F207324

General Info

Members Datasets Scaffolds Average Seq Length
149 124 144 413

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0012533|Ga0495655_0012533_192_1679
Length 485
Sequence MVWEAFQRVKANKGAPGADGVTIEQYEKNLSRNLFKLWNRMSSGSYFPPAVKAVEIPKAGGKGIRVLGVPTVSDRIAQTVAAMYLERRVEPVFHPDSYGYRPRRSALDAVEQCRRRCWRSDWVVDLDIRAFFDSVDHELMLKAVERHIDADGKWVLLYVKRWLVAPLAKADGSVQQRNRGTPQGSAISPVLANLYLHYAFDAWLVREFPQVTFERYCDDAVIHCGSERQARLVRDALAQRLAQVGLELHPDKTRIVYCKDADRRGSYEHTAFTFLGYTFRPRLAKNRFGKHFVSFLPAVSKEAIKAMGKEMRSWRIAQRSDKSLMDLARMFNSIVQGWINYYGRFYKSMLYPLLRRINRMLVSWACQKYKRLRRREKRAGELLAGAARRYPNMFAHWRFGLKPDGWAMGYSPWTPRPPRRSPQSRRARVGDARSEMAGLLPTSAAVARSAHRNAPYHINELTFRKEPSDSQRAIRTQKITISPGL

