F185830

General Info

Members Datasets Scaffolds Average Seq Length
142 117 284 156

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10457312|Ga0213876_104573121
Length 170
Sequence MAKQHEYRLTTTWTGNRGQGTADYRAYSRDHELRAPGKKQVLPGSSDPAFRGDGSRYNPEELLVGSLSACHMLWILHLCADAGITVTEYTDEASGVMREQADGAAEFTSVTLRPRVTITDPEQIEEAQALHERAHQLCFIARSVKFPVRHEPVTVAEKRAPKTNSSSDAV

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
117 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 2.11
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 4.23
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 18.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10457312 3300021384 Bacteria 679
2 rootL2_10208216 3300003322 Bacteria 9210
3 rootH1_10082801 3300003323 Bacteria 15340
4 Ga0065714_10005169 3300005288 Bacteria 13494
5 Ga0065714_10157084 3300005288 Bacteria 1072
6 Ga0065715_10191664 3300005293 Unclassified 1411
7 Ga0070658_10328454 3300005327 Bacteria 1307
8 Ga0070680_101197338 3300005336 Bacteria 657
9 Ga0070660_100073791 3300005339 Bacteria 2668
10 Ga0070661_100112268 3300005344 Bacteria 2036
11 Ga0070669_100808010 3300005353 Unclassified 797
12 Ga0070659_100291830 3300005366 Bacteria 1358
13 Ga0070714_100034444 3300005435 Bacteria 4241
14 Ga0070714_100095080 3300005435 Unclassified 2616
15 Ga0070713_100806122 3300005436 Bacteria 900
16 Ga0070711_100020516 3300005439 Unclassified 4260
17 Ga0070705_101067350 3300005440 Unclassified 659
18 Ga0070708_100220944 3300005445 Unclassified 1777
19 Ga0070678_100057671 3300005456 Unclassified 2846
20 Ga0070681_10932007 3300005458 Unclassified 787
21 Ga0070707_100000517 3300005468 Bacteria 38472
22 Ga0070707_100022911 3300005468 Bacteria 5905
23 Ga0070698_100050727 3300005471 Bacteria 4228
24 Ga0070699_100730875 3300005518 Unclassified 905
25 Ga0070697_100103887 3300005536 Bacteria 2362
26 Ga0068853_100129591 3300005539 Unclassified 2257
27 Ga0070696_101068629 3300005546 Bacteria 677
28 Ga0070704_100000278 3300005549 Bacteria 22517
29 Ga0068855_100009010 3300005563 Bacteria 12058
30 Ga0068856_100228746 3300005614 Unclassified 1875
31 Ga0070717_10010519 3300006028 Bacteria 6991
32 Ga0070716_100051775 3300006173 Bacteria 2336
33 Ga0075366_10376045 3300006195 Bacteria 873
34 Ga0097621_100655191 3300006237 Unclassified 964
35 Ga0075428_100299545 3300006844 Bacteria 1729
36 Ga0075434_100351035 3300006871 Unclassified 1496
37 Ga0105240_10001115 3300009093 Bacteria 47291
38 Ga0111539_10039450 3300009094 Bacteria 5691
39 Ga0105247_10193950 3300009101 Bacteria 1361
40 Ga0114129_11090464 3300009147 Bacteria 1000
41 Ga0105243_11237201 3300009148 Bacteria 761
42 Ga0105238_10062364 3300009551 Bacteria 3728
43 Ga0157373_10094621 3300013100 Bacteria 2103
44 Ga0157373_10732205 3300013100 Bacteria 726
45 Ga0157370_10001525 3300013104 Bacteria 28645
46 Ga0157369_10016099 3300013105 Bacteria 8414
47 Ga0157369_10608245 3300013105 Unclassified 1128
48 Ga0157375_11622900 3300013308 Bacteria 765
