F210133

General Info

Members Datasets Scaffolds Average Seq Length
150 113 139 488

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738543023|2739303165
Length 564
Sequence KSIDLLTKEASESGEGTLKRTLGPVNLVALGIGAIIGAGLFSITGSAAANNAGPAITISFVIAALGCGFAGLCYAEFASMIPVAGSAYTYSYATMGEFVAWVIGWDLVLEYALGAATVSISWSRYLVKFLGYYDLHLPPQVTMSPFEHVTLLDGTVVHGMMNLPAVFIIVLMSFILIRGTSESAFVNGLIVSIKVVIVFIFIFLGWKYINTENYSPYFIPADKPGHESVFTHGWGGVIRAAGIVFFAYIGFDAVSTAAQEAKNPKRDMPIGILVSLFICTILYILFAHVMTGVANYDLFKGQDGIAPVAVAIDNMGLKNAAGVVTPAFPWLNKLIILAILGGYASVVLVMLLGQSRVFFSMSRDGLLPKVFSEVHPKFSTPAKNNLLFMVFTSLFSAFVPATVVGEMTSIGTLLAFILVCIGIVILRKRMPDLPRAFKVPLVPLIPILGVVVCLGMMVFLPLDTWVRLLVWMIIGVNVYLFYGMKNSLLSDNKKETLMKSTKTVSYIGIALTVLLVIVAIIHHHITDGVDTGLYYFSLIFAAAHFILYAFKAANAGNVTIKEIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
8 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
9 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
10 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
11 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
12 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
13 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 1.33
Isolates 7.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 2.67
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_38688 2162886007 Bacteria 22286
2 LJNas_1002338 3300000546 Bacteria 2314
3 Ga0065714_10002525 3300005288 Bacteria 27682
4 Ga0065714_10003446 3300005288 Bacteria 7100
5 Ga0065704_10000301 3300005289 Bacteria 42046
6 Ga0070680_100130932 3300005336 Bacteria 2099
7 Ga0070682_100017333 3300005337 Bacteria 4197
8 Ga0070709_10003043 3300005434 Bacteria 8997
9 Ga0070713_100036924 3300005436 Bacteria 3947
10 Ga0070662_100079072 3300005457 Bacteria 2444
11 Ga0070662_100124321 3300005457 Bacteria 1981
12 Ga0070706_100001148 3300005467 Bacteria 28547
13 Ga0070707_100001991 3300005468 Bacteria 19549
14 Ga0070698_100000015 3300005471 Bacteria 111813
15 Ga0070698_100062291 3300005471 Bacteria 3763
16 Ga0070699_100016255 3300005518 Bacteria 6388
17 Ga0070679_100118661 3300005530 Bacteria 2630
18 Ga0070697_100002029 3300005536 Bacteria 15494
19 Ga0070697_100035373 3300005536 Bacteria 4028
20 Ga0070672_100221655 3300005543 Bacteria 1586
21 Ga0070696_100020220 3300005546 Bacteria 4512
22 Ga0070665_100000633 3300005548 Bacteria 47882
23 Ga0070665_100002828 3300005548 Bacteria 18791
24 Ga0068855_100002912 3300005563 Bacteria 20942
25 Ga0068855_100067278 3300005563 Bacteria 4174
26 Ga0070664_100130424 3300005564 Bacteria 2208
27 Ga0068856_100060559 3300005614 Bacteria 3740
28 Ga0068856_100081806 3300005614 Bacteria 3204
29 Ga0070716_100000715 3300006173 Bacteria 14169
30 Ga0070716_100027578 3300006173 Bacteria 3053
31 Ga0075430_100013084 3300006846 Bacteria 7071
32 Ga0075431_100001735 3300006847 Bacteria 20509
33 Ga0075429_100148389 3300006880 Bacteria 2053
34 Ga0075436_100018907 3300006914 Bacteria 4718
35 Ga0105240_10001655 3300009093 Bacteria 37827
36 Ga0105240_10066107 3300009093 Bacteria 4487
37 Ga0105240_10207278 3300009093 Bacteria 2294
38 Ga0111539_10135433 3300009094 Bacteria 2885
