F154510

General Info

Members Datasets Scaffolds Average Seq Length
132 99 264 301

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991436|2819544111
Length 356
Sequence LAASSKPFRQASSAGNCLLMRIRPFPSLRFDVALKTLTWQHIFITQQYFHPMPIPDYQTCMLPLLRFLGDGVEHSLRDAEEALAEQFHLSPLERVKLLPSGQQGVFKNRIGWARTYLKKACLIELPKRAVSKITERGKQVLAANPSKIDIKYLEQWPEFIEFRDSSKQNSKATLSEELTSAETTPEETIELASQGLREQLAQTLLSRILSCSPTFFEQLVLELLVKMGYGGSRRDAGERVGQTGDGGIDGIIKEDRLGLDTIFIQAKRWQDSVGRPEIQKFVGALQGQRARKGVFITTSVYTAEAVDYASRIDTKVVLIDGKQLAGLMIDFDIGVSVSASYVVKRVDSDYFEETDF

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
4 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
13 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
50 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
56 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
57 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
58 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
63 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
68 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
83 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
91 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
92 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
95 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
96 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 2818991436 Collimonas arenae 515 Isolate Unclassified
99 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 1.52
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 1.52
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10111527 3300005295 Bacteria 2392
2 Ga0068868_100365194 3300005338 Bacteria 1239
3 Ga0070708_100029855 3300005445 Bacteria 4706
4 Ga0070681_10013372 3300005458 Bacteria 8155
5 Ga0070681_10173790 3300005458 Bacteria 2076
6 Ga0070698_100212014 3300005471 Bacteria 1871
7 Ga0070679_100042002 3300005530 Bacteria 4553
8 Ga0068859_100187349 3300005617 Bacteria 2153
9 Ga0081538_10051490 3300005981 Bacteria 2472
10 Ga0081538_10056582 3300005981 Unclassified 2296
11 Ga0081539_10012050 3300005985 Bacteria 6724
12 Ga0075428_100053336 3300006844 Bacteria 4430
13 Ga0075431_100150545 3300006847 Bacteria 2396
14 Ga0075433_10001975 3300006852 Bacteria 15423
15 Ga0075433_10031666 3300006852 Bacteria 4522
16 Ga0075433_10122101 3300006852 Unclassified 2313
17 Ga0075433_10220842 3300006852 Unclassified 1683
18 Ga0075434_100001053 3300006871 Bacteria 22503
19 Ga0075434_100261393 3300006871 Bacteria 1750
20 Ga0075434_100368848 3300006871 Bacteria 1457
21 Ga0075429_100119970 3300006880 Bacteria 2298
22 Ga0097620_100187360 3300006931 Bacteria 2153
23 Ga0075435_100129113 3300007076 Bacteria 2114
24 Ga0105240_10067578 3300009093 Unclassified 4430
25 Ga0111539_10061998 3300009094 Unclassified 4428
26 Ga0111539_10129128 3300009094 Unclassified 2960
27 Ga0114129_10001839 3300009147 Bacteria 28890
28 Ga0114129_10025055 3300009147 Archaea 8455
29 Ga0114129_10456468 3300009147 Bacteria 1675
30 Ga0105243_10829724 3300009148 Bacteria 914
31 Ga0105248_10011674 3300009177 Bacteria 9680
32 Ga0105237_10271299 3300009545 Unclassified 1699
33 Ga0105238_10013087 3300009551 Bacteria 8370
34 Ga0105246_10333068 3300011119 Bacteria 1238
35 Ga0157370_10504014 3300013104 Bacteria 1111
36 Ga0163162_10002423 3300013306 Bacteria 17568
37 Ga0163162_10554479 3300013306 Unclassified 1277
38 Ga0157372_10439755 3300013307 Unclassified 1520
39 Ga0157375_10192777 3300013308 Bacteria 2193
40 Ga0157380_10050671 3300014326 Bacteria 3280
41 Ga0157380_10063628 3300014326 Bacteria 2959
42 Ga0157379_10296620 3300014968 Bacteria 1473
43 Ga0213872_10000405 3300021361 Bacteria 35574
44 Ga0207697_10011138 3300025315 Bacteria 3812
