F130954

General Info

Members Datasets Scaffolds Average Seq Length
126 93 125 208

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000324|Ga0265327_1000032453
Length 228
Sequence MKVLGLTGSIGQGKSTAARMLRRLGLPVHDADATVHRLLAPGGGAVGPIAAAFPGTVTAGAVDRGRLGQLVFADPAALRRLEAILHPLVRAAERDFLKRQARRRRRLAVLDIPLLFETGGERRCDAVAVVVAPAFLQRQRVLRRPGMTAARLAAIRAQQLPDALKTRRADFVVPTGTGMVPALRRLKAAVKVLVSRPGRGKWPPGPSIHRGGPCARSSSTPKPPASTR

Samples

Sample ID Description Type Environment
1 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
22 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
50 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
51 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
52 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
53 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
87 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
88 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
89 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
90 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
91 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
92 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.32
Nodule 0.79
Rhizoplane 0
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000067 3300003215 Bacteria 118869
2 Ga0055542_1010800 3300003762 Bacteria 1651
3 Ga0070671_100161715 3300005355 Bacteria 1893
4 Ga0070714_101031158 3300005435 Bacteria 801
5 Ga0070713_100080261 3300005436 Bacteria 2781
6 Ga0070681_10212763 3300005458 Bacteria 1849
7 Ga0070698_100012913 3300005471 Bacteria 8845
8 Ga0070698_100584674 3300005471 Bacteria 1057
9 Ga0070665_100001288 3300005548 Bacteria 30002
10 Ga0068855_100467145 3300005563 Bacteria 1375
11 Ga0070702_100268544 3300005615 Bacteria 1165
12 Ga0081540_1010421 3300005983 Bacteria 6298
13 Ga0099795_10056830 3300007788 Bacteria 1441
14 Ga0105240_10132620 3300009093 Bacteria 2986
15 Ga0105240_10171937 3300009093 Bacteria 2565
16 Ga0111539_10780349 3300009094 Bacteria 1112
17 Ga0105237_10457096 3300009545 Bacteria 1283
18 Ga0105238_10006157 3300009551 Bacteria 11909
19 Ga0105238_10099241 3300009551 Bacteria 2895
20 Ga0105249_11319901 3300009553 Bacteria 793
21 Ga0105239_10592601 3300010375 Bacteria 1264
22 Ga0157379_10184946 3300014968 Bacteria 1882
23 Ga0213873_10027422 3300021358 Bacteria 1389
24 Ga0213872_10014586 3300021361 Bacteria 3664
25 Ga0213872_10121809 3300021361 Bacteria 1153
26 Ga0213876_10072568 3300021384 Bacteria 1818
27 Ga0213876_10126385 3300021384 Bacteria 1358
28 Ga0209148_1001594 3300025254 Bacteria 10675
29 Ga0209455_1003836 3300025272 Bacteria 5145
30 Ga0209676_1000783 3300025292 Bacteria 42336
31 Ga0209758_1000284 3300025297 Bacteria 100315
32 Ga0209050_1007936 3300025298 Bacteria 5814
33 Ga0207707_10172393 3300025912 Bacteria 1890
34 Ga0207707_10193735 3300025912 Bacteria 1773
35 Ga0207695_10126313 3300025913 Bacteria 2519
36 Ga0207693_10108336 3300025915 Bacteria 2179
37 Ga0207646_10540399 3300025922 Bacteria 1048
38 Ga0207694_10000316 3300025924 Bacteria 45429
39 Ga0207664_10222207 3300025929 Bacteria 1638
40 Ga0207644_10140555 3300025931 Bacteria 1859
41 Ga0207670_10346261 3300025936 Bacteria 1176
42 Ga0268266_10000508 3300028379 Bacteria 54988
43 Ga0265324_10014342 3300029957 Bacteria 2935
44 Ga0265328_10000423 3300031239 Bacteria 19862
