F200140

General Info

Members Datasets Scaffolds Average Seq Length
147 121 294 245

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10000761|Ga0099794_100007615
Length 256
Sequence MKKILIVGATSAIAQHAGRLWASRNAEFFLVGRDEHRLAAVADDLRVRGAKLVETCVSDVNDFHAHSGMVHRAVEALQTIEVALIAHGSLPNQKQCEGSFDKTLDALCTNCLSVVSLLTHFASYFEQQGSGTIAVISSVAGDRGRKDNYVYGAAKGMVTIFLQGLRNRLHRSGVQVLTIKPGLVDTPMTAEFQKGFLWAEPNAVGQCIVKAIEQRKDTVYIPWFWRPTMALIRAVPESVFKKLDLAQARKAEPRTS

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
94 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
95 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
100 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
101 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
102 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 1.36
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 0.68
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10000761 3300007265 Bacteria 10864
2 JGI24742J22300_10017977 3300002244 Bacteria 1198
3 rootH2_10017497 3300003320 Bacteria 20969
4 rootL2_10221745 3300003322 Bacteria 5652
5 Ga0055535_1004060 3300003761 Bacteria 3760
6 Ga0055531_10000076 3300003794 Bacteria 106998
7 Ga0070670_100000015 3300005331 Bacteria 228819
8 Ga0070689_100433224 3300005340 Bacteria 1116
9 Ga0070689_100591211 3300005340 Bacteria 960
10 Ga0070691_10003769 3300005341 Bacteria 6853
11 Ga0070688_100003690 3300005365 Bacteria 7914
12 Ga0070667_100000015 3300005367 Bacteria 238203
13 Ga0070667_100017498 3300005367 Bacteria 5941
14 Ga0070708_100045734 3300005445 Bacteria 3858
15 Ga0070681_10101214 3300005458 Bacteria 2827
16 Ga0068867_100330745 3300005459 Unclassified 1265
17 Ga0070685_10000116 3300005466 Bacteria 50879
18 Ga0070706_100015218 3300005467 Bacteria 7101
19 Ga0070706_100123285 3300005467 Unclassified 2416
20 Ga0070707_100082706 3300005468 Bacteria 3101
21 Ga0070707_100198864 3300005468 Unclassified 1953
22 Ga0070698_100027448 3300005471 Bacteria 5921
23 Ga0070698_100045132 3300005471 Unclassified 4511
24 Ga0070699_100026659 3300005518 Bacteria 4984
25 Ga0070699_100109193 3300005518 Unclassified 2428
26 Ga0070679_100011181 3300005530 Bacteria 8552
27 Ga0070697_100073289 3300005536 Unclassified 2811
28 Ga0070664_100170031 3300005564 Bacteria 1933
29 Ga0068859_100201796 3300005617 Bacteria 2073
30 Ga0068864_100000056 3300005618 Bacteria 127891
31 Ga0068863_100049553 3300005841 Bacteria 3982
32 Ga0068863_100118217 3300005841 Bacteria 2526
33 Ga0068858_100025798 3300005842 Bacteria 5466
34 Ga0068858_100102795 3300005842 Bacteria 2665
35 Ga0068860_100000857 3300005843 Bacteria 33940
36 Ga0068862_100000784 3300005844 Bacteria 31488
37 Ga0068862_100097603 3300005844 Bacteria 2565
38 Ga0070717_10107386 3300006028 Unclassified 2377
39 Ga0097620_100201814 3300006931 Bacteria 2073
40 Ga0105245_10018204 3300009098 Bacteria 6142
41 Ga0105247_10019986 3300009101 Bacteria 4024
42 Ga0105242_10013232 3300009176 Bacteria 6371
43 Ga0105242_10020974 3300009176 Bacteria 5125
44 Ga0105248_10005811 3300009177 Bacteria 13563
45 Ga0105237_10845569 3300009545 Unclassified 922
46 Ga0105249_10019442 3300009553 Bacteria 6060
47 Ga0157378_10035438 3300013297 Unclassified 4413