49 Ga0157380_10497483 3300014326 Unclassified 1183
50 Ga0157376_10089897 3300014969 Bacteria 2656
51 Ga0213872_10004106 3300021361 Bacteria 7836
52 Ga0213875_10083992 3300021388 Bacteria 1486
53 Ga0224572_1035206 3300024225 Unclassified 950
54 Ga0207699_10172286 3300025906 Bacteria 1449
55 Ga0207684_10003819 3300025910 Bacteria 14513
56 Ga0207707_10696946 3300025912 Unclassified 853
57 Ga0207707_10719263 3300025912 Unclassified 837
58 Ga0207663_10156939 3300025916 Bacteria 1602
59 Ga0207657_10074722 3300025919 Bacteria 2861
60 Ga0207649_10083838 3300025920 Bacteria 2070
61 Ga0207646_10001517 3300025922 Bacteria 28533
62 Ga0207646_10074742 3300025922 Bacteria 3027
63 Ga0207700_10560800 3300025928 Bacteria 1014
64 Ga0207664_10043717 3300025929 Bacteria 3506
65 Ga0207664_10094548 3300025929 Unclassified 2457
66 Ga0207664_10115672 3300025929 Bacteria 2237
67 Ga0207664_10125753 3300025929 Bacteria 2152
68 Ga0207690_10254526 3300025932 Bacteria 1358
69 Ga0207665_10082533 3300025939 Bacteria 2215
70 Ga0207667_10027184 3300025949 Bacteria 6235
71 Ga0207678_10676715 3300026067 Bacteria 907
72 Ga0207683_10429188 3300026121 Unclassified 1218
73 Ga0207428_10072174 3300027907 Bacteria 2710
74 Ga0265336_10039901 3300028666 Bacteria 1438
75 Ga0265760_10000528 3300031090 Bacteria 10748
76 Ga0265760_10028711 3300031090 Bacteria 1633
77 Ga0265760_10106154 3300031090 Unclassified 891
78 Ga0265332_10009838 3300031238 Bacteria 4262
79 Ga0265328_10007148 3300031239 Bacteria 4673
80 Ga0265320_10005586 3300031240 Bacteria 8048
81 Ga0265340_10004893 3300031247 Bacteria 7454
82 Ga0265331_10002260 3300031250 Bacteria 13168
83 Ga0265316_10024582 3300031344 Bacteria 5042
84 Ga0307408_101292999 3300031548 Bacteria 683
85 Ga0265342_10004885 3300031712 Bacteria 10380
86 Ga0307407_10200966 3300031903 Bacteria 1336
87 Ga0307414_10001424 3300032004 Bacteria 12417
88 Ga0307415_100684374 3300032126 Bacteria 923
89 Ga0395899_0015323 3300037312 Bacteria 5842
90 Ga0395899_0256185 3300037312 Bacteria 1199
91 Ga0395900_0015718 3300037418 Bacteria 7716
92 Ga0395900_0113136 3300037418 Bacteria 2786
93 Ga0395898_0011002 3300037466 Bacteria 9428
94 Ga0395898_0346678 3300037466 Bacteria 1416
95 Ga0436364_0026955 3300037853 Bacteria 9629
96 Ga0436364_0273345 3300037853 Bacteria 2794207
97 Ga0436364_1277675 3300037853 Bacteria 2340
98 Ga0395901_0008614 3300038443 Bacteria 10309
99 Ga0395901_0041978 3300038443 Bacteria 4740
100 Ga0436365_0145643 3300039437 Bacteria 1537
101 Ga0436360_0682444 3300039438 Bacteria 917
102 Ga0436361_0659795 3300039447 Bacteria 3565
103 Ga0436363_0827159 3300039450 Bacteria 1323
104 Ga0436362_0164082 3300039453 Unclassified 506
105 Ga0466982_0190889 3300044672 Unclassified 1233
106 Ga0466966_0192177 3300044684 Bacteria 1236
107 Ga0466966_0212544 3300044684 Bacteria 1169
108 Ga0466963_0239677 3300044694 Bacteria 1272
109 Ga0466957_0015155 3300044842 Bacteria 4499
