F208896

General Info

Members Datasets Scaffolds Average Seq Length
150 106 141 237

Family's Representative Sequence

Representative Sequence 3300025298|Ga0209050_1004335|Ga0209050_10043353
Length 270
Sequence MPRSSWWPRRWKRCIKPASRKTVSTKYRIRILKLDILVLSAHPDDAEISCGGTIAKHVSLGYKVGIVDFTKGELGTRGTPQTRKEEAAEAARIQGIAVRENLGLKDGFFQNDPDHQMAVVRAIRKFQPRIILANAVYDRHIDHGKGASLAYDASFLSGLVKINTQDDHGHAQAPWRPEAFYHSIQSLFIEPDFIVDISGFWETKMAALRAFKTQFYDPNSNEPETYISNPTFLKMIEARAIEFGHAIGTSHGEGYTVRRYPGVNSLFDLR

Samples

Sample ID Description Type Environment
1 2738541283 Pedobacter sp. OK701 Isolate Unclassified
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
4 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
5 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
6 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
7 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
8 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
9 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
10 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
65 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
66 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
81 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
99 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
100 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
101 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
102 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
103 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
106 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.33
Nodule 0
Rhizoplane 0.67
Rhizosphere 65.33
Stem 0
Stem Tuber 0
Unclassified 20.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001619 3300003316 Bacteria 18216
2 rootH1_10026975 3300003316 Bacteria 13102
3 rootH1_10085231 3300003316 Bacteria 3711
4 rootH2_10021864 3300003320 Bacteria 30597
5 rootH2_10114809 3300003320 Bacteria 1867
6 rootH2_10323762 3300003320 Unclassified 1507
7 rootL2_10042221 3300003322 Bacteria 6992
8 rootL2_10088947 3300003322 Bacteria 7123
9 rootL2_10093288 3300003322 Bacteria 5735
10 rootL2_10355726 3300003322 Bacteria 1944
11 rootH1_10000888 3300003323 Bacteria 41861
12 rootH1_10006004 3300003316 Bacteria 6053
13 rootH1_10006004 3300003323 Bacteria 3031
14 rootH1_10007147 3300003323 Bacteria 2044
15 rootH1_10030031 3300003323 Bacteria 2604
16 rootH1_10044857 3300003323 Bacteria 12183
17 rootH1_10154603 3300003323 Bacteria 2455
18 rootH1_10166634 3300003323 Bacteria 5499
19 Ga0055536_1000007 3300003781 Bacteria 345133
20 Ga0055530_10000939 3300003791 Bacteria 23838
21 Ga0065165_1001677 3300005262 Bacteria 22412
22 Ga0070658_10322022 3300005327 Bacteria 1320
23 Ga0070683_100035506 3300005329 Bacteria 4557
24 Ga0070680_100017559 3300005336 Bacteria 5643
25 Ga0070680_100225787 3300005336 Bacteria 1581
26 Ga0070682_100024518 3300005337 Bacteria 3591
27 Ga0070682_100067669 3300005337 Bacteria 2275
28 Ga0070694_100502219 3300005444 Bacteria 965
29 Ga0070681_10074999 3300005458 Bacteria 3343
30 Ga0070679_100022984 3300005530 Bacteria 6098
31 Ga0070679_100104023 3300005530 Bacteria 2826