45 Ga0207688_10056480 3300025901 Bacteria 2205
46 Ga0207707_10025029 3300025912 Bacteria 5222
47 Ga0207707_10042749 3300025912 Bacteria 3954
48 Ga0207671_10134809 3300025914 Unclassified 1898
49 Ga0207652_10070762 3300025921 Bacteria 3030
50 Ga0207694_10133171 3300025924 Unclassified 1994
51 Ga0207711_10013484 3300025941 Bacteria 6786
52 Ga0207661_10465197 3300025944 Bacteria 1153
53 Ga0265319_1000531 3300028563 Bacteria 26056
54 Ga0265322_10000747 3300028654 Bacteria 11838
55 Ga0265330_10004601 3300031235 Bacteria 6980
56 Ga0265320_10004448 3300031240 Bacteria 9184
57 Ga0265331_10002988 3300031250 Bacteria 11126
58 Ga0316575_10031072 3300031665 Bacteria 2090
59 Ga0316576_10093310 3300031727 Bacteria 2243
60 Ga0316577_10041832 3300031733 Bacteria 2564
61 Ga0307414_10021561 3300032004 Bacteria 4046
62 Ga0316580_10060846 3300032139 Bacteria 1159
63 Ga0316593_10061129 3300032168 Bacteria 1288
64 Ga0316588_1011963 3300033528 Bacteria 1861
65 Ga0316574_0058765 3300035398 Bacteria 2409
66 Ga0316582_0184913 3300036647 Bacteria 1418
67 Ga0316584_0000278 3300036712 Bacteria 26081
68 Ga0316584_0056662 3300036712 Bacteria 2933
69 Ga0400484_03210 3300038725 Bacteria 1216
70 Ga0400490_31453 3300038726 Unclassified 1185
71 Ga0400486_14580 3300038742 Bacteria 1208
72 Ga0400489_75971 3300039093 Bacteria 8883
73 Ga0436361_0729108 3300039447 Bacteria 59083
74 Ga0451577_0000001 3300042876 Bacteria 2461803
75 Ga0453684_0000046 3300044712 Bacteria 575242
76 Ga0453684_0024826 3300044712 Bacteria 8735
77 Ga0453684_0049301 3300044712 Bacteria 5556
78 Ga0453684_0051077 3300044712 Bacteria 5427
79 Ga0453684_0080107 3300044712 Unclassified 4079
80 Ga0453684_0259844 3300044712 Unclassified 1990
81 Ga0495650_0000499 3300046471 Bacteria 59360
82 Ga0495605_0000005 3300046474 Bacteria 376973
83 Ga0495605_0139546 3300046474 Bacteria 1088
84 Ga0495610_0000014 3300046512 Bacteria 444708
85 Ga0495628_0035805 3300046516 Bacteria 3988
86 Ga0495643_0001079 3300046522 Bacteria 27199
87 Ga0495687_006860 3300047443 Bacteria 6864
88 Ga0495626_0000997 3300048091 Bacteria 24339
89 Ga0496109_0320876 3300048912 Bacteria 1462
90 Ga0496124_0024144 3300048927 Bacteria 5534
91 Ga0501031_0038251 3300049568 Bacteria 3132
92 Ga0501032_0002674 3300049569 Bacteria 13907
93 Ga0501033_0006340 3300049570 Bacteria 9271
94 Ga0501036_0026388 3300049572 Bacteria 4903
95 Ga0501036_0346188 3300049572 Bacteria 1241
96 Ga0501037_0083684 3300049573 Bacteria 2311
97 Ga0501038_0003576 3300049574 Bacteria 14462
98 Ga0501038_0233807 3300049574 Bacteria 1461
99 Ga0501043_0025256 3300049579 Bacteria 4660
100 Ga0501047_0002772 3300049581 Bacteria 16650
101 Ga0501047_0031968 3300049581 Bacteria 5078
102 Ga0501048_0023825 3300049582 Bacteria 4470
103 Ga0501048_0063257 3300049582 Bacteria 2617
104 Ga0501048_0253487 3300049582 Bacteria 1250
105 Ga0501068_0132742 3300049584 Bacteria 1558
106 Ga0501070_0221624 3300049586 Bacteria 1551
107 Ga0501075_0065565 3300049591 Bacteria 2740
108 Ga0501076_0077526 3300049592 Bacteria 2666
109 Ga0501079_0070437 3300049741 Bacteria 2700
110 Ga0501081_0144464 3300049743 Unclassified 1706
111 Ga0501035_0000506 3300049822 Bacteria 43989
112 Ga0501035_0019475 3300049822 Bacteria 6239
113 Ga0501044_0007676 3300049823 Bacteria 11861
114 Ga0501044_0043012 3300049823 Bacteria 4694
115 nmdc:mga05p37_38846_c1 3300050507 Bacteria 5840
116 nmdc:mga09592_112103_c1 3300050508 Bacteria 2340
117 nmdc:mga0qj67_131263_c1 3300050509 Unclassified 2029
118 nmdc:mga0n895_2357_c1 3300050512 Bacteria 14725
119 nmdc:mga0n895_367296_c1 3300050512 Bacteria 1457
120 nmdc:mga0n895_393269_c1 3300050512 Bacteria 1402