39 Ga0105245_10000604 3300009098 Bacteria 32552
40 Ga0105241_10003811 3300009174 Bacteria 11177
41 Ga0105241_10026310 3300009174 Bacteria 4328
42 Ga0105242_10112756 3300009176 Bacteria 2321
43 Ga0105237_10004340 3300009545 Bacteria 16434
44 Ga0105237_10005512 3300009545 Bacteria 14263
45 Ga0105238_10001738 3300009551 Bacteria 21897
46 Ga0105239_10005534 3300010375 Bacteria 14789
47 Ga0157373_10001684 3300013100 Bacteria 16873
48 Ga0157373_10012164 3300013100 Bacteria 6326
49 Ga0157371_10001041 3300013102 Bacteria 30406
50 Ga0157371_10019599 3300013102 Bacteria 4984
51 Ga0157370_10016415 3300013104 Bacteria 7496
52 Ga0157370_10043158 3300013104 Bacteria 4341
53 Ga0157370_10134986 3300013104 Bacteria 2300
54 Ga0157369_10000234 3300013105 Bacteria 76957
55 Ga0157369_10018352 3300013105 Bacteria 7843
56 Ga0157369_10053180 3300013105 Bacteria 4378
57 Ga0157378_10007815 3300013297 Bacteria 9337
58 Ga0163162_10164069 3300013306 Bacteria 2345
59 Ga0157372_10025101 3300013307 Bacteria 6477
60 Ga0157372_10195499 3300013307 Bacteria 2343
61 Ga0163163_10003965 3300014325 Bacteria 12636
62 Ga0157380_10000015 3300014326 Bacteria 129842
63 Ga0182008_10000024 3300014497 Bacteria 199978
64 Ga0157376_10102680 3300014969 Bacteria 2501
65 Ga0163161_10001453 3300017792 Bacteria 17518
66 Ga0213872_10004279 3300021361 Bacteria 7637
67 Ga0207699_10001099 3300025906 Bacteria 12764
68 Ga0207645_10103845 3300025907 Bacteria 1835
69 Ga0207684_10000309 3300025910 Bacteria 69239
70 Ga0207654_10019236 3300025911 Bacteria 3601
71 Ga0207695_10002524 3300025913 Bacteria 26889
72 Ga0207695_10022089 3300025913 Bacteria 7238
73 Ga0207646_10001918 3300025922 Bacteria 25038
74 Ga0207694_10000675 3300025924 Bacteria 30607
75 Ga0207650_10035482 3300025925 Bacteria 3622
76 Ga0207706_10158334 3300025933 Bacteria 1991
77 Ga0207665_10006038 3300025939 Bacteria 8047
78 Ga0207665_10033109 3300025939 Bacteria 3424
79 Ga0207691_10215216 3300025940 Bacteria 1668
80 Ga0207679_10071286 3300025945 Bacteria 2621
81 Ga0207667_10015060 3300025949 Bacteria 8796
82 Ga0207667_10031729 3300025949 Bacteria 5701
83 Ga0207708_10011532 3300026075 Bacteria 6584
84 Ga0265354_1000302 3300028016 Bacteria 8847
85 Ga0268266_10000208 3300028379 Bacteria 102593
86 Ga0268266_10000340 3300028379 Bacteria 73049
87 Ga0265323_10002453 3300028653 Bacteria 8492
88 Ga0265322_10004360 3300028654 Bacteria 4223
89 Ga0265322_10018315 3300028654 Bacteria 2013
90 Ga0265336_10001224 3300028666 Bacteria 12182
91 Ga0265336_10029081 3300028666 Unclassified 1725
92 Ga0307515_10008213 3300028794 Bacteria 20418
93 Ga0265338_10009795 3300028800 Bacteria 11364
94 Ga0265338_10018203 3300028800 Bacteria 7531
95 Ga0265338_10070040 3300028800 Bacteria 3009
96 Ga0265338_10080882 3300028800 Bacteria 2728
97 Ga0265760_10018875 3300031090 Bacteria 1987
98 Ga0265760_10019798 3300031090 Bacteria 1940
99 Ga0265339_10006784 3300031249 Bacteria 7469
100 Ga0265314_10041413 3300031711 Bacteria 3297
101 Ga0265314_10086705 3300031711 Bacteria 2049
102 Ga0307412_10000030 3300031911 Bacteria 208541