110 Ga0466958_0007757 3300045836 Bacteria 5922
111 Ga0495625_0236442 3300046660 Unclassified 1191
112 Ga0496100_0811491 3300048903 Unclassified 733
113 Ga0496104_0205915 3300048907 Bacteria 1879
114 Ga0496104_0258896 3300048907 Unclassified 1653
115 Ga0496105_0067795 3300048908 Bacteria 2946
116 Ga0496115_0006483 3300048918 Bacteria 8579
117 Ga0496115_0031745 3300048918 Bacteria 4163
118 Ga0496117_0136595 3300048920 Bacteria 1476
119 Ga0496119_0006434 3300048922 Bacteria 10887
120 Ga0496120_0003372 3300048923 Bacteria 14628
121 Ga0501299_111503 3300049522 Bacteria 648
122 Ga0501032_0057215 3300049569 Bacteria 2620
123 Ga0501033_0005616 3300049570 Bacteria 9911
124 Ga0501034_0273091 3300049571 Bacteria 1631
125 Ga0501038_0097683 3300049574 Bacteria 2450
126 Ga0501039_0167680 3300049575 Bacteria 1726
127 Ga0501043_0011508 3300049579 Bacteria 6925
128 Ga0501046_0024917 3300049580 Bacteria 4901
129 Ga0501048_0119919 3300049582 Bacteria 1858
130 Ga0501069_0331145 3300049585 Bacteria 896
131 Ga0501070_0226430 3300049586 Bacteria 1533
132 Ga0501209_055423 3300049656 Bacteria 1093
133 Ga0501080_0235402 3300049742 Bacteria 1673
134 Ga0501080_0724263 3300049742 Bacteria 876
135 Ga0501044_0159369 3300049823 Bacteria 2234
136 nmdc:mga05p37_1070867_c1 3300050507 Bacteria 848
137 nmdc:mga08y16_1205906_c1 3300050511 Bacteria 727
138 nmdc:mga08y16_1932641_c1 3300050511 Bacteria 540
139 nmdc:mga08y16_311916_c1 3300050511 Bacteria 1620
140 nmdc:mga08y16_753750_c1 3300050511 Bacteria 970
141 2758224325 2757320536 Bacteria 3629334
142 8046355891 8046352972 Bacteria 3613806
143 Ga0213876_10457312
144 rootL2_10208216
145 rootH1_10082801
146 Ga0065714_10005169
147 Ga0065714_10157084
148 Ga0065715_10191664
149 Ga0070658_10328454
150 Ga0070680_101197338
151 Ga0070660_100073791
152 Ga0070661_100112268
153 Ga0070669_100808010
154 Ga0070659_100291830
155 Ga0070714_100034444
156 Ga0070714_100095080
157 Ga0070713_100806122
158 Ga0070711_100020516
159 Ga0070705_101067350
160 Ga0070708_100220944
161 Ga0070678_100057671
162 Ga0070681_10932007
163 Ga0070707_100000517
164 Ga0070707_100022911
165 Ga0070698_100050727
166 Ga0070699_100730875
167 Ga0070697_100103887
168 Ga0068853_100129591
169 Ga0070696_101068629
170 Ga0070704_100000278
171 Ga0068855_100009010
172 Ga0068856_100228746
173 Ga0070717_10010519
174 Ga0070716_100051775
175 Ga0075366_10376045
176 Ga0097621_100655191
177 Ga0075428_100299545
178 Ga0075434_100351035
179 Ga0105240_10001115
180 Ga0111539_10039450
181 Ga0105247_10193950
182 Ga0114129_11090464
183 Ga0105243_11237201
184 Ga0105238_10062364
185 Ga0157373_10094621
186 Ga0157373_10732205
187 Ga0157370_10001525
188 Ga0157369_10016099
189 Ga0157369_10608245
190 Ga0157375_11622900
191 Ga0157380_10497483
192 Ga0157376_10089897
193 Ga0213872_10004106
194 Ga0213875_10083992
195 Ga0224572_1035206
196 Ga0207699_10172286
197 Ga0207684_10003819
198 Ga0207707_10696946
199 Ga0207707_10719263
200 Ga0207663_10156939
201 Ga0207657_10074722