45 Ga0265331_10000150 3300031250 Bacteria 90008
46 Ga0265327_10000324 3300031251 Bacteria 90964
47 Ga0265327_10023748 3300031251 Bacteria 3620
48 Ga0265316_10059444 3300031344 Bacteria 2973
49 Ga0265313_10025256 3300031595 Bacteria 3154
50 Ga0265313_10044516 3300031595 Bacteria 2166
51 Ga0307412_10584963 3300031911 Bacteria 943
52 Ga0307409_100165959 3300031995 Bacteria 1938
53 Ga0307416_100146537 3300032002 Bacteria 2157
54 Ga0307414_10470879 3300032004 Bacteria 1106
55 Ga0307415_100352879 3300032126 Bacteria 1239
56 Ga0373934_0112224 3300035086 Bacteria 1106
57 Ga0373934_0147643 3300035086 Bacteria 962
58 Ga0373923_0072818 3300035111 Bacteria 1478
59 Ga0373953_0000798 3300035117 Bacteria 8788
60 Ga0373955_0019169 3300035172 Bacteria 3415
61 Ga0373961_0024972 3300035241 Bacteria 1621
62 Ga0373931_0298648 3300035691 Bacteria 994
63 Ga0373933_0217761 3300035724 Bacteria 1224
64 Ga0373947_0470735 3300035725 Bacteria 852
65 Ga0373937_0014522 3300036401 Bacteria 6954
66 Ga0373937_0019813 3300036401 Bacteria 6024
67 Ga0373925_0203511 3300037068 Bacteria 1575
68 Ga0395899_0169625 3300037312 Bacteria 1537
69 Ga0395900_0079980 3300037418 Bacteria 3359
70 Ga0436364_1016227 3300037853 Bacteria 971
71 Ga0395901_0029866 3300038443 Bacteria 5614
72 Ga0436365_0794820 3300039437 Bacteria 1516
73 Ga0436365_0899044 3300039437 Bacteria 4341
74 Ga0436365_1526895 3300039437 Bacteria 1203
75 Ga0436360_0365447 3300039438 Bacteria 2600
76 Ga0436360_0796790 3300039438 Bacteria 1418
77 Ga0436360_0902035 3300039438 Bacteria 3059
78 Ga0436361_0201953 3300039447 Bacteria 1455
79 Ga0436361_0246046 3300039447 Bacteria 19243
80 Ga0436361_0368527 3300039447 Unclassified 3340
81 Ga0436361_0651973 3300039447 Bacteria 4025
82 Ga0436361_1094701 3300039447 Bacteria 1085
83 Ga0436361_1199123 3300039447 Bacteria 1305
84 Ga0436363_1179474 3300039450 Bacteria 1105
85 Ga0436362_0250991 3300039453 Bacteria 1401
86 Ga0436362_0844612 3300039453 Bacteria 1685
87 Ga0436362_0933473 3300039453 Bacteria 2368
88 Ga0436362_1034618 3300039453 Unclassified 1117
89 Ga0451577_0006850 3300042876 Bacteria 11287
90 Ga0451577_0083158 3300042876 Bacteria 2855
91 Ga0451577_0118140 3300042876 Bacteria 2375
92 Ga0453684_0130468 3300044712 Bacteria 3016
93 Ga0453684_0247095 3300044712 Bacteria 2051
94 Ga0451576_0000056 3300045051 Bacteria 303398
95 Ga0451576_0000203 3300045051 Bacteria 149655
96 Ga0451576_0058390 3300045051 Bacteria 4032
97 Ga0451576_0069373 3300045051 Bacteria 3668
98 Ga0451576_0802193 3300045051 Bacteria 988
99 Ga0495592_0275162 3300046454 Unclassified 1103
100 Ga0495629_0119995 3300046459 Bacteria 1832
101 Ga0495580_0375440 3300046472 Bacteria 961
102 Ga0495594_0566961 3300046499 Bacteria 644
103 Ga0495667_0053762 3300046559 Bacteria 2651
104 Ga0495635_0019330 3300046663 Bacteria 4751
105 Ga0495599_0196743 3300046678 Bacteria 1239
106 Ga0501039_0655477 3300049575 Bacteria 822
107 Ga0501047_0241905 3300049581 Bacteria 1655
108 Ga0501073_0344498 3300049589 Bacteria 1029
109 Ga0501076_0390192 3300049592 Bacteria 1144
110 Ga0501080_0667313 3300049742 Bacteria 919
111 Ga0501083_0006018 3300049744 Bacteria 8595
112 Ga0501044_0010176 3300049823 Bacteria 10221
113 Ga0501044_0304827 3300049823 Bacteria 1521
114 Ga0495601_0077959 3300053077 Bacteria 2122
