F215082

General Info

Members Datasets Scaffolds Average Seq Length
152 125 152 182

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0041365|Ga0453683_0041365_615_1232
Length 205
Sequence MLRDSSGKVHVLGIGGSLRKGSYNRALLYTAQELAPDNMEIHVFSNETMASIPLFNEDVRQQGEPNAVQKFKQEINRADALLFATPEYNYSMSGVLKNAIDWASRPANASPLNGKPVAIMGASTGMSGTIRAQTHFRQVCVFNNMFVVNSPGVFVADASKKFDAAGKLIDPNTREFVRLLLQALLEWTNRLQFGIVMADVKNTTL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
95 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
104 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
105 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
106 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
107 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
108 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
109 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
110 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
111 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
112 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
113 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
114 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
115 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
116 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
117 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
118 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
119 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
120 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
121 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
124 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.79
Nodule 0
Rhizoplane 1.32
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10109897 3300005327 Bacteria 2283
2 Ga0070683_101282047 3300005329 Bacteria 704
3 Ga0070690_100016474 3300005330 Bacteria 4429
4 Ga0070670_100516861 3300005331 Bacteria 1063
5 Ga0068869_100270960 3300005334 Bacteria 1362
6 Ga0070689_100010516 3300005340 Bacteria 6596
7 Ga0070689_100023499 3300005340 Bacteria 4615
8 Ga0070688_100042493 3300005365 Bacteria 2797
9 Ga0070688_100153932 3300005365 Bacteria 1574
10 Ga0070688_100348947 3300005365 Bacteria 1083
11 Ga0070678_100037162 3300005456 Bacteria 3416
12 Ga0070681_10266675 3300005458 Bacteria 1624
13 Ga0070698_100023604 3300005471 Bacteria 6428
14 Ga0070679_100008040 3300005530 Bacteria 9910
15 Ga0070684_100241902 3300005535 Bacteria 1649
16 Ga0070697_100446490 3300005536 Bacteria 1126
17 Ga0070665_100307912 3300005548 Bacteria 1587
18 Ga0068856_100333951 3300005614 Bacteria 1533
19 Ga0068864_100016333 3300005618 Bacteria 6179
20 Ga0068861_100269159 3300005719 Bacteria 1462
21 Ga0068861_100546104 3300005719 Bacteria 1055
22 Ga0068870_10071495 3300005840 Bacteria 1893
23 Ga0068863_100045254 3300005841 Bacteria 4177
24 Ga0068862_100478617 3300005844 Bacteria 1178
25 Ga0081455_10324074 3300005937 Unclassified 1096
26 Ga0070717_10312668 3300006028 Bacteria 1398
27 Ga0070712_100530232 3300006175 Bacteria 990
28 Ga0097621_101186314 3300006237 Bacteria 719
29 Ga0075430_100244397 3300006846 Bacteria 1487
30 Ga0075429_100099179 3300006880 Bacteria 2541
31 Ga0075435_100115321 3300007076 Bacteria 2237
32 Ga0105245_10000074 3300009098 Bacteria 103733
33 Ga0105245_10097935 3300009098 Bacteria 2709
