F123597

General Info

Members Datasets Scaffolds Average Seq Length
124 100 248 114

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0097487|Ga0453684_0097487_994_1359
Length 121
Sequence MEIKQGDIFWIEQEEPAGSEPGYRRPFVVVQNNLFNHSRMNTVVVCALTTNLQRAKAPGNVLLEPGEGGILKTSVVNISQIFTVDKQDLQEYCGSLTPRRVEQILSGIFLLLEPAEVDSRY

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
76 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
77 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
99 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 0
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 33.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0097487 3300044712 Bacteria 3608
2 JGI25406J46586_10019358 3300003203 Bacteria 2776
3 rootL2_10005129 3300003322 Bacteria 2339
4 Ga0065707_10321120 3300005295 Unclassified 961
5 Ga0070666_10103925 3300005335 Bacteria 1960
6 Ga0070669_100345096 3300005353 Unclassified 1207
7 Ga0070667_100000069 3300005367 Bacteria 126807
8 Ga0070708_100264802 3300005445 Bacteria 1616
9 Ga0070708_100299213 3300005445 Unclassified 1515
10 Ga0068867_100751169 3300005459 Unclassified 865
11 Ga0070707_100075885 3300005468 Bacteria 3243
12 Ga0070697_100196394 3300005536 Unclassified 1714
13 Ga0068853_101414486 3300005539 Bacteria 673
14 Ga0070696_100087520 3300005546 Unclassified 2213
15 Ga0068859_100072520 3300005617 Bacteria 3480
16 Ga0068861_100220817 3300005719 Unclassified 1602
17 Ga0068861_102710100 3300005719 Unclassified 500
18 Ga0068863_100447163 3300005841 Bacteria 1268
19 Ga0068858_100062858 3300005842 Bacteria 3434
20 Ga0068858_101337811 3300005842 Bacteria 705
21 Ga0068860_100004933 3300005843 Bacteria 13601
22 Ga0081539_10000046 3300005985 Bacteria 275677
23 Ga0070717_11580697 3300006028 Unclassified 594
24 Ga0075428_101454724 3300006844 Bacteria 718
25 Ga0075430_100473883 3300006846 Unclassified 1033
26 Ga0075434_100010321 3300006871 Bacteria 8757
27 Ga0097620_100072519 3300006931 Bacteria 3480
28 Ga0099794_10107760 3300007265 Bacteria 1394
29 Ga0099795_10073822 3300007788 Bacteria 1292
30 Ga0105250_10029236 3300009092 Bacteria 2218
31 Ga0105247_10010957 3300009101 Bacteria 5474
32 Ga0105247_10012173 3300009101 Bacteria 5172
33 Ga0105247_10760471 3300009101 Unclassified 735
34 Ga0114129_10329955 3300009147 Bacteria 2026
35 Ga0105241_10719728 3300009174 Bacteria 913
36 Ga0105248_10332188 3300009177 Unclassified 1712
37 Ga0105248_10970515 3300009177 Bacteria 960
38 Ga0105237_10728175 3300009545 Bacteria 998
39 Ga0105238_10795223 3300009551 Bacteria 961
40 Ga0105249_10123348 3300009553 Bacteria 2464
41 Ga0163162_10384798 3300013306 Bacteria 1536
42 Ga0157375_10503794 3300013308 Unclassified 1375
43 Ga0163163_10233646 3300014325 Bacteria 1888
44 Ga0163163_10320252 3300014325 Bacteria 1604
45 Ga0163163_10393785 3300014325 Bacteria 1443
46 Ga0157380_10319916 3300014326 Unclassified 1438
47 Ga0157380_11207604 3300014326 Unclassified 800
48 Ga0157379_10105526 3300014968 Bacteria 2529
49 Ga0157379_10418935 3300014968 Unclassified 1233
50 Ga0207696_1021979 3300025711 Bacteria 2034
51 Ga0207710_10011690 3300025900 Bacteria 3692
52 Ga0207710_10125677 3300025900 Bacteria 1228
53 Ga0207680_10018594 3300025903 Bacteria 3698
54 Ga0207654_11119870 3300025911 Unclassified 573
55 Ga0207652_11654020 3300025921 Bacteria 545
56 Ga0207646_10150358 3300025922 Bacteria 2099
57 Ga0207681_11672622 3300025923 Unclassified 532
58 Ga0207694_11016598 3300025924 Unclassified 701
59 Ga0207711_10526776 3300025941 Bacteria 1102
60 Ga0207711_11234123 3300025941 Unclassified 689
61 Ga0207712_10218120 3300025961 Bacteria 1523
