F495941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1875 | 443 | 3750 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0219340|Ga0395900_0219340_1169_1402 |
| Length | 77 |
| Sequence | MVPGNPATEEVPPPMPRRDAYELLLIEEADAWFEYLEATRAQSAIRYKEVEPWAWARLSQRLRAIRTKKTKLRPAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 121 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 122 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 233 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 236 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 238 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 280 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 281 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 282 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 283 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 284 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 285 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 286 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 295 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 385 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 441 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 443 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.01 |
| Nodule | 0 |
| Rhizoplane | 9.97 |
| Rhizosphere | 88.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0219340 | 3300037418 | Bacteria | 1918 |
| 2 | JGI24744J21845_10060472 | 3300002077 | Unclassified | 693 |
| 3 | JGI24034J26672_10070579 | 3300002239 | Unclassified | 625 |
| 4 | JGI24742J22300_10023254 | 3300002244 | Bacteria | 1064 |
| 5 | rootH1_10088161 | 3300003323 | Bacteria | 2449 |
| 6 | rootH1_10123228 | 3300003323 | Bacteria | 1409 |
| 7 | JGI25407J50210_10145706 | 3300003373 | Unclassified | 583 |
| 8 | JGI25405J52794_10093891 | 3300003911 | Unclassified | 666 |
| 9 | Ga0070658_10016040 | 3300005327 | Bacteria | 5992 |
| 10 | Ga0070658_10071183 | 3300005327 | Bacteria | 2848 |
| 11 | Ga0070658_10092282 | 3300005327 | Bacteria | 2497 |
| 12 | Ga0070658_10098885 | 3300005327 | Bacteria | 2410 |
| 13 | Ga0070658_10248193 | 3300005327 | Bacteria | 1510 |
| 14 | Ga0070658_10486786 | 3300005327 | Bacteria | 1065 |
| 15 | Ga0070658_10608776 | 3300005327 | Bacteria | 947 |
| 16 | Ga0070658_10852836 | 3300005327 | Bacteria | 792 |
| 17 | Ga0070658_11426435 | 3300005327 | Unclassified | 601 |
| 18 | Ga0070676_11441949 | 3300005328 | Unclassified | 529 |
| 19 | Ga0070683_100003297 | 3300005329 | Bacteria | 13045 |
| 20 | Ga0070683_100016747 | 3300005329 | Bacteria | 6466 |
| 21 | Ga0070683_100069425 | 3300005329 | Bacteria | 3285 |
| 22 | Ga0070683_100187814 | 3300005329 | Bacteria | 1962 |
| 23 | Ga0070683_100217466 | 3300005329 | Bacteria | 1816 |
| 24 | Ga0070683_100384919 | 3300005329 | Bacteria | 1337 |
| 25 | Ga0070683_100453469 | 3300005329 | Bacteria | 1224 |
| 26 | Ga0070683_100706519 | 3300005329 | Bacteria | 966 |
| 27 | Ga0070683_100957991 | 3300005329 | Unclassified | 821 |
| 28 | Ga0070683_101101856 | 3300005329 | Unclassified | 763 |
| 29 | Ga0070683_101593325 | 3300005329 | Bacteria | 628 |
| 30 | Ga0070683_101622317 | 3300005329 | Unclassified | 622 |
| 31 | Ga0070690_100093286 | 3300005330 | Bacteria | 1986 |
| 32 | Ga0070670_100201731 | 3300005331 | Bacteria | 1728 |
| 33 | Ga0070670_101837657 | 3300005331 | Bacteria | 558 |
| 34 | Ga0070677_10537699 | 3300005333 | Unclassified | 639 |
| 35 | Ga0070666_10725538 | 3300005335 | Bacteria | 729 |
| 36 | Ga0070680_100041318 | 3300005336 | Bacteria | 3739 |
| 37 | Ga0070680_100073155 | 3300005336 | Bacteria | 2818 |
| 38 | Ga0070680_100107739 | 3300005336 | Bacteria | 2317 |
| 39 | Ga0070680_100153099 | 3300005336 | Bacteria | 1936 |
| 40 | Ga0070680_100382902 | 3300005336 | Bacteria | 1198 |
