F211701

General Info

Members Datasets Scaffolds Average Seq Length
151 116 298 312

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10000004|Ga0207692_10000004377
Length 362
Sequence LLGIVRNQGFVGERRTHQRNGLSGAGTGARRPLHVNEALGDRHSMRSAFAHTLLELAETDERIVLLTGDLGFAVLEPFAERHPERFWNVGVAEQNMVGVATGLADAGYTPYVYSIATFASMRGYEFVRNGPILHELPVRVVGVGGGMDYGHNGVTHYALEDAGIMRVQPGIAVIAPADPEQTRAALPAIQGLPGPVYLRLGKESQPVPGLDGRFALGRAERIGGGRDVALVTLGGMAATAVEAAERLAADGVDASVLVVSSLNPAPTDDLAEALADVPVALSAEAHYVNGALGSLVAETIAEQGLACRLVRAGLRAMPIGATGSRPHLYERHGLAPDQLAASALRALEGVPAPVTTGATQPR

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 13.91
Rhizosphere 83.44
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10000004 3300025898 Bacteria 413600
2 Ga0070690_100210133 3300005330 Bacteria 1358
3 Ga0070660_100069962 3300005339 Bacteria 2738
4 Ga0070660_100099251 3300005339 Unclassified 2305
5 Ga0070692_10011181 3300005345 Bacteria 4115
6 Ga0070669_100015020 3300005353 Bacteria 5521
7 Ga0070675_100131589 3300005354 Unclassified 2132
8 Ga0070675_100255000 3300005354 Bacteria 1536
9 Ga0070671_100193678 3300005355 Bacteria 1723
10 Ga0070674_100000158 3300005356 Bacteria 31265
11 Ga0070688_100120624 3300005365 Unclassified 1756
12 Ga0070659_100000003 3300005366 Bacteria 309142
13 Ga0070667_100126873 3300005367 Bacteria 2224
14 Ga0070714_100000026 3300005435 Bacteria 145396
15 Ga0070714_100002361 3300005435 Bacteria 13885
16 Ga0070714_100008290 3300005435 Bacteria 8106
17 Ga0070714_100044277 3300005435 Unclassified 3767
18 Ga0070710_10000001 3300005437 Bacteria 552187
19 Ga0070705_100016817 3300005440 Bacteria 3808
20 Ga0070663_100028484 3300005455 Bacteria 3804
21 Ga0070678_100005721 3300005456 Bacteria 7221
22 Ga0070681_10030037 3300005458 Bacteria 5453
23 Ga0070707_100022723 3300005468 Bacteria 5930
24 Ga0070707_100130533 3300005468 Unclassified 2443
25 Ga0070707_100142425 3300005468 Bacteria 2333
26 Ga0070699_100051081 3300005518 Unclassified 3580
27 Ga0070679_100037418 3300005530 Bacteria 4820
28 Ga0070684_100047368 3300005535 Bacteria 3725
29 Ga0070686_100017604 3300005544 Bacteria 4178
30 Ga0070704_100033431 3300005549 Bacteria 3477
31 Ga0068852_100085100 3300005616 Bacteria 2816
32 Ga0068863_100461626 3300005841 Bacteria 1247
33 Ga0068858_100018296 3300005842 Bacteria 6561
34 Ga0068860_100003145 3300005843 Bacteria 17056
35 Ga0081539_10000615 3300005985 Bacteria 72134
36 Ga0070712_100000061 3300006175 Bacteria 54506
37 Ga0097621_100080148 3300006237 Bacteria 2715
38 Ga0075431_100255161 3300006847 Unclassified 1781
39 Ga0075429_100066666 3300006880 Bacteria 3134
40 Ga0075429_100129836 3300006880 Unclassified 2204
41 Ga0068865_100201588 3300006881 Bacteria 1545
42 Ga0075435_100433703 3300007076 Bacteria 1132
43 Ga0111539_10092692 3300009094 Bacteria 3550
44 Ga0105245_10695232 3300009098 Bacteria 1050
45 Ga0105247_10060788 3300009101 Bacteria 2342
46 Ga0105247_10096864 3300009101 Bacteria 1881
47 Ga0114129_10005255 3300009147 Bacteria 18253
48 Ga0114129_10056745 3300009147 Bacteria 5483
49 Ga0105243_10001387 3300009148 Bacteria 21471
50 Ga0105242_10005685 3300009176 Bacteria 9624
51 Ga0105248_10416764 3300009177 Bacteria 1512
52 Ga0105238_10400079 3300009551 Bacteria 1366
53 Ga0105249_10158058 3300009553 Bacteria 2188
54 Ga0105246_10002227 3300011119 Bacteria 11700
55 Ga0157378_10005390 3300013297 Bacteria 11215
56 Ga0157375_10088265 3300013308 Bacteria 3155
57 Ga0163163_10256593 3300014325 Bacteria 1799
58 Ga0157379_10001684 3300014968 Bacteria 18272
59 Ga0157379_10042022 3300014968 Bacteria 4080
60 Ga0157376_10021276 3300014969 Bacteria 5037
61 Ga0207642_10005941 3300025899 Bacteria 4023
62 Ga0207710_10034227 3300025900 Bacteria 2231
63 Ga0207710_10056466 3300025900 Bacteria 1771
64 Ga0207684_10010615 3300025910 Bacteria 8096