62 Ga0207658_10000038 3300025986 Bacteria 145669
63 Ga0207703_10129467 3300026035 Bacteria 2177
64 Ga0207703_11767436 3300026035 Unclassified 594
65 Ga0207641_11248949 3300026088 Bacteria 743
66 Ga0209588_1050046 3300027671 Bacteria 1352
67 Ga0209998_10032406 3300027717 Unclassified 1161
68 Ga0209974_10169031 3300027876 Unclassified 796
69 Ga0265356_1003938 3300028017 Bacteria 1837
70 Ga0268264_10048788 3300028381 Bacteria 3522
71 Ga0265323_10009518 3300028653 Bacteria 3962
72 Ga0265322_10002818 3300028654 Bacteria 5311
73 Ga0265330_10403947 3300031235 Unclassified 578
74 Ga0265329_10007742 3300031242 Bacteria 4127
75 Ga0265316_10022752 3300031344 Bacteria 5275
76 Ga0265316_10393692 3300031344 Unclassified 998
77 Ga0265316_11027644 3300031344 Unclassified 573
78 Ga0307408_100593415 3300031548 Bacteria 983
79 Ga0307508_10019723 3300031616 Bacteria 6125
80 Ga0265342_10021244 3300031712 Bacteria 4149
81 Ga0265342_10070668 3300031712 Bacteria 2036
82 Ga0316576_10952851 3300031727 Unclassified 613
83 Ga0307413_10242013 3300031824 Bacteria 1333
84 Ga0307407_10323598 3300031903 Bacteria 1083
85 Ga0307409_100583790 3300031995 Bacteria 1102
86 Ga0307416_101622155 3300032002 Bacteria 752
87 Ga0307414_11020319 3300032004 Bacteria 762
88 Ga0307411_10591269 3300032005 Bacteria 953
89 Ga0316593_10125548 3300032168 Bacteria 923
90 Ga0316574_0055097 3300035398 Bacteria 2485
91 Ga0400483_070658 3300039062 Unclassified 1450
92 Ga0400483_241520 3300039062 Unclassified 1161
93 Ga0439458_0210141 3300042157 Unclassified 534
94 Ga0439435_0050618 3300042436 Bacteria 1188
95 Ga0451577_0112602 3300042876 Bacteria 2435
96 Ga0466963_0317902 3300044694 Bacteria 1095
97 Ga0453684_0043961 3300044712 Bacteria 5990
98 Ga0453684_0380362 3300044712 Bacteria 1585
99 Ga0453684_0467256 3300044712 Unclassified 1402
100 Ga0453684_0833568 3300044712 Bacteria 992
101 Ga0453684_0896040 3300044712 Unclassified 950
102 Ga0451576_0232967 3300045051 Bacteria 1923
103 Ga0495594_0219922 3300046499 Unclassified 1083
104 Ga0495586_0326486 3300046535 Unclassified 880
105 Ga0495600_0179152 3300046809 Unclassified 1366
106 Ga0501031_0692972 3300049568 Unclassified 654
107 Ga0501033_0801208 3300049570 Bacteria 637
108 Ga0501033_0869558 3300049570 Bacteria 607
109 Ga0501067_0062190 3300049583 Unclassified 2066
110 Ga0501071_0932906 3300049587 Bacteria 670
111 Ga0501072_0358337 3300049588 Bacteria 1158
112 Ga0501072_0451703 3300049588 Unclassified 1018
113 Ga0501075_0373455 3300049591 Bacteria 1087
114 Ga0501077_0184185 3300049593 Bacteria 1327
115 Ga0501081_0755525 3300049743 Bacteria 731
116 Ga0501044_0363870 3300049823 Bacteria 1364
117 Ga0501045_0793561 3300049824 Unclassified 697
118 nmdc:mga05p37_767316_c1 3300050507 Bacteria 1060
119 nmdc:mga0rr50_916513_c1 3300050513 Bacteria 747
120 Ga0500637_0438128 3300053178 Unclassified 667
121 Ga0501084_0174005 3300054114 Bacteria 1817
122 Ga0590075_087588 3300059424 Unclassified 808
123 Ga0590077_052966 3300059426 Bacteria 913
124 Ga0501082_1177534 3300060353 Unclassified 670
125 Ga0453684_0097487
126 JGI25406J46586_10019358
127 rootL2_10005129
128 Ga0065707_10321120
129 Ga0070666_10103925
130 Ga0070669_100345096
131 Ga0070667_100000069
132 Ga0070708_100264802
133 Ga0070708_100299213
134 Ga0068867_100751169
135 Ga0070707_100075885
136 Ga0070697_100196394
137 Ga0068853_101414486
138 Ga0070696_100087520
139 Ga0068859_100072520
140 Ga0068861_100220817
141 Ga0068861_102710100
142 Ga0068863_100447163
143 Ga0068858_100062858
144 Ga0068858_101337811
145 Ga0068860_100004933
146 Ga0081539_10000046
147 Ga0070717_11580697
148 Ga0075428_101454724