34 Ga0105243_10343078 3300009148 Bacteria 1369
35 Ga0105242_10855244 3300009176 Bacteria 905
36 Ga0105237_10993446 3300009545 Bacteria 846
37 Ga0105249_10168662 3300009553 Bacteria 2121
38 Ga0157374_10055446 3300013296 Bacteria 3699
39 Ga0163163_11402862 3300014325 Bacteria 760
40 Ga0157376_10196607 3300014969 Bacteria 1853
41 Ga0157376_10602140 3300014969 Bacteria 1094
42 Ga0157376_10757951 3300014969 Bacteria 980
43 Ga0207643_10342079 3300025908 Bacteria 938
44 Ga0207705_10072319 3300025909 Bacteria 2501
45 Ga0207707_10103684 3300025912 Bacteria 2486
46 Ga0207652_10073816 3300025921 Bacteria 2969
47 Ga0207650_10165804 3300025925 Bacteria 1753
48 Ga0207687_10000139 3300025927 Bacteria 48406
49 Ga0207687_10154667 3300025927 Bacteria 1753
50 Ga0207709_10176941 3300025935 Bacteria 1503
51 Ga0207670_10040045 3300025936 Bacteria 3073
52 Ga0207670_10048918 3300025936 Bacteria 2824
53 Ga0207670_10105573 3300025936 Bacteria 2019
54 Ga0207669_10053099 3300025937 Bacteria 2439
55 Ga0207704_10993831 3300025938 Unclassified 709
56 Ga0207689_10094636 3300025942 Bacteria 2453
57 Ga0207689_10451039 3300025942 Bacteria 1075
58 Ga0207712_10147477 3300025961 Bacteria 1813
59 Ga0207641_10017425 3300026088 Bacteria 5880
60 Ga0207648_10272425 3300026089 Bacteria 1512
61 Ga0207675_100454627 3300026118 Bacteria 1269
62 Ga0207683_10001958 3300026121 Bacteria 18228
63 Ga0268266_10000993 3300028379 Bacteria 35782
64 Ga0268265_10142289 3300028380 Bacteria 2010
65 Ga0307517_10039452 3300028786 Bacteria 5184
66 Ga0307515_10014575 3300028794 Bacteria 14553
67 Ga0265338_10098776 3300028800 Bacteria 2387
68 Ga0307513_10029433 3300031456 Bacteria 6261
69 Ga0307509_10002130 3300031507 Bacteria 32573
70 Ga0307509_10119621 3300031507 Bacteria 2615
71 Ga0307508_10001844 3300031616 Bacteria 23446
72 Ga0307516_10006556 3300031730 Bacteria 13617
73 Ga0307516_10086536 3300031730 Bacteria 2970
74 Ga0307415_100237918 3300032126 Unclassified 1471
75 Ga0307415_100607535 3300032126 Bacteria 974
76 Ga0307507_10155066 3300033179 Bacteria 1710
77 Ga0373949_0002485 3300035090 Bacteria 4717
78 Ga0373936_0000004 3300035113 Bacteria 351159
79 Ga0373956_0121262 3300035119 Bacteria 1221
80 Ga0373956_0243634 3300035119 Bacteria 854
81 Ga0373961_0000018 3300035241 Bacteria 101570
82 Ga0395899_0036270 3300037312 Bacteria 3699
83 Ga0395900_0627297 3300037418 Bacteria 1013
84 Ga0395900_1185096 3300037418 Bacteria 679
85 Ga0395898_0140214 3300037466 Bacteria 2314
86 Ga0395905_0115017 3300037471 Bacteria 2528
87 Ga0395905_0304282 3300037471 Bacteria 1482
88 Ga0395901_0451477 3300038443 Bacteria 1315
89 Ga0436365_0963726 3300039437 Bacteria 951
90 Ga0436365_1557397 3300039437 Bacteria 1199
91 Ga0451793_1899388 3300041452 Unclassified 875
92 Ga0451833_1071233 3300041491 Bacteria 749
93 Ga0451577_0310663 3300042876 Bacteria 1429
94 Ga0453683_0041365 3300044673 Bacteria 2894
95 Ga0466965_0311205 3300044683 Bacteria 856
96 Ga0453684_0731616 3300044712 Bacteria 1072
97 Ga0451576_0454506 3300045051 Bacteria 1345
98 Ga0466967_0539909 3300045976 Unclassified 1147
99 Ga0495603_0347333 3300046455 Unclassified 851
100 Ga0495650_0014759 3300046471 Bacteria 4040
101 Ga0495649_0073766 3300046694 Bacteria 1828
102 Ga0495686_0023373 3300047472 Bacteria 4077
103 Ga0496115_0397552 3300048918 Bacteria 1119
