F199461

General Info

Members Datasets Scaffolds Average Seq Length
147 124 147 158

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100352109|Ga0070680_1003521092
Length 165
Sequence VTDTRGRLNIDAGPGQWNLSGSIDETSALIELLSRAQHGSLVLDLAGVTFINSLGVRDWIRMQNEATRQGLVIELRRVSEPIIHQLNMIIATRGNSRVTSFYAPYACDSCGREESQLIDVTANAVGLANLVAPSITCPECGAQMAFNDFPERYFSFLVPETPRPG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
73 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
101 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
102 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
103 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
104 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
105 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
106 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
107 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
108 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
109 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
119 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
122 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
123 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.08
Nodule 0
Rhizoplane 2.04
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10135547 3300005327 Unclassified 2054
2 Ga0070658_11333761 3300005327 Unclassified 623
3 Ga0070690_100003997 3300005330 Bacteria 8156
4 Ga0070680_100352109 3300005336 Bacteria 1252
5 Ga0070680_100454577 3300005336 Unclassified 1094
6 Ga0070682_100306640 3300005337 Unclassified 1167
7 Ga0068868_100474399 3300005338 Unclassified 1092
8 Ga0070689_100027161 3300005340 Unclassified 4314
9 Ga0070687_101127153 3300005343 Bacteria 575
10 Ga0070669_100279145 3300005353 Bacteria 1338
11 Ga0070709_10324950 3300005434 Bacteria 1130
12 Ga0070694_100655176 3300005444 Unclassified 850
13 Ga0070708_100378034 3300005445 Bacteria 1336
14 Ga0070685_10227969 3300005466 Unclassified 1224
15 Ga0070706_100068562 3300005467 Bacteria 3280
16 Ga0070698_100395494 3300005471 Unclassified 1315
17 Ga0070699_100477643 3300005518 Bacteria 1131
18 Ga0070679_100008826 3300005530 Bacteria 9510
19 Ga0070679_100846669 3300005530 Bacteria 858
20 Ga0070684_100228694 3300005535 Bacteria 1698
21 Ga0070697_101709606 3300005536 Unclassified 563
22 Ga0070695_100233446 3300005545 Bacteria 1331
23 Ga0070695_100535264 3300005545 Bacteria 911
24 Ga0070665_100633025 3300005548 Bacteria 1083
25 Ga0068855_100422969 3300005563 Unclassified 1457
26 Ga0068855_101542106 3300005563 Bacteria 681
27 Ga0068857_100177994 3300005577 Bacteria 1935
28 Ga0068856_100058633 3300005614 Unclassified 3802
29 Ga0068859_100271533 3300005617 Unclassified 1788
30 Ga0068851_10425144 3300005834 Unclassified 785
31 Ga0068870_10377163 3300005840 Bacteria 917
32 Ga0068860_100637812 3300005843 Bacteria 1073
33 Ga0068862_100246448 3300005844 Unclassified 1627
34 Ga0070717_10008138 3300006028 Bacteria 7825
35 Ga0070717_10020045 3300006028 Bacteria 5254
36 Ga0068871_100633129 3300006358 Bacteria 975
37 Ga0075429_100055911 3300006880 Bacteria 3434
38 Ga0075429_100072329 3300006880 Bacteria 3003
39 Ga0068865_100015122 3300006881 Unclassified 4917