Samples

Sample ID Description Type Environment
1 2671180195 Frankia sp. CcI49 Isolate Nodule
2 2773857922 Frankia sp. CcI49 Isolate Nodule
3 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
4 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
5 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
59 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
117 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
118 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
121 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
122 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0.67
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 1.34
Rhizoplane 1.34
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002016 3300003203 Bacteria 9592
2 rootH1_10044251 3300003316 Bacteria 2112
3 rootL2_10032078 3300003322 Bacteria 3874
4 Ga0070658_10023824 3300005327 Bacteria 4910
5 Ga0070683_100029207 3300005329 Bacteria 4990
6 Ga0070687_100087642 3300005343 Bacteria 1714
7 Ga0070678_100117778 3300005456 Bacteria 2089
8 Ga0070681_10107719 3300005458 Bacteria 2727
9 Ga0070707_100157969 3300005468 Bacteria 2209
10 Ga0070698_100323559 3300005471 Bacteria 1473
11 Ga0070699_100155915 3300005518 Bacteria 2021
12 Ga0070679_100172386 3300005530 Bacteria 2136
13 Ga0070684_100007925 3300005535 Bacteria 8289
14 Ga0068863_100219684 3300005841 Bacteria 1831
15 Ga0068858_100130216 3300005842 Bacteria 2359
16 Ga0081455_10019952 3300005937 Bacteria 6328
17 Ga0081540_1040917 3300005983 Bacteria 2409
18 Ga0081539_10000263 3300005985 Bacteria 120622
19 Ga0081539_10018412 3300005985 Bacteria 4848
20 Ga0075428_100204998 3300006844 Bacteria 2131
21 Ga0075430_100115408 3300006846 Bacteria 2237
22 Ga0075435_100094049 3300007076 Bacteria 2477
23 Ga0111539_10095821 3300009094 Bacteria 3485
24 Ga0111539_10321110 3300009094 Bacteria 1802
25 Ga0114129_10111843 3300009147 Bacteria 3768
26 Ga0105239_10080157 3300010375 Bacteria 3592
27 Ga0105239_10472295 3300010375 Bacteria 1424
28 Ga0157321_1000491 3300012487 Bacteria 1797
29 Ga0157375_10217222 3300013308 Bacteria 2070
30 Ga0163163_10079455 3300014325 Bacteria 3278
31 Ga0163163_10193933 3300014325 Bacteria 2079
32 Ga0206350_10636006 3300020080 Bacteria 2123
33 Ga0207705_10028767 3300025909 Bacteria 3961
34 Ga0207684_10127706 3300025910 Bacteria 2182
35 Ga0207652_10001454 3300025921 Bacteria 20971
36 Ga0207646_10180187 3300025922 Bacteria 1908
37 Ga0207665_10142194 3300025939 Bacteria 1712
38 Ga0207661_10000736 3300025944 Bacteria 21239
39 Ga0207641_10190396 3300026088 Bacteria 1885
40 Ga0207428_10044443 3300027907 Bacteria 3584
41 Ga0307517_10117986 3300028786 Bacteria 1978
42 Ga0307515_10114619 3300028794 Bacteria 3113
43 Ga0307511_10105963 3300030521 Bacteria 1817
44 Ga0265331_10015213 3300031250 Bacteria 4070
45 Ga0307513_10134965 3300031456 Bacteria 2405
46 Ga0307509_10022878 3300031507 Bacteria 7030
47 Ga0307509_10065197 3300031507 Bacteria 3827
48 Ga0307408_100060568 3300031548 Bacteria 2759
49 Ga0307508_10104799 3300031616 Bacteria 2425
50 Ga0307508_10130891 3300031616 Bacteria 2112
51 Ga0307516_10101038 3300031730 Bacteria 2699
52 Ga0307410_10090684 3300031852 Bacteria 2168
53 Ga0307406_10096678 3300031901 Bacteria 2001
54 Ga0307409_100086623 3300031995 Bacteria 2550
55 Ga0307409_100151651 3300031995 Bacteria 2013
56 Ga0307414_10147250 3300032004 Bacteria 1852
57 Ga0307411_10104675 3300032005 Bacteria 2010
58 Ga0307415_100173452 3300032126 Bacteria 1684
59 Ga0307507_10120008 3300033179 Bacteria 2107
60 Ga0307510_10107131 3300033180 Bacteria 2555
61 Ga0316214_1000245 3300033545 Bacteria 5139
62 Ga0373937_0205472 3300036401 Bacteria 1852
63 Ga0395898_0214629 3300037466 Bacteria 1835
64 Ga0395905_0155866 3300037471 Bacteria 2148
65 Ga0395905_0240731 3300037471 Bacteria 1691
66 Ga0436361_0414308 3300039447 Bacteria 3261
67 Ga0436363_0522372 3300039450 Bacteria 2299
68 Ga0451577_0160755 3300042876 Bacteria 2022
69 Ga0439440_0021635 3300042993 Bacteria 1451
70 Ga0453683_0093510 3300044673 Bacteria 1885
71 Ga0466964_0027957 3300044706 Bacteria 2218
72 Ga0453684_0122476 3300044712 Bacteria 3137
73 Ga0466960_0048015 3300044901 Bacteria 2050