104 Ga0501033_0302044 3300049570 Bacteria 1127
105 Ga0501036_0353092 3300049572 Bacteria 1228
106 Ga0501037_0685772 3300049573 Bacteria 683
107 Ga0501047_0004749 3300049581 Bacteria 12779
108 Ga0501047_0044893 3300049581 Bacteria 4271
109 Ga0501067_0430983 3300049583 Bacteria 736
110 Ga0501069_0222414 3300049585 Bacteria 1097
111 Ga0501069_0302825 3300049585 Bacteria 938
112 Ga0501070_0017044 3300049586 Bacteria 6096
113 Ga0501070_0337924 3300049586 Unclassified 1223
114 Ga0501071_0598492 3300049587 Bacteria 848
115 Ga0501216_003089 3300049660 Unclassified 2411
116 Ga0501227_028559 3300049665 Bacteria 1325
117 Ga0501080_0473786 3300049742 Bacteria 1121
118 Ga0501083_0072877 3300049744 Bacteria 2282
119 Ga0501044_0004106 3300049823 Bacteria 16325
120 Ga0501044_0091852 3300049823 Bacteria 3062
121 Ga0501220_00642 3300049852 Bacteria 1096
122 nmdc:mga09592_313211_c1 3300050508 Bacteria 1360
123 nmdc:mga09592_46798_c1 3300050508 Bacteria 3644
124 nmdc:mga09592_554529_c1 3300050508 Bacteria 987
125 nmdc:mga0qj67_246206_c1 3300050509 Bacteria 1450
126 nmdc:mga0rr50_69724_c1 3300050513 Bacteria 2676
127 nmdc:mga08x19_1347517_c1 3300050514 Bacteria 505
128 Ga0500635_0068995 3300053080 Bacteria 1250
129 Ga0500646_0004800 3300053090 Bacteria 3424
130 Ga0500583_0239063 3300053092 Unclassified 898
131 Ga0500566_0001482 3300053094 Bacteria 13747
132 Ga0500566_0085697 3300053094 Bacteria 1747
133 Ga0500640_000930 3300053095 Bacteria 8227
134 Ga0500554_000029 3300053102 Bacteria 24088
135 Ga0500554_013526 3300053102 Bacteria 2083
136 Ga0500572_003746 3300053111 Bacteria 3451
137 Ga0500595_000381 3300053119 Bacteria 28625
138 Ga0500597_002265 3300053120 Bacteria 5289
139 Ga0500614_000061 3300053123 Bacteria 23293
140 Ga0500614_162072 3300053123 Bacteria 678
141 Ga0500642_0189933 3300053130 Bacteria 958
142 Ga0500655_051618 3300053133 Unclassified 820
143 Ga0500559_0018769 3300053136 Bacteria 2921
144 Ga0500585_204430 3300053144 Bacteria 656
145 Ga0500588_0099633 3300053146 Bacteria 1000
146 Ga0500603_003326 3300053150 Bacteria 3457
147 Ga0500638_125372 3300053162 Unclassified 1170
148 Ga0500639_159783 3300053163 Bacteria 1027
149 Ga0500637_0072402 3300053178 Bacteria 1983
150 Ga0500596_011373 3300053735 Bacteria 1362
151 Ga0500601_011458 3300053737 Bacteria 997
152 Ga0501082_0197864 3300060353 Bacteria 1748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0685772 Ga0501037_0685772_67_612 147
2 3300049581 Ga0501047_0044893 Ga0501047_0044893_3215_3760 147
3 3300049586 Ga0501070_0337924 Ga0501070_0337924_538_1083 147
4 3300049823 Ga0501044_0091852 Ga0501044_0091852_1732_2277 147
5 3300050514 nmdc:mga08x19_1347517_c1 nmdc:mga08x19_1347517_c1_19_489 154
6 3300049586 Ga0501070_0017044 Ga0501070_0017044_10_492 160
7 3300006880 Ga0075429_100099179 Ga0075429_1000991793 161
8 3300050508 nmdc:mga09592_46798_c1 nmdc:mga09592_46798_c1_1430_1969 161
9 3300005536 Ga0070697_100446490 Ga0070697_1004464901 162
10 3300035119 Ga0373956_0121262 Ga0373956_0121262_261_797 163
11 3300046455 Ga0495603_0347333 Ga0495603_0347333_129_665 163
12 3300053102 Ga0500554_013526 Ga0500554_013526_237_773 163
13 3300053120 Ga0500597_002265 Ga0500597_002265_4337_4873 163
14 3300053162 Ga0500638_125372 Ga0500638_125372_159_695 163
15 3300053178 Ga0500637_0072402 Ga0500637_0072402_1051_1587 163