103 Ga0307414_10000680 3300032004 Bacteria 17420
104 Ga0307414_10001228 3300032004 Bacteria 13211
105 Ga0373925_0196827 3300037068 Bacteria 1601
106 Ga0395899_0024346 3300037312 Bacteria 4578
107 Ga0395898_0158741 3300037466 Bacteria 2163
108 Ga0436361_0529073 3300039447 Bacteria 7590
109 Ga0436361_0905464 3300039447 Bacteria 16880
110 Ga0451577_0000161 3300042876 Bacteria 146704
111 Ga0451577_0001429 3300042876 Bacteria 31860
112 Ga0451577_0003932 3300042876 Bacteria 16050
113 Ga0466972_0000159 3300044658 Bacteria 54274
114 Ga0453683_0000718 3300044673 Bacteria 34148
115 Ga0453684_0003579 3300044712 Bacteria 34669
116 Ga0453684_0012324 3300044712 Bacteria 14148
117 Ga0466970_0005193 3300044765 Bacteria 6440
118 Ga0451576_0003968 3300045051 Bacteria 19696
119 Ga0466958_0050024 3300045836 Bacteria 2530
120 Ga0466967_0097486 3300045976 Bacteria 2684
121 Ga0495580_0139249 3300046472 Bacteria 1682
122 Ga0495610_0000197 3300046512 Bacteria 67429
123 Ga0495658_0038271 3300046683 Bacteria 2656
124 Ga0496102_0073627 3300048905 Bacteria 3139
125 Ga0496112_0004056 3300048915 Bacteria 12289
126 Ga0496112_0144161 3300048915 Bacteria 2350
127 Ga0496115_0023581 3300048918 Bacteria 4776
128 Ga0496126_0011437 3300048929 Bacteria 9185
129 Ga0501047_0003095 3300049581 Bacteria 15787
130 Ga0501241_004089 3300049758 Bacteria 2743
131 Ga0501035_0140806 3300049822 Bacteria 2097
132 Ga0501044_0001352 3300049823 Bacteria 28823
133 Ga0501044_0260272 3300049823 Bacteria 1673
134 nmdc:mga09592_135948_c1 3300050508 Bacteria 2117
135 nmdc:mga06r32_56535_c1 3300050510 Bacteria 3767
136 nmdc:mga0rr50_202169_c1 3300050513 Bacteria 1633
137 nmdc:mga08x19_4486_c1 3300050514 Bacteria 8272
138 Ga0495601_0129699 3300053077 Bacteria 1642
139 Ga0500651_0035192 3300053093 Bacteria 3156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_202169_c1 nmdc:mga0rr50_202169_c1_389_1582 352
2 3300005614 Ga0068856_100081806 Ga0068856_1000818062 393
3 3300028653 Ga0265323_10002453 Ga0265323_100024537 416
4 3300028654 Ga0265322_10018315 Ga0265322_100183153 416
5 3300028800 Ga0265338_10070040 Ga0265338_100700403 416
6 3300005336 Ga0070680_100130932 Ga0070680_1001309321 419
7 3300005337 Ga0070682_100017333 Ga0070682_1000173331 420
8 3300005530 Ga0070679_100118661 Ga0070679_1001186611 420
9 3300005614 Ga0068856_100060559 Ga0068856_1000605593 420
10 3300013105 Ga0157369_10018352 Ga0157369_100183524 420
11 3300025913 Ga0207695_10022089 Ga0207695_100220893 420
12 3300025949 Ga0207667_10031729 Ga0207667_100317295 420
13 3300037312 Ga0395899_0024346 Ga0395899_0024346_2429_3850 420
14 3300009098 Ga0105245_10000604 Ga0105245_1000060416 421
15 3300037466 Ga0395898_0158741 Ga0395898_0158741_640_2151 425
16 3300005548 Ga0070665_100002828 Ga0070665_10000282811 426
17 3300028379 Ga0268266_10000340 Ga0268266_1000034011 426
18 3300009174 Ga0105241_10003811 Ga0105241_1000381112 427
19 3300025911 Ga0207654_10019236 Ga0207654_100192362 427
20 3300005563 Ga0068855_100002912 Ga0068855_1000029124 428
21 3300025949 Ga0207667_10015060 Ga0207667_100150607 428