74 Ga0451576_0299693 3300045051 Bacteria 1681
75 Ga0466967_0064478 3300045976 Bacteria 3258
76 Ga0495592_0106048 3300046454 Bacteria 1995
77 Ga0495603_0021225 3300046455 Bacteria 3931
78 Ga0495603_0048347 3300046455 Bacteria 2532
79 Ga0495603_0077080 3300046455 Bacteria 1956
80 Ga0495603_0091144 3300046455 Bacteria 1782
81 Ga0495603_0102090 3300046455 Bacteria 1674
82 Ga0495603_0146129 3300046455 Bacteria 1374
83 Ga0495629_0076877 3300046459 Bacteria 2330
84 Ga0495629_0126690 3300046459 Bacteria 1779
85 Ga0495641_0071326 3300046461 Bacteria 1560
86 Ga0495580_0110563 3300046472 Bacteria 1909
87 Ga0495605_0085878 3300046474 Bacteria 1464
88 Ga0495605_0096243 3300046474 Bacteria 1366
89 Ga0495585_0029629 3300046492 Bacteria 3115
90 Ga0495585_0101149 3300046492 Bacteria 1541
91 Ga0495594_0057093 3300046499 Bacteria 2155
92 Ga0495594_0066353 3300046499 Bacteria 2002
93 Ga0495594_0166503 3300046499 Bacteria 1253
94 Ga0495583_0024790 3300046506 Bacteria 3007
95 Ga0495583_0042151 3300046506 Bacteria 2134
96 Ga0495606_0008843 3300046507 Bacteria 8632
97 Ga0495620_0020782 3300046515 Bacteria 3199
98 Ga0495666_0020419 3300046526 Bacteria 3282
99 Ga0495666_0026445 3300046526 Bacteria 2860
100 Ga0495587_0070105 3300046536 Bacteria 2041
101 Ga0495622_0016509 3300046557 Bacteria 3439
102 Ga0495668_0010740 3300046616 Bacteria 5528
103 Ga0495634_0210138 3300046642 Bacteria 1205
104 Ga0495611_0037599 3300046648 Bacteria 2151
105 Ga0495625_0054129 3300046660 Bacteria 2867
106 Ga0495588_0067079 3300046674 Bacteria 1862
107 Ga0495657_0137954 3300046675 Bacteria 1522
108 Ga0495623_0104517 3300046679 Bacteria 1722
109 Ga0495658_0039521 3300046683 Bacteria 2618
110 Ga0495658_0167874 3300046683 Bacteria 1357
111 Ga0495613_0051115 3300046689 Bacteria 3047
112 Ga0495624_0103599 3300046690 Bacteria 1751
113 Ga0495600_0174730 3300046809 Bacteria 1385
114 Ga0495660_0005677 3300046810 Bacteria 7457
115 Ga0495660_0051771 3300046810 Bacteria 2233
116 Ga0495581_0079243 3300047315 Bacteria 1901
117 Ga0495581_0088061 3300047315 Bacteria 1800
118 Ga0495676_0012644 3300047321 Bacteria 7597
119 Ga0495680_0202345 3300047322 Bacteria 1424
120 Ga0495683_0022694 3300047323 Bacteria 3227
121 Ga0495685_035981 3300047447 Bacteria 1700
122 Ga0495593_0061320 3300047673 Bacteria 1967
123 Ga0495602_0100479 3300048088 Bacteria 2375
124 Ga0496102_0008135 3300048905 Bacteria 8974
125 Ga0496106_0017687 3300048909 Bacteria 5271
126 Ga0496116_0002207 3300048919 Bacteria 20736
127 Ga0496117_0086590 3300048920 Bacteria 2035
128 Ga0496118_0043157 3300048921 Bacteria 3549
129 Ga0496121_0003865 3300048924 Bacteria 20823
130 Ga0501070_0039539 3300049586 Bacteria 3934
131 nmdc:mga09592_113402_c1 3300050508 Bacteria 2326
132 nmdc:mga0qj67_108130_c1 3300050509 Bacteria 2244
133 nmdc:mga0qj67_129976_c1 3300050509 Bacteria 2040
134 nmdc:mga0qj67_22738_c1 3300050509 Bacteria 4817
135 nmdc:mga08y16_26894_c1 3300050511 Bacteria 6063
136 Ga0495612_0002853 3300053078 Bacteria 7147
137 Ga0500635_0004981 3300053080 Bacteria 3456
138 Ga0495655_0012533 3300053083 Bacteria 1730
139 Ga0500644_0009708 3300053088 Bacteria 2583
140 Ga0500658_0018780 3300053134 Bacteria 2597
141 Ga0500600_0059395 3300053149 Bacteria 2137
142 Ga0590071_004086 3300059421 Bacteria 3561
143 Ga0590074_006636 3300059423 Bacteria 1921
144 Ga0590077_010818 3300059426 Bacteria 1879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0166503 Ga0495594_0166503_15_1100 341
2 3300046642 Ga0495634_0210138 Ga0495634_0210138_80_1162 344
3 3300046683 Ga0495658_0167874 Ga0495658_0167874_233_1330 360
4 3300046474 Ga0495605_0096243 Ga0495605_0096243_35_1213 373
5 3300046679 Ga0495623_0104517 Ga0495623_0104517_323_1495 385
6 3300050509 nmdc:mga0qj67_129976_c1 nmdc:mga0qj67_129976_c1_79_1245 386
7 3300005841 Ga0068863_100219684 Ga0068863_1002196841 387
8 3300005983 Ga0081540_1040917 Ga0081540_10409172 387
9 3300014325 Ga0163163_10193933 Ga0163163_101939331 387
10 3300026088 Ga0207641_10190396 Ga0207641_101903961 387
11 3300037471 Ga0395905_0240731 Ga0395905_0240731_138_1310 389
12 3300042876 Ga0451577_0160755 Ga0451577_0160755_656_1909 391
13 3300044673 Ga0453683_0093510 Ga0453683_0093510_558_1811 391