202 Ga0207649_10083838
203 Ga0207646_10001517
204 Ga0207646_10074742
205 Ga0207700_10560800
206 Ga0207664_10043717
207 Ga0207664_10094548
208 Ga0207664_10115672
209 Ga0207664_10125753
210 Ga0207690_10254526
211 Ga0207665_10082533
212 Ga0207667_10027184
213 Ga0207678_10676715
214 Ga0207683_10429188
215 Ga0207428_10072174
216 Ga0265336_10039901
217 Ga0265760_10000528
218 Ga0265760_10028711
219 Ga0265760_10106154
220 Ga0265332_10009838
221 Ga0265328_10007148
222 Ga0265320_10005586
223 Ga0265340_10004893
224 Ga0265331_10002260
225 Ga0265316_10024582
226 Ga0307408_101292999
227 Ga0265342_10004885
228 Ga0307407_10200966
229 Ga0307414_10001424
230 Ga0307415_100684374
231 Ga0395899_0015323
232 Ga0395899_0256185
233 Ga0395900_0015718
234 Ga0395900_0113136
235 Ga0395898_0011002
236 Ga0395898_0346678
237 Ga0436364_0026955
238 Ga0436364_0273345
239 Ga0436364_1277675
240 Ga0395901_0008614
241 Ga0395901_0041978
242 Ga0436365_0145643
243 Ga0436360_0682444
244 Ga0436361_0659795
245 Ga0436363_0827159
246 Ga0436362_0164082
247 Ga0466982_0190889
248 Ga0466966_0192177
249 Ga0466966_0212544
250 Ga0466963_0239677
251 Ga0466957_0015155
252 Ga0466958_0007757
253 Ga0495625_0236442
254 Ga0496100_0811491
255 Ga0496104_0205915
256 Ga0496104_0258896
257 Ga0496105_0067795
258 Ga0496115_0006483
259 Ga0496115_0031745
260 Ga0496117_0136595
261 Ga0496119_0006434
262 Ga0496120_0003372
263 Ga0501299_111503
264 Ga0501032_0057215
265 Ga0501033_0005616
266 Ga0501034_0273091
267 Ga0501038_0097683
268 Ga0501039_0167680
269 Ga0501043_0011508
270 Ga0501046_0024917
271 Ga0501048_0119919
272 Ga0501069_0331145
273 Ga0501070_0226430
274 Ga0501209_055423
275 Ga0501080_0235402
276 Ga0501080_0724263
277 Ga0501044_0159369
278 nmdc:mga05p37_1070867_c1
279 nmdc:mga08y16_1205906_c1
280 nmdc:mga08y16_1932641_c1
281 nmdc:mga08y16_311916_c1
282 nmdc:mga08y16_753750_c1
283 2758224325
284 8046355891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

52

152

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.898 5 153
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8762 4 157
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8704 4 157
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.865 5 153
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.8353 3 154
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8878 6 153 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8663 6 153 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8499 11 157 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8382 11 157 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8267 3 154 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A0Q6KAI3-F1-model_v4 Peroxiredoxin 0.9972 4 157
AF-A0A1H2AZC8-F1-model_v4 Organic hydroperoxide reductase OsmC/OhrA 0.9963 4 157
AF-A0A5C6RFS3-F1-model_v4 OsmC family peroxiredoxin 0.9955 4 157
AF-A0A2I9D7Q6-F1-model_v4 deleted 0.9942 4 156
AF-A0A0N1E2P5-F1-model_v4 Peroxiredoxin 0.9928 4 157

Map