32 Ga0068853_100014148 3300005539 Bacteria 6532
33 Ga0070665_100373805 3300005548 Bacteria 1432
34 Ga0068855_100307716 3300005563 Bacteria 1754
35 Ga0068854_100264100 3300005578 Bacteria 1379
36 Ga0068856_100047618 3300005614 Unclassified 4224
37 Ga0068856_100150883 3300005614 Bacteria 2333
38 Ga0068852_100002617 3300005616 Bacteria 12436
39 Ga0068852_100160295 3300005616 Bacteria 2100
40 Ga0068863_100161189 3300005841 Bacteria 2149
41 Ga0068862_100836151 3300005844 Bacteria 901
42 Ga0075366_10240643 3300006195 Bacteria 1103
43 Ga0075428_100036856 3300006844 Bacteria 5385
44 Ga0075428_100497035 3300006844 Bacteria 1305
45 Ga0105240_10045216 3300009093 Bacteria 5587
46 Ga0111539_10005241 3300009094 Bacteria 16795
47 Ga0111539_10009709 3300009094 Bacteria 12145
48 Ga0105241_10003646 3300009174 Bacteria 11434
49 Ga0105237_10004063 3300009545 Bacteria 17068
50 Ga0105249_10354803 3300009553 Bacteria 1486
51 Ga0105239_10016717 3300010375 Bacteria 8109
52 Ga0157373_10008177 3300013100 Bacteria 7781
53 Ga0157373_10012922 3300013100 Bacteria 6130
54 Ga0157371_10018020 3300013102 Bacteria 5230
55 Ga0157370_10004884 3300013104 Bacteria 15210
56 Ga0157370_10042224 3300013104 Bacteria 4396
57 Ga0157370_10062186 3300013104 Bacteria 3541
58 Ga0157369_10039950 3300013105 Bacteria 5125
59 Ga0157369_10079397 3300013105 Bacteria 3514
60 Ga0157374_10112554 3300013296 Bacteria 2619
61 Ga0157372_10020843 3300013307 Bacteria 7078
62 Ga0157372_10100148 3300013307 Bacteria 3306
63 Ga0157380_10000443 3300014326 Bacteria 25341
64 Ga0157380_10297994 3300014326 Bacteria 1484
65 Ga0182008_10000105 3300014497 Bacteria 65344
66 Ga0182006_1000128 3300015261 Bacteria 81425
67 Ga0163161_10010805 3300017792 Bacteria 6327
68 Ga0163161_10043956 3300017792 Bacteria 3216
69 Ga0209676_1000058 3300025292 Bacteria 345185
70 Ga0209050_1000054 3300025298 Bacteria 345186
71 Ga0209050_1004335 3300025298 Bacteria 9674
72 Ga0209050_1017465 3300025298 Bacteria 2858
73 Ga0207654_10005565 3300025911 Bacteria 6372
74 Ga0207707_10057950 3300025912 Bacteria 3371
75 Ga0207695_10081895 3300025913 Bacteria 3265
76 Ga0207671_10039925 3300025914 Bacteria 3475
77 Ga0207660_10007868 3300025917 Bacteria 6900
78 Ga0207652_10021750 3300025921 Bacteria 5296
79 Ga0207652_10205056 3300025921 Bacteria 1774
80 Ga0207667_10058557 3300025949 Unclassified 4040
81 Ga0207667_10107255 3300025949 Bacteria 2881
82 Ga0207667_10505248 3300025949 Bacteria 1226
83 Ga0207640_10241503 3300025981 Bacteria 1396
84 Ga0207702_10078590 3300026078 Unclassified 2857
85 Ga0207702_10134380 3300026078 Bacteria 2230
86 Ga0207698_10001651 3300026142 Bacteria 13013
87 Ga0207698_10110969 3300026142 Bacteria 2298
88 Ga0307515_10000016 3300028794 Bacteria 554870
89 Ga0316177_1161038 3300030731 Bacteria 16906
90 Ga0316176_1147530 3300030732 Bacteria 17762
91 Ga0316183_1043120 3300030742 Bacteria 33823
92 Ga0316181_1288056 3300030744 Bacteria 10042
93 Ga0316182_1092957 3300030745 Bacteria 1245
94 Ga0307513_10275807 3300031456 Bacteria 1462
95 Ga0307513_10559597 3300031456 Bacteria 855