65 Ga0207707_10026098 3300025912 Bacteria 5108
66 Ga0207693_10000201 3300025915 Bacteria 54465
67 Ga0207660_10052428 3300025917 Bacteria 2904
68 Ga0207662_10039712 3300025918 Unclassified 2762
69 Ga0207657_10078658 3300025919 Bacteria 2776
70 Ga0207646_10060865 3300025922 Unclassified 3371
71 Ga0207646_10112044 3300025922 Unclassified 2449
72 Ga0207646_10301394 3300025922 Bacteria 1448
73 Ga0207681_10010983 3300025923 Bacteria 5562
74 Ga0207659_10094666 3300025926 Bacteria 2239
75 Ga0207664_10000012 3300025929 Bacteria 278872
76 Ga0207664_10000498 3300025929 Bacteria 27964
77 Ga0207690_10000306 3300025932 Bacteria 33820
78 Ga0207686_10043194 3300025934 Bacteria 2761
79 Ga0207669_10000083 3300025937 Bacteria 47557
80 Ga0207669_10061240 3300025937 Bacteria 2312
81 Ga0207704_10032328 3300025938 Bacteria 2960
82 Ga0207661_10021447 3300025944 Bacteria 4839
83 Ga0207661_10102928 3300025944 Bacteria 2402
84 Ga0207651_10289314 3300025960 Bacteria 1358
85 Ga0207712_10122832 3300025961 Bacteria 1967
86 Ga0207658_10116645 3300025986 Bacteria 2121
87 Ga0207703_10138283 3300026035 Bacteria 2111
88 Ga0207678_10024548 3300026067 Bacteria 5266
89 Ga0207683_10000068 3300026121 Bacteria 78969
90 Ga0265326_10000094 3300028558 Bacteria 45864
91 Ga0265326_10045257 3300028558 Bacteria 1248
92 Ga0265319_1000227 3300028563 Bacteria 42176
93 Ga0265319_1002185 3300028563 Bacteria 10896
94 Ga0265319_1032859 3300028563 Bacteria 1796
95 Ga0265334_10000134 3300028573 Bacteria 46634
96 Ga0265318_10094075 3300028577 Bacteria 1103
97 Ga0265336_10038799 3300028666 Bacteria 1461
98 Ga0265338_10000383 3300028800 Bacteria 79248
99 Ga0265338_10010647 3300028800 Bacteria 10749
100 Ga0265338_10045765 3300028800 Bacteria 4019
101 Ga0265324_10003744 3300029957 Bacteria 7114
102 Ga0265324_10004756 3300029957 Bacteria 6015
103 Ga0265320_10043112 3300031240 Bacteria 2233
104 Ga0265325_10028518 3300031241 Bacteria 3009
105 Ga0307411_10364374 3300032005 Bacteria 1183
106 Ga0373927_0001014 3300035695 Bacteria 21403
107 Ga0373925_0000660 3300037068 Bacteria 32393
108 Ga0395899_0018823 3300037312 Bacteria 5247
109 Ga0395900_0043806 3300037418 Bacteria 4612
110 Ga0395898_0175765 3300037466 Bacteria 2046
111 Ga0395905_0487599 3300037471 Unclassified 1132
112 Ga0395901_0049629 3300038443 Bacteria 4360
113 Ga0400489_09071 3300039093 Bacteria 54909
114 Ga0453684_0020990 3300044712 Bacteria 9794
115 Ga0495605_0042167 3300046474 Unclassified 2270
116 Ga0495639_0089091 3300046475 Bacteria 1445
117 Ga0495630_0000423 3300046517 Bacteria 32391
118 Ga0495625_0000154 3300046660 Bacteria 105083
119 Ga0495657_0000021 3300046675 Bacteria 153590
120 Ga0496100_0000254 3300048903 Bacteria 27391
121 Ga0496100_0009189 3300048903 Bacteria 5546
122 Ga0496101_0002622 3300048904 Bacteria 11056
123 Ga0496101_0002731 3300048904 Bacteria 10832
124 Ga0496102_0047677 3300048905 Bacteria 3895
125 Ga0496102_0197335 3300048905 Bacteria 1897
126 Ga0496104_0011692 3300048907 Bacteria 7871
127 Ga0496104_0443418 3300048907 Bacteria 1210
128 Ga0496105_0110292 3300048908 Bacteria 2271
129 Ga0496106_0005829 3300048909 Bacteria 9110
130 Ga0496106_0289534 3300048909 Bacteria 1313
131 Ga0496107_0005567 3300048910 Bacteria 8626
132 Ga0496109_0001480 3300048912 Bacteria 19498
133 Ga0496109_0008122 3300048912 Bacteria 8899
134 Ga0496112_0001307 3300048915 Bacteria 18926
135 Ga0496112_0301111 3300048915 Bacteria 1549
136 Ga0496113_0185746 3300048916 Bacteria 1649
137 Ga0496114_0004670 3300048917 Bacteria 10647
138 Ga0496114_0025086 3300048917 Bacteria 4870
139 Ga0496115_0000004 3300048918 Bacteria 319734
140 Ga0496115_0083570 3300048918 Bacteria 2603
141 Ga0496117_0001638 3300048920 Bacteria 31520
142 Ga0501069_0044823 3300049585 Bacteria 2449
143 Ga0501070_0000124 3300049586 Bacteria 68928
144 Ga0501080_0003636 3300049742 Bacteria 13601
