F115459

General Info

Members Datasets Scaffolds Average Seq Length
122 95 244 479

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0020385|Ga0466963_0020385_2123_3694
Length 523
Sequence MSSTETATPVDAPSMSASVSAPATTSAALGRPIAGLSWNRTVWALLVVLCGALFLDGLDISMVGVALPSIGSDLHLAPGSLQWIVSAYVLGYGGFLLLGGRAADLVGRRPVFITAVAVFGVASLVSSVMSNDTALIALRLVKGIAAGFTVPAGLSIITTTFAEGAARNRALSIYTVCGASGFSLGLVFGGILTEVGWRATFAAPAPIALVIAAAAYRLVPRVQRERLRLADLDLAGAFTSTLSLLVLVYAVVEAPQRGWGSPVTIGLLLASAALMAAFSAIEQRHPRPLVRLGILRSRTVLHANVSGAVMFGGYVAFQFVVTLYVQNSLNWSPLKMALAFLPAGLVVVASATRMGSVLERFDTRKLIFVGLLAFVTGYALFLRVNPSMSYANFLLPTMLLLGTGFALAFPSINAQATAGVAADEQGLASGLVNTSIQIGGAVVLAIITAIIGGNPHSTPGELIPGMAVSIAVVVGVSAIGLVLTAGVLGAGRRSARXXXSAAPEAPLTLSELDEPDGVLCEVC