48 Ga0157375_10007462 3300013308 Bacteria 9569
49 Ga0163163_10000158 3300014325 Bacteria 70435
50 Ga0157379_10127401 3300014968 Bacteria 2291
51 Ga0157379_10384619 3300014968 Bacteria 1288
52 Ga0157376_10233018 3300014969 Unclassified 1711
53 Ga0182007_10065840 3300015262 Bacteria 1187
54 Ga0206349_1795267 3300020075 Bacteria 2950
55 Ga0206352_10970316 3300020078 Bacteria 2624
56 Ga0213872_10026201 3300021361 Bacteria 2679
57 Ga0213876_10084743 3300021384 Bacteria 1677
58 Ga0213875_10157372 3300021388 Bacteria 1066
59 Ga0209436_106949 3300025208 Bacteria 2417
60 Ga0209025_1000384 3300025294 Bacteria 91722
61 Ga0207710_10208618 3300025900 Unclassified 967
62 Ga0207684_10043435 3300025910 Bacteria 3811
63 Ga0207684_10528628 3300025910 Bacteria 1010
64 Ga0207707_10269332 3300025912 Bacteria 1476
65 Ga0207671_10312594 3300025914 Unclassified 1242
66 Ga0207693_10414534 3300025915 Bacteria 1053
67 Ga0207660_10091765 3300025917 Bacteria 2253
68 Ga0207652_10008161 3300025921 Bacteria 8408
69 Ga0207646_10010926 3300025922 Bacteria 8821
70 Ga0207646_10020747 3300025922 Bacteria 6084
71 Ga0207650_10000013 3300025925 Bacteria 409471
72 Ga0207686_10030601 3300025934 Unclassified 3188
73 Ga0207686_10068534 3300025934 Bacteria 2273
74 Ga0207709_10575503 3300025935 Bacteria 889
75 Ga0207670_10521060 3300025936 Bacteria 968
76 Ga0207670_10619942 3300025936 Bacteria 890
77 Ga0207711_10000200 3300025941 Bacteria 63897
78 Ga0207712_10175961 3300025961 Bacteria 1677
79 Ga0207658_10000005 3300025986 Bacteria 408341
80 Ga0207703_10194682 3300026035 Bacteria 1798
81 Ga0207703_10598722 3300026035 Bacteria 1043
82 Ga0207641_10027671 3300026088 Bacteria 4683
83 Ga0207641_10413580 3300026088 Bacteria 1297
84 Ga0207676_10000010 3300026095 Bacteria 519402
85 Ga0209588_1002324 3300027671 Bacteria 5149
86 Ga0268266_10006400 3300028379 Bacteria 10791
87 Ga0268265_10000486 3300028380 Bacteria 41482
88 Ga0268264_10000036 3300028381 Bacteria 392994
89 Ga0307515_10042149 3300028794 Bacteria 7151
90 Ga0265338_10053951 3300028800 Bacteria 3590
91 Ga0265320_10062424 3300031240 Bacteria 1775
92 Ga0265331_10003945 3300031250 Bacteria 9372
93 Ga0265331_10035180 3300031250 Unclassified 2466
94 Ga0265327_10002599 3300031251 Bacteria 18686
95 Ga0307513_10234029 3300031456 Bacteria 1648
96 Ga0307408_100000014 3300031548 Bacteria 377369
97 Ga0316576_10006258 3300031727 Bacteria 7390
98 Ga0307413_10068718 3300031824 Bacteria 2220
99 Ga0307410_10033426 3300031852 Bacteria 3320
100 Ga0307406_10032668 3300031901 Bacteria 3179
101 Ga0307407_10000047 3300031903 Bacteria 59255
102 Ga0307412_10003834 3300031911 Bacteria 8359
103 Ga0307409_100001917 3300031995 Bacteria 10618
104 Ga0307416_100003554 3300032002 Bacteria 9192
105 Ga0307416_100040739 3300032002 Bacteria 3612
106 Ga0307416_100047415 3300032002 Bacteria 3400
107 Ga0307414_10019000 3300032004 Bacteria 4249
108 Ga0307411_10011009 3300032005 Bacteria 4855
109 Ga0307415_100002139 3300032126 Bacteria 9779
110 Ga0307415_100036821 3300032126 Bacteria 3210
111 Ga0307415_100423441 3300032126 Unclassified 1143
112 Ga0373954_0196763 3300035118 Bacteria 990
113 Ga0373956_0003903 3300035119 Bacteria 5992