| 41 | Ga0070680_100433600 | 3300005336 | Bacteria | 1122 |
| 42 | Ga0070680_100597787 | 3300005336 | Bacteria | 947 |
| 43 | Ga0070680_100614679 | 3300005336 | Bacteria | 933 |
| 44 | Ga0070680_101472557 | 3300005336 | Bacteria | 590 |
| 45 | Ga0070682_100008033 | 3300005337 | Bacteria | 5943 |
| 46 | Ga0070682_100011913 | 3300005337 | Bacteria | 4974 |
| 47 | Ga0070682_100140015 | 3300005337 | Bacteria | 1648 |
| 48 | Ga0070682_100204361 | 3300005337 | Bacteria | 1395 |
| 49 | Ga0070682_100583439 | 3300005337 | Bacteria | 880 |
| 50 | Ga0070682_100630025 | 3300005337 | Unclassified | 851 |
| 51 | Ga0070682_101481337 | 3300005337 | Bacteria | 583 |
| 52 | Ga0068868_100058188 | 3300005338 | Bacteria | 3054 |
| 53 | Ga0068868_100059813 | 3300005338 | Bacteria | 3015 |
| 54 | Ga0068868_100195298 | 3300005338 | Bacteria | 1685 |
| 55 | Ga0068868_100208432 | 3300005338 | Bacteria | 1632 |
| 56 | Ga0068868_100313275 | 3300005338 | Unclassified | 1335 |
| 57 | Ga0070660_100006179 | 3300005339 | Bacteria | 8287 |
| 58 | Ga0070660_100006340 | 3300005339 | Bacteria | 8194 |
| 59 | Ga0070660_100019025 | 3300005339 | Bacteria | 5028 |
| 60 | Ga0070660_100049000 | 3300005339 | Bacteria | 3246 |
| 61 | Ga0070660_100053966 | 3300005339 | Bacteria | 3101 |
| 62 | Ga0070660_100576591 | 3300005339 | Unclassified | 939 |
| 63 | Ga0070660_100579003 | 3300005339 | Bacteria | 938 |
| 64 | Ga0070660_100623911 | 3300005339 | Bacteria | 902 |
| 65 | Ga0070660_100653010 | 3300005339 | Unclassified | 881 |
| 66 | Ga0070660_100792180 | 3300005339 | Bacteria | 797 |
| 67 | Ga0070660_101636740 | 3300005339 | Bacteria | 548 |
| 68 | Ga0070689_100021517 | 3300005340 | Bacteria | 4803 |
| 69 | Ga0070691_10005264 | 3300005341 | Bacteria | 5876 |
| 70 | Ga0070691_10288227 | 3300005341 | Bacteria | 893 |
| 71 | Ga0070687_100233370 | 3300005343 | Bacteria | 1133 |
| 72 | Ga0070687_100612511 | 3300005343 | Bacteria | 750 |
| 73 | Ga0070661_100002698 | 3300005344 | Bacteria | 12154 |
| 74 | Ga0070661_100024528 | 3300005344 | Bacteria | 4325 |
| 75 | Ga0070661_100032768 | 3300005344 | Bacteria | 3762 |
| 76 | Ga0070661_100184776 | 3300005344 | Bacteria | 1588 |
| 77 | Ga0070661_100239234 | 3300005344 | Bacteria | 1397 |
| 78 | Ga0070661_100246963 | 3300005344 | Bacteria | 1376 |
| 79 | Ga0070661_100465372 | 3300005344 | Bacteria | 1008 |
| 80 | Ga0070661_100471181 | 3300005344 | Bacteria | 1001 |
| 81 | Ga0070661_100485109 | 3300005344 | Unclassified | 987 |
| 82 | Ga0070661_100611922 | 3300005344 | Bacteria | 882 |
| 83 | Ga0070692_10024853 | 3300005345 | Bacteria | 2948 |
| 84 | Ga0070692_10206319 | 3300005345 | Bacteria | 1154 |
| 85 | Ga0070668_100032668 | 3300005347 | Bacteria | 3960 |
| 86 | Ga0070668_101399040 | 3300005347 | Bacteria | 638 |
| 87 | Ga0070669_100105406 | 3300005353 | Bacteria | 2133 |
| 88 | Ga0070675_100036438 | 3300005354 | Bacteria | 4003 |
| 89 | Ga0070675_100731917 | 3300005354 | Bacteria | 902 |
| 90 | Ga0070675_100920607 | 3300005354 | Bacteria | 802 |
| 91 | Ga0070675_101131549 | 3300005354 | Unclassified | 720 |
| 92 | Ga0070671_100170323 | 3300005355 | Bacteria | 1842 |
| 93 | Ga0070671_100567965 | 3300005355 | Bacteria | 979 |
| 94 | Ga0070671_101850570 | 3300005355 | Unclassified | 536 |
| 95 | Ga0070674_100108970 | 3300005356 | Bacteria | 2030 |
| 96 | Ga0070674_100203027 | 3300005356 | Bacteria | 1532 |
| 97 | Ga0070674_100496712 | 3300005356 | Bacteria | 1015 |
| 98 | Ga0070674_100664772 | 3300005356 | Bacteria | 887 |
| 99 | Ga0070674_100683219 | 3300005356 | Bacteria | 876 |
| 100 | Ga0070674_101151166 | 3300005356 | Bacteria | 687 |
| 101 | Ga0070673_100179388 | 3300005364 | Bacteria | 1812 |
| 102 | Ga0070673_100303062 | 3300005364 | Unclassified | 1407 |
| 103 | Ga0070688_100132736 | 3300005365 | Bacteria | 1682 |