22 3300009093 Ga0105240_10207278 Ga0105240_102072782 430
23 3300009174 Ga0105241_10026310 Ga0105241_100263102 430
24 3300009176 Ga0105242_10112756 Ga0105242_101127561 430
25 3300009545 Ga0105237_10004340 Ga0105237_100043403 430
26 3300010375 Ga0105239_10005534 Ga0105239_100055347 430
27 3300013100 Ga0157373_10012164 Ga0157373_100121642 430
28 3300013104 Ga0157370_10134986 Ga0157370_101349862 430
29 3300013307 Ga0157372_10195499 Ga0157372_101954991 430
30 3300005536 Ga0070697_100002029 Ga0070697_10000202910 431
31 3300006846 Ga0075430_100013084 Ga0075430_1000130847 432
32 3300006847 Ga0075431_100001735 Ga0075431_10000173516 432
33 3300006880 Ga0075429_100148389 Ga0075429_1001483891 432
34 3300050508 nmdc:mga09592_135948_c1 nmdc:mga09592_135948_c1_285_1742 432
35 3300050510 nmdc:mga06r32_56535_c1 nmdc:mga06r32_56535_c1_1996_3453 432
36 3300025907 Ga0207645_10103845 Ga0207645_101038452 433
37 3300028800 Ga0265338_10080882 Ga0265338_100808823 433
38 3300006914 Ga0075436_100018907 Ga0075436_1000189072 435
39 3300031249 Ga0265339_10006784 Ga0265339_100067843 435
40 3300031711 Ga0265314_10041413 Ga0265314_100414133 435
41 3300050514 nmdc:mga08x19_4486_c1 nmdc:mga08x19_4486_c1_4729_6183 435
42 3300013105 Ga0157369_10053180 Ga0157369_100531803 438
43 3300013306 Ga0163162_10164069 Ga0163162_101640691 438
44 3300037068 Ga0373925_0196827 Ga0373925_0196827_14_1471 438
45 3300039447 Ga0436361_0529073 Ga0436361_0529073_3375_4808 438
46 3300046683 Ga0495658_0038271 Ga0495658_0038271_656_2113 438
47 3300048905 Ga0496102_0073627 Ga0496102_0073627_92_1612 438
48 3300048915 Ga0496112_0144161 Ga0496112_0144161_757_2277 438
49 3300048918 Ga0496115_0023581 Ga0496115_0023581_1759_3279 438
50 3300046472 Ga0495580_0139249 Ga0495580_0139249_162_1664 439
51 3300048915 Ga0496112_0004056 Ga0496112_0004056_1661_3274 439
52 3300014325 Ga0163163_10003965 Ga0163163_1000396510 440
53 3300014326 Ga0157380_10000015 Ga0157380_1000001567 440
54 3300045976 Ga0466967_0097486 Ga0466967_0097486_962_2485 440
55 3300005548 Ga0070665_100000633 Ga0070665_1000006331 441
56 3300006173 Ga0070716_100027578 Ga0070716_1000275782 441
57 3300009093 Ga0105240_10001655 Ga0105240_1000165510 441
58 3300009093 Ga0105240_10066107 Ga0105240_100661075 441
59 3300009551 Ga0105238_10001738 Ga0105238_100017385 441
60 3300013297 Ga0157378_10007815 Ga0157378_100078155 441
61 3300025913 Ga0207695_10002524 Ga0207695_1000252418 441
62 3300025924 Ga0207694_10000675 Ga0207694_1000067512 441
63 3300028379 Ga0268266_10000208 Ga0268266_1000020835 441
64 3300049823 Ga0501044_0260272 Ga0501044_0260272_168_1586 441
65 3300028794 Ga0307515_10008213 Ga0307515_100082139 442
66 3300009545 Ga0105237_10005512 Ga0105237_1000551210 443
67 3300025939 Ga0207665_10033109 Ga0207665_100331092 443
68 3300028016 Ga0265354_1000302 Ga0265354_10003026 443
69 3300028654 Ga0265322_10004360 Ga0265322_100043603 443
70 3300028666 Ga0265336_10001224 Ga0265336_100012248 443
71 3300031090 Ga0265760_10018875 Ga0265760_100188751 443
72 3300031090 Ga0265760_10019798 Ga0265760_100197981 443