145 nmdc:mga0yw44_94344_c1 3300050492 Unclassified 1335
146 nmdc:mga09592_12283_c1 3300050508 Bacteria 6972
147 nmdc:mga09592_212107_c1 3300050508 Unclassified 1678
148 nmdc:mga08y16_135137_c1 3300050511 Bacteria 2563
149 Ga0500595_026098 3300053119 Bacteria 2017
150 Ga0207692_10000004
151 Ga0070690_100210133
152 Ga0070660_100069962
153 Ga0070660_100099251
154 Ga0070692_10011181
155 Ga0070669_100015020
156 Ga0070675_100131589
157 Ga0070675_100255000
158 Ga0070671_100193678
159 Ga0070674_100000158
160 Ga0070688_100120624
161 Ga0070659_100000003
162 Ga0070667_100126873
163 Ga0070714_100000026
164 Ga0070714_100002361
165 Ga0070714_100008290
166 Ga0070714_100044277
167 Ga0070710_10000001
168 Ga0070705_100016817
169 Ga0070663_100028484
170 Ga0070678_100005721
171 Ga0070681_10030037
172 Ga0070707_100022723
173 Ga0070707_100130533
174 Ga0070707_100142425
175 Ga0070699_100051081
176 Ga0070679_100037418
177 Ga0070684_100047368
178 Ga0070686_100017604
179 Ga0070704_100033431
180 Ga0068852_100085100
181 Ga0068863_100461626
182 Ga0068858_100018296
183 Ga0068860_100003145
184 Ga0081539_10000615
185 Ga0070712_100000061
186 Ga0097621_100080148
187 Ga0075431_100255161
188 Ga0075429_100066666
189 Ga0075429_100129836
190 Ga0068865_100201588
191 Ga0075435_100433703
192 Ga0111539_10092692
193 Ga0105245_10695232
194 Ga0105247_10060788
195 Ga0105247_10096864
196 Ga0114129_10005255
197 Ga0114129_10056745
198 Ga0105243_10001387
199 Ga0105242_10005685
200 Ga0105248_10416764
201 Ga0105238_10400079
202 Ga0105249_10158058
203 Ga0105246_10002227
204 Ga0157378_10005390
205 Ga0157375_10088265
206 Ga0163163_10256593
207 Ga0157379_10001684
208 Ga0157379_10042022
209 Ga0157376_10021276
210 Ga0207642_10005941
211 Ga0207710_10034227
212 Ga0207710_10056466
213 Ga0207684_10010615
214 Ga0207707_10026098
215 Ga0207693_10000201
216 Ga0207660_10052428
217 Ga0207662_10039712
218 Ga0207657_10078658
219 Ga0207646_10060865
220 Ga0207646_10112044
221 Ga0207646_10301394
222 Ga0207681_10010983
223 Ga0207659_10094666
224 Ga0207664_10000012
225 Ga0207664_10000498
226 Ga0207690_10000306
227 Ga0207686_10043194
228 Ga0207669_10000083
229 Ga0207669_10061240
230 Ga0207704_10032328
231 Ga0207661_10021447
232 Ga0207661_10102928
233 Ga0207651_10289314
234 Ga0207712_10122832
235 Ga0207658_10116645
236 Ga0207703_10138283
237 Ga0207678_10024548
238 Ga0207683_10000068
239 Ga0265326_10000094
240 Ga0265326_10045257
241 Ga0265319_1000227
242 Ga0265319_1002185
243 Ga0265319_1032859
244 Ga0265334_10000134
245 Ga0265318_10094075
246 Ga0265336_10038799
247 Ga0265338_10000383
248 Ga0265338_10010647
249 Ga0265338_10045765
250 Ga0265324_10003744
251 Ga0265324_10004756
252 Ga0265320_10043112
253 Ga0265325_10028518
254 Ga0307411_10364374
255 Ga0373927_0001014
256 Ga0373925_0000660
257 Ga0395899_0018823
258 Ga0395900_0043806
259 Ga0395898_0175765
260 Ga0395905_0487599
261 Ga0395901_0049629
262 Ga0400489_09071
263 Ga0453684_0020990
264 Ga0495605_0042167
265 Ga0495639_0089091
266 Ga0495630_0000423
267 Ga0495625_0000154
268 Ga0495657_0000021
269 Ga0496100_0000254
270 Ga0496100_0009189
271 Ga0496101_0002622
272 Ga0496101_0002731
273 Ga0496102_0047677
274 Ga0496102_0197335
275 Ga0496104_0011692
276 Ga0496104_0443418
277 Ga0496105_0110292
278 Ga0496106_0005829
279 Ga0496106_0289534
280 Ga0496107_0005567
281 Ga0496109_0001480
282 Ga0496109_0008122
283 Ga0496112_0001307
284 Ga0496112_0301111
285 Ga0496113_0185746
286 Ga0496114_0004670
287 Ga0496114_0025086
288 Ga0496115_0000004
289 Ga0496115_0083570
290 Ga0496117_0001638
291 Ga0501069_0044823
292 Ga0501070_0000124
293 Ga0501080_0003636
294 nmdc:mga0yw44_94344_c1
295 nmdc:mga09592_12283_c1
296 nmdc:mga09592_212107_c1
297 nmdc:mga08y16_135137_c1
298 Ga0500595_026098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