114 Ga0436364_0565409 3300037853 Unclassified 2317
115 Ga0400490_15988 3300038726 Bacteria 9734
116 Ga0400490_60543 3300038726 Bacteria 15396
117 Ga0400488_43949 3300038741 Bacteria 36927
118 Ga0400487_43693 3300039110 Unclassified 1324
119 Ga0436365_1590713 3300039437 Bacteria 5447
120 Ga0436361_0260478 3300039447 Bacteria 1151
121 Ga0436363_1229479 3300039450 Bacteria 14360
122 Ga0436363_1274433 3300039450 Bacteria 41070
123 Ga0450890_000038 3300042127 Bacteria 29723
124 Ga0450890_026665 3300042127 Unclassified 806
125 Ga0450891_002245 3300042129 Bacteria 1955
126 Ga0450892_000019 3300042130 Bacteria 17230
127 Ga0450893_0000150 3300042532 Bacteria 8686
128 Ga0451577_0046906 3300042876 Bacteria 3864
129 Ga0466982_0034426 3300044672 Bacteria 3030
130 Ga0466961_0075227 3300044693 Bacteria 2141
131 Ga0453684_0077624 3300044712 Bacteria 4161
132 Ga0466970_0341256 3300044765 Unclassified 849
133 Ga0466957_0194317 3300044842 Bacteria 1331
134 Ga0466959_0030997 3300045049 Bacteria 3958
135 Ga0495653_0000191 3300046463 Bacteria 50017
136 Ga0495633_0002582 3300046558 Bacteria 12680
137 Ga0496110_0251282 3300048913 Unclassified 1609
138 Ga0496125_0102565 3300048928 Unclassified 2102
139 Ga0501072_0111363 3300049588 Bacteria 2179
140 Ga0501076_0147388 3300049592 Bacteria 1914
141 Ga0501279_000246 3300049775 Bacteria 7400
142 Ga0501279_001149 3300049775 Bacteria 3475
143 nmdc:mga03n38_128715_c1 3300050490 Bacteria 1252
144 Ga0500644_0004451 3300053088 Bacteria 3506
145 Ga0500616_0062775 3300053153 Bacteria 1918
146 Ga0501082_0289290 3300060353 Bacteria 1427
147 2819576228 2818991442 Bacteria 8318214
148 Ga0099794_10000761
149 JGI24742J22300_10017977
150 rootH2_10017497
151 rootL2_10221745
152 Ga0055535_1004060
153 Ga0055531_10000076
154 Ga0070670_100000015
155 Ga0070689_100433224
156 Ga0070689_100591211
157 Ga0070691_10003769
158 Ga0070688_100003690
159 Ga0070667_100000015
160 Ga0070667_100017498
161 Ga0070708_100045734
162 Ga0070681_10101214
163 Ga0068867_100330745
164 Ga0070685_10000116
165 Ga0070706_100015218
166 Ga0070706_100123285
167 Ga0070707_100082706
168 Ga0070707_100198864
169 Ga0070698_100027448
170 Ga0070698_100045132
171 Ga0070699_100026659
172 Ga0070699_100109193
173 Ga0070679_100011181
174 Ga0070697_100073289
175 Ga0070664_100170031
176 Ga0068859_100201796
177 Ga0068864_100000056
178 Ga0068863_100049553
179 Ga0068863_100118217
180 Ga0068858_100025798
181 Ga0068858_100102795
182 Ga0068860_100000857
183 Ga0068862_100000784
184 Ga0068862_100097603
185 Ga0070717_10107386
186 Ga0097620_100201814
187 Ga0105245_10018204
188 Ga0105247_10019986
189 Ga0105242_10013232
190 Ga0105242_10020974
191 Ga0105248_10005811
192 Ga0105237_10845569
193 Ga0105249_10019442
194 Ga0157378_10035438
195 Ga0157375_10007462
196 Ga0163163_10000158
197 Ga0157379_10127401
198 Ga0157379_10384619
199 Ga0157376_10233018
200 Ga0182007_10065840
201 Ga0206349_1795267
202 Ga0206352_10970316
203 Ga0213872_10026201
204 Ga0213876_10084743
205 Ga0213875_10157372
206 Ga0209436_106949
207 Ga0209025_1000384
208 Ga0207710_10208618
209 Ga0207684_10043435
210 Ga0207684_10528628
211 Ga0207707_10269332
212 Ga0207671_10312594
213 Ga0207693_10414534
214 Ga0207660_10091765