96 Ga0307509_10029534 3300031507 Bacteria 6083
97 Ga0307509_10072733 3300031507 Bacteria 3581
98 Ga0307408_100000404 3300031548 Bacteria 38790
99 Ga0307408_100003726 3300031548 Bacteria 10377
100 Ga0307514_10062911 3300031649 Bacteria 2820
101 Ga0316579_10134978 3300031691 Bacteria 1189
102 Ga0307412_10003125 3300031911 Bacteria 9201
103 Ga0307412_10767192 3300031911 Bacteria 834
104 Ga0307409_100265207 3300031995 Bacteria 1578
105 Ga0307416_100039016 3300032002 Bacteria 3671
106 Ga0307414_10000639 3300032004 Bacteria 17958
107 Ga0307411_10456993 3300032005 Bacteria 1070
108 Ga0395901_0191770 3300038443 Bacteria 2143
109 Ga0451851_0852592 3300041507 Unclassified 1326
110 Ga0439445_0073575 3300042004 Bacteria 948
111 Ga0451577_0007369 3300042876 Bacteria 10800
112 Ga0451577_0068581 3300042876 Bacteria 3163
113 Ga0453684_0004286 3300044712 Bacteria 30426
114 Ga0453684_0649734 3300044712 Bacteria 1151
115 Ga0451576_0083792 3300045051 Bacteria 3317
116 Ga0495638_0000020 3300046460 Bacteria 372434
117 Ga0495643_0001392 3300046522 Bacteria 22592
118 Ga0496115_0014368 3300048918 Bacteria 5994
119 Ga0496122_0000479 3300048925 Bacteria 83186
120 Ga0496123_0013582 3300048926 Bacteria 6819
121 Ga0496125_0140299 3300048928 Bacteria 1682
122 Ga0501300_006660 3300049523 Bacteria 1697
123 Ga0501036_0166314 3300049572 Bacteria 1859
124 Ga0501047_0198780 3300049581 Bacteria 1866
125 Ga0501236_005692 3300049670 Bacteria 1512
126 Ga0501035_0020082 3300049822 Bacteria 6135
127 nmdc:mga09592_269930_c1 3300050508 Bacteria 1475
128 nmdc:mga08y16_139827_c1 3300050511 Bacteria 2517
129 nmdc:mga08y16_28509_c1 3300050511 Bacteria 5886
130 Ga0500583_0179416 3300053092 Bacteria 1055
131 Ga0500556_0032050 3300053104 Bacteria 1793
132 Ga0500562_027412 3300053108 Bacteria 1495
133 Ga0500642_0266249 3300053130 Bacteria 783
134 Ga0500655_016433 3300053133 Bacteria 1363
135 Ga0500604_0000207 3300053151 Bacteria 16825
136 Ga0500616_0000007 3300053153 Bacteria 836875
137 Ga0500616_0019175 3300053153 Bacteria 3857
138 Ga0500622_0000031 3300053156 Bacteria 207165
139 Ga0500622_0000039 3300053156 Bacteria 170859
140 Ga0500622_0152982 3300053156 Bacteria 1088
141 Ga0500627_0085137 3300053158 Bacteria 1411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100035506 Ga0070683_1000355063 213
2 3300005336 Ga0070680_100225787 Ga0070680_1002257871 213
3 3300005337 Ga0070682_100024518 Ga0070682_1000245184 213
4 3300005458 Ga0070681_10074999 Ga0070681_100749993 213
5 3300005530 Ga0070679_100022984 Ga0070679_1000229843 213
6 3300005539 Ga0068853_100014148 Ga0068853_1000141482 213
7 3300005578 Ga0068854_100264100 Ga0068854_1002641002 213
8 3300005614 Ga0068856_100150883 Ga0068856_1001508832 213
9 3300005616 Ga0068852_100160295 Ga0068852_1001602952 213
10 3300009093 Ga0105240_10045216 Ga0105240_100452163 213
11 3300009174 Ga0105241_10003646 Ga0105241_100036466 213
12 3300010375 Ga0105239_10016717 Ga0105239_100167172 213
13 3300013100 Ga0157373_10012922 Ga0157373_100129225 213
14 3300013102 Ga0157371_10018020 Ga0157371_100180203 213
15 3300013105 Ga0157369_10079397 Ga0157369_100793974 213
