0207644_10610922 3300025931 Bacteria 906
74 Ga0207706_10111979 3300025933 Bacteria 2401
75 Ga0207706_10225989 3300025933 Bacteria 1638
76 Ga0207691_10041371 3300025940 Bacteria 4255
77 Ga0207651_10051098 3300025960 Bacteria 2811
78 Ga0207651_10311478 3300025960 Bacteria 1313
79 Ga0207712_10101462 3300025961 Bacteria 2140
80 Ga0207677_10057407 3300026023 Bacteria 2673
81 Ga0207648_10179382 3300026089 Bacteria 1874
82 Ga0207428_10000048 3300027907 Bacteria 180760
83 Ga0268265_10497886 3300028380 Bacteria 1148
84 Ga0307408_100024339 3300031548 Bacteria 4133
85 Ga0316576_10000326 3300031727 Bacteria 21344
86 Ga0307405_10068535 3300031731 Bacteria 2270
87 Ga0307413_10028984 3300031824 Bacteria 3091
88 Ga0307413_10053517 3300031824 Bacteria 2444
89 Ga0307413_10117728 3300031824 Bacteria 1792
90 Ga0307410_10000911 3300031852 Bacteria 12606
91 Ga0307410_10009285 3300031852 Bacteria 5509
92 Ga0307406_10043268 3300031901 Bacteria 2815
93 Ga0307407_10238613 3300031903 Bacteria 1239
94 Ga0307407_10293906 3300031903 Bacteria 1130
95 Ga0307412_10141748 3300031911 Bacteria 1761
96 Ga0307409_100000402 3300031995 Bacteria 18423
97 Ga0307409_100089149 3300031995 Bacteria 2520
98 Ga0307409_100134200 3300031995 Bacteria 2121
99 Ga0307416_100038785 3300032002 Bacteria 3679
100 Ga0307416_100053656 3300032002 Bacteria 3235
101 Ga0307416_100139591 3300032002 Bacteria 2200
102 Ga0307416_100166264 3300032002 Bacteria 2046
103 Ga0307414_10013388 3300032004 Bacteria 4882
104 Ga0307411_10005008 3300032005 Bacteria 6446
105 Ga0307411_10008127 3300032005 Bacteria 5411
106 Ga0307415_100079977 3300032126 Bacteria 2330
107 Ga0373929_0044941 3300035085 Unclassified 993
108 Ga0373934_0000606 3300035086 Bacteria 12643
109 Ga0373954_0035343 3300035118 Bacteria 2317
110 Ga0373956_0028603 3300035119 Bacteria 2426
111 Ga0373957_0026136 3300035120 Bacteria 2109
112 Ga0316574_0009295 3300035398 Bacteria 5500
113 Ga0373937_0000387 3300036401 Bacteria 41007
114 Ga0395899_0242179 3300037312 Bacteria 1241
115 Ga0436360_1302795 3300039438 Bacteria 7950
116 Ga0439462_0012726 3300042015 Bacteria 2152
117 Ga0453684_0007531 3300044712 Bacteria 19969
118 Ga0451576_0023369 3300045051 Bacteria 6693
119 Ga0451576_0440994 3300045051 Bacteria 1366
120 Ga0466967_0243756 3300045976 Bacteria 1715
121 Ga0495662_0237539 3300046476 Bacteria 898
122 Ga0501039_0054513 3300049575 Bacteria 3095
123 Ga0501040_0134837 3300049576 Bacteria 1738
124 Ga0501041_0128359 3300049577 Bacteria 1579
125 Ga0501042_0581795 3300049578 Bacteria 814
126 Ga0501046_0143004 3300049580 Bacteria 1809
127 Ga0501070_0080684 3300049586 Bacteria 2692
128 Ga0501071_0252080 3300049587 Bacteria 1332
129 Ga0501076_0002929 3300049592 Bacteria 11836
130 Ga0501076_0042438 3300049592 Bacteria 3581
131 Ga0501202_041240 3300049652 Bacteria 997
132 Ga0501079_0140500 3300049741 Bacteria 1881
133 Ga0501079_0229588 3300049741 Bacteria 1450
134 Ga0501080_0108113 3300049742 Bacteria 2578
135 Ga0501081_0048520 3300049743 Bacteria 2922
136 Ga0501081_0163609 3300049743 Bacteria 1604
137 Ga0501081_0222420 3300049743 Bacteria 1373
138 Ga0501045_0042107 3300049824 Bacteria 3324
139 nmdc:mga05p37_10954_c1 3300050507 Bacteria 10767
140 nmdc:mga05p37_159310_c1 3300050507 Bacteria 2757
141 nmdc:mga05p37_74631_c1 3300050507 Bacteria 4174
142 nmdc:mga09592_273538_c1 3300050508 Unclassified 1465
143 nmdc:mga06r32_129965_c1 3300050510 Unclassified 2490
144 nmdc:mga06r32_173616_c1 3300050510 Bacteria 2139
145 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
146 nmdc:mga0a205_90047_c1 3300050515 Bacteria 2965
147 Ga0590071_001218 3300059421 Bacteria 6953
148 Ga0590071_001725 3300059421 Bacteria 5642
149 Ga0590074_000017 3300059423 Bacteria 20687
150 Ga0590075_000217 3300059424 Bacteria 16065
151 Ga0590075_019583 3300059424 Bacteria 1680