215 Ga0207652_10008161
216 Ga0207646_10010926
217 Ga0207646_10020747
218 Ga0207650_10000013
219 Ga0207686_10030601
220 Ga0207686_10068534
221 Ga0207709_10575503
222 Ga0207670_10521060
223 Ga0207670_10619942
224 Ga0207711_10000200
225 Ga0207712_10175961
226 Ga0207658_10000005
227 Ga0207703_10194682
228 Ga0207703_10598722
229 Ga0207641_10027671
230 Ga0207641_10413580
231 Ga0207676_10000010
232 Ga0209588_1002324
233 Ga0268266_10006400
234 Ga0268265_10000486
235 Ga0268264_10000036
236 Ga0307515_10042149
237 Ga0265338_10053951
238 Ga0265320_10062424
239 Ga0265331_10003945
240 Ga0265331_10035180
241 Ga0265327_10002599
242 Ga0307513_10234029
243 Ga0307408_100000014
244 Ga0316576_10006258
245 Ga0307413_10068718
246 Ga0307410_10033426
247 Ga0307406_10032668
248 Ga0307407_10000047
249 Ga0307412_10003834
250 Ga0307409_100001917
251 Ga0307416_100003554
252 Ga0307416_100040739
253 Ga0307416_100047415
254 Ga0307414_10019000
255 Ga0307411_10011009
256 Ga0307415_100002139
257 Ga0307415_100036821
258 Ga0307415_100423441
259 Ga0373954_0196763
260 Ga0373956_0003903
261 Ga0436364_0565409
262 Ga0400490_15988
263 Ga0400490_60543
264 Ga0400488_43949
265 Ga0400487_43693
266 Ga0436365_1590713
267 Ga0436361_0260478
268 Ga0436363_1229479
269 Ga0436363_1274433
270 Ga0450890_000038
271 Ga0450890_026665
272 Ga0450891_002245
273 Ga0450892_000019
274 Ga0450893_0000150
275 Ga0451577_0046906
276 Ga0466982_0034426
277 Ga0466961_0075227
278 Ga0453684_0077624
279 Ga0466970_0341256
280 Ga0466957_0194317
281 Ga0466959_0030997
282 Ga0495653_0000191
283 Ga0495633_0002582
284 Ga0496110_0251282
285 Ga0496125_0102565
286 Ga0501072_0111363
287 Ga0501076_0147388
288 Ga0501279_000246
289 Ga0501279_001149
290 nmdc:mga03n38_128715_c1
291 Ga0500644_0004451
292 Ga0500616_0062775
293 Ga0501082_0289290
294 2819576228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

195

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

215

0.91

PF08659

KR

KR domain

3

186

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g93-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.8877 2 241
3r1i-assembly1.cif.gz_A-2 crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.8864 6 229
8g9v-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.8835 1 244
3sj7-assembly1.cif.gz_A-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.8822 6 225
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.8812 6 225
ID Description Score Start End Superfamily
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 7 248 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 8 248 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9286 8 248 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 7 248 3.40.50.720
af_Q9VCR9_81_353_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9045 6 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A317IES5-F1-model_v4 Short-chain dehydrogenase 0.9501 107 250 GO:0016020
GO:0016491
AF-A0A2N1VLE7-F1-model_v4 Short-chain dehydrogenase 0.9474 6 250 GO:0016020
GO:0016491
AF-A0A0L8QHB0-F1-model_v4 deleted 0.9473 32 250
AF-A0A4Q6CZV9-F1-model_v4 deleted 0.9467 6 225
AF-A0A2N1VLE7-F1-model_v4 Short-chain dehydrogenase 0.94 6 250 GO:0016020
GO:0016491

Map