16 3300005471 Ga0070698_100023604 Ga0070698_1000236047 164
17 3300006846 Ga0075430_100244397 Ga0075430_1002443972 164
18 3300007076 Ga0075435_100115321 Ga0075435_1001153212 164
19 3300025942 Ga0207689_10451039 Ga0207689_104510392 164
20 3300026089 Ga0207648_10272425 Ga0207648_102724252 164
21 3300031730 Ga0307516_10006556 Ga0307516_100065569 164
22 3300035090 Ga0373949_0002485 Ga0373949_0002485_4035_4571 164
23 3300037471 Ga0395905_0115017 Ga0395905_0115017_1948_2493 164
24 3300049570 Ga0501033_0302044 Ga0501033_0302044_262_807 164
25 3300049572 Ga0501036_0353092 Ga0501036_0353092_216_761 164
26 3300049581 Ga0501047_0004749 Ga0501047_0004749_10062_10607 164
27 3300049583 Ga0501067_0430983 Ga0501067_0430983_42_608 164
28 3300049585 Ga0501069_0222414 Ga0501069_0222414_39_548 164
29 3300049587 Ga0501071_0598492 Ga0501071_0598492_269_835 164
30 3300049742 Ga0501080_0473786 Ga0501080_0473786_399_965 164
31 3300049744 Ga0501083_0072877 Ga0501083_0072877_1052_1618 164
32 3300049823 Ga0501044_0004106 Ga0501044_0004106_6008_6553 164
33 3300050508 nmdc:mga09592_313211_c1 nmdc:mga09592_313211_c1_246_785 164
34 3300050509 nmdc:mga0qj67_246206_c1 nmdc:mga0qj67_246206_c1_176_724 164
35 3300050513 nmdc:mga0rr50_69724_c1 nmdc:mga0rr50_69724_c1_856_1401 164
36 3300053095 Ga0500640_000930 Ga0500640_000930_3754_4293 164
37 3300053102 Ga0500554_000029 Ga0500554_000029_14841_15380 164
38 3300053111 Ga0500572_003746 Ga0500572_003746_943_1482 164
39 3300053119 Ga0500595_000381 Ga0500595_000381_25696_26235 164
40 3300053123 Ga0500614_000061 Ga0500614_000061_11712_12251 164
41 3300053136 Ga0500559_0018769 Ga0500559_0018769_1710_2249 164
42 3300053144 Ga0500585_204430 Ga0500585_204430_84_623 164
43 3300053737 Ga0500601_011458 Ga0500601_011458_119_658 164
44 3300060353 Ga0501082_0197864 Ga0501082_0197864_524_1090 164
45 3300005334 Ga0068869_100270960 Ga0068869_1002709602 165
46 3300005340 Ga0070689_100023499 Ga0070689_1000234994 165
47 3300005365 Ga0070688_100042493 Ga0070688_1000424932 165
48 3300005719 Ga0068861_100546104 Ga0068861_1005461041 165
49 3300005840 Ga0068870_10071495 Ga0068870_100714952 165
50 3300005841 Ga0068863_100045254 Ga0068863_1000452543 165
51 3300005844 Ga0068862_100478617 Ga0068862_1004786172 165
52 3300005937 Ga0081455_10324074 Ga0081455_103240742 165
53 3300006028 Ga0070717_10312668 Ga0070717_103126682 165
54 3300006175 Ga0070712_100530232 Ga0070712_1005302322 165
55 3300009098 Ga0105245_10097935 Ga0105245_100979353 165
56 3300009148 Ga0105243_10343078 Ga0105243_103430782 165
57 3300009176 Ga0105242_10855244 Ga0105242_108552442 165
58 3300014325 Ga0163163_11402862 Ga0163163_114028621 165
59 3300014969 Ga0157376_10602140 Ga0157376_106021402 165
60 3300025908 Ga0207643_10342079 Ga0207643_103420791 165
61 3300025927 Ga0207687_10154667 Ga0207687_101546673 165
62 3300025935 Ga0207709_10176941 Ga0207709_101769411 165
63 3300025936 Ga0207670_10040045 Ga0207670_100400453 165
64 3300025936 Ga0207670_10105573 Ga0207670_101055733 165
65 3300025942 Ga0207689_10094636 Ga0207689_100946363 165
66 3300026088 Ga0207641_10017425 Ga0207641_100174253 165
67 3300026118 Ga0207675_100454627 Ga0207675_1004546272 165
68 3300028380 Ga0268265_10142289 Ga0268265_101422891 165
69 3300028786 Ga0307517_10039452 Ga0307517_100394521 165