149 Ga0075430_100473883
150 Ga0075434_100010321
151 Ga0097620_100072519
152 Ga0099794_10107760
153 Ga0099795_10073822
154 Ga0105250_10029236
155 Ga0105247_10010957
156 Ga0105247_10012173
157 Ga0105247_10760471
158 Ga0114129_10329955
159 Ga0105241_10719728
160 Ga0105248_10332188
161 Ga0105248_10970515
162 Ga0105237_10728175
163 Ga0105238_10795223
164 Ga0105249_10123348
165 Ga0163162_10384798
166 Ga0157375_10503794
167 Ga0163163_10233646
168 Ga0163163_10320252
169 Ga0163163_10393785
170 Ga0157380_10319916
171 Ga0157380_11207604
172 Ga0157379_10105526
173 Ga0157379_10418935
174 Ga0207696_1021979
175 Ga0207710_10011690
176 Ga0207710_10125677
177 Ga0207680_10018594
178 Ga0207654_11119870
179 Ga0207652_11654020
180 Ga0207646_10150358
181 Ga0207681_11672622
182 Ga0207694_11016598
183 Ga0207711_10526776
184 Ga0207711_11234123
185 Ga0207712_10218120
186 Ga0207658_10000038
187 Ga0207703_10129467
188 Ga0207703_11767436
189 Ga0207641_11248949
190 Ga0209588_1050046
191 Ga0209998_10032406
192 Ga0209974_10169031
193 Ga0265356_1003938
194 Ga0268264_10048788
195 Ga0265323_10009518
196 Ga0265322_10002818
197 Ga0265330_10403947
198 Ga0265329_10007742
199 Ga0265316_10022752
200 Ga0265316_10393692
201 Ga0265316_11027644
202 Ga0307408_100593415
203 Ga0307508_10019723
204 Ga0265342_10021244
205 Ga0265342_10070668
206 Ga0316576_10952851
207 Ga0307413_10242013
208 Ga0307407_10323598
209 Ga0307409_100583790
210 Ga0307416_101622155
211 Ga0307414_11020319
212 Ga0307411_10591269
213 Ga0316593_10125548
214 Ga0316574_0055097
215 Ga0400483_070658
216 Ga0400483_241520
217 Ga0439458_0210141
218 Ga0439435_0050618
219 Ga0451577_0112602
220 Ga0466963_0317902
221 Ga0453684_0043961
222 Ga0453684_0380362
223 Ga0453684_0467256
224 Ga0453684_0833568
225 Ga0453684_0896040
226 Ga0451576_0232967
227 Ga0495594_0219922
228 Ga0495586_0326486
229 Ga0495600_0179152
230 Ga0501031_0692972
231 Ga0501033_0801208
232 Ga0501033_0869558
233 Ga0501067_0062190
234 Ga0501071_0932906
235 Ga0501072_0358337
236 Ga0501072_0451703
237 Ga0501075_0373455
238 Ga0501077_0184185
239 Ga0501081_0755525
240 Ga0501044_0363870
241 Ga0501045_0793561
242 nmdc:mga05p37_767316_c1
243 nmdc:mga0rr50_916513_c1
244 Ga0500637_0438128
245 Ga0501084_0174005
246 Ga0590075_087588
247 Ga0590077_052966
248 Ga0501082_1177534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

4

112

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.9691 2 114
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9613 1 114
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.96 2 114
5hk0-assembly2.cif.gz_D crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9572 5 114
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9526 1 114
ID Description Score Start End Superfamily
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9332 5 113 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.925 2 114 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.9169 2 114 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9092 2 113 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9072 5 113 2.30.30.110
ID Description Score Start End GO Terms
AF-D5MFK6-F1-model_v4 Uncharacterized protein 1.001 49 114 GO:0003677
AF-A0A534VY09-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9965 37 114 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A7Z8PAQ2-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9896 46 113 GO:0003677
AF-A0A1E7HNS8-F1-model_v4 PemK family transcriptional regulator 0.9885 26 111 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A6N2E326-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9881 49 113 GO:0003677

Map