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
44 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
50 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
51 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
64 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
67 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
76 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
77 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
83 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
84 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
85 2643221670 Streptomyces sp. Root431 Isolate Unclassified
86 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
87 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
88 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
89 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
90 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
91 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
92 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
93 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
94 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
95 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.98
Metatranscriptomes 0
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.74
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0020385 3300044694 Bacteria 4169
2 rootH2_10055135 3300003320 Bacteria 7921
3 JGI25407J50210_10003245 3300003373 Bacteria 3872
4 Ga0070658_10042941 3300005327 Bacteria 3653
5 Ga0070658_10067816 3300005327 Bacteria 2915
6 Ga0070714_100000182 3300005435 Bacteria 50060
7 Ga0070713_100032135 3300005436 Bacteria 4189
8 Ga0070662_100085470 3300005457 Bacteria 2358
9 Ga0070707_100256450 3300005468 Bacteria 1702
10 Ga0070698_100083360 3300005471 Bacteria 3186
11 Ga0070679_100015672 3300005530 Bacteria 7287
12 Ga0070679_100166021 3300005530 Bacteria 2181
13 Ga0070679_100190646 3300005530 Bacteria 2019
14 Ga0068855_100027398 3300005563 Bacteria 6816
15 Ga0068859_100075717 3300005617 Bacteria 3406
16 Ga0081455_10072547 3300005937 Bacteria 2850
17 Ga0081538_10010536 3300005981 Bacteria 7575
18 Ga0081538_10011694 3300005981 Bacteria 7092
19 Ga0070717_10044998 3300006028 Bacteria 3607
20 Ga0075428_100000616 3300006844 Bacteria 36391
21 Ga0075428_100119095 3300006844 Bacteria 2875
22 Ga0075430_100004287 3300006846 Bacteria 12043
23 Ga0075430_100009757 3300006846 Bacteria 8118
24 Ga0075429_100004651 3300006880 Bacteria 11806
25 Ga0075429_100006984 3300006880 Bacteria 9810
26 Ga0097620_100075721 3300006931 Bacteria 3406
27 Ga0105240_10174495 3300009093 Bacteria 2542
28 Ga0111539_10007038 3300009094 Bacteria 14435
29 Ga0105247_10003982 3300009101 Bacteria 9511
30 Ga0114129_10003433 3300009147 Bacteria 22271
31 Ga0105243_10000722 3300009148 Bacteria 31720
32 Ga0105243_10065368 3300009148 Bacteria 2921
33 Ga0105239_10030225 3300010375 Bacteria 5955
34 Ga0105246_10005823 3300011119 Bacteria 7515
35 Ga0213875_10014207 3300021388 Bacteria 3890
36 Ga0207710_10008125 3300025900 Bacteria 4430
37 Ga0207705_10078081 3300025909 Bacteria 2409
38 Ga0207705_10118149 3300025909 Bacteria 1965
39 Ga0207707_10026612 3300025912 Bacteria 5056
40 Ga0207657_10028670 3300025919 Bacteria 5074
41 Ga0207657_10033907 3300025919 Bacteria 4597
42 Ga0207700_10064873 3300025928 Bacteria 2784
43 Ga0207664_10000185 3300025929 Bacteria 47364
44 Ga0207709_10008814 3300025935 Bacteria 5563
45 Ga0207667_10023498 3300025949 Bacteria 6788
46 Ga0207658_10005594 3300025986 Bacteria 8597
47 Ga0307513_10000209 3300031456 Bacteria 84521
48 Ga0307408_100012973 3300031548 Bacteria 5525
49 Ga0307413_10173563 3300031824 Bacteria 1529
50 Ga0307412_10176721 3300031911 Bacteria 1601
51 Ga0307411_10007976 3300032005 Bacteria 5448
52 Ga0307507_10000017 3300033179 Bacteria 224506
53 Ga0373947_0013280 3300035725 Bacteria 4718
54 Ga0373925_0039437 3300037068 Bacteria 3494
55 Ga0395900_0019234 3300037418 Bacteria 6964
56 Ga0395900_0169314 3300037418 Bacteria 2225
57 Ga0395898_0114549 3300037466 Bacteria 2584
58 Ga0395898_0207919 3300037466 Bacteria 1868
59 Ga0436364_0279090 3300037853 Bacteria 1640
60 Ga0436364_0415229 3300037853 Bacteria 6666
61 Ga0395901_0171749 3300038443 Bacteria 2275
62 Ga0439436_0004560 3300041404 Bacteria 4248
63 Ga0439466_0012947 3300041411 Bacteria 3060
64 Ga0439442_000039 3300042002 Bacteria 29723
65 Ga0439449_0011443 3300042007 Bacteria 3338
66 Ga0466969_0006435 3300044656 Bacteria 6253
67 Ga0466972_0006061 3300044658 Bacteria 6074
68 Ga0466972_0048857 3300044658 Bacteria 2044
69 Ga0466966_0008303 3300044684 Bacteria 6882
70 Ga0466966_0016115 3300044684 Bacteria 4940
71 Ga0466961_0006460 3300044693 Bacteria 7445
72 Ga0466961_0030633 3300044693 Bacteria 3457
73 Ga0466963_0042489 3300044694 Bacteria 2985
74 Ga0466970_0000745 3300044765 Bacteria 15839
75 Ga0466960_0051808 3300044901 Bacteria 1984
76 Ga0466959_0002061 3300045049 Bacteria 12717
77 Ga0466959_0020897 3300045049 Bacteria 4825
78 Ga0466958_0067850 3300045836 Bacteria 2179
79 Ga0466967_0015343 3300045976 Bacteria 6001
80 Ga0466967_0019489 3300045976 Bacteria 5455
81 Ga0466967_0027762 3300045976 Bacteria 4712
82 Ga0466967_0057878 3300045976 Bacteria 3424
83 Ga0466967_0075513 3300045976 Bacteria 3029
84 Ga0466967_0259251 3300045976 Bacteria 1663
85 Ga0496102_0000121 3300048905 Bacteria 112133
86 Ga0496102_0033257 3300048905 Bacteria 4632
87 Ga0496103_0000224 3300048906 Bacteria 55730
88 Ga0496109_0087337 3300048912 Bacteria 2881
89 Ga0496110_0140985 3300048913 Bacteria 2179