14 3300044712 Ga0453684_0122476 Ga0453684_0122476_635_1888 391
15 3300014325 Ga0163163_10079455 Ga0163163_100794556 392
16 3300020080 Ga0206350_10636006 Ga0206350_106360061 392
17 3300048924 Ga0496121_0003865 Ga0496121_0003865_1865_3106 392
18 3300045051 Ga0451576_0299693 Ga0451576_0299693_230_1483 393
19 3300006844 Ga0075428_100204998 Ga0075428_1002049982 396
20 3300009094 Ga0111539_10095821 Ga0111539_100958212 396
21 3300027907 Ga0207428_10044443 Ga0207428_100444432 396
22 3300031507 Ga0307509_10022878 Ga0307509_100228787 396
23 3300046455 Ga0495603_0021225 Ga0495603_0021225_1952_3202 396
24 3300046455 Ga0495603_0146129 Ga0495603_0146129_54_1304 396
25 3300046459 Ga0495629_0126690 Ga0495629_0126690_95_1345 396
26 3300047315 Ga0495581_0079243 Ga0495581_0079243_475_1725 396
27 3300047321 Ga0495676_0012644 Ga0495676_0012644_6171_7421 396
28 3300050511 nmdc:mga08y16_26894_c1 nmdc:mga08y16_26894_c1_222_1472 396
29 3300046455 Ga0495603_0077080 Ga0495603_0077080_601_1803 397
30 3300046499 Ga0495594_0066353 Ga0495594_0066353_93_1295 397
31 3300046674 Ga0495588_0067079 Ga0495588_0067079_473_1675 397
32 3300046683 Ga0495658_0039521 Ga0495658_0039521_723_1925 397
33 3300046455 Ga0495603_0048347 Ga0495603_0048347_702_1952 400
34 3300046492 Ga0495585_0101149 Ga0495585_0101149_162_1412 400
35 3300046499 Ga0495594_0057093 Ga0495594_0057093_772_2022 400
36 3300046506 Ga0495583_0042151 Ga0495583_0042151_482_1732 400
37 3300046526 Ga0495666_0020419 Ga0495666_0020419_1908_3158 400
38 3300046557 Ga0495622_0016509 Ga0495622_0016509_751_2001 400
39 3300046648 Ga0495611_0037599 Ga0495611_0037599_203_1453 400
40 3300046810 Ga0495660_0051771 Ga0495660_0051771_861_2111 400
41 3300047447 Ga0495685_035981 Ga0495685_035981_141_1391 400
42 3300053080 Ga0500635_0004981 Ga0500635_0004981_1223_2428 401
43 3300006846 Ga0075430_100115408 Ga0075430_1001154081 403
44 3300039447 Ga0436361_0414308 Ga0436361_0414308_1796_3037 403
45 3300050509 nmdc:mga0qj67_108130_c1 nmdc:mga0qj67_108130_c1_783_2045 403
46 3300005343 Ga0070687_100087642 Ga0070687_1000876421 404
47 3300044706 Ga0466964_0027957 Ga0466964_0027957_346_1608 405
48 3300044901 Ga0466960_0048015 Ga0466960_0048015_282_1544 405
49 3300045976 Ga0466967_0064478 Ga0466967_0064478_511_1773 405
50 3300053083 Ga0495655_0012533 Ga0495655_0012533_192_1679 405
51 3300059421 Ga0590071_004086 Ga0590071_004086_2189_3451 405
52 3300059423 Ga0590074_006636 Ga0590074_006636_49_1311 405
53 3300059426 Ga0590077_010818 Ga0590077_010818_503_1765 405
54 3300005468 Ga0070707_100157969 Ga0070707_1001579692 408
55 3300005471 Ga0070698_100323559 Ga0070698_1003235592 408
56 3300005518 Ga0070699_100155915 Ga0070699_1001559152 408
57 3300025922 Ga0207646_10180187 Ga0207646_101801871 408
58 3300036401 Ga0373937_0205472 Ga0373937_0205472_504_1745 408
59 3300012487 Ga0157321_1000491 Ga0157321_10004912 409
60 iso_pu_bacteria 2775506925 2776377754 410
61 iso_pu_bacteria 2863067949 2863074912 410
62 3300007076 Ga0075435_100094049 Ga0075435_1000940493 411
63 3300009094 Ga0111539_10321110 Ga0111539_103211102 411
64 3300010375 Ga0105239_10080157 Ga0105239_100801572 411
65 3300031250 Ga0265331_10015213 Ga0265331_100152132 411
66 3300031852 Ga0307410_10090684 Ga0307410_100906841 411
67 3300046472 Ga0495580_0110563 Ga0495580_0110563_624_1874 411
68 3300046526 Ga0495666_0026445 Ga0495666_0026445_1226_2476 411
69 3300046675 Ga0495657_0137954 Ga0495657_0137954_150_1400 411
70 3300005456 Ga0070678_100117778 Ga0070678_1001177782 412
71 3300013308 Ga0157375_10217222 Ga0157375_102172221 412
72 3300031995 Ga0307409_100151651 Ga0307409_1001516511 412
73 3300032126 Ga0307415_100173452 Ga0307415_1001734521 412
74 3300046455 Ga0495603_0091144 Ga0495603_0091144_430_1686 412
75 3300048905 Ga0496102_0008135 Ga0496102_0008135_849_2120 412
76 3300048919 Ga0496116_0002207 Ga0496116_0002207_6709_7980 412
77 3300048920 Ga0496117_0086590 Ga0496117_0086590_281_1552 412
78 3300048921 Ga0496118_0043157 Ga0496118_0043157_872_2143 412
79 3300005327 Ga0070658_10023824 Ga0070658_100238243 413
80 3300005329 Ga0070683_100029207 Ga0070683_1000292074 413
81 3300005458 Ga0070681_10107719 Ga0070681_101077191 413