40 Ga0097620_100271520 3300006931 Unclassified 1788
41 Ga0105240_10827600 3300009093 Unclassified 1001
42 Ga0105245_10000070 3300009098 Bacteria 106666
43 Ga0105243_10066596 3300009148 Bacteria 2897
44 Ga0105242_10062909 3300009176 Bacteria 3055
45 Ga0105249_10049612 3300009553 Bacteria 3828
46 Ga0105239_10191556 3300010375 Unclassified 2289
47 Ga0157374_10013173 3300013296 Bacteria 7213
48 Ga0157374_11888219 3300013296 Unclassified 623
49 Ga0157378_10230686 3300013297 Bacteria 1764
50 Ga0163163_11657170 3300014325 Bacteria 700
51 Ga0157376_10002405 3300014969 Bacteria 12643
52 Ga0213876_10051069 3300021384 Bacteria 2185
53 Ga0207643_10259848 3300025908 Bacteria 1072
54 Ga0207705_10108003 3300025909 Unclassified 2054
55 Ga0207684_10027424 3300025910 Unclassified 4854
56 Ga0207660_10408839 3300025917 Unclassified 1094
57 Ga0207652_10059834 3300025921 Bacteria 3284
58 Ga0207652_10609392 3300025921 Bacteria 979
59 Ga0207687_10000043 3300025927 Bacteria 106920
60 Ga0207686_10171328 3300025934 Bacteria 1531
61 Ga0207709_10108748 3300025935 Bacteria 1849
62 Ga0207670_10013604 3300025936 Unclassified 4803
63 Ga0207704_10304351 3300025938 Unclassified 1222
64 Ga0207689_10190577 3300025942 Unclassified 1692
65 Ga0207661_10637833 3300025944 Unclassified 979
66 Ga0207712_10056713 3300025961 Bacteria 2760
67 Ga0207648_10868020 3300026089 Bacteria 842
68 Ga0207674_10265942 3300026116 Unclassified 1662
69 Ga0207674_10449257 3300026116 Unclassified 1246
70 Ga0207683_10006574 3300026121 Bacteria 9952
71 Ga0307515_10014825 3300028794 Bacteria 14414
72 Ga0265338_10137213 3300028800 Bacteria 1921
73 Ga0307513_10042487 3300031456 Bacteria 5005
74 Ga0307509_10050074 3300031507 Bacteria 4474
75 Ga0307509_10135852 3300031507 Bacteria 2405
76 Ga0265314_10124302 3300031711 Bacteria 1619
77 Ga0307516_10018453 3300031730 Bacteria 7250
78 Ga0307406_10923363 3300031901 Bacteria 744
79 Ga0307415_100040491 3300032126 Bacteria 3087
80 Ga0307415_100296992 3300032126 Bacteria 1336
81 Ga0307507_10206950 3300033179 Bacteria 1346
82 Ga0373936_0309039 3300035113 Bacteria 715
83 Ga0373941_0000764 3300035115 Bacteria 6577
84 Ga0373954_0068442 3300035118 Unclassified 1684
85 Ga0373961_0000056 3300035241 Bacteria 65159
86 Ga0395899_0093557 3300037312 Bacteria 2175
87 Ga0395899_0120791 3300037312 Bacteria 1877
88 Ga0395900_0418408 3300037418 Unclassified 1301
89 Ga0395900_0755371 3300037418 Bacteria 902
90 Ga0395898_0118173 3300037466 Bacteria 2540
91 Ga0395905_0475275 3300037471 Bacteria 1149
92 Ga0395905_1053764 3300037471 Bacteria 716
93 Ga0395901_0067356 3300038443 Bacteria 3728
94 Ga0436365_0523455 3300039437 Bacteria 3781
95 Ga0436365_1468761 3300039437 Bacteria 517
96 Ga0436363_0967381 3300039450 Bacteria 1567
97 Ga0436362_0484149 3300039453 Bacteria 951
98 Ga0453684_0413445 3300044712 Bacteria 1508
99 Ga0451576_1271488 3300045051 Unclassified 767
100 Ga0495650_0038104 3300046471 Bacteria 2086
101 Ga0495686_0007774 3300047472 Bacteria 7982
102 Ga0495686_0019737 3300047472 Bacteria 4501
103 Ga0496104_0730884 3300048907 Bacteria 897
104 Ga0496112_0119228 3300048915 Unclassified 2609
