F217394

General Info

Members Datasets Scaffolds Average Seq Length
153 116 306 121

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10237780|Ga0316576_102377803
Length 145
Sequence MGIHQNRYNWQHNTIHFRNRPNKMKVTAEHNERIAKMTFASVYPHYVTKVEKKGRTKEELHQVIEWLTGFDDGKLEELIDDKATFETFFQKADLNPNAELIKGVICGYRIEEIDNPLTRQVRYLDKLVDELAKGRKMEKILRVEK

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
88 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
89 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
90 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
98 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
104 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
105 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
106 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
107 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
110 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
116 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10237780 3300031727 Bacteria 1369
2 Ga0065704_10077999 3300005289 Bacteria 4556
3 Ga0065704_10230018 3300005289 Bacteria 1046
4 Ga0065704_10441520 3300005289 Bacteria 713
5 Ga0065712_10081935 3300005290 Bacteria 2961
6 Ga0065715_10083313 3300005293 Bacteria 545
7 Ga0065707_10104700 3300005295 Bacteria 2683
8 Ga0070658_10051036 3300005327 Bacteria 3352
9 Ga0070683_101950223 3300005329 Bacteria 564
10 Ga0068869_100115021 3300005334 Bacteria 2051
11 Ga0070660_100002278 3300005339 Bacteria 13181
12 Ga0070668_100487010 3300005347 Bacteria 1066
13 Ga0070669_100005362 3300005353 Bacteria 9252
14 Ga0070675_100096137 3300005354 Bacteria 2488
15 Ga0070673_100132203 3300005364 Bacteria 2095
16 Ga0070688_100392427 3300005365 Bacteria 1025
17 Ga0070701_10036128 3300005438 Bacteria 2488
18 Ga0070705_100183221 3300005440 Bacteria 1420
19 Ga0068867_102386996 3300005459 Unclassified 503
20 Ga0070685_10260480 3300005466 Bacteria 1153
21 Ga0068855_100245201 3300005563 Bacteria 2000
22 Ga0068854_100089126 3300005578 Bacteria 2292
23 Ga0068852_100422449 3300005616 Bacteria 1315
24 Ga0068852_101559758 3300005616 Bacteria 683
25 Ga0068859_100175984 3300005617 Bacteria 2221
26 Ga0068864_101311148 3300005618 Unclassified 724
27 Ga0068866_10159504 3300005718 Bacteria 1314
28 Ga0068861_100063511 3300005719 Bacteria 2838
29 Ga0068870_10082373 3300005840 Bacteria 1781
30 Ga0068862_100009406 3300005844 Bacteria 8085
31 Ga0068871_100021529 3300006358 Bacteria 4957
32 Ga0075430_100150655 3300006846 Bacteria 1937
33 Ga0075434_101264063 3300006871 Bacteria 749
34 Ga0075429_100022816 3300006880 Bacteria 5426
35 Ga0075429_101762889 3300006880 Unclassified 537
36 Ga0097620_100175975 3300006931 Bacteria 2221
37 Ga0105250_10015598 3300009092 Bacteria 3110
38 Ga0105240_10031290 3300009093 Bacteria 6903
39 Ga0111539_10005331 3300009094 Bacteria 16644
40 Ga0105242_10453987 3300009176 Unclassified 1209
41 Ga0105238_10028336 3300009551 Bacteria 5707
42 Ga0105249_10025020 3300009553 Bacteria 5372
43 Ga0105239_10000006 3300010375 Bacteria 442319
44 Ga0157373_10000080 3300013100 Bacteria 82365
45 Ga0157371_10051165 3300013102 Bacteria 2935
46 Ga0157371_11582370 3300013102 Bacteria 513
47 Ga0157370_10091004 3300013104 Bacteria 2864
48 Ga0157370_10127368 3300013104 Bacteria 2377