16 3300013296 Ga0157374_10112554 Ga0157374_101125543 213
17 3300013307 Ga0157372_10100148 Ga0157372_101001484 213
18 3300025911 Ga0207654_10005565 Ga0207654_100055653 213
19 3300025912 Ga0207707_10057950 Ga0207707_100579501 213
20 3300025913 Ga0207695_10081895 Ga0207695_100818954 213
21 3300025921 Ga0207652_10205056 Ga0207652_102050563 213
22 3300025949 Ga0207667_10107255 Ga0207667_101072552 213
23 3300025981 Ga0207640_10241503 Ga0207640_102415032 213
24 3300026078 Ga0207702_10134380 Ga0207702_101343802 213
25 3300026142 Ga0207698_10110969 Ga0207698_101109692 213
26 3300006195 Ga0075366_10240643 Ga0075366_102406432 216
27 3300003323 rootH1_10007147 rootH1_100071471 217
28 3300005548 Ga0070665_100373805 Ga0070665_1003738052 217
29 3300009553 Ga0105249_10354803 Ga0105249_103548031 217
30 iso_pu_bacteria 2738541283 2738758056 218
31 iso_pu_bacteria 2842903701 2842903932 218
32 iso_pu_bacteria 2852627209 2852629994 218
33 iso_pu_bacteria 2902048731 2902049929 218
34 iso_pu_bacteria 2910245624 2910247634 218
35 iso_pu_bacteria 2919186247 2919188283 218
36 iso_pu_bacteria 2939664404 2939664450 218
37 iso_pu_bacteria 2965320100 2965320452 218
38 iso_pu_bacteria 2739367866 2740032909 219
39 iso_pu_bacteria 2884634485 2884635124 219
40 3300003316 rootH1_10026975 rootH1_100269755 222
41 3300003320 rootH2_10114809 rootH2_101148092 222
42 3300003323 rootH1_10000888 rootH1_100008883 222
43 3300003323 rootH1_10030031 rootH1_100300313 222
44 3300003323 rootH1_10044857 rootH1_1004485712 222
45 3300003323 rootH1_10154603 rootH1_101546032 222
46 3300003781 Ga0055536_1000007 Ga0055536_1000007245 222
47 3300003791 Ga0055530_10000939 Ga0055530_1000093914 222
48 3300005337 Ga0070682_100067669 Ga0070682_1000676692 222
49 3300005563 Ga0068855_100307716 Ga0068855_1003077162 222
50 3300005614 Ga0068856_100047618 Ga0068856_1000476184 222
51 3300005841 Ga0068863_100161189 Ga0068863_1001611892 222
52 3300005844 Ga0068862_100836151 Ga0068862_1008361512 222
53 3300009545 Ga0105237_10004063 Ga0105237_1000406315 222
54 3300013104 Ga0157370_10004884 Ga0157370_1000488412 222
55 3300013104 Ga0157370_10062186 Ga0157370_100621864 222
56 3300013105 Ga0157369_10039950 Ga0157369_100399502 222
57 3300013307 Ga0157372_10020843 Ga0157372_100208436 222
58 3300014497 Ga0182008_10000105 Ga0182008_1000010533 222
59 3300015261 Ga0182006_1000128 Ga0182006_100012879 222
60 3300017792 Ga0163161_10010805 Ga0163161_100108052 222
61 3300017792 Ga0163161_10043956 Ga0163161_100439562 222
62 3300025292 Ga0209676_1000058 Ga0209676_1000058238 222
63 3300025298 Ga0209050_1000054 Ga0209050_1000054238 222
64 3300025914 Ga0207671_10039925 Ga0207671_100399253 222
65 3300025949 Ga0207667_10505248 Ga0207667_105052482 222
66 3300026078 Ga0207702_10078590 Ga0207702_100785903 222
67 3300030731 Ga0316177_1161038 Ga0316177_116103813 222
68 3300030732 Ga0316176_1147530 Ga0316176_11475309 222
69 3300030742 Ga0316183_1043120 Ga0316183_104312031 222
70 3300030744 Ga0316181_1288056 Ga0316181_12880563 222
71 3300030745 Ga0316182_1092957 Ga0316182_10929572 222