70 3300028794 Ga0307515_10014575 Ga0307515_100145755 165
71 3300031456 Ga0307513_10029433 Ga0307513_100294336 165
72 3300031616 Ga0307508_10001844 Ga0307508_1000184422 165
73 3300032126 Ga0307415_100237918 Ga0307415_1002379182 165
74 3300033179 Ga0307507_10155066 Ga0307507_101550662 165
75 3300035113 Ga0373936_0000004 Ga0373936_0000004_213618_214160 165
76 3300037312 Ga0395899_0036270 Ga0395899_0036270_2744_3292 165
77 3300037418 Ga0395900_0627297 Ga0395900_0627297_112_660 165
78 3300037418 Ga0395900_1185096 Ga0395900_1185096_45_593 165
79 3300037466 Ga0395898_0140214 Ga0395898_0140214_584_1132 165
80 3300037471 Ga0395905_0304282 Ga0395905_0304282_48_599 165
81 3300038443 Ga0395901_0451477 Ga0395901_0451477_752_1300 165
82 3300044683 Ga0466965_0311205 Ga0466965_0311205_247_798 165
83 3300046694 Ga0495649_0073766 Ga0495649_0073766_695_1237 165
84 3300048918 Ga0496115_0397552 Ga0496115_0397552_43_588 165
85 3300049585 Ga0501069_0302825 Ga0501069_0302825_56_607 165
86 3300053090 Ga0500646_0004800 Ga0500646_0004800_2276_2818 165
87 3300053092 Ga0500583_0239063 Ga0500583_0239063_174_716 165
88 3300053094 Ga0500566_0085697 Ga0500566_0085697_529_1071 165
89 3300053123 Ga0500614_162072 Ga0500614_162072_108_650 165
90 3300053130 Ga0500642_0189933 Ga0500642_0189933_128_712 165
91 3300053146 Ga0500588_0099633 Ga0500588_0099633_166_708 165
92 3300053163 Ga0500639_159783 Ga0500639_159783_316_858 165
93 3300053735 Ga0500596_011373 Ga0500596_011373_695_1237 165
94 3300005330 Ga0070690_100016474 Ga0070690_1000164742 166
95 3300005365 Ga0070688_100153932 Ga0070688_1001539322 166
96 3300005456 Ga0070678_100037162 Ga0070678_1000371623 166
97 3300005548 Ga0070665_100307912 Ga0070665_1003079122 166
98 3300005618 Ga0068864_100016333 Ga0068864_1000163333 166
99 3300009553 Ga0105249_10168662 Ga0105249_101686623 166
100 3300013296 Ga0157374_10055446 Ga0157374_100554464 166
101 3300014969 Ga0157376_10196607 Ga0157376_101966072 166
102 3300025937 Ga0207669_10053099 Ga0207669_100530993 166
103 3300025961 Ga0207712_10147477 Ga0207712_101474772 166
104 3300026121 Ga0207683_10001958 Ga0207683_100019583 166
105 3300028379 Ga0268266_10000993 Ga0268266_1000099325 166
106 3300028800 Ga0265338_10098776 Ga0265338_100987762 166
107 3300031507 Ga0307509_10002130 Ga0307509_1000213025 166
108 3300035241 Ga0373961_0000018 Ga0373961_0000018_28933_29529 166
109 3300039437 Ga0436365_0963726 Ga0436365_0963726_179_748 166
110 3300041452 Ga0451793_1899388 Ga0451793_1899388_312_857 166
111 3300049660 Ga0501216_003089 Ga0501216_003089_1796_2350 166
112 3300050508 nmdc:mga09592_554529_c1 nmdc:mga09592_554529_c1_101_622 166
113 3300005329 Ga0070683_101282047 Ga0070683_1012820471 167
114 3300005331 Ga0070670_100516861 Ga0070670_1005168612 167
115 3300005340 Ga0070689_100010516 Ga0070689_1000105162 167
116 3300005365 Ga0070688_100348947 Ga0070688_1003489472 167
117 3300005458 Ga0070681_10266675 Ga0070681_102666752 167
118 3300005530 Ga0070679_100008040 Ga0070679_1000080407 167
119 3300005535 Ga0070684_100241902 Ga0070684_1002419022 167
120 3300005614 Ga0068856_100333951 Ga0068856_1003339512 167
121 3300005719 Ga0068861_100269159 Ga0068861_1002691592 167
122 3300009098 Ga0105245_10000074 Ga0105245_1000007496 167
123 3300009545 Ga0105237_10993446 Ga0105237_109934462 167
