F218152

General Info

Members Datasets Scaffolds Average Seq Length
153 94 306 268

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0201763|Ga0501077_0201763_67_978
Length 303
Sequence VDAGRQFVGAARREGSGGAARHRRAHVRRLVAALVLATAPLGAVFAQFDHGHAAWTALLKKHVVLIDGGKASQVHYAGFAQDRAQLSAYLDTLSKVTEAEFSEWSKPQRMAFLINAYNAFTVAFILSKYPDLKSIRDLGSLPFNSPWKRRFFTLLGREYYLDGIEHEMLRKKGAYDEPRVHYAVNCASIGCPMLREEAYVAERLDAQLEEQAVRFLSDRSRNRYNAQSGRLEVSRIFDWFKEDWTSGDRGFDGKQAPIQSREQYFGRYARWLADGFAGQELVAAGRVPIDFLDYDWALNDVRR

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
51 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
54 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
55 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
56 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
79 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
87 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
88 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
89 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
94 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 0
Rhizosphere 95.42
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0201763 3300049593 Bacteria 1263
2 Ga0065707_10095566 3300005295 Bacteria 3364
3 Ga0070670_100024411 3300005331 Bacteria 5198
4 Ga0070680_100384938 3300005336 Bacteria 1194
5 Ga0070689_100610949 3300005340 Unclassified 945
6 Ga0070674_100130949 3300005356 Bacteria 1870
7 Ga0070667_100245199 3300005367 Bacteria 1601
8 Ga0070709_10540605 3300005434 Bacteria 890
9 Ga0070694_100076037 3300005444 Bacteria 2324
10 Ga0070694_100099390 3300005444 Bacteria 2056
11 Ga0070698_100193860 3300005471 Bacteria 1969
12 Ga0070698_100288114 3300005471 Bacteria 1573
13 Ga0068853_100028392 3300005539 Bacteria 4706
14 Ga0070695_100154008 3300005545 Bacteria 1607
15 Ga0070693_100150963 3300005547 Bacteria 1471
16 Ga0070704_100000612 3300005549 Bacteria 17183
17 Ga0068857_100428510 3300005577 Bacteria 1234
18 Ga0068859_100020876 3300005617 Bacteria 6573
19 Ga0068851_10001988 3300005834 Bacteria 8995
20 Ga0070716_100078407 3300006173 Bacteria 1964
21 Ga0075428_100023494 3300006844 Bacteria 6824
22 Ga0075428_100032706 3300006844 Bacteria 5745
23 Ga0075430_100061352 3300006846 Bacteria 3159
24 Ga0075431_100002592 3300006847 Bacteria 17462
25 Ga0075431_100003628 3300006847 Bacteria 14955
26 Ga0075431_100082595 3300006847 Bacteria 3317
27 Ga0075429_100000871 3300006880 Bacteria 23800
28 Ga0097620_100020879 3300006931 Bacteria 6573
29 Ga0075435_100096817 3300007076 Bacteria 2441
30 Ga0105240_10007018 3300009093 Bacteria 16438
31 Ga0111539_10019588 3300009094 Bacteria 8348
32 Ga0105245_10007143 3300009098 Bacteria 9796
33 Ga0114129_10002840 3300009147 Bacteria 24196
34 Ga0114129_10334730 3300009147 Bacteria 2009
35 Ga0105242_10021857 3300009176 Bacteria 5028
36 Ga0105237_10122171 3300009545 Bacteria 2598
37 Ga0157380_10360542 3300014326 Bacteria 1364
38 Ga0157377_10399243 3300014745 Bacteria 936
39 Ga0157376_10425490 3300014969 Bacteria 1290
40 Ga0207653_10059008 3300025885 Bacteria 1291
41 Ga0207695_10052356 3300025913 Unclassified 4278
42 Ga0207671_10090305 3300025914 Bacteria 2307
43 Ga0207650_10107606 3300025925 Bacteria 2154
44 Ga0207687_10071576 3300025927 Bacteria 2478
45 Ga0207686_10309371 3300025934 Bacteria 1176
46 Ga0207658_10179747 3300025986 Bacteria 1750
47 Ga0207708_10039383 3300026075 Bacteria 3601
48 Ga0207675_100393664 3300026118 Bacteria 1364
49 Ga0209971_1008750 3300027682 Bacteria 2401
50 Ga0207428_10002833 3300027907 Bacteria 17208
51 Ga0207428_10174073 3300027907 Bacteria 1629
52 Ga0307408_100437879 3300031548 Bacteria 1131
53 Ga0316575_10016304 3300031665 Bacteria 2810
54 Ga0307416_101066525 3300032002 Bacteria 912
55 Ga0316574_0000937 3300035398 Bacteria 13025
56 Ga0373935_0019780 3300035692 Bacteria 4108
57 Ga0373927_0057272 3300035695 Bacteria 2520
58 Ga0373933_0379791 3300035724 Unclassified 920
59 Ga0373937_0018928 3300036401 Bacteria 6157
60 Ga0400488_35318 3300038741 Unclassified 2075