| 104 | Ga0070659_100048745 | 3300005366 | Bacteria | 3328 |
| 105 | Ga0070659_100090277 | 3300005366 | Bacteria | 2455 |
| 106 | Ga0070659_100137994 | 3300005366 | Unclassified | 1984 |
| 107 | Ga0070659_100268979 | 3300005366 | Bacteria | 1416 |
| 108 | Ga0070659_100377470 | 3300005366 | Bacteria | 1194 |
| 109 | Ga0070659_100556793 | 3300005366 | Bacteria | 982 |
| 110 | Ga0070659_101151062 | 3300005366 | Bacteria | 685 |
| 111 | Ga0070659_101324562 | 3300005366 | Unclassified | 639 |
| 112 | Ga0070659_101412871 | 3300005366 | Unclassified | 619 |
| 113 | Ga0070667_100851317 | 3300005367 | Bacteria | 848 |
| 114 | Ga0070709_10012572 | 3300005434 | Bacteria | 4740 |
| 115 | Ga0070709_11573929 | 3300005434 | Bacteria | 535 |
| 116 | Ga0070714_100098934 | 3300005435 | Bacteria | 2567 |
| 117 | Ga0070714_100130514 | 3300005435 | Unclassified | 2245 |
| 118 | Ga0070714_100143950 | 3300005435 | Bacteria | 2142 |
| 119 | Ga0070714_100224394 | 3300005435 | Bacteria | 1728 |
| 120 | Ga0070714_100314709 | 3300005435 | Bacteria | 1462 |
| 121 | Ga0070714_100342032 | 3300005435 | Bacteria | 1403 |
| 122 | Ga0070714_100386341 | 3300005435 | Bacteria | 1320 |
| 123 | Ga0070714_100655985 | 3300005435 | Unclassified | 1010 |
| 124 | Ga0070714_100682127 | 3300005435 | Bacteria | 990 |
| 125 | Ga0070714_100915305 | 3300005435 | Bacteria | 852 |
| 126 | Ga0070713_100005633 | 3300005436 | Bacteria | 8589 |
| 127 | Ga0070713_100231110 | 3300005436 | Bacteria | 1681 |
| 128 | Ga0070713_100280432 | 3300005436 | Bacteria | 1529 |
| 129 | Ga0070713_100326946 | 3300005436 | Bacteria | 1417 |
| 130 | Ga0070713_100403459 | 3300005436 | Bacteria | 1277 |
| 131 | Ga0070713_100465303 | 3300005436 | Bacteria | 1189 |
| 132 | Ga0070713_100531479 | 3300005436 | Bacteria | 1112 |
| 133 | Ga0070713_100938935 | 3300005436 | Bacteria | 833 |
| 134 | Ga0070713_101357593 | 3300005436 | Bacteria | 689 |
| 135 | Ga0070713_102240771 | 3300005436 | Unclassified | 529 |
| 136 | Ga0070710_10018740 | 3300005437 | Bacteria | 3566 |
| 137 | Ga0070710_10290935 | 3300005437 | Bacteria | 1063 |
| 138 | Ga0070710_10330810 | 3300005437 | Bacteria | 1003 |
| 139 | Ga0070710_10575359 | 3300005437 | Unclassified | 781 |
| 140 | Ga0070710_11077429 | 3300005437 | Unclassified | 589 |
| 141 | Ga0070701_10041529 | 3300005438 | Bacteria | 2344 |
| 142 | Ga0070701_10271170 | 3300005438 | Bacteria | 1032 |
| 143 | Ga0070711_100006744 | 3300005439 | Bacteria | 6948 |
| 144 | Ga0070711_100287240 | 3300005439 | Unclassified | 1304 |
| 145 | Ga0070711_100476821 | 3300005439 | Bacteria | 1025 |
| 146 | Ga0070711_100611666 | 3300005439 | Bacteria | 910 |
| 147 | Ga0070711_100761389 | 3300005439 | Unclassified | 819 |
| 148 | Ga0070711_101093843 | 3300005439 | Unclassified | 687 |
| 149 | Ga0070711_101770697 | 3300005439 | Unclassified | 542 |
| 150 | Ga0070711_101880465 | 3300005439 | Bacteria | 526 |
| 151 | Ga0070705_100080692 | 3300005440 | Bacteria | 1996 |
| 152 | Ga0070705_101596276 | 3300005440 | Bacteria | 549 |
| 153 | Ga0070700_100040120 | 3300005441 | Bacteria | 2864 |
| 154 | Ga0070694_100023433 | 3300005444 | Bacteria | 3970 |
| 155 | Ga0070694_100079789 | 3300005444 | Bacteria | 2273 |
| 156 | Ga0070708_100467683 | 3300005445 | Bacteria | 1190 |
| 157 | Ga0070708_100495288 | 3300005445 | Bacteria | 1153 |
| 158 | Ga0070708_100895718 | 3300005445 | Unclassified | 833 |
| 159 | Ga0070708_101378864 | 3300005445 | Unclassified | 658 |
| 160 | Ga0070663_100078961 | 3300005455 | Bacteria | 2413 |
| 161 | Ga0070663_100522326 | 3300005455 | Bacteria | 989 |
| 162 | Ga0070663_100656783 | 3300005455 | Unclassified | 887 |
| 163 | Ga0070663_100740155 | 3300005455 | Bacteria | 839 |
| 164 | Ga0070663_100820686 | 3300005455 | Bacteria | 799 |