124 3300014969 Ga0157376_10757951 Ga0157376_107579512 167
125 3300025912 Ga0207707_10103684 Ga0207707_101036842 167
126 3300025921 Ga0207652_10073816 Ga0207652_100738163 167
127 3300025925 Ga0207650_10165804 Ga0207650_101658043 167
128 3300025927 Ga0207687_10000139 Ga0207687_1000013919 167
129 3300025936 Ga0207670_10048918 Ga0207670_100489182 167
130 3300025938 Ga0207704_10993831 Ga0207704_109938311 167
131 3300031507 Ga0307509_10119621 Ga0307509_101196213 167
132 3300031730 Ga0307516_10086536 Ga0307516_100865361 167
133 3300032126 Ga0307415_100607535 Ga0307415_1006075352 167
134 3300035119 Ga0373956_0243634 Ga0373956_0243634_75_641 167
135 3300041491 Ga0451833_1071233 Ga0451833_1071233_170_721 167
136 3300042876 Ga0451577_0310663 Ga0451577_0310663_220_777 167
137 3300044673 Ga0453683_0041365 Ga0453683_0041365_615_1232 167
138 3300044712 Ga0453684_0731616 Ga0453684_0731616_468_1025 167
139 3300045051 Ga0451576_0454506 Ga0451576_0454506_702_1259 167
140 3300046471 Ga0495650_0014759 Ga0495650_0014759_3211_3777 167
141 3300047472 Ga0495686_0023373 Ga0495686_0023373_1471_2025 167
142 3300049665 Ga0501227_028559 Ga0501227_028559_39_611 167
143 3300049852 Ga0501220_00642 Ga0501220_00642_71_643 167
144 3300053080 Ga0500635_0068995 Ga0500635_0068995_81_635 167
145 3300053094 Ga0500566_0001482 Ga0500566_0001482_1649_2203 167
146 3300053133 Ga0500655_051618 Ga0500655_051618_66_662 167
147 3300053150 Ga0500603_003326 Ga0500603_003326_1356_1910 167
148 3300005327 Ga0070658_10109897 Ga0070658_101098972 168
149 3300006237 Ga0097621_101186314 Ga0097621_1011863141 168
150 3300025909 Ga0207705_10072319 Ga0207705_100723192 168
151 3300039437 Ga0436365_1557397 Ga0436365_1557397_423_983 168
152 3300045976 Ga0466967_0539909 Ga0466967_0539909_624_1136 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

9

160

0.96

PF02525

Flavodoxin_2

Flavodoxin-like fold

10

167

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.9471 2 164
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.9451 2 164
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.9413 2 164
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.9402 2 162
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.9303 2 152
ID Description Score Start End Superfamily
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9303 2 152 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9299 2 161 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8877 2 159 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8823 2 161 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8351 2 152 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A7W0ZW94-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9736 2 164 GO:0005829
GO:0010181
GO:0016491
AF-A0A535BQH4-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9635 2 164 GO:0005829
GO:0010181
GO:0016491
AF-A0A2D5EUX6-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9588 2 159 GO:0005829
GO:0010181
GO:0016491
AF-A0A061N8L6-F1-model_v4 NADPH:quinone oxidoreductase 0.9564 26 164 GO:0005829
GO:0010181
GO:0016491
AF-A0A8B5XFN3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9539 2 164 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
91.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map