115 Ga0495595_0268212 3300053084 Bacteria 856
116 Ga0495619_0005086 3300053085 Bacteria 8351
117 Ga0495619_0011046 3300053085 Bacteria 5681
118 Ga0500641_0012250 3300053096 Bacteria 3129
119 Ga0500555_004186 3300053103 Bacteria 4107
120 Ga0500595_000251 3300053119 Bacteria 35565
121 Ga0500595_006832 3300053119 Bacteria 4802
122 Ga0500616_0000899 3300053153 Bacteria 32637
123 Ga0500609_004021 3300053731 Bacteria 2047
124 Ga0501084_0288579 3300054114 Bacteria 1386
125 Ga0501084_0667377 3300054114 Bacteria 877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1016227 Ga0436364_1016227_387_956 175
2 3300039447 Ga0436361_0246046 Ga0436361_0246046_7588_8202 178
3 3300005471 Ga0070698_100012913 Ga0070698_1000129136 183
4 3300005548 Ga0070665_100001288 Ga0070665_10000128815 183
5 3300005983 Ga0081540_1010421 Ga0081540_10104216 183
6 3300021358 Ga0213873_10027422 Ga0213873_100274222 183
7 3300025912 Ga0207707_10172393 Ga0207707_101723933 183
8 3300028379 Ga0268266_10000508 Ga0268266_100005085 183
9 3300039437 Ga0436365_1526895 Ga0436365_1526895_399_1049 183
10 3300039450 Ga0436363_1179474 Ga0436363_1179474_234_857 183
11 3300046499 Ga0495594_0566961 Ga0495594_0566961_20_625 183
12 3300021361 Ga0213872_10014586 Ga0213872_100145863 187
13 3300039447 Ga0436361_0651973 Ga0436361_0651973_2512_3186 187
14 3300003762 Ga0055542_1010800 Ga0055542_10108001 189
15 3300025254 Ga0209148_1001594 Ga0209148_100159412 189
16 3300025272 Ga0209455_1003836 Ga0209455_10038361 189
17 iso_pu_bacteria 2842333319 2842335348 190
18 3300025292 Ga0209676_1000783 Ga0209676_100078312 192
19 3300025298 Ga0209050_1007936 Ga0209050_10079363 192
20 3300042876 Ga0451577_0006850 Ga0451577_0006850_7663_8286 192
21 3300003215 JGI25153J46596_10000067 JGI25153J46596_1000006753 194
22 3300005355 Ga0070671_100161715 Ga0070671_1001617153 194
23 3300005435 Ga0070714_101031158 Ga0070714_1010311581 194
24 3300005436 Ga0070713_100080261 Ga0070713_1000802613 194
25 3300005458 Ga0070681_10212763 Ga0070681_102127632 194
26 3300005471 Ga0070698_100584674 Ga0070698_1005846742 194
27 3300005563 Ga0068855_100467145 Ga0068855_1004671452 194
28 3300005615 Ga0070702_100268544 Ga0070702_1002685442 194
29 3300007788 Ga0099795_10056830 Ga0099795_100568301 194
30 3300009093 Ga0105240_10132620 Ga0105240_101326202 194
31 3300009093 Ga0105240_10171937 Ga0105240_101719372 194
32 3300009094 Ga0111539_10780349 Ga0111539_107803492 194
33 3300009545 Ga0105237_10457096 Ga0105237_104570962 194
34 3300009551 Ga0105238_10006157 Ga0105238_1000615712 194
35 3300009551 Ga0105238_10099241 Ga0105238_100992412 194
36 3300009553 Ga0105249_11319901 Ga0105249_113199012 194
37 3300010375 Ga0105239_10592601 Ga0105239_105926012 194
38 3300014968 Ga0157379_10184946 Ga0157379_101849463 194
39 3300021361 Ga0213872_10121809 Ga0213872_101218092 194
40 3300021384 Ga0213876_10072568 Ga0213876_100725682 194
41 3300021384 Ga0213876_10126385 Ga0213876_101263852 194
42 3300025297 Ga0209758_1000284 Ga0209758_100028453 194
43 3300025912 Ga0207707_10193735 Ga0207707_101937352 194
44 3300025913 Ga0207695_10126313 Ga0207695_101263131 194
45 3300025915 Ga0207693_10108336 Ga0207693_101083363 194
46 3300025922 Ga0207646_10540399 Ga0207646_105403992 194
47 3300025924 Ga0207694_10000316 Ga0207694_1000031610 194
48 3300025929 Ga0207664_10222207 Ga0207664_102222072 194