61 Ga0400488_62841 3300038741 Bacteria 12815
62 Ga0400486_15066 3300038742 Bacteria 1369
63 Ga0400487_49499 3300039110 Bacteria 13654
64 Ga0400487_54092 3300039110 Bacteria 14105
65 Ga0439441_008548 3300042001 Bacteria 1675
66 Ga0451577_0006578 3300042876 Bacteria 11553
67 Ga0451577_0012396 3300042876 Bacteria 8007
68 Ga0451577_0063567 3300042876 Bacteria 3291
69 Ga0451577_0162447 3300042876 Bacteria 2012
70 Ga0451577_0327754 3300042876 Bacteria 1389
71 Ga0453684_0166540 3300044712 Bacteria 2601
72 Ga0453684_0217785 3300044712 Bacteria 2214
73 Ga0451576_0005143 3300045051 Bacteria 16568
74 Ga0451576_0029603 3300045051 Bacteria 5859
75 Ga0451576_0097310 3300045051 Bacteria 3061
76 Ga0451576_0982071 3300045051 Bacteria 885
77 Ga0495652_0117420 3300046529 Bacteria 2128
78 Ga0501036_0081210 3300049572 Bacteria 2740
79 Ga0501036_0282953 3300049572 Bacteria 1388
80 Ga0501037_0049689 3300049573 Bacteria 3071
81 Ga0501037_0164550 3300049573 Bacteria 1580
82 Ga0501038_0078132 3300049574 Bacteria 2793
83 Ga0501038_0105005 3300049574 Bacteria 2347
84 Ga0501039_0043100 3300049575 Bacteria 3486
85 Ga0501039_0116675 3300049575 Bacteria 2090
86 Ga0501039_0117584 3300049575 Bacteria 2082
87 Ga0501039_0138593 3300049575 Bacteria 1911
88 Ga0501039_0138677 3300049575 Bacteria 1910
89 Ga0501039_0806017 3300049575 Bacteria 732
90 Ga0501040_0318832 3300049576 Bacteria 1112
91 Ga0501041_0005167 3300049577 Bacteria 7617
92 Ga0501041_0005845 3300049577 Bacteria 7196
93 Ga0501041_0316422 3300049577 Bacteria 984
94 Ga0501042_0003390 3300049578 Bacteria 9999
95 Ga0501042_0011226 3300049578 Bacteria 6037
96 Ga0501042_0062674 3300049578 Bacteria 2657
97 Ga0501043_0226239 3300049579 Bacteria 1446
98 Ga0501043_0312351 3300049579 Bacteria 1199
99 Ga0501046_0062295 3300049580 Bacteria 2915
100 Ga0501048_0217304 3300049582 Bacteria 1355
101 Ga0501048_0332101 3300049582 Bacteria 1083
102 Ga0501069_0236392 3300049585 Bacteria 1064
103 Ga0501071_0011972 3300049587 Bacteria 5860
104 Ga0501071_0050261 3300049587 Bacteria 3003
105 Ga0501071_0429524 3300049587 Bacteria 1010
106 Ga0501072_0018180 3300049588 Bacteria 5408
107 Ga0501075_0009143 3300049591 Bacteria 6925
108 Ga0501075_0018603 3300049591 Bacteria 5031
109 Ga0501075_0164136 3300049591 Bacteria 1694
110 Ga0501076_0000932 3300049592 Bacteria 19056
111 Ga0501076_0023819 3300049592 Bacteria 4724
112 Ga0501076_0071341 3300049592 Bacteria 2778
113 Ga0501076_0077259 3300049592 Bacteria 2671
114 Ga0501076_0154712 3300049592 Bacteria 1866
115 Ga0501077_0110536 3300049593 Bacteria 1741
116 Ga0501079_0006599 3300049741 Bacteria 8730
117 Ga0501079_0028942 3300049741 Bacteria 4252
118 Ga0501079_0476565 3300049741 Bacteria 981
119 Ga0501080_0001366 3300049742 Bacteria 20410
120 Ga0501080_0058802 3300049742 Bacteria 3578
121 Ga0501080_0085531 3300049742 Bacteria 2930
122 Ga0501080_0451214 3300049742 Bacteria 1153
123 Ga0501081_0017506 3300049743 Bacteria 4744
124 Ga0501081_0040319 3300049743 Bacteria 3197
125 Ga0501081_0321086 3300049743 Bacteria 1138
126 Ga0501083_0195507 3300049744 Bacteria 1320
127 Ga0501035_0251938 3300049822 Bacteria 1499
128 Ga0501035_0422135 3300049822 Bacteria 1107
129 Ga0501045_0001063 3300049824 Bacteria 18134
130 Ga0501045_0028037 3300049824 Bacteria 4061
131 Ga0501045_0067863 3300049824 Bacteria 2619
132 Ga0501045_0497421 3300049824 Bacteria 905
133 nmdc:mga0k408_23312_c1 3300050493 Bacteria 3489
134 nmdc:mga0k408_39934_c1 3300050493 Bacteria 2698
135 nmdc:mga05p37_2494_c1 3300050507 Bacteria 21411
136 nmdc:mga09592_19699_c1 3300050508 Bacteria 5541
137 nmdc:mga09592_540_c1 3300050508 Bacteria 28649
138 nmdc:mga0qj67_51901_c1 3300050509 Bacteria 3244
139 nmdc:mga06r32_1364_c1 3300050510 Bacteria 22076
140 nmdc:mga06r32_50773_c1 3300050510 Bacteria 3967
141 nmdc:mga08y16_291094_c1 3300050511 Bacteria 1684
142 nmdc:mga08y16_88037_c1 3300050511 Bacteria 3236
143 nmdc:mga0rr50_145026_c1 3300050513 Bacteria 1913
144 nmdc:mga0a205_201146_c1 3300050515 Bacteria 1882