121 nmdc:mga0n895_565_c1 3300050512 Bacteria 25416
122 nmdc:mga0rr50_2301_c1 3300050513 Bacteria 10712
123 nmdc:mga0a205_204941_c1 3300050515 Unclassified 1862
124 nmdc:mga0a205_33567_c1 3300050515 Bacteria 4920
125 nmdc:mga0a205_57502_c2 3300050515 Unclassified 2634
126 nmdc:mga0a205_782_c2 3300050515 Bacteria 21774
127 Ga0500588_0004881 3300053146 Bacteria 2936
128 Ga0500619_035964 3300053154 Bacteria 1540
129 Ga0500636_0000086 3300053177 Bacteria 46124
130 Ga0501084_0189447 3300054114 Bacteria 1735
131 2819544111 2818991436 Bacteria 5376622
132 2787435938 2786546517 Bacteria 6614109
133 Ga0065707_10111527
134 Ga0068868_100365194
135 Ga0070708_100029855
136 Ga0070681_10013372
137 Ga0070681_10173790
138 Ga0070698_100212014
139 Ga0070679_100042002
140 Ga0068859_100187349
141 Ga0081538_10051490
142 Ga0081538_10056582
143 Ga0081539_10012050
144 Ga0075428_100053336
145 Ga0075431_100150545
146 Ga0075433_10001975
147 Ga0075433_10031666
148 Ga0075433_10122101
149 Ga0075433_10220842
150 Ga0075434_100001053
151 Ga0075434_100261393
152 Ga0075434_100368848
153 Ga0075429_100119970
154 Ga0097620_100187360
155 Ga0075435_100129113
156 Ga0105240_10067578
157 Ga0111539_10061998
158 Ga0111539_10129128
159 Ga0114129_10001839
160 Ga0114129_10025055
161 Ga0114129_10456468
162 Ga0105243_10829724
163 Ga0105248_10011674
164 Ga0105237_10271299
165 Ga0105238_10013087
166 Ga0105246_10333068
167 Ga0157370_10504014
168 Ga0163162_10002423
169 Ga0163162_10554479
170 Ga0157372_10439755
171 Ga0157375_10192777
172 Ga0157380_10050671
173 Ga0157380_10063628
174 Ga0157379_10296620
175 Ga0213872_10000405
176 Ga0207697_10011138
177 Ga0207688_10056480
178 Ga0207707_10025029
179 Ga0207707_10042749
180 Ga0207671_10134809
181 Ga0207652_10070762
182 Ga0207694_10133171
183 Ga0207711_10013484
184 Ga0207661_10465197
185 Ga0265319_1000531
186 Ga0265322_10000747
187 Ga0265330_10004601
188 Ga0265320_10004448
189 Ga0265331_10002988
190 Ga0316575_10031072
191 Ga0316576_10093310
192 Ga0316577_10041832
193 Ga0307414_10021561
194 Ga0316580_10060846
195 Ga0316593_10061129
196 Ga0316588_1011963
197 Ga0316574_0058765
198 Ga0316582_0184913
199 Ga0316584_0000278
200 Ga0316584_0056662
201 Ga0400484_03210
202 Ga0400490_31453
203 Ga0400486_14580
204 Ga0400489_75971
205 Ga0436361_0729108
206 Ga0451577_0000001
207 Ga0453684_0000046
208 Ga0453684_0024826
209 Ga0453684_0049301
210 Ga0453684_0051077
211 Ga0453684_0080107
212 Ga0453684_0259844
213 Ga0495650_0000499
214 Ga0495605_0000005
215 Ga0495605_0139546
216 Ga0495610_0000014
217 Ga0495628_0035805
218 Ga0495643_0001079
219 Ga0495687_006860
220 Ga0495626_0000997
221 Ga0496109_0320876
222 Ga0496124_0024144
223 Ga0501031_0038251
224 Ga0501032_0002674
225 Ga0501033_0006340
226 Ga0501036_0026388
227 Ga0501036_0346188
228 Ga0501037_0083684
229 Ga0501038_0003576
230 Ga0501038_0233807
231 Ga0501043_0025256
232 Ga0501047_0002772
233 Ga0501047_0031968
234 Ga0501048_0023825
235 Ga0501048_0063257
236 Ga0501048_0253487
237 Ga0501068_0132742
238 Ga0501070_0221624
239 Ga0501075_0065565
240 Ga0501076_0077526
241 Ga0501079_0070437
242 Ga0501081_0144464
243 Ga0501035_0000506
244 Ga0501035_0019475
245 Ga0501044_0007676
246 Ga0501044_0043012
247 nmdc:mga05p37_38846_c1
248 nmdc:mga09592_112103_c1
249 nmdc:mga0qj67_131263_c1
250 nmdc:mga0n895_2357_c1
251 nmdc:mga0n895_367296_c1
252 nmdc:mga0n895_393269_c1
253 nmdc:mga0n895_565_c1
254 nmdc:mga0rr50_2301_c1
255 nmdc:mga0a205_204941_c1
256 nmdc:mga0a205_33567_c1
257 nmdc:mga0a205_57502_c2
258 nmdc:mga0a205_782_c2
259 Ga0500588_0004881
260 Ga0500619_035964
261 Ga0500636_0000086
262 Ga0501084_0189447
263 2819544111
264 2787435938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14338