105 Ga0496114_1050655 3300048917 Bacteria 698
106 Ga0501292_014673 3300049515 Bacteria 1218
107 Ga0501034_0224603 3300049571 Bacteria 1829
108 Ga0501034_0240927 3300049571 Unclassified 1755
109 Ga0501036_0528195 3300049572 Unclassified 981
110 Ga0501037_0400515 3300049573 Bacteria 941
111 Ga0501043_0445283 3300049579 Unclassified 974
112 Ga0501047_0023308 3300049581 Bacteria 5944
113 Ga0501047_0253433 3300049581 Bacteria 1608
114 Ga0501067_0052744 3300049583 Unclassified 2253
115 Ga0501067_0273993 3300049583 Bacteria 940
116 Ga0501069_0017842 3300049585 Bacteria 3827
117 Ga0501070_0050109 3300049586 Bacteria 3466
118 Ga0501070_0055603 3300049586 Bacteria 3280
119 Ga0501070_0075241 3300049586 Bacteria 2795
120 Ga0501071_0066434 3300049587 Bacteria 2621
121 Ga0501072_0427593 3300049588 Bacteria 1049
122 Ga0501202_169757 3300049652 Unclassified 582
123 Ga0501216_004246 3300049660 Bacteria 2121
124 Ga0501223_036302 3300049663 Unclassified 957
125 Ga0501227_000720 3300049665 Bacteria 7206
126 Ga0501228_004353 3300049666 Unclassified 1210
127 Ga0501230_014843 3300049667 Bacteria 1285
128 Ga0501233_000741 3300049668 Bacteria 5416
129 Ga0501235_072425 3300049669 Unclassified 816
130 Ga0501225_0001903 3300049705 Bacteria 6549
131 Ga0501234_113285 3300049707 Unclassified 501
132 Ga0501079_1214372 3300049741 Unclassified 594
133 Ga0501080_0493070 3300049742 Bacteria 1095
134 Ga0501081_0143402 3300049743 Bacteria 1713
135 Ga0501083_0152561 3300049744 Bacteria 1512
136 Ga0501035_0151419 3300049822 Unclassified 2013
137 Ga0501044_0043002 3300049823 Bacteria 4695
138 nmdc:mga09592_56609_c1 3300050508 Bacteria 3313
139 nmdc:mga09592_73457_c1 3300050508 Bacteria 2906
140 nmdc:mga08x19_667497_c1 3300050514 Bacteria 737
141 Ga0500566_0001010 3300053094 Bacteria 16203
142 Ga0500614_115547 3300053123 Bacteria 786
143 Ga0500568_0093247 3300053139 Bacteria 1134
144 Ga0500590_213030 3300053148 Bacteria 805
145 Ga0500603_000666 3300053150 Bacteria 8363
146 Ga0500639_134879 3300053163 Bacteria 1164
147 Ga0501082_0257374 3300060353 Unclassified 1518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10259848 Ga0207643_102598482 137
2 3300049707 Ga0501234_113285 Ga0501234_113285_12_443 143
3 3300005330 Ga0070690_100003997 Ga0070690_1000039977 144
4 3300025961 Ga0207712_10056713 Ga0207712_100567133 144
5 3300049705 Ga0501225_0001903 Ga0501225_0001903_1806_2270 147
6 3300009148 Ga0105243_10066596 Ga0105243_100665963 152
7 3300025935 Ga0207709_10108748 Ga0207709_101087483 152
8 3300035113 Ga0373936_0309039 Ga0373936_0309039_163_621 152
9 3300044712 Ga0453684_0413445 Ga0453684_0413445_370_831 153
10 3300045051 Ga0451576_1271488 Ga0451576_1271488_170_631 153
11 3300048915 Ga0496112_0119228 Ga0496112_0119228_598_1059 153
12 3300049515 Ga0501292_014673 Ga0501292_014673_313_774 153
13 3300049571 Ga0501034_0240927 Ga0501034_0240927_529_990 153
14 3300049583 Ga0501067_0052744 Ga0501067_0052744_330_791 153
15 3300049585 Ga0501069_0017842 Ga0501069_0017842_1116_1577 153
16 3300049586 Ga0501070_0050109 Ga0501070_0050109_1136_1597 153
17 3300049588 Ga0501072_0427593 Ga0501072_0427593_250_711 153