49 Ga0157370_10295004 3300013104 Bacteria 1497
50 Ga0157369_10431603 3300013105 Bacteria 1365
51 Ga0157369_10461607 3300013105 Bacteria 1315
52 Ga0157369_11016908 3300013105 Bacteria 848
53 Ga0157378_11672902 3300013297 Bacteria 683
54 Ga0163162_10001114 3300013306 Bacteria 24954
55 Ga0163162_10173823 3300013306 Bacteria 2279
56 Ga0163162_10204357 3300013306 Bacteria 2104
57 Ga0157372_12300901 3300013307 Bacteria 619
58 Ga0157372_12369958 3300013307 Bacteria 609
59 Ga0157375_10068347 3300013308 Bacteria 3555
60 Ga0157375_10187643 3300013308 Unclassified 2221
61 Ga0163163_10228696 3300014325 Bacteria 1909
62 Ga0163163_11176233 3300014325 Unclassified 830
63 Ga0157380_10039582 3300014326 Bacteria 3667
64 Ga0182008_10000232 3300014497 Bacteria 43445
65 Ga0182008_10000491 3300014497 Bacteria 29764
66 Ga0157377_10023818 3300014745 Bacteria 3249
67 Ga0157377_10883351 3300014745 Bacteria 667
68 Ga0157377_11552119 3300014745 Bacteria 528
69 Ga0157379_11333651 3300014968 Bacteria 694
70 Ga0182006_1000159 3300015261 Bacteria 72265
71 Ga0163161_10264409 3300017792 Bacteria 1344
72 Ga0163161_10870121 3300017792 Unclassified 762
73 Ga0207643_10492813 3300025908 Unclassified 783
74 Ga0207705_10159292 3300025909 Bacteria 1695
75 Ga0207671_10010163 3300025914 Bacteria 7795
76 Ga0207681_11296159 3300025923 Bacteria 612
77 Ga0207650_10509559 3300025925 Bacteria 1006
78 Ga0207659_10020373 3300025926 Bacteria 4383
79 Ga0207706_10031128 3300025933 Bacteria 4755
80 Ga0207665_10699229 3300025939 Bacteria 797
81 Ga0207691_10448685 3300025940 Bacteria 1098
82 Ga0207689_10070306 3300025942 Bacteria 2875
83 Ga0207667_10585791 3300025949 Bacteria 1126
84 Ga0207712_10248403 3300025961 Bacteria 1437
85 Ga0207668_11151755 3300025972 Unclassified 696
86 Ga0207668_11434905 3300025972 Bacteria 622
87 Ga0207640_10095335 3300025981 Bacteria 2072
88 Ga0207648_10649592 3300026089 Bacteria 975
89 Ga0207674_10047598 3300026116 Bacteria 4394
90 Ga0207675_100003862 3300026118 Bacteria 14565
91 Ga0207698_10517293 3300026142 Bacteria 1164
92 Ga0209974_10226500 3300027876 Bacteria 697
93 Ga0207428_10137119 3300027907 Bacteria 1870
94 Ga0307515_10017574 3300028794 Bacteria 13009
95 Ga0265320_10229411 3300031240 Bacteria 826
96 Ga0265331_10564007 3300031250 Bacteria 514
97 Ga0265327_10087997 3300031251 Unclassified 1520
98 Ga0265327_10356776 3300031251 Bacteria 638
99 Ga0307408_100004946 3300031548 Bacteria 8961
100 Ga0316576_10955924 3300031727 Bacteria 612
101 Ga0307405_11322499 3300031731 Bacteria 628
102 Ga0307413_10276176 3300031824 Bacteria 1261
103 Ga0307413_11741812 3300031824 Bacteria 556
104 Ga0307407_10110617 3300031903 Unclassified 1724
105 Ga0307407_11211694 3300031903 Bacteria 590
106 Ga0307409_102808187 3300031995 Unclassified 515
107 Ga0307416_100249635 3300032002 Bacteria 1726
108 Ga0307414_10014318 3300032004 Bacteria 4751
109 Ga0307414_10066288 3300032004 Bacteria 2580
110 Ga0307414_10083973 3300032004 Bacteria 2340
111 Ga0307414_10230692 3300032004 Bacteria 1526
112 Ga0307414_10297219 3300032004 Bacteria 1364
113 Ga0307414_10322409 3300032004 Unclassified 1315
114 Ga0307414_10357744 3300032004 Bacteria 1255
115 Ga0307414_10562992 3300032004 Bacteria 1017
116 Ga0307414_10688189 3300032004 Bacteria 925
117 Ga0307414_10860378 3300032004 Unclassified 829