49 3300025931 Ga0207644_10140555 Ga0207644_101405552 194
50 3300025936 Ga0207670_10346261 Ga0207670_103462612 194
51 3300029957 Ga0265324_10014342 Ga0265324_100143424 194
52 3300031239 Ga0265328_10000423 Ga0265328_100004238 194
53 3300031250 Ga0265331_10000150 Ga0265331_1000015010 194
54 3300031251 Ga0265327_10000324 Ga0265327_1000032453 194
55 3300031251 Ga0265327_10023748 Ga0265327_100237482 194
56 3300031344 Ga0265316_10059444 Ga0265316_100594443 194
57 3300031595 Ga0265313_10025256 Ga0265313_100252564 194
58 3300031595 Ga0265313_10044516 Ga0265313_100445163 194
59 3300031911 Ga0307412_10584963 Ga0307412_105849632 194
60 3300031995 Ga0307409_100165959 Ga0307409_1001659592 194
61 3300032002 Ga0307416_100146537 Ga0307416_1001465373 194
62 3300032004 Ga0307414_10470879 Ga0307414_104708792 194
63 3300032126 Ga0307415_100352879 Ga0307415_1003528792 194
64 3300035086 Ga0373934_0112224 Ga0373934_0112224_246_896 194
65 3300035086 Ga0373934_0147643 Ga0373934_0147643_33_668 194
66 3300035111 Ga0373923_0072818 Ga0373923_0072818_801_1451 194
67 3300035117 Ga0373953_0000798 Ga0373953_0000798_3384_4034 194
68 3300035172 Ga0373955_0019169 Ga0373955_0019169_805_1443 194
69 3300035241 Ga0373961_0024972 Ga0373961_0024972_649_1275 194
70 3300035691 Ga0373931_0298648 Ga0373931_0298648_150_803 194
71 3300035724 Ga0373933_0217761 Ga0373933_0217761_55_705 194
72 3300035725 Ga0373947_0470735 Ga0373947_0470735_123_761 194
73 3300036401 Ga0373937_0014522 Ga0373937_0014522_1511_2161 194
74 3300036401 Ga0373937_0019813 Ga0373937_0019813_3561_4196 194
75 3300037068 Ga0373925_0203511 Ga0373925_0203511_459_1094 194
76 3300037312 Ga0395899_0169625 Ga0395899_0169625_37_645 194
77 3300037418 Ga0395900_0079980 Ga0395900_0079980_2032_2643 194
78 3300038443 Ga0395901_0029866 Ga0395901_0029866_2621_3232 194
79 3300039437 Ga0436365_0794820 Ga0436365_0794820_502_1128 194
80 3300039437 Ga0436365_0899044 Ga0436365_0899044_593_1228 194
81 3300039438 Ga0436360_0365447 Ga0436360_0365447_1888_2514 194
82 3300039438 Ga0436360_0796790 Ga0436360_0796790_60_716 194
83 3300039438 Ga0436360_0902035 Ga0436360_0902035_1448_2095 194
84 3300039447 Ga0436361_0201953 Ga0436361_0201953_383_1009 194
85 3300039447 Ga0436361_0368527 Ga0436361_0368527_1786_2442 194
86 3300039447 Ga0436361_1094701 Ga0436361_1094701_247_903 194
87 3300039447 Ga0436361_1199123 Ga0436361_1199123_291_965 194
88 3300039453 Ga0436362_0250991 Ga0436362_0250991_559_1209 194
89 3300039453 Ga0436362_0844612 Ga0436362_0844612_213_839 194
90 3300039453 Ga0436362_0933473 Ga0436362_0933473_306_941 194
91 3300039453 Ga0436362_1034618 Ga0436362_1034618_243_971 194
92 3300042876 Ga0451577_0083158 Ga0451577_0083158_1270_1881 194
93 3300042876 Ga0451577_0118140 Ga0451577_0118140_540_1136 194
94 3300044712 Ga0453684_0130468 Ga0453684_0130468_2366_2956 194
95 3300044712 Ga0453684_0247095 Ga0453684_0247095_1277_1870 194
96 3300045051 Ga0451576_0000056 Ga0451576_0000056_102938_103549 194
97 3300045051 Ga0451576_0000203 Ga0451576_0000203_116694_117290 194
98 3300045051 Ga0451576_0058390 Ga0451576_0058390_1153_1749 194
99 3300045051 Ga0451576_0069373 Ga0451576_0069373_885_1478 194
100 3300045051 Ga0451576_0802193 Ga0451576_0802193_121_714 194
101 3300046454 Ga0495592_0275162 Ga0495592_0275162_49_699 194