152 Ga0590077_007791 3300059426 Bacteria 2188
153 Ga0590077_037679 3300059426 Bacteria 1069
154 Ga0530510_0508362 3300061734 Bacteria 913
155 nmdc:mga0rr50_86761_c1
156 Ga0065712_10016318
157 Ga0065715_10089616
158 Ga0065707_10001522
159 Ga0065707_10178656
160 Ga0070670_100440154
161 Ga0070680_100042691
162 Ga0070680_100506438
163 Ga0070680_100637759
164 Ga0070675_100186966
165 Ga0070674_100646445
166 Ga0070688_100008545
167 Ga0070688_100019076
168 Ga0070688_100026969
169 Ga0070703_10035372
170 Ga0070705_100571057
171 Ga0070662_100078953
172 Ga0070662_100226214
173 Ga0070681_10079706
174 Ga0068867_100336162
175 Ga0070685_10154807
176 Ga0070706_100219649
177 Ga0070706_100584440
178 Ga0070707_100047221
179 Ga0070707_100168122
180 Ga0070707_100244289
181 Ga0070698_100520390
182 Ga0070679_100266516
183 Ga0070672_100244908
184 Ga0070695_100104204
185 Ga0070696_100549254
186 Ga0070704_100169444
187 Ga0068852_100299202
188 Ga0068859_100018112
189 Ga0068864_100375660
190 Ga0075367_10258830
191 Ga0075428_100000030
192 Ga0075431_100116695
193 Ga0075431_100143489
194 Ga0075433_10000303
195 Ga0075433_10023263
196 Ga0075434_100282652
197 Ga0075429_100233287
198 Ga0097620_100018112
199 Ga0075435_100074276
200 Ga0075435_100133273
201 Ga0111539_10000015
202 Ga0111539_10044804
203 Ga0111539_10096435
204 Ga0114129_10000392
205 Ga0114129_10267219
206 Ga0105249_10041855
207 Ga0157379_10342074
208 Ga0197907_11211718
209 Ga0197907_11218711
210 Ga0206356_10330593
211 Ga0206349_1437166
212 Ga0206351_10381251
213 Ga0206350_10899526
214 Ga0206350_11315266
215 Ga0224712_10128717
216 Ga0207653_10047220
217 Ga0207645_10146034
218 Ga0207684_10201879
219 Ga0207684_10321756
220 Ga0207684_10418224
221 Ga0207707_10053742
222 Ga0207660_10422311
223 Ga0207646_10083651
224 Ga0207650_10208699
225 Ga0207650_10589547
226 Ga0207659_10117727
227 Ga0207644_10610922
228 Ga0207706_10111979
229 Ga0207706_10225989
230 Ga0207691_10041371
231 Ga0207651_10051098
232 Ga0207651_10311478
233 Ga0207712_10101462
234 Ga0207677_10057407
235 Ga0207648_10179382
236 Ga0207428_10000048
237 Ga0268265_10497886
238 Ga0307408_100024339
239 Ga0316576_10000326
240 Ga0307405_10068535
241 Ga0307413_10028984
242 Ga0307413_10053517
243 Ga0307413_10117728
244 Ga0307410_10000911
245 Ga0307410_10009285
246 Ga0307406_10043268
247 Ga0307407_10238613
248 Ga0307407_10293906
249 Ga0307412_10141748
250 Ga0307409_100000402
251 Ga0307409_100089149
252 Ga0307409_100134200
253 Ga0307416_100038785
254 Ga0307416_100053656
255 Ga0307416_100139591
256 Ga0307416_100166264
257 Ga0307414_10013388
258 Ga0307411_10005008
259 Ga0307411_10008127
260 Ga0307415_100079977
261 Ga0373929_0044941
262 Ga0373934_0000606
263 Ga0373954_0035343
264 Ga0373956_0028603
265 Ga0373957_0026136
266 Ga0316574_0009295
267 Ga0373937_0000387
268 Ga0395899_0242179
269 Ga0436360_1302795
270 Ga0439462_0012726
271 Ga0453684_0007531
272 Ga0451576_0023369
273 Ga0451576_0440994
274 Ga0466967_0243756
275 Ga0495662_0237539
276 Ga0501039_0054513
277 Ga0501040_0134837
278 Ga0501041_0128359
279 Ga0501042_0581795
280 Ga0501046_0143004
281 Ga0501070_0080684
282 Ga0501071_0252080
283 Ga0501076_0002929
284 Ga0501076_0042438
285 Ga0501202_041240
286 Ga0501079_0140500
287 Ga0501079_0229588
288 Ga0501080_0108113
289 Ga0501081_0048520
290 Ga0501081_0163609
291 Ga0501081_0222420
292 Ga0501045_0042107
293 nmdc:mga05p37_10954_c1
294 nmdc:mga05p37_159310_c1
295 nmdc:mga05p37_74631_c1
296 nmdc:mga09592_273538_c1
297 nmdc:mga06r32_129965_c1
298 nmdc:mga06r32_173616_c1
299 nmdc:mga08y16_8_c1
300 nmdc:mga0a205_90047_c1
301 Ga0590071_001218
302 Ga0590071_001725
303 Ga0590074_000017
304 Ga0590075_000217
305 Ga0590075_019583
306 Ga0590077_007791
307 Ga0590077_037679
308 Ga0530510_0508362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10370