82 3300005530 Ga0070679_100172386 Ga0070679_1001723862 413
83 3300005535 Ga0070684_100007925 Ga0070684_1000079255 413
84 3300005842 Ga0068858_100130216 Ga0068858_1001302163 413
85 3300009147 Ga0114129_10111843 Ga0114129_101118433 413
86 3300010375 Ga0105239_10472295 Ga0105239_104722951 413
87 3300025909 Ga0207705_10028767 Ga0207705_100287673 413
88 3300025921 Ga0207652_10001454 Ga0207652_1000145412 413
89 3300025944 Ga0207661_10000736 Ga0207661_1000073622 413
90 iso_pu_bacteria 2671180195 2671838436 414
91 iso_pu_bacteria 2773857922 2774856592 414
92 3300032005 Ga0307411_10104675 Ga0307411_101046753 415
93 3300046474 Ga0495605_0085878 Ga0495605_0085878_75_1337 415
94 3300046492 Ga0495585_0029629 Ga0495585_0029629_1759_3021 415
95 3300046506 Ga0495583_0024790 Ga0495583_0024790_1122_2384 415
96 3300046507 Ga0495606_0008843 Ga0495606_0008843_2782_4044 415
97 3300046515 Ga0495620_0020782 Ga0495620_0020782_1024_2286 415
98 3300046616 Ga0495668_0010740 Ga0495668_0010740_276_1538 415
99 3300046660 Ga0495625_0054129 Ga0495625_0054129_275_1537 415
100 3300046810 Ga0495660_0005677 Ga0495660_0005677_104_1366 415
101 3300047323 Ga0495683_0022694 Ga0495683_0022694_400_1662 415
102 3300028786 Ga0307517_10117986 Ga0307517_101179861 416
103 3300028794 Ga0307515_10114619 Ga0307515_101146193 416
104 3300030521 Ga0307511_10105963 Ga0307511_101059631 416
105 3300031507 Ga0307509_10065197 Ga0307509_100651973 416
106 3300031616 Ga0307508_10104799 Ga0307508_101047992 416
107 3300031730 Ga0307516_10101038 Ga0307516_101010381 416
108 3300033180 Ga0307510_10107131 Ga0307510_101071312 416
109 3300046455 Ga0495603_0102090 Ga0495603_0102090_303_1589 416
110 3300046461 Ga0495641_0071326 Ga0495641_0071326_59_1345 416
111 3300046689 Ga0495613_0051115 Ga0495613_0051115_1558_2808 416
112 3300046690 Ga0495624_0103599 Ga0495624_0103599_188_1453 416
113 3300050508 nmdc:mga09592_113402_c1 nmdc:mga09592_113402_c1_104_1357 416
114 3300050509 nmdc:mga0qj67_22738_c1 nmdc:mga0qj67_22738_c1_513_1850 416
115 3300053088 Ga0500644_0009708 Ga0500644_0009708_351_1613 416
116 3300053134 Ga0500658_0018780 Ga0500658_0018780_1203_2465 416
117 3300053149 Ga0500600_0059395 Ga0500600_0059395_747_2006 416
118 3300003316 rootH1_10044251 rootH1_100442511 417
119 3300039450 Ga0436363_0522372 Ga0436363_0522372_740_2008 417
120 3300005937 Ga0081455_10019952 Ga0081455_100199525 419
121 3300005985 Ga0081539_10018412 Ga0081539_100184122 419
122 3300025910 Ga0207684_10127706 Ga0207684_101277061 419
123 3300025939 Ga0207665_10142194 Ga0207665_101421942 419
124 3300031456 Ga0307513_10134965 Ga0307513_101349651 419
125 3300031616 Ga0307508_10130891 Ga0307508_101308911 419
126 3300033179 Ga0307507_10120008 Ga0307507_101200082 419
127 3300037466 Ga0395898_0214629 Ga0395898_0214629_34_1308 419
128 3300037471 Ga0395905_0155866 Ga0395905_0155866_95_1369 419
129 3300042993 Ga0439440_0021635 Ga0439440_0021635_62_1336 419
130 3300046454 Ga0495592_0106048 Ga0495592_0106048_646_1920 419
131 3300046459 Ga0495629_0076877 Ga0495629_0076877_345_1619 419
132 3300046536 Ga0495587_0070105 Ga0495587_0070105_485_1759 419
133 3300047315 Ga0495581_0088061 Ga0495581_0088061_266_1540 419
134 3300047322 Ga0495680_0202345 Ga0495680_0202345_22_1296 419
135 3300047673 Ga0495593_0061320 Ga0495593_0061320_32_1306 419
136 3300048088 Ga0495602_0100479 Ga0495602_0100479_717_1991 419
137 3300049586 Ga0501070_0039539 Ga0501070_0039539_1915_3192 419
138 iso_pu_bacteria 2919713450 2919720165 419
139 3300048909 Ga0496106_0017687 Ga0496106_0017687_2462_3838 420
140 3300003322 rootL2_10032078 rootL2_100320782 421
141 3300031548 Ga0307408_100060568 Ga0307408_1000605682 421
142 3300031901 Ga0307406_10096678 Ga0307406_100966782 421
143 3300031995 Ga0307409_100086623 Ga0307409_1000866232 421
144 3300032004 Ga0307414_10147250 Ga0307414_101472502 421
145 3300033545 Ga0316214_1000245 Ga0316214_10002454 421
146 3300046809 Ga0495600_0174730 Ga0495600_0174730_11_1300 421
147 3300053078 Ga0495612_0002853 Ga0495612_0002853_3618_4907 421
148 3300003203 JGI25406J46586_10002016 JGI25406J46586_100020165 422
149 3300005985 Ga0081539_10000263 Ga0081539_1000026310 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00078