72 3300031456 Ga0307513_10275807 Ga0307513_102758072 222
73 3300031507 Ga0307509_10029534 Ga0307509_100295344 222
74 3300031507 Ga0307509_10072733 Ga0307509_100727332 222
75 3300031548 Ga0307408_100000404 Ga0307408_10000040433 222
76 3300031548 Ga0307408_100003726 Ga0307408_1000037269 222
77 3300031911 Ga0307412_10003125 Ga0307412_100031258 222
78 3300031911 Ga0307412_10767192 Ga0307412_107671921 222
79 3300032004 Ga0307414_10000639 Ga0307414_100006397 222
80 3300038443 Ga0395901_0191770 Ga0395901_0191770_722_1438 222
81 3300042876 Ga0451577_0007369 Ga0451577_0007369_4338_5063 222
82 3300044712 Ga0453684_0004286 Ga0453684_0004286_10036_10761 222
83 3300046522 Ga0495643_0001392 Ga0495643_0001392_10963_11679 222
84 3300048918 Ga0496115_0014368 Ga0496115_0014368_344_1060 222
85 3300048925 Ga0496122_0000479 Ga0496122_0000479_48645_49361 222
86 3300048926 Ga0496123_0013582 Ga0496123_0013582_2831_3547 222
87 3300048928 Ga0496125_0140299 Ga0496125_0140299_864_1580 222
88 3300049572 Ga0501036_0166314 Ga0501036_0166314_175_891 222
89 3300049581 Ga0501047_0198780 Ga0501047_0198780_56_772 222
90 3300049670 Ga0501236_005692 Ga0501236_005692_47_766 222
91 3300049822 Ga0501035_0020082 Ga0501035_0020082_3583_4299 222
92 3300003316 rootH1_10001619 rootH1_100016197 223
93 3300003316 rootH1_10085231 rootH1_100852314 223
94 3300003320 rootH2_10021864 rootH2_100218644 223
95 3300003320 rootH2_10323762 rootH2_103237622 223
96 3300003322 rootL2_10042221 rootL2_100422212 223
97 3300003322 rootL2_10088947 rootL2_100889475 223
98 3300003322 rootL2_10093288 rootL2_100932883 223
99 3300003322 rootL2_10355726 rootL2_103557262 223
100 3300003323 rootH1_10006004 rootH1_100060044 223
101 3300003323 rootH1_10166634 rootH1_101666344 223
102 3300005262 Ga0065165_1001677 Ga0065165_100167711 223
103 3300005327 Ga0070658_10322022 Ga0070658_103220222 223
104 3300005336 Ga0070680_100017559 Ga0070680_1000175594 223
105 3300005444 Ga0070694_100502219 Ga0070694_1005022191 223
106 3300005530 Ga0070679_100104023 Ga0070679_1001040233 223
107 3300005616 Ga0068852_100002617 Ga0068852_10000261711 223
108 3300006844 Ga0075428_100036856 Ga0075428_1000368564 223
109 3300006844 Ga0075428_100497035 Ga0075428_1004970352 223
110 3300009094 Ga0111539_10005241 Ga0111539_1000524115 223
111 3300009094 Ga0111539_10009709 Ga0111539_100097096 223
112 3300013100 Ga0157373_10008177 Ga0157373_100081773 223
113 3300013104 Ga0157370_10042224 Ga0157370_100422241 223
114 3300014326 Ga0157380_10000443 Ga0157380_100004438 223
115 3300014326 Ga0157380_10297994 Ga0157380_102979942 223
116 3300025298 Ga0209050_1004335 Ga0209050_10043353 223
117 3300025298 Ga0209050_1017465 Ga0209050_10174653 223
118 3300025917 Ga0207660_10007868 Ga0207660_100078684 223
119 3300025921 Ga0207652_10021750 Ga0207652_100217503 223
120 3300025949 Ga0207667_10058557 Ga0207667_100585574 223
121 3300026142 Ga0207698_10001651 Ga0207698_100016512 223
122 3300028794 Ga0307515_10000016 Ga0307515_10000016364 223
123 3300031456 Ga0307513_10559597 Ga0307513_105595971 223
124 3300031649 Ga0307514_10062911 Ga0307514_100629113 223