Rv2993c-like_N

Rv2993c-like, N-terminal

20

69

0.96

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

74

267

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9505 56 253
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9441 57 253
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9231 56 253
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9224 56 253
6sbj-assembly1.cif.gz_B x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9216 56 253
ID Description Score Start End Superfamily
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9592 41 252 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.955 41 253 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9505 56 249 3.90.850.10
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9479 39 252 3.90.850.10
af_Q10B63_1_221_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9473 56 253 3.90.850.10
ID Description Score Start End GO Terms
AF-Q64BR6-F1-model_v4 2-hydroxyhepta-24-diene-17-dioate isomerase (EC 4.2.1.141) 0.9744 55 253 GO:0016829
GO:0016853
GO:0018773
GO:0046872
AF-A0A833NRL5-F1-model_v4 5-oxopent-3-ene-1 2 5-tricarboxylate decarboxylase 0.9737 54 252 GO:0018773
GO:0046872
AF-A0A843G7L8-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.973 61 253 GO:0018773
GO:0046872
AF-A0A7C3HDB0-F1-model_v4 FAA hydrolase family protein 0.9721 78 253 GO:0018773
GO:0046872
AF-A0A2V8IVX1-F1-model_v4 Fumarylacetoacetate hydrolase 0.9711 41 253 GO:0016787
GO:0044281

Map