145 Ga0501084_0011124 3300054114 Bacteria 7452
146 Ga0590071_039801 3300059421 Bacteria 1130
147 Ga0501082_0012380 3300060353 Bacteria 7332
148 Ga0501082_0053543 3300060353 Bacteria 3478
149 Ga0501082_0315189 3300060353 Bacteria 1362
150 Ga0530510_0005711 3300061734 Bacteria 8617
151 Ga0530510_0037779 3300061734 Bacteria 3484
152 Ga0530510_0491061 3300061734 Bacteria 930
153 8055227472 8055225921 Bacteria 3341787
154 Ga0501077_0201763
155 Ga0065707_10095566
156 Ga0070670_100024411
157 Ga0070680_100384938
158 Ga0070689_100610949
159 Ga0070674_100130949
160 Ga0070667_100245199
161 Ga0070709_10540605
162 Ga0070694_100076037
163 Ga0070694_100099390
164 Ga0070698_100193860
165 Ga0070698_100288114
166 Ga0068853_100028392
167 Ga0070695_100154008
168 Ga0070693_100150963
169 Ga0070704_100000612
170 Ga0068857_100428510
171 Ga0068859_100020876
172 Ga0068851_10001988
173 Ga0070716_100078407
174 Ga0075428_100023494
175 Ga0075428_100032706
176 Ga0075430_100061352
177 Ga0075431_100002592
178 Ga0075431_100003628
179 Ga0075431_100082595
180 Ga0075429_100000871
181 Ga0097620_100020879
182 Ga0075435_100096817
183 Ga0105240_10007018
184 Ga0111539_10019588
185 Ga0105245_10007143
186 Ga0114129_10002840
187 Ga0114129_10334730
188 Ga0105242_10021857
189 Ga0105237_10122171
190 Ga0157380_10360542
191 Ga0157377_10399243
192 Ga0157376_10425490
193 Ga0207653_10059008
194 Ga0207695_10052356
195 Ga0207671_10090305
196 Ga0207650_10107606
197 Ga0207687_10071576
198 Ga0207686_10309371
199 Ga0207658_10179747
200 Ga0207708_10039383
201 Ga0207675_100393664
202 Ga0209971_1008750
203 Ga0207428_10002833
204 Ga0207428_10174073
205 Ga0307408_100437879
206 Ga0316575_10016304
207 Ga0307416_101066525
208 Ga0316574_0000937
209 Ga0373935_0019780
210 Ga0373927_0057272
211 Ga0373933_0379791
212 Ga0373937_0018928
213 Ga0400488_35318
214 Ga0400488_62841
215 Ga0400486_15066
216 Ga0400487_49499
217 Ga0400487_54092
218 Ga0439441_008548
219 Ga0451577_0006578
220 Ga0451577_0012396
221 Ga0451577_0063567
222 Ga0451577_0162447
223 Ga0451577_0327754
224 Ga0453684_0166540
225 Ga0453684_0217785
226 Ga0451576_0005143
227 Ga0451576_0029603
228 Ga0451576_0097310
229 Ga0451576_0982071
230 Ga0495652_0117420
231 Ga0501036_0081210
232 Ga0501036_0282953
233 Ga0501037_0049689
234 Ga0501037_0164550
235 Ga0501038_0078132
236 Ga0501038_0105005
237 Ga0501039_0043100
238 Ga0501039_0116675
239 Ga0501039_0117584
240 Ga0501039_0138593
241 Ga0501039_0138677
242 Ga0501039_0806017
243 Ga0501040_0318832
244 Ga0501041_0005167
245 Ga0501041_0005845
246 Ga0501041_0316422
247 Ga0501042_0003390
248 Ga0501042_0011226
249 Ga0501042_0062674
250 Ga0501043_0226239
251 Ga0501043_0312351
252 Ga0501046_0062295
253 Ga0501048_0217304
254 Ga0501048_0332101
255 Ga0501069_0236392
256 Ga0501071_0011972
257 Ga0501071_0050261
258 Ga0501071_0429524
259 Ga0501072_0018180
260 Ga0501075_0009143
261 Ga0501075_0018603
262 Ga0501075_0164136
263 Ga0501076_0000932
264 Ga0501076_0023819
265 Ga0501076_0071341
266 Ga0501076_0077259
267 Ga0501076_0154712
268 Ga0501077_0110536
269 Ga0501079_0006599
270 Ga0501079_0028942
271 Ga0501079_0476565
272 Ga0501080_0001366
273 Ga0501080_0058802
274 Ga0501080_0085531
275 Ga0501080_0451214
276 Ga0501081_0017506
277 Ga0501081_0040319
278 Ga0501081_0321086
279 Ga0501083_0195507
280 Ga0501035_0251938
281 Ga0501035_0422135
282 Ga0501045_0001063
283 Ga0501045_0028037
284 Ga0501045_0067863
285 Ga0501045_0497421
286 nmdc:mga0k408_23312_c1
287 nmdc:mga0k408_39934_c1
288 nmdc:mga05p37_2494_c1
289 nmdc:mga09592_19699_c1
290 nmdc:mga09592_540_c1
291 nmdc:mga0qj67_51901_c1
292 nmdc:mga06r32_1364_c1
293 nmdc:mga06r32_50773_c1
294 nmdc:mga08y16_291094_c1
295 nmdc:mga08y16_88037_c1
296 nmdc:mga0rr50_145026_c1
297 nmdc:mga0a205_201146_c1
298 Ga0501084_0011124
299 Ga0590071_039801
300 Ga0501082_0012380
301 Ga0501082_0053543
302 Ga0501082_0315189
303 Ga0530510_0005711
304 Ga0530510_0037779
305 Ga0530510_0491061
306 8055227472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04784

DUF547

Protein of unknown function, DUF547

101

216

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tpt-assembly1.cif.gz_G single-particle cryo-em structure of arp2/3 complex at branched-actin junction. 0.383 56 103
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.3636 18 71
3n1b-assembly2.cif.gz_B c-terminal domain of vps54 subunit of the garp complex 0.3616 26 115
7rdr-assembly1.cif.gz_A circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces 0.3572 26 251
2xj7-assembly1.cif.gz_A btgh84 in complex with 6-acetamido-6-deoxy-castanospermine 0.3372 20 191
ID Description Score Start End Superfamily
af_D4A4G3_401_571_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6314 51 102 1.25.40.10
af_Q6AYP3_138_305_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.62 51 102 1.25.40.10
af_A0A1D6F4T2_218_349_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6078 51 99 1.25.40.10
af_A0A1D6K077_251_378_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5748 51 99 1.25.40.10
af_Q7F0I0_252_364_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5716 51 99 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A353Y989-F1-model_v4 DUF547 domain-containing protein 0.9892 18 268
AF-A0A7H1MYW8-F1-model_v4 DUF547 domain-containing protein 0.9851 20 267
AF-A0A6N6L7F3-F1-model_v4 DUF547 domain-containing protein 0.9844 15 267
AF-A0A653I572-F1-model_v4 DUF547 domain-containing protein 0.9841 20 268
AF-A0A0C4WPM8-F1-model_v4 DUF547 domain-containing protein 0.9759 18 209

Map