125 3300031691 Ga0316579_10134978 Ga0316579_101349781 223
126 3300031995 Ga0307409_100265207 Ga0307409_1002652072 223
127 3300032002 Ga0307416_100039016 Ga0307416_1000390162 223
128 3300032005 Ga0307411_10456993 Ga0307411_104569931 223
129 3300041507 Ga0451851_0852592 Ga0451851_0852592_433_1152 223
130 3300042004 Ga0439445_0073575 Ga0439445_0073575_207_926 223
131 3300042876 Ga0451577_0068581 Ga0451577_0068581_242_967 223
132 3300044712 Ga0453684_0649734 Ga0453684_0649734_395_1120 223
133 3300045051 Ga0451576_0083792 Ga0451576_0083792_1687_2412 223
134 3300046460 Ga0495638_0000020 Ga0495638_0000020_97599_98318 223
135 3300049523 Ga0501300_006660 Ga0501300_006660_195_914 223
136 3300050508 nmdc:mga09592_269930_c1 nmdc:mga09592_269930_c1_725_1444 223
137 3300050511 nmdc:mga08y16_139827_c1 nmdc:mga08y16_139827_c1_1680_2399 223
138 3300050511 nmdc:mga08y16_28509_c1 nmdc:mga08y16_28509_c1_2429_3148 223
139 3300053092 Ga0500583_0179416 Ga0500583_0179416_85_804 223
140 3300053104 Ga0500556_0032050 Ga0500556_0032050_59_778 223
141 3300053108 Ga0500562_027412 Ga0500562_027412_371_1090 223
142 3300053130 Ga0500642_0266249 Ga0500642_0266249_17_736 223
143 3300053133 Ga0500655_016433 Ga0500655_016433_13_732 223
144 3300053151 Ga0500604_0000207 Ga0500604_0000207_5642_6361 223
145 3300053153 Ga0500616_0000007 Ga0500616_0000007_828694_829413 223
146 3300053153 Ga0500616_0019175 Ga0500616_0019175_1431_2153 223
147 3300053156 Ga0500622_0000031 Ga0500622_0000031_72003_72722 223
148 3300053156 Ga0500622_0000039 Ga0500622_0000039_89413_90132 223
149 3300053156 Ga0500622_0152982 Ga0500622_0152982_46_765 223
150 3300053158 Ga0500627_0085137 Ga0500627_0085137_680_1399 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

37

154

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.908 2 213
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.8999 1 212
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8814 3 212
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8733 3 212
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.8607 2 213
ID Description Score Start End Superfamily
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8999 1 212 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8814 3 212 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8529 1 212 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8456 5 210 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8343 3 212 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A519VLX6-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9812 47 220 GO:0019213
GO:0071793
AF-A0A381TJ31-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9745 45 220 GO:0019213
GO:0071793
AF-A0A2A5XKE9-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9724 77 220
AF-A0A3B8IYM9-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9702 1 220 GO:0016811
GO:0019213
GO:0071793
AF-A0A4Q3B4X0-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9694 45 223 GO:0019213
GO:0071793

Feature Viewer

pLDDT pTM Quality
92.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map