18 3300049652 Ga0501202_169757 Ga0501202_169757_59_520 153
19 3300049660 Ga0501216_004246 Ga0501216_004246_249_710 153
20 3300049663 Ga0501223_036302 Ga0501223_036302_229_690 153
21 3300049665 Ga0501227_000720 Ga0501227_000720_3273_3734 153
22 3300049666 Ga0501228_004353 Ga0501228_004353_296_757 153
23 3300049667 Ga0501230_014843 Ga0501230_014843_218_679 153
24 3300049668 Ga0501233_000741 Ga0501233_000741_2078_2539 153
25 3300049669 Ga0501235_072425 Ga0501235_072425_148_609 153
26 3300049742 Ga0501080_0493070 Ga0501080_0493070_600_1061 153
27 3300049743 Ga0501081_0143402 Ga0501081_0143402_313_774 153
28 3300049744 Ga0501083_0152561 Ga0501083_0152561_487_948 153
29 3300060353 Ga0501082_0257374 Ga0501082_0257374_907_1368 153
30 3300039453 Ga0436362_0484149 Ga0436362_0484149_331_795 154
31 3300005343 Ga0070687_101127153 Ga0070687_1011271531 155
32 3300005466 Ga0070685_10227969 Ga0070685_102279692 155
33 3300006028 Ga0070717_10008138 Ga0070717_100081388 155
34 3300031507 Ga0307509_10135852 Ga0307509_101358522 155
35 3300049583 Ga0501067_0273993 Ga0501067_0273993_311_778 155
36 3300005336 Ga0070680_100454577 Ga0070680_1004545772 156
37 3300005530 Ga0070679_100846669 Ga0070679_1008466691 156
38 3300005535 Ga0070684_100228694 Ga0070684_1002286942 156
39 3300005548 Ga0070665_100633025 Ga0070665_1006330252 156
40 3300005563 Ga0068855_101542106 Ga0068855_1015421062 156
41 3300021384 Ga0213876_10051069 Ga0213876_100510692 156
42 3300025917 Ga0207660_10408839 Ga0207660_104088392 156
43 3300025921 Ga0207652_10609392 Ga0207652_106093922 156
44 3300037312 Ga0395899_0093557 Ga0395899_0093557_1510_1980 156
45 3300037312 Ga0395899_0120791 Ga0395899_0120791_1357_1827 156
46 3300037418 Ga0395900_0418408 Ga0395900_0418408_238_708 156
47 3300037418 Ga0395900_0755371 Ga0395900_0755371_191_661 156
48 3300037466 Ga0395898_0118173 Ga0395898_0118173_155_625 156
49 3300037471 Ga0395905_0475275 Ga0395905_0475275_109_579 156
50 3300038443 Ga0395901_0067356 Ga0395901_0067356_18_488 156
51 3300039437 Ga0436365_0523455 Ga0436365_0523455_2972_3442 156
52 3300039437 Ga0436365_1468761 Ga0436365_1468761_36_506 156
53 3300049572 Ga0501036_0528195 Ga0501036_0528195_179_649 156
54 3300049579 Ga0501043_0445283 Ga0501043_0445283_456_926 156
55 3300049581 Ga0501047_0023308 Ga0501047_0023308_5137_5607 156
56 3300049581 Ga0501047_0253433 Ga0501047_0253433_643_1113 156
57 3300049586 Ga0501070_0055603 Ga0501070_0055603_905_1375 156
58 3300049741 Ga0501079_1214372 Ga0501079_1214372_99_569 156
59 3300049822 Ga0501035_0151419 Ga0501035_0151419_730_1200 156
60 3300049823 Ga0501044_0043002 Ga0501044_0043002_314_784 156
61 3300005338 Ga0068868_100474399 Ga0068868_1004743992 157
62 3300005434 Ga0070709_10324950 Ga0070709_103249502 157
63 3300005444 Ga0070694_100655176 Ga0070694_1006551762 157
64 3300005467 Ga0070706_100068562 Ga0070706_1000685623 157
65 3300005471 Ga0070698_100395494 Ga0070698_1003954942 157
66 3300005518 Ga0070699_100477643 Ga0070699_1004776432 157
67 3300005545 Ga0070695_100233446 Ga0070695_1002334462 157
68 3300005617 Ga0068859_100271533 Ga0068859_1002715332 157
69 3300006931 Ga0097620_100271520 Ga0097620_1002715202 157