| 165 | Ga0070663_100945173 | 3300005455 | Bacteria | 747 |
| 166 | Ga0070663_101415188 | 3300005455 | Unclassified | 616 |
| 167 | Ga0070663_101843643 | 3300005455 | Bacteria | 543 |
| 168 | Ga0070678_100073123 | 3300005456 | Bacteria | 2572 |
| 169 | Ga0070678_100199702 | 3300005456 | Bacteria | 1650 |
| 170 | Ga0070678_100272808 | 3300005456 | Bacteria | 1427 |
| 171 | Ga0070678_100773283 | 3300005456 | Unclassified | 870 |
| 172 | Ga0070678_100783034 | 3300005456 | Unclassified | 865 |
| 173 | Ga0070662_100004795 | 3300005457 | Bacteria | 8568 |
| 174 | Ga0070662_100059662 | 3300005457 | Bacteria | 2780 |
| 175 | Ga0070662_100166555 | 3300005457 | Bacteria | 1727 |
| 176 | Ga0070662_100893283 | 3300005457 | Unclassified | 758 |
| 177 | Ga0070681_10001709 | 3300005458 | Bacteria | 19668 |
| 178 | Ga0070681_10008931 | 3300005458 | Bacteria | 9851 |
| 179 | Ga0070681_10097777 | 3300005458 | Bacteria | 2882 |
| 180 | Ga0070681_10116678 | 3300005458 | Bacteria | 2606 |
| 181 | Ga0070681_10145227 | 3300005458 | Unclassified | 2302 |
| 182 | Ga0070681_10156623 | 3300005458 | Bacteria | 2202 |
| 183 | Ga0070681_10277901 | 3300005458 | Bacteria | 1586 |
| 184 | Ga0070681_10305474 | 3300005458 | Bacteria | 1500 |
| 185 | Ga0070681_10401722 | 3300005458 | Bacteria | 1281 |
| 186 | Ga0070681_11179128 | 3300005458 | Bacteria | 688 |
| 187 | Ga0068867_100186236 | 3300005459 | Bacteria | 1653 |
| 188 | Ga0070685_10033217 | 3300005466 | Bacteria | 2896 |
| 189 | Ga0070706_100016897 | 3300005467 | Bacteria | 6740 |
| 190 | Ga0070706_100299789 | 3300005467 | Bacteria | 1500 |
| 191 | Ga0070706_100373109 | 3300005467 | Bacteria | 1329 |
| 192 | Ga0070706_100866528 | 3300005467 | Unclassified | 835 |
| 193 | Ga0070707_100001116 | 3300005468 | Bacteria | 26505 |
| 194 | Ga0070707_100068961 | 3300005468 | Bacteria | 3404 |
| 195 | Ga0070707_100655848 | 3300005468 | Bacteria | 1012 |
| 196 | Ga0070707_100848147 | 3300005468 | Unclassified | 878 |
| 197 | Ga0070698_100031926 | 3300005471 | Bacteria | 5458 |
| 198 | Ga0070698_100045050 | 3300005471 | Bacteria | 4515 |
| 199 | Ga0070698_100068838 | 3300005471 | Bacteria | 3556 |
| 200 | Ga0070698_100072305 | 3300005471 | Unclassified | 3457 |
| 201 | Ga0070698_100578955 | 3300005471 | Bacteria | 1062 |
| 202 | Ga0070698_100897443 | 3300005471 | Bacteria | 832 |
| 203 | Ga0070698_101212677 | 3300005471 | Bacteria | 704 |
| 204 | Ga0070699_100186910 | 3300005518 | Bacteria | 1840 |
| 205 | Ga0070699_100370696 | 3300005518 | Bacteria | 1292 |
| 206 | Ga0070699_100472617 | 3300005518 | Unclassified | 1137 |
| 207 | Ga0070699_100637952 | 3300005518 | Bacteria | 972 |
| 208 | Ga0070699_100847821 | 3300005518 | Bacteria | 837 |
| 209 | Ga0070699_101763869 | 3300005518 | Unclassified | 567 |
| 210 | Ga0070679_100009015 | 3300005530 | Bacteria | 9411 |
| 211 | Ga0070679_100048061 | 3300005530 | Bacteria | 4252 |
| 212 | Ga0070679_100053369 | 3300005530 | Bacteria | 4024 |
| 213 | Ga0070679_100067233 | 3300005530 | Bacteria | 3574 |
| 214 | Ga0070679_100071325 | 3300005530 | Bacteria | 3465 |
| 215 | Ga0070679_100121152 | 3300005530 | Bacteria | 2601 |
| 216 | Ga0070679_100143070 | 3300005530 | Bacteria | 2370 |
| 217 | Ga0070679_100348594 | 3300005530 | Bacteria | 1428 |
| 218 | Ga0070679_100623649 | 3300005530 | Bacteria | 1021 |
| 219 | Ga0070679_100744792 | 3300005530 | Bacteria | 923 |
| 220 | Ga0070679_100824911 | 3300005530 | Bacteria | 871 |
| 221 | Ga0070679_101101705 | 3300005530 | Unclassified | 739 |
| 222 | Ga0070679_101304481 | 3300005530 | Bacteria | 672 |
| 223 | Ga0070679_101311044 | 3300005530 | Bacteria | 670 |
| 224 | Ga0070679_101369575 | 3300005530 | Bacteria | 653 |
| 225 | Ga0070679_101818370 | 3300005530 | Unclassified | 558 |
| 226 | Ga0070684_100001346 | 3300005535 | Bacteria | 17608 |