RVT_1

Reverse transcriptase (RNA-dependent DNA polymerase)

56

279

0.91

PF08388

GIIM

Group II intron, maturase-specific domain

304

380

0.91

PF00680

RdRP_1

Viral RNA-dependent RNA polymerase

105

294

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t2r-assembly1.cif.gz_D structure of a group ii intron ribonucleoprotein in the pre-ligation (pre-2f) state 0.8997 14 380
7uin-assembly1.cif.gz_D cryoem structure of an group ii intron retroelement 0.8776 14 393
6ar1-assembly2.cif.gz_D structure of a thermostable group ii intron reverse transcriptase with template-primer and its functional and evolutionary implications (rt/duplex (nat)) 0.8753 13 380
6ar1-assembly1.cif.gz_A structure of a thermostable group ii intron reverse transcriptase with template-primer and its functional and evolutionary implications (rt/duplex (nat)) 0.8748 13 380
8bgj-assembly2.cif.gz_B crystal structure of reverse transcriptase domain from caloramator australicus cart-capp 0.8742 81 294
ID Description Score Start End Superfamily
af_Q47688_90_332_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8697 72 273 3.30.70.270
af_A0A0G2KTU9_518_768_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8559 81 273 3.30.70.270
af_Q55DS8_493_661_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8492 81 221 3.30.70.270
af_A0A2R8QR39_23_279_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8477 81 272 3.30.70.270
1d0eA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8465 136 294 3.30.70.270
ID Description Score Start End GO Terms
AF-A0A428VVB5-F1-model_v4 RNA-directed DNA polymerase (EC 2.7.7.49) 0.9935 83 256 GO:0003723
GO:0003964
GO:0051607
AF-A0A7Y0H5I3-F1-model_v4 Reverse transcriptase 0.989 212 417 GO:0003964
AF-A0A0F8YDL8-F1-model_v4 Reverse transcriptase domain-containing protein 0.9851 68 243 GO:0003723
GO:0003964
GO:0051607
AF-A0A5Q5FZA8-F1-model_v4 deleted 0.9846 7 358
AF-A0A4S2QPM3-F1-model_v4 Group II intron reverse transcriptase/maturase 0.9844 7 200 GO:0003964

Feature Viewer

pLDDT pTM Quality
91.1 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map