70 3300013296 Ga0157374_10013173 Ga0157374_100131735 157
71 3300025910 Ga0207684_10027424 Ga0207684_100274244 157
72 3300025934 Ga0207686_10171328 Ga0207686_101713281 157
73 3300025942 Ga0207689_10190577 Ga0207689_101905772 157
74 3300028794 Ga0307515_10014825 Ga0307515_100148254 157
75 3300035115 Ga0373941_0000764 Ga0373941_0000764_349_825 157
76 3300037471 Ga0395905_1053764 Ga0395905_1053764_200_673 157
77 3300039450 Ga0436363_0967381 Ga0436363_0967381_478_957 157
78 3300050514 nmdc:mga08x19_667497_c1 nmdc:mga08x19_667497_c1_142_615 157
79 3300053163 Ga0500639_134879 Ga0500639_134879_260_736 157
80 3300005327 Ga0070658_11333761 Ga0070658_113337611 158
81 3300005340 Ga0070689_100027161 Ga0070689_1000271612 158
82 3300005353 Ga0070669_100279145 Ga0070669_1002791452 158
83 3300005536 Ga0070697_101709606 Ga0070697_1017096061 158
84 3300005840 Ga0068870_10377163 Ga0068870_103771632 158
85 3300005843 Ga0068860_100637812 Ga0068860_1006378122 158
86 3300005844 Ga0068862_100246448 Ga0068862_1002464482 158
87 3300006028 Ga0070717_10020045 Ga0070717_100200452 158
88 3300006880 Ga0075429_100055911 Ga0075429_1000559113 158
89 3300006880 Ga0075429_100072329 Ga0075429_1000723293 158
90 3300009553 Ga0105249_10049612 Ga0105249_100496123 158
91 3300013297 Ga0157378_10230686 Ga0157378_102306863 158
92 3300014325 Ga0163163_11657170 Ga0163163_116571701 158
93 3300025936 Ga0207670_10013604 Ga0207670_100136046 158
94 3300026121 Ga0207683_10006574 Ga0207683_100065742 158
95 3300031456 Ga0307513_10042487 Ga0307513_100424878 158
96 3300031730 Ga0307516_10018453 Ga0307516_100184538 158
97 3300031901 Ga0307406_10923363 Ga0307406_109233631 158
98 3300032126 Ga0307415_100040491 Ga0307415_1000404912 158
99 3300032126 Ga0307415_100296992 Ga0307415_1002969922 158
100 3300033179 Ga0307507_10206950 Ga0307507_102069502 158
101 3300035118 Ga0373954_0068442 Ga0373954_0068442_990_1469 158
102 3300035241 Ga0373961_0000056 Ga0373961_0000056_16374_16853 158
103 3300047472 Ga0495686_0007774 Ga0495686_0007774_4709_5206 158
104 3300047472 Ga0495686_0019737 Ga0495686_0019737_3776_4264 158
105 3300049571 Ga0501034_0224603 Ga0501034_0224603_334_810 158
106 3300049573 Ga0501037_0400515 Ga0501037_0400515_309_785 158
107 3300049586 Ga0501070_0075241 Ga0501070_0075241_436_912 158
108 3300050508 nmdc:mga09592_56609_c1 nmdc:mga09592_56609_c1_1464_1946 158
109 3300050508 nmdc:mga09592_73457_c1 nmdc:mga09592_73457_c1_742_1224 158
110 3300053094 Ga0500566_0001010 Ga0500566_0001010_8692_9171 158
111 3300053123 Ga0500614_115547 Ga0500614_115547_149_628 158
112 3300053139 Ga0500568_0093247 Ga0500568_0093247_102_587 158
113 3300053148 Ga0500590_213030 Ga0500590_213030_157_636 158
114 3300053150 Ga0500603_000666 Ga0500603_000666_3116_3595 158
115 3300005445 Ga0070708_100378034 Ga0070708_1003780341 159
116 3300005545 Ga0070695_100535264 Ga0070695_1005352642 159
117 3300006358 Ga0068871_100633129 Ga0068871_1006331292 159
118 3300009176 Ga0105242_10062909 Ga0105242_100629093 159
119 3300025944 Ga0207661_10637833 Ga0207661_106378332 159
120 3300026116 Ga0207674_10449257 Ga0207674_104492572 159
121 3300048907 Ga0496104_0730884 Ga0496104_0730884_21_506 159