| 227 | Ga0070684_100003380 | 3300005535 | Bacteria | 11961 |
| 228 | Ga0070684_100053716 | 3300005535 | Bacteria | 3508 |
| 229 | Ga0070684_100108551 | 3300005535 | Bacteria | 2487 |
| 230 | Ga0070684_100250311 | 3300005535 | Bacteria | 1619 |
| 231 | Ga0070684_100428355 | 3300005535 | Bacteria | 1222 |
| 232 | Ga0070684_100496145 | 3300005535 | Bacteria | 1131 |
| 233 | Ga0070684_100625416 | 3300005535 | Bacteria | 1002 |
| 234 | Ga0070684_100633781 | 3300005535 | Bacteria | 995 |
| 235 | Ga0070684_101016851 | 3300005535 | Bacteria | 778 |
| 236 | Ga0070697_101956650 | 3300005536 | Unclassified | 525 |
| 237 | Ga0068853_100168512 | 3300005539 | Bacteria | 1980 |
| 238 | Ga0068853_100475111 | 3300005539 | Bacteria | 1178 |
| 239 | Ga0068853_100656223 | 3300005539 | Bacteria | 999 |
| 240 | Ga0068853_100709751 | 3300005539 | Bacteria | 960 |
| 241 | Ga0068853_100835890 | 3300005539 | Unclassified | 883 |
| 242 | Ga0068853_100919773 | 3300005539 | Bacteria | 840 |
| 243 | Ga0068853_101602356 | 3300005539 | Bacteria | 631 |
| 244 | Ga0070672_100013324 | 3300005543 | Bacteria | 5805 |
| 245 | Ga0070672_100095092 | 3300005543 | Bacteria | 2409 |
| 246 | Ga0070672_100553620 | 3300005543 | Bacteria | 999 |
| 247 | Ga0070686_100019696 | 3300005544 | Bacteria | 3980 |
| 248 | Ga0070695_100000005 | 3300005545 | Bacteria | 97484 |
| 249 | Ga0070695_100011656 | 3300005545 | Bacteria | 5260 |
| 250 | Ga0070695_100841576 | 3300005545 | Bacteria | 738 |
| 251 | Ga0070695_100991516 | 3300005545 | Unclassified | 683 |
| 252 | Ga0070696_100166395 | 3300005546 | Bacteria | 1627 |
| 253 | Ga0070696_100510140 | 3300005546 | Unclassified | 958 |
| 254 | Ga0070693_100004489 | 3300005547 | Bacteria | 6604 |
| 255 | Ga0070693_100129487 | 3300005547 | Bacteria | 1576 |
| 256 | Ga0070693_100150667 | 3300005547 | Bacteria | 1473 |
| 257 | Ga0070693_100517621 | 3300005547 | Unclassified | 849 |
| 258 | Ga0070665_100593888 | 3300005548 | Bacteria | 1120 |
| 259 | Ga0070665_101101562 | 3300005548 | Bacteria | 806 |
| 260 | Ga0070665_101334748 | 3300005548 | Unclassified | 727 |
| 261 | Ga0070704_100025533 | 3300005549 | Bacteria | 3891 |
| 262 | Ga0070704_100377249 | 3300005549 | Bacteria | 1204 |
| 263 | Ga0070704_100858345 | 3300005549 | Bacteria | 814 |
| 264 | Ga0068855_100015403 | 3300005563 | Bacteria | 9204 |
| 265 | Ga0068855_100235191 | 3300005563 | Bacteria | 2049 |
| 266 | Ga0068855_100408025 | 3300005563 | Bacteria | 1488 |
| 267 | Ga0068855_100484169 | 3300005563 | Bacteria | 1346 |
| 268 | Ga0068855_100725644 | 3300005563 | Bacteria | 1061 |
| 269 | Ga0068855_101092612 | 3300005563 | Bacteria | 834 |
| 270 | Ga0068855_101315071 | 3300005563 | Bacteria | 748 |
| 271 | Ga0068855_102062283 | 3300005563 | Unclassified | 575 |
| 272 | Ga0070664_100299077 | 3300005564 | Bacteria | 1454 |
| 273 | Ga0070664_101980440 | 3300005564 | Unclassified | 553 |
| 274 | Ga0068857_100163799 | 3300005577 | Bacteria | 2018 |
| 275 | Ga0068857_100400219 | 3300005577 | Bacteria | 1278 |
| 276 | Ga0068857_100608132 | 3300005577 | Bacteria | 1034 |
| 277 | Ga0068857_100995106 | 3300005577 | Bacteria | 807 |
| 278 | Ga0068857_101579600 | 3300005577 | Bacteria | 640 |
| 279 | Ga0068857_101914792 | 3300005577 | Unclassified | 581 |
| 280 | Ga0068854_100037494 | 3300005578 | Bacteria | 3403 |
| 281 | Ga0068854_100538973 | 3300005578 | Bacteria | 988 |
| 282 | Ga0068854_101583529 | 3300005578 | Unclassified | 597 |
| 283 | Ga0068854_101634330 | 3300005578 | Unclassified | 588 |
| 284 | Ga0068856_100034463 | 3300005614 | Bacteria | 4958 |
| 285 | Ga0068856_100098033 | 3300005614 | Bacteria | 2921 |
| 286 | Ga0068856_100120218 | 3300005614 | Bacteria | 2628 |
| 287 | Ga0068856_100331366 | 3300005614 | Bacteria | 1540 |