73 3300042876 Ga0451577_0003932 Ga0451577_0003932_9588_11153 443
74 3300044712 Ga0453684_0012324 Ga0453684_0012324_8279_9844 443
75 3300031711 Ga0265314_10086705 Ga0265314_100867052 445
76 3300044658 Ga0466972_0000159 Ga0466972_0000159_1638_3068 445
77 3300044765 Ga0466970_0005193 Ga0466970_0005193_1975_3405 445
78 3300053077 Ga0495601_0129699 Ga0495601_0129699_107_1627 445
79 3300014969 Ga0157376_10102680 Ga0157376_101026802 446
80 3300028800 Ga0265338_10009795 Ga0265338_100097956 447
81 3300044673 Ga0453683_0000718 Ga0453683_0000718_9257_10822 447
82 3300048929 Ga0496126_0011437 Ga0496126_0011437_945_2624 447
83 3300000546 LJNas_1002338 LJNas_10023382 448
84 3300005543 Ga0070672_100221655 Ga0070672_1002216551 448
85 3300025940 Ga0207691_10215216 Ga0207691_102152161 448
86 3300028666 Ga0265336_10029081 Ga0265336_100290812 448
87 3300042876 Ga0451577_0001429 Ga0451577_0001429_10576_12093 448
88 3300044712 Ga0453684_0003579 Ga0453684_0003579_25331_26848 448
89 3300045051 Ga0451576_0003968 Ga0451576_0003968_8182_9699 448
90 3300005546 Ga0070696_100020220 Ga0070696_1000202203 449
91 3300005564 Ga0070664_100130424 Ga0070664_1001304243 449
92 3300025945 Ga0207679_10071286 Ga0207679_100712862 449
93 3300028800 Ga0265338_10018203 Ga0265338_100182038 449
94 iso_pu_bacteria 2842698319 2842701762 449
95 3300005434 Ga0070709_10003043 Ga0070709_100030436 450
96 3300005436 Ga0070713_100036924 Ga0070713_1000369243 450
97 3300005457 Ga0070662_100124321 Ga0070662_1001243211 450
98 3300005563 Ga0068855_100067278 Ga0068855_1000672784 450
99 3300006173 Ga0070716_100000715 Ga0070716_1000007153 450
100 3300013307 Ga0157372_10025101 Ga0157372_100251015 450
101 3300025906 Ga0207699_10001099 Ga0207699_100010992 450
102 3300025939 Ga0207665_10006038 Ga0207665_100060385 450
103 3300026075 Ga0207708_10011532 Ga0207708_100115324 450
104 3300045836 Ga0466958_0050024 Ga0466958_0050024_619_2097 450
105 3300009094 Ga0111539_10135433 Ga0111539_101354332 452
106 3300021361 Ga0213872_10004279 Ga0213872_100042794 452
107 3300039447 Ga0436361_0905464 Ga0436361_0905464_5427_6983 452
108 3300005467 Ga0070706_100001148 Ga0070706_10000114825 453
109 3300005468 Ga0070707_100001991 Ga0070707_10000199114 453
110 3300005471 Ga0070698_100000015 Ga0070698_10000001560 453
111 3300005518 Ga0070699_100016255 Ga0070699_1000162555 453
112 3300005536 Ga0070697_100035373 Ga0070697_1000353732 453
113 3300025910 Ga0207684_10000309 Ga0207684_1000030952 453
114 3300025922 Ga0207646_10001918 Ga0207646_100019186 453
115 3300042876 Ga0451577_0000161 Ga0451577_0000161_16344_17816 454
116 3300049581 Ga0501047_0003095 Ga0501047_0003095_1805_3319 455
117 3300049822 Ga0501035_0140806 Ga0501035_0140806_224_1738 455
118 3300049823 Ga0501044_0001352 Ga0501044_0001352_25355_26869 455
119 iso_pu_bacteria 2738541281 2738745503 455
120 iso_pu_bacteria 2738543032 2739354733 455
121 iso_pu_bacteria 2829745981 2829750460 456
122 iso_pu_bacteria 2861691609 2861692475 456
123 3300005471 Ga0070698_100062291 Ga0070698_1000622913 457