122 3300048917 Ga0496114_1050655 Ga0496114_1050655_53_538 159
123 3300049587 Ga0501071_0066434 Ga0501071_0066434_60_551 159
124 3300006881 Ga0068865_100015122 Ga0068865_1000151223 160
125 3300025938 Ga0207704_10304351 Ga0207704_103043512 160
126 3300026089 Ga0207648_10868020 Ga0207648_108680202 160
127 3300031507 Ga0307509_10050074 Ga0307509_100500742 160
128 3300046471 Ga0495650_0038104 Ga0495650_0038104_644_1132 160
129 3300028800 Ga0265338_10137213 Ga0265338_101372132 161
130 3300005327 Ga0070658_10135547 Ga0070658_101355473 162
131 3300005336 Ga0070680_100352109 Ga0070680_1003521092 162
132 3300005337 Ga0070682_100306640 Ga0070682_1003066402 162
133 3300005530 Ga0070679_100008826 Ga0070679_10000882610 162
134 3300005563 Ga0068855_100422969 Ga0068855_1004229692 162
135 3300005577 Ga0068857_100177994 Ga0068857_1001779943 162
136 3300005614 Ga0068856_100058633 Ga0068856_1000586333 162
137 3300005834 Ga0068851_10425144 Ga0068851_104251442 162
138 3300009093 Ga0105240_10827600 Ga0105240_108276002 162
139 3300009098 Ga0105245_10000070 Ga0105245_1000007019 162
140 3300010375 Ga0105239_10191556 Ga0105239_101915562 162
141 3300013296 Ga0157374_11888219 Ga0157374_118882191 162
142 3300014969 Ga0157376_10002405 Ga0157376_1000240517 162
143 3300025909 Ga0207705_10108003 Ga0207705_101080033 162
144 3300025921 Ga0207652_10059834 Ga0207652_100598343 162
145 3300025927 Ga0207687_10000043 Ga0207687_100000432 162
146 3300026116 Ga0207674_10265942 Ga0207674_102659422 162
147 3300031711 Ga0265314_10124302 Ga0265314_101243022 162

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s9c-assembly1.cif.gz_B cryo-em structure of dolphin prestin: sensor down ii (expanded ii) state 0.866 39 87
7s9d-assembly1.cif.gz_B cryo-em structure of dolphin prestin: intermediate state 0.8636 39 87
8opq-assembly1.cif.gz_A structure of human solute carrier 26 family member a6 (slc26a6) anion transporter in an inward-facing state 0.8499 38 87
3oir-assembly1.cif.gz_A crystal structure of sulfate transporter family protein from wolinella succinogenes 0.8215 17 88
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.7993 7 88
ID Description Score Start End Superfamily
af_Q09764_608_740_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8571 39 75 3.30.750.24
af_Q8NG04_406_544_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8416 39 88 3.30.750.24
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8339 33 88 3.30.750.24
af_G5EC30_461_581_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7597 33 96 3.30.750.24
af_A0A1D8PRZ2_628_764_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7584 17 97 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A538Q4V7-F1-model_v4 STAS domain-containing protein 0.9659 8 157
AF-A0A538Q4V7-F1-model_v4 STAS domain-containing protein 0.9473 8 157
AF-A0A7W0VYC3-F1-model_v4 STAS domain-containing protein 0.9226 10 161
AF-A0A7W0VYC3-F1-model_v4 STAS domain-containing protein 0.9052 10 161
AF-A0A7J5EU94-F1-model_v4 Uncharacterized protein 0.897 2 158

Feature Viewer

pLDDT pTM Quality
90.45 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map