| 288 | Ga0068856_100368886 | 3300005614 | Bacteria | 1454 |
| 289 | Ga0068856_100658363 | 3300005614 | Bacteria | 1068 |
| 290 | Ga0068856_100701143 | 3300005614 | Unclassified | 1033 |
| 291 | Ga0068856_101121585 | 3300005614 | Bacteria | 804 |
| 292 | Ga0068856_101939767 | 3300005614 | Unclassified | 600 |
| 293 | Ga0070702_100286244 | 3300005615 | Bacteria | 1133 |
| 294 | Ga0068852_100063458 | 3300005616 | Bacteria | 3216 |
| 295 | Ga0068852_100400716 | 3300005616 | Bacteria | 1350 |
| 296 | Ga0068852_100428481 | 3300005616 | Bacteria | 1306 |
| 297 | Ga0068852_102136329 | 3300005616 | Unclassified | 582 |
| 298 | Ga0068859_100269591 | 3300005617 | Bacteria | 1794 |
| 299 | Ga0068864_100269034 | 3300005618 | Bacteria | 1587 |
| 300 | Ga0068864_101440182 | 3300005618 | Unclassified | 691 |
| 301 | Ga0068866_10045682 | 3300005718 | Bacteria | 2198 |
| 302 | Ga0068866_10305028 | 3300005718 | Bacteria | 996 |
| 303 | Ga0068866_10365597 | 3300005718 | Unclassified | 921 |
| 304 | Ga0068866_10368733 | 3300005718 | Bacteria | 917 |
| 305 | Ga0068861_100074770 | 3300005719 | Bacteria | 2635 |
| 306 | Ga0068851_10002070 | 3300005834 | Bacteria | 8843 |
| 307 | Ga0068863_100086259 | 3300005841 | Bacteria | 2974 |
| 308 | Ga0068863_100288516 | 3300005841 | Unclassified | 1591 |
| 309 | Ga0068858_100085497 | 3300005842 | Bacteria | 2934 |
| 310 | Ga0068858_102094484 | 3300005842 | Unclassified | 559 |
| 311 | Ga0068860_100067666 | 3300005843 | Bacteria | 3393 |
| 312 | Ga0068860_100517562 | 3300005843 | Bacteria | 1193 |
| 313 | Ga0068862_100330463 | 3300005844 | Bacteria | 1409 |
| 314 | Ga0081455_10003816 | 3300005937 | Bacteria | 17194 |
| 315 | Ga0081455_10006745 | 3300005937 | Bacteria | 12256 |
| 316 | Ga0081455_10024297 | 3300005937 | Bacteria | 5616 |
| 317 | Ga0081455_10050355 | 3300005937 | Bacteria | 3583 |
| 318 | Ga0081455_10063627 | 3300005937 | Bacteria | 3095 |
| 319 | Ga0081455_10132784 | 3300005937 | Bacteria | 1944 |
| 320 | Ga0081538_10007043 | 3300005981 | Bacteria | 9778 |
| 321 | Ga0081539_10097199 | 3300005985 | Bacteria | 1509 |
| 322 | Ga0081539_10115576 | 3300005985 | Bacteria | 1342 |
| 323 | Ga0070717_10003220 | 3300006028 | Bacteria | 11656 |
| 324 | Ga0070717_10012743 | 3300006028 | Bacteria | 6417 |
| 325 | Ga0070717_10030743 | 3300006028 | Bacteria | 4315 |
| 326 | Ga0070717_10170919 | 3300006028 | Bacteria | 1890 |
| 327 | Ga0070717_10221896 | 3300006028 | Bacteria | 1662 |
| 328 | Ga0070717_10259625 | 3300006028 | Unclassified | 1537 |
| 329 | Ga0070717_10357267 | 3300006028 | Unclassified | 1307 |
| 330 | Ga0070717_11244775 | 3300006028 | Bacteria | 677 |
| 331 | Ga0075365_10010226 | 3300006038 | Bacteria | 5452 |
| 332 | Ga0075365_10153559 | 3300006038 | Bacteria | 1602 |
| 333 | Ga0075368_10267828 | 3300006042 | Bacteria | 732 |
| 334 | Ga0075363_100240246 | 3300006048 | Bacteria | 1041 |
| 335 | Ga0075364_10524643 | 3300006051 | Bacteria | 810 |
| 336 | Ga0075364_10775196 | 3300006051 | Unclassified | 654 |
| 337 | Ga0075364_10841228 | 3300006051 | Unclassified | 625 |
| 338 | Ga0075432_10040899 | 3300006058 | Bacteria | 1618 |
| 339 | Ga0075432_10192675 | 3300006058 | Bacteria | 803 |
| 340 | Ga0070715_10031348 | 3300006163 | Bacteria | 2157 |
| 341 | Ga0070715_10324433 | 3300006163 | Bacteria | 832 |
| 342 | Ga0070716_100003399 | 3300006173 | Bacteria | 7484 |
| 343 | Ga0070716_100287821 | 3300006173 | Bacteria | 1137 |
| 344 | Ga0070716_100403003 | 3300006173 | Bacteria | 984 |
| 345 | Ga0070716_100503260 | 3300006173 | Unclassified | 894 |
| 346 | Ga0070716_101816962 | 3300006173 | Unclassified | 505 |
| 347 | Ga0070712_100081747 | 3300006175 | Bacteria | 2342 |
| 348 | Ga0070712_100305097 | 3300006175 | Bacteria | 1290 |
| 349 | Ga0070712_100436581 | 3300006175 | Bacteria | 1088 |