90 Ga0496110_0202471 3300048913 Bacteria 1804
91 Ga0496112_0028561 3300048915 Bacteria 5385
92 Ga0496119_0022123 3300048922 Bacteria 4566
93 Ga0496122_0020484 3300048925 Bacteria 5973
94 Ga0501032_0019700 3300049569 Bacteria 4714
95 Ga0501033_0124827 3300049570 Bacteria 1867
96 Ga0501034_0011792 3300049571 Bacteria 9046
97 Ga0501034_0271555 3300049571 Bacteria 1636
98 Ga0501038_0001791 3300049574 Bacteria 19946
99 Ga0501039_0075466 3300049575 Bacteria 2621
100 Ga0501048_0000423 3300049582 Bacteria 29706
101 Ga0501069_0067106 3300049585 Bacteria 2006
102 Ga0501077_0136470 3300049593 Bacteria 1556
103 Ga0501035_0031235 3300049822 Bacteria 4851
104 Ga0501044_0050429 3300049823 Bacteria 4294
105 Ga0501044_0130402 3300049823 Bacteria 2508
106 nmdc:mga09592_16047_c1 3300050508 Bacteria 6123
107 nmdc:mga0qj67_2996_c1 3300050509 Bacteria 12121
108 nmdc:mga08y16_46075_c1 3300050511 Bacteria 4567
109 nmdc:mga0a205_33503_c1 3300050515 Bacteria 4924
110 Ga0501084_0040140 3300054114 Bacteria 3915
111 Ga0466962_0008545 3300061719 Bacteria 4909
112 2644386273 2643221670 Bacteria 6497041
113 2644536241 2643221697 Bacteria 3575694
114 2739236267 2738543011 Bacteria 5731169
115 2816505387 2816332139 Bacteria 9138787
116 2819745613 2818991472 Bacteria 10089953
117 2873321992 2873314349 Bacteria 8512634
118 2889304267 2889300758 Bacteria 5690814
119 2939745339 2939743619 Bacteria 5762299
120 2945944695 2945941187 Bacteria 4682474
121 2954382936 2954380949 Bacteria 10050426
122 8054111339 8054107350 Bacteria 5022511
123 Ga0466963_0020385
124 rootH2_10055135
125 JGI25407J50210_10003245
126 Ga0070658_10042941
127 Ga0070658_10067816
128 Ga0070714_100000182
129 Ga0070713_100032135
130 Ga0070662_100085470
131 Ga0070707_100256450
132 Ga0070698_100083360
133 Ga0070679_100015672
134 Ga0070679_100166021
135 Ga0070679_100190646
136 Ga0068855_100027398
137 Ga0068859_100075717
138 Ga0081455_10072547
139 Ga0081538_10010536
140 Ga0081538_10011694
141 Ga0070717_10044998
142 Ga0075428_100000616
143 Ga0075428_100119095
144 Ga0075430_100004287
145 Ga0075430_100009757
146 Ga0075429_100004651
147 Ga0075429_100006984
148 Ga0097620_100075721
149 Ga0105240_10174495
150 Ga0111539_10007038
151 Ga0105247_10003982
152 Ga0114129_10003433
153 Ga0105243_10000722
154 Ga0105243_10065368
155 Ga0105239_10030225
156 Ga0105246_10005823
157 Ga0213875_10014207
158 Ga0207710_10008125
159 Ga0207705_10078081
160 Ga0207705_10118149
161 Ga0207707_10026612
162 Ga0207657_10028670
163 Ga0207657_10033907
164 Ga0207700_10064873
165 Ga0207664_10000185
166 Ga0207709_10008814
167 Ga0207667_10023498
168 Ga0207658_10005594
169 Ga0307513_10000209
170 Ga0307408_100012973
171 Ga0307413_10173563
172 Ga0307412_10176721
173 Ga0307411_10007976
174 Ga0307507_10000017
175 Ga0373947_0013280
176 Ga0373925_0039437
177 Ga0395900_0019234
178 Ga0395900_0169314
179 Ga0395898_0114549
180 Ga0395898_0207919
181 Ga0436364_0279090
182 Ga0436364_0415229
183 Ga0395901_0171749
184 Ga0439436_0004560
185 Ga0439466_0012947
186 Ga0439442_000039
187 Ga0439449_0011443
188 Ga0466969_0006435
189 Ga0466972_0006061
190 Ga0466972_0048857
191 Ga0466966_0008303
192 Ga0466966_0016115
193 Ga0466961_0006460
194 Ga0466961_0030633
195 Ga0466963_0042489
196 Ga0466970_0000745
197 Ga0466960_0051808
198 Ga0466959_0002061
199 Ga0466959_0020897
200 Ga0466958_0067850
201 Ga0466967_0015343
202 Ga0466967_0019489
203 Ga0466967_0027762
204 Ga0466967_0057878
205 Ga0466967_0075513
206 Ga0466967_0259251
207 Ga0496102_0000121
208 Ga0496102_0033257
209 Ga0496103_0000224
210 Ga0496109_0087337
211 Ga0496110_0140985
212 Ga0496110_0202471
213 Ga0496112_0028561
214 Ga0496119_0022123
215 Ga0496122_0020484
216 Ga0501032_0019700
217 Ga0501033_0124827
218 Ga0501034_0011792
219 Ga0501034_0271555
220 Ga0501038_0001791
221 Ga0501039_0075466
222 Ga0501048_0000423
223 Ga0501069_0067106
224 Ga0501077_0136470
225 Ga0501035_0031235
226 Ga0501044_0050429
227 Ga0501044_0130402
228 nmdc:mga09592_16047_c1
229 nmdc:mga0qj67_2996_c1
230 nmdc:mga08y16_46075_c1
231 nmdc:mga0a205_33503_c1
232 Ga0501084_0040140
233 Ga0466962_0008545
234 2644386273
235 2644536241
236 2739236267
237 2816505387
238 2819745613
239 2873321992
240 2889304267
241 2939745339
242 2945944695
243 2954382936
244 8054111339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

49

444

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.843 11 468
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8369 27 468
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8253 28 468
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8245 27 468
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8245 27 468
ID Description Score Start End Superfamily
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9492 30 204 1.20.1250.20
af_P9WG85_29_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9479 33 258 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9468 34 234 1.20.1250.20
af_Q03263_69_259_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9448 30 207 1.20.1250.20
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9398 27 209 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A372JM89-F1-model_v4 MFS transporter 0.9822 27 138 GO:0016020
GO:0022857
AF-A0A538CW67-F1-model_v4 MFS transporter 0.9775 28 209 GO:0016020
GO:0022857
AF-A0A537NMT5-F1-model_v4 MFS transporter 0.9622 32 181 GO:0005886
GO:0022857
AF-A0A372JM89-F1-model_v4 MFS transporter 0.957 27 138 GO:0016020
GO:0022857
AF-A0A7H4MK84-F1-model_v4 Drug resistance MFS transporter drug:H+ antiporter-1 (DHA2) family 0.9489 29 161 GO:0005886
GO:0022857

Map