41

207

0.96

PF02780

Transketolase_C

Transketolase, C-terminal domain

217

339

0.95

PF17147

PFOR_II

Pyruvate:ferredoxin oxidoreductase core domain II

226

312

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_DDD split gene transketolase, active alpha2beta2 heterotetramer 0.9303 2 305
7a9g-assembly1.cif.gz_BBB truncated 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from mycobacterium tuberculosis with intermediate 2-acetyl-thiamine diphosphate 0.9231 2 305
8a29-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9227 2 302
2o1x-assembly2.cif.gz_D 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from deinococcus radiodurans 0.9207 2 303
8a45-assembly1.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9187 2 302
ID Description Score Start End Superfamily
af_Q58092_3_181_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9618 2 158 3.40.50.970
af_O50408_212_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9487 4 164 3.40.50.970
af_I1M1A4_399_568_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9273 2 165 3.40.50.970
af_D3ZHE7_301_494_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9234 2 173 3.40.50.970
af_Q8IDW0_828_997_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9118 2 163 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7D8BA50-F1-model_v4 deleted 0.9786 1 102
AF-K1RWP6-F1-model_v4 Transketolase central region (EC 1.2.4.4) 0.9707 4 141 GO:0003863
AF-A0A7K3IX52-F1-model_v4 Transketolase family protein 0.9694 2 135
AF-A0A382TYG3-F1-model_v4 Transketolase-like pyrimidine-binding domain-containing protein 0.9688 1 114
AF-A0A7Y3LJ63-F1-model_v4 Transketolase 0.9683 1 183 GO:0000287

Map