| 350 | Ga0070712_100465396 | 3300006175 | Unclassified | 1055 |
| 351 | Ga0070712_101222068 | 3300006175 | Bacteria | 654 |
| 352 | Ga0070712_101392229 | 3300006175 | Bacteria | 612 |
| 353 | Ga0070712_101685356 | 3300006175 | Bacteria | 555 |
| 354 | Ga0070712_101982486 | 3300006175 | Unclassified | 510 |
| 355 | Ga0075367_10408568 | 3300006178 | Bacteria | 859 |
| 356 | Ga0075367_10685351 | 3300006178 | Unclassified | 652 |
| 357 | Ga0075427_10081102 | 3300006194 | Unclassified | 587 |
| 358 | Ga0097621_100071797 | 3300006237 | Bacteria | 2862 |
| 359 | Ga0097621_100499444 | 3300006237 | Bacteria | 1102 |
| 360 | Ga0097621_101178287 | 3300006237 | Bacteria | 721 |
| 361 | Ga0068871_100111316 | 3300006358 | Unclassified | 2303 |
| 362 | Ga0068871_101112090 | 3300006358 | Bacteria | 739 |
| 363 | Ga0068871_101332491 | 3300006358 | Unclassified | 676 |
| 364 | Ga0075431_100151018 | 3300006847 | Bacteria | 2392 |
| 365 | Ga0075431_101011051 | 3300006847 | Unclassified | 798 |
| 366 | Ga0075433_10047993 | 3300006852 | Bacteria | 3713 |
| 367 | Ga0075433_10055599 | 3300006852 | Bacteria | 3455 |
| 368 | Ga0075433_10129823 | 3300006852 | Bacteria | 2239 |
| 369 | Ga0075433_10179494 | 3300006852 | Bacteria | 1884 |
| 370 | Ga0075433_10321564 | 3300006852 | Bacteria | 1369 |
| 371 | Ga0075433_10478564 | 3300006852 | Bacteria | 1097 |
| 372 | Ga0075433_10478665 | 3300006852 | Unclassified | 1097 |
| 373 | Ga0075433_10577305 | 3300006852 | Bacteria | 988 |
| 374 | Ga0075433_11223287 | 3300006852 | Bacteria | 652 |
| 375 | Ga0075434_100003166 | 3300006871 | Bacteria | 14671 |
| 376 | Ga0075434_100016920 | 3300006871 | Bacteria | 7013 |
| 377 | Ga0075434_100153440 | 3300006871 | Bacteria | 2323 |
| 378 | Ga0075434_100221740 | 3300006871 | Bacteria | 1911 |
| 379 | Ga0075434_100266345 | 3300006871 | Bacteria | 1733 |
| 380 | Ga0075434_100302477 | 3300006871 | Bacteria | 1620 |
| 381 | Ga0075434_100599381 | 3300006871 | Bacteria | 1121 |
| 382 | Ga0075434_101055084 | 3300006871 | Bacteria | 826 |
| 383 | Ga0075434_101113124 | 3300006871 | Unclassified | 803 |
| 384 | Ga0075429_100545619 | 3300006880 | Bacteria | 1016 |
| 385 | Ga0068865_100069957 | 3300006881 | Bacteria | 2485 |
| 386 | Ga0068865_100191110 | 3300006881 | Bacteria | 1583 |
| 387 | Ga0068865_101170725 | 3300006881 | Bacteria | 680 |
| 388 | Ga0075436_100015420 | 3300006914 | Bacteria | 5233 |
| 389 | Ga0075436_100199176 | 3300006914 | Bacteria | 1418 |
| 390 | Ga0075436_100242960 | 3300006914 | Unclassified | 1281 |
| 391 | Ga0075436_100470264 | 3300006914 | Bacteria | 917 |
| 392 | Ga0075436_100702882 | 3300006914 | Bacteria | 749 |
| 393 | Ga0075436_101143891 | 3300006914 | Unclassified | 587 |
| 394 | Ga0097620_100269570 | 3300006931 | Bacteria | 1794 |
| 395 | Ga0075435_100002887 | 3300007076 | Bacteria | 11528 |
| 396 | Ga0075435_100024812 | 3300007076 | Bacteria | 4659 |
| 397 | Ga0075435_100538495 | 3300007076 | Bacteria | 1011 |
| 398 | Ga0075435_100576966 | 3300007076 | Unclassified | 975 |
| 399 | Ga0075435_100916597 | 3300007076 | Bacteria | 764 |
| 400 | Ga0075435_101127506 | 3300007076 | Bacteria | 686 |
| 401 | Ga0099795_10163697 | 3300007788 | Bacteria | 920 |
| 402 | Ga0105244_10453584 | 3300009036 | Unclassified | 590 |
| 403 | Ga0105240_10057664 | 3300009093 | Bacteria | 4850 |
| 404 | Ga0105240_10081524 | 3300009093 | Bacteria | 3976 |
| 405 | Ga0105240_10188879 | 3300009093 | Bacteria | 2424 |
| 406 | Ga0105240_10320364 | 3300009093 | Unclassified | 1767 |
| 407 | Ga0105240_10437306 | 3300009093 | Bacteria | 1466 |
| 408 | Ga0105240_11463306 | 3300009093 | Bacteria | 717 |
| 409 | Ga0105240_12258862 | 3300009093 | Bacteria | 564 |
| 410 | Ga0105240_12697635 | 3300009093 | Unclassified | 512 |
| 411 | Ga0111539_10181783 | 3300009094 | Bacteria | 2456 |