Mrr_N

Mrr N-terminal domain

57

143

0.99

PF04471

Mrr_cat

Restriction endonuclease

208

328

0.97

PF13156

Mrr_cat_2

Restriction endonuclease

233

339

0.88

PF22722

NA-iREase1

NACHT-associated inactive Restriction Endonuclease 1

216

325

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e38-assembly1.cif.gz_B structural basis of mapping the spontaneous mutations with 5-flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis 0.7634 225 271
3b73-assembly1.cif.gz_A crystal structure of the phih1 repressor-like protein from haloarcula marismortui 0.735 9 97
1cf7-assembly1.cif.gz_B structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp 0.7292 5 83
1y88-assembly1.cif.gz_A crystal structure of protein of unknown function af1548 0.7181 166 282
4v7h-assembly1.cif.gz_AT structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution 0.6984 13 92
ID Description Score Start End Superfamily
af_I6Y9K2_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9892 7 91 1.10.10.10
af_I6Y9K2_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9667 7 91 1.10.10.10
af_P24202_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 7 91 1.10.10.10
af_P24202_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9079 7 91 1.10.10.10
af_P24202_139_297_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8916 132 294 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A2V8NEY3-F1-model_v4 Restriction endonuclease 0.9982 1 90 GO:0004519
AF-T0Y3W2-F1-model_v4 Mrr restriction system protein 0.9942 1 84
AF-A0A7W1UIA1-F1-model_v4 Restriction system protein Mrr-like N-terminal domain-containing protein 0.9929 1 109
AF-A0A1W6ST73-F1-model_v4 Restriction system protein Mrr-like N-terminal domain-containing protein 0.9891 1 95
AF-A0A7V7WHB1-F1-model_v4 Restriction endonuclease 0.9854 1 105 GO:0004519

Map