124 3300005457 Ga0070662_100079072 Ga0070662_1000790722 458
125 3300013105 Ga0157369_10000234 Ga0157369_1000023425 463
126 3300025925 Ga0207650_10035482 Ga0207650_100354822 467
127 3300025933 Ga0207706_10158334 Ga0207706_101583341 475
128 3300005288 Ga0065714_10003446 Ga0065714_100034462 508
129 3300017792 Ga0163161_10001453 Ga0163161_1000145314 508
130 3300046512 Ga0495610_0000197 Ga0495610_0000197_59128_60852 512
131 3300032004 Ga0307414_10000680 Ga0307414_100006805 527
132 3300049758 Ga0501241_004089 Ga0501241_004089_1006_2703 527
133 3300013102 Ga0157371_10019599 Ga0157371_100195992 528
134 3300013104 Ga0157370_10043158 Ga0157370_100431582 528
135 iso_pu_bacteria 2738541284 2738763545 530
136 iso_pu_bacteria 2738543023 2739303165 530
137 iso_pu_bacteria 2775506987 2776615016 530
138 iso_pu_bacteria 2852627209 2852629529 530
139 iso_pu_bacteria 2919186247 2919190249 530
140 iso_pu_bacteria 2939664404 2939668530 530
141 2162886007 SwRhRL2b_contig_38688 SwRhRL2b_0041.00006580 534
142 3300005288 Ga0065714_10002525 Ga0065714_100025259 534
143 3300005289 Ga0065704_10000301 Ga0065704_1000030127 534
144 3300013100 Ga0157373_10001684 Ga0157373_100016843 534
145 3300013102 Ga0157371_10001041 Ga0157371_1000104110 534
146 3300013104 Ga0157370_10016415 Ga0157370_100164153 534
147 3300014497 Ga0182008_10000024 Ga0182008_1000002466 534
148 3300031911 Ga0307412_10000030 Ga0307412_10000030130 534
149 3300032004 Ga0307414_10001228 Ga0307414_100012289 534
150 3300053093 Ga0500651_0035192 Ga0500651_0035192_926_2623 534

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13906

AA_permease_C

C-terminus of AA_permease

437

487

0.98

PF00324

AA_permease

Amino acid permease

26

526

0.86

PF13520

AA_permease_2

Amino acid permease

22

478

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8256 1 462
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8195 1 462
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8187 1 462
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8161 1 462
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.7778 24 425
ID Description Score Start End Superfamily
af_Q9VWD3_53_450_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8856 22 433 1.20.1740.10
af_B5DFJ0_32_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8662 21 440 1.20.1740.10
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8574 22 528 1.20.1740.10
af_Q54F04_40_476_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8521 21 463 1.20.1740.10
af_B5DFJ0_32_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8516 21 440 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A4U3BLU4-F1-model_v4 deleted 0.9458 2 430
AF-A0A4Q3E0G5-F1-model_v4 Amino acid permease 0.9343 37 454 GO:0015171
GO:0016020
AF-A0A4U3BLU4-F1-model_v4 deleted 0.9342 2 430
AF-A0A656TPG4-F1-model_v4 deleted 0.9299 4 426
AF-A0A150GZL8-F1-model_v4 Cationic amino acid transporter C-terminal domain-containing protein 0.9147 5 370 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
78.85 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map