| 412 | Ga0111539_10414434 | 3300009094 | Bacteria | 1569 |
| 413 | Ga0111539_10595014 | 3300009094 | Bacteria | 1288 |
| 414 | Ga0111539_10649507 | 3300009094 | Unclassified | 1228 |
| 415 | Ga0111539_10733701 | 3300009094 | Bacteria | 1150 |
| 416 | Ga0111539_10898619 | 3300009094 | Unclassified | 1030 |
| 417 | Ga0111539_11624889 | 3300009094 | Unclassified | 749 |
| 418 | Ga0105245_10028407 | 3300009098 | Bacteria | 4934 |
| 419 | Ga0105245_10042251 | 3300009098 | Bacteria | 4067 |
| 420 | Ga0105245_10105558 | 3300009098 | Bacteria | 2613 |
| 421 | Ga0105245_10324044 | 3300009098 | Bacteria | 1519 |
| 422 | Ga0105245_10526847 | 3300009098 | Bacteria | 1201 |
| 423 | Ga0105245_10754483 | 3300009098 | Bacteria | 1009 |
| 424 | Ga0105245_11080129 | 3300009098 | Bacteria | 848 |
| 425 | Ga0105245_13284950 | 3300009098 | Unclassified | 500 |
| 426 | Ga0105247_10146499 | 3300009101 | Bacteria | 1552 |
| 427 | Ga0105247_10478840 | 3300009101 | Unclassified | 903 |
| 428 | Ga0114129_10017839 | 3300009147 | Bacteria | 10107 |
| 429 | Ga0114129_10040101 | 3300009147 | Bacteria | 6602 |
| 430 | Ga0114129_10323206 | 3300009147 | Bacteria | 2051 |
| 431 | Ga0114129_11018950 | 3300009147 | Unclassified | 1041 |
| 432 | Ga0114129_11288816 | 3300009147 | Bacteria | 906 |
| 433 | Ga0114129_11708312 | 3300009147 | Unclassified | 768 |
| 434 | Ga0105243_10048038 | 3300009148 | Bacteria | 3363 |
| 435 | Ga0105243_10439161 | 3300009148 | Bacteria | 1222 |
| 436 | Ga0105243_11133986 | 3300009148 | Bacteria | 792 |
| 437 | Ga0105241_10419178 | 3300009174 | Bacteria | 1178 |
| 438 | Ga0105241_10476533 | 3300009174 | Unclassified | 1109 |
| 439 | Ga0105241_10992912 | 3300009174 | Unclassified | 785 |
| 440 | Ga0105241_11078927 | 3300009174 | Bacteria | 755 |
| 441 | Ga0105241_11083456 | 3300009174 | Bacteria | 754 |
| 442 | Ga0105241_12253919 | 3300009174 | Unclassified | 541 |
| 443 | Ga0105241_12365976 | 3300009174 | Unclassified | 530 |
| 444 | Ga0105242_10028905 | 3300009176 | Bacteria | 4417 |
| 445 | Ga0105242_10047642 | 3300009176 | Bacteria | 3481 |
| 446 | Ga0105242_10308279 | 3300009176 | Bacteria | 1447 |
| 447 | Ga0105242_10598492 | 3300009176 | Bacteria | 1065 |
| 448 | Ga0105242_10743469 | 3300009176 | Unclassified | 965 |
| 449 | Ga0105242_10837481 | 3300009176 | Bacteria | 914 |
| 450 | Ga0105242_10954724 | 3300009176 | Bacteria | 862 |
| 451 | Ga0105242_11549173 | 3300009176 | Bacteria | 695 |
| 452 | Ga0105242_11756877 | 3300009176 | Bacteria | 658 |
| 453 | Ga0105242_12807429 | 3300009176 | Unclassified | 537 |
| 454 | Ga0105248_10075747 | 3300009177 | Bacteria | 3782 |
| 455 | Ga0105248_10545490 | 3300009177 | Bacteria | 1308 |
| 456 | Ga0105248_10712017 | 3300009177 | Bacteria | 1133 |
| 457 | Ga0105248_11063767 | 3300009177 | Unclassified | 914 |
| 458 | Ga0105248_11768615 | 3300009177 | Unclassified | 701 |
| 459 | Ga0105237_10047231 | 3300009545 | Bacteria | 4328 |
| 460 | Ga0105237_10130509 | 3300009545 | Bacteria | 2507 |
| 461 | Ga0105237_10522395 | 3300009545 | Bacteria | 1194 |
| 462 | Ga0105237_10771175 | 3300009545 | Unclassified | 968 |
| 463 | Ga0105237_10817692 | 3300009545 | Bacteria | 939 |
| 464 | Ga0105238_10027833 | 3300009551 | Bacteria | 5760 |
| 465 | Ga0105238_10151827 | 3300009551 | Unclassified | 2291 |
| 466 | Ga0105238_11111453 | 3300009551 | Bacteria | 813 |
| 467 | Ga0105238_11619344 | 3300009551 | Bacteria | 678 |
| 468 | Ga0105238_12457276 | 3300009551 | Unclassified | 557 |
| 469 | Ga0105249_10303992 | 3300009553 | Bacteria | 1601 |
| 470 | Ga0105239_10103161 | 3300010375 | Bacteria | 3156 |
| 471 | Ga0105239_10301886 | 3300010375 | Bacteria | 1803 |
| 472 | Ga0105239_10364199 | 3300010375 | Bacteria | 1633 |
| 473 | Ga0105239_10739199 | 3300010375 | Bacteria | 1126 |
| 474