102 3300046459 Ga0495629_0119995 Ga0495629_0119995_667_1305 194
103 3300046472 Ga0495580_0375440 Ga0495580_0375440_73_723 194
104 3300046559 Ga0495667_0053762 Ga0495667_0053762_391_1029 194
105 3300046663 Ga0495635_0019330 Ga0495635_0019330_2014_2652 194
106 3300046678 Ga0495599_0196743 Ga0495599_0196743_65_703 194
107 3300049575 Ga0501039_0655477 Ga0501039_0655477_122_712 194
108 3300049581 Ga0501047_0241905 Ga0501047_0241905_285_875 194
109 3300049589 Ga0501073_0344498 Ga0501073_0344498_213_803 194
110 3300049592 Ga0501076_0390192 Ga0501076_0390192_248_838 194
111 3300049742 Ga0501080_0667313 Ga0501080_0667313_192_791 194
112 3300049744 Ga0501083_0006018 Ga0501083_0006018_5793_6428 194
113 3300049823 Ga0501044_0010176 Ga0501044_0010176_7109_7699 194
114 3300049823 Ga0501044_0304827 Ga0501044_0304827_549_1190 194
115 3300053077 Ga0495601_0077959 Ga0495601_0077959_815_1453 194
116 3300053084 Ga0495595_0268212 Ga0495595_0268212_168_818 194
117 3300053085 Ga0495619_0005086 Ga0495619_0005086_3038_3688 194
118 3300053085 Ga0495619_0011046 Ga0495619_0011046_1747_2385 194
119 3300053096 Ga0500641_0012250 Ga0500641_0012250_1933_2523 194
120 3300053103 Ga0500555_004186 Ga0500555_004186_2504_3094 194
121 3300053119 Ga0500595_000251 Ga0500595_000251_26966_27556 194
122 3300053119 Ga0500595_006832 Ga0500595_006832_3245_3859 194
123 3300053153 Ga0500616_0000899 Ga0500616_0000899_13699_14289 194
124 3300053731 Ga0500609_004021 Ga0500609_004021_840_1430 194
125 3300054114 Ga0501084_0288579 Ga0501084_0288579_697_1293 194
126 3300054114 Ga0501084_0667377 Ga0501084_0667377_185_769 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

2

180

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n3b-assembly1.cif.gz_A crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.9049 2 193
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.901 2 193
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.8978 2 193
1vht-assembly3.cif.gz_C crystal structure of dephospho-coa kinase with bis(adenosine)-5'-triphosphate 0.8967 2 192
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.8836 2 193
ID Description Score Start End Superfamily
af_O74414_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9342 1 194 3.40.50.300
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9296 1 194 3.40.50.300
af_O74414_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9296 1 194 3.40.50.300
af_Q9ZQH0_1_198_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9259 1 194 3.40.50.300
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9251 1 194 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X0DLZ3-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9931 1 193 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E7V449-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9924 1 194 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7X3Y6S2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9908 12 192 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1H9GWZ3-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9888 1 193 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E1CVV2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9884 1 193 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
94.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map