118 Ga0316574_0482195 3300035398 Bacteria 775
119 Ga0400487_63221 3300039110 Bacteria 1100
120 Ga0439453_0072077 3300041408 Bacteria 732
121 Ga0451841_0910088 3300041498 Bacteria 523
122 Ga0439441_003504 3300042001 Bacteria 2320
123 Ga0451577_0065333 3300042876 Bacteria 3245
124 Ga0453684_0016392 3300044712 Bacteria 11590
125 Ga0453684_0257020 3300044712 Bacteria 2003
126 Ga0495650_0149062 3300046471 Bacteria 841
127 Ga0495610_0000340 3300046512 Bacteria 49215
128 Ga0495637_0042276 3300046520 Bacteria 1951
129 Ga0495663_0000026 3300046525 Bacteria 90652
130 Ga0495598_0004021 3300046537 Bacteria 3158
131 Ga0495621_0472001 3300046539 Unclassified 539
132 Ga0495668_0000637 3300046616 Bacteria 42167
133 Ga0495671_0154533 3300046692 Bacteria 1117
134 Ga0495686_0069105 3300047472 Bacteria 2178
135 Ga0496115_0088528 3300048918 Bacteria 2528
136 Ga0501292_064530 3300049515 Bacteria 670
137 Ga0501299_198064 3300049522 Bacteria 532
138 Ga0501228_021469 3300049666 Bacteria 734
139 Ga0501235_105758 3300049669 Bacteria 692
140 Ga0501241_000365 3300049758 Bacteria 9940
141 Ga0501044_1653461 3300049823 Bacteria 505
142 Ga0501204_003672 3300049850 Bacteria 1627
143 Ga0501284_01408 3300050005 Bacteria 1279
144 nmdc:mga09592_1563674_c1 3300050508 Unclassified 535
145 nmdc:mga09592_236471_c1 3300050508 Bacteria 1583
146 nmdc:mga09592_288898_c1 3300050508 Bacteria 1422
147 nmdc:mga0qj67_44722_c1 3300050509 Bacteria 3491
148 nmdc:mga06r32_290538_c1 3300050510 Bacteria 1621
149 nmdc:mga08y16_140719_c1 3300050511 Bacteria 2509
150 nmdc:mga08y16_176900_c1 3300050511 Bacteria 2216
151 nmdc:mga08y16_857952_c1 3300050511 Bacteria 897
152 2904446417 2904445276 Bacteria 5310396
153 8036738098 8036736890 Bacteria 2944828
154 Ga0316576_10237780
155 Ga0065704_10077999
156 Ga0065704_10230018
157 Ga0065704_10441520
158 Ga0065712_10081935
159 Ga0065715_10083313
160 Ga0065707_10104700
161 Ga0070658_10051036
162 Ga0070683_101950223
163 Ga0068869_100115021
164 Ga0070660_100002278
165 Ga0070668_100487010
166 Ga0070669_100005362
167 Ga0070675_100096137
168 Ga0070673_100132203
169 Ga0070688_100392427
170 Ga0070701_10036128
171 Ga0070705_100183221
172 Ga0068867_102386996
173 Ga0070685_10260480
174 Ga0068855_100245201
175 Ga0068854_100089126
176 Ga0068852_100422449
177 Ga0068852_101559758
178 Ga0068859_100175984
179 Ga0068864_101311148
180 Ga0068866_10159504
181 Ga0068861_100063511
182 Ga0068870_10082373
183 Ga0068862_100009406
184 Ga0068871_100021529
185 Ga0075430_100150655
186 Ga0075434_101264063
187 Ga0075429_100022816
188 Ga0075429_101762889
189 Ga0097620_100175975
190 Ga0105250_10015598
191 Ga0105240_10031290
192 Ga0111539_10005331
193 Ga0105242_10453987
194 Ga0105238_10028336
195 Ga0105249_10025020
196 Ga0105239_10000006
197 Ga0157373_10000080
198 Ga0157371_10051165
199 Ga0157371_11582370
200 Ga0157370_10091004
201 Ga0157370_10127368
202 Ga0157370_10295004
203 Ga0157369_10431603
204 Ga0157369_10461607
205 Ga0157369_11016908
206 Ga0157378_11672902
207 Ga0163162_10001114
208 Ga0163162_10173823
209 Ga0163162_10204357
210 Ga0157372_12300901
211 Ga0157372_12369958
212 Ga0157375_10068347
213 Ga0157375_10187643
214 Ga0163163_10228696
215 Ga0163163_11176233
216 Ga0157380_10039582
217 Ga0182008_10000232
218 Ga0182008_10000491
219 Ga0157377_10023818
220 Ga0157377_10883351
221 Ga0157377_11552119
222 Ga0157379_11333651
223 Ga0182006_1000159
224 Ga0163161_10264409
225 Ga0163161_10870121
226 Ga0207643_10492813
227 Ga0207705_10159292
228 Ga0207671_10010163
229 Ga0207681_11296159
230 Ga0207650_10509559
231 Ga0207659_10020373
232 Ga0207706_10031128
233 Ga0207665_10699229
234 Ga0207691_10448685
235 Ga0207689_10070306
236 Ga0207667_10585791
237 Ga0207712_10248403
238 Ga0207668_11151755
239 Ga0207668_11434905
240 Ga0207640_10095335
241 Ga0207648_10649592
242 Ga0207674_10047598
243 Ga0207675_100003862
244 Ga0207698_10517293
245 Ga0209974_10226500
246 Ga0207428_10137119
247 Ga0307515_10017574
248 Ga0265320_10229411
249 Ga0265331_10564007
250 Ga0265327_10087997
251 Ga0265327_10356776
252 Ga0307408_100004946
253 Ga0316576_10955924
254 Ga0307405_11322499
255 Ga0307413_10276176
256 Ga0307413_11741812
257 Ga0307407_10110617
258 Ga0307407_11211694
259 Ga0307409_102808187
260 Ga0307416_100249635
261 Ga0307414_10014318
262 Ga0307414_10066288
263 Ga0307414_10083973
264 Ga0307414_10230692
265 Ga0307414_10297219
266 Ga0307414_10322409
267 Ga0307414_10357744
268 Ga0307414_10562992
269 Ga0307414_10688189
270 Ga0307414_10860378
271 Ga0316574_0482195
272 Ga0400487_63221
273 Ga0439453_0072077
274 Ga0451841_0910088
275 Ga0439441_003504
276 Ga0451577_0065333
277 Ga0453684_0016392
278 Ga0453684_0257020
279 Ga0495650_0149062
280 Ga0495610_0000340
281 Ga0495637_0042276
282 Ga0495663_0000026
283 Ga0495598_0004021
284 Ga0495621_0472001
285 Ga0495668_0000637
286 Ga0495671_0154533
287 Ga0495686_0069105
288 Ga0496115_0088528
289 Ga0501292_064530
290 Ga0501299_198064
291 Ga0501228_021469
292 Ga0501235_105758
293 Ga0501241_000365
294 Ga0501044_1653461
295 Ga0501204_003672
296 Ga0501284_01408
297 nmdc:mga09592_1563674_c1
298 nmdc:mga09592_236471_c1
299 nmdc:mga09592_288898_c1
300 nmdc:mga0qj67_44722_c1
301 nmdc:mga06r32_290538_c1
302 nmdc:mga08y16_140719_c1
303 nmdc:mga08y16_176900_c1
304 nmdc:mga08y16_857952_c1
305 2904446417
306 8036738098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

33

142

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9268 10 118
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.8399 10 118
4tvx-assembly1.cif.gz_O crystal structure of the e. coli crispr rna-guided surveillance complex, cascade 0.3784 3 113
5cd4-assembly1.cif.gz_C the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.3661 2 117
5cd4-assembly2.cif.gz_P the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.3636 2 117
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9145 10 118 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8283 10 118 1.10.8.290
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7569 14 118 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.6777 14 118 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.6717 14 118 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A1M6B2Y4-F1-model_v4 DUF2200 domain-containing protein 1.004 1 118
AF-A0A221US13-F1-model_v4 DUF2200 domain-containing protein 1.003 1 118
AF-F0SJ18-F1-model_v4 Uncharacterized conserved protein UCP033199 1.002 1 120
AF-A0A7Y2V2F2-F1-model_v4 DUF2200 domain-containing protein 1.002 1 120
AF-A0A5B8YNB4-F1-model_v4 DUF2200 domain-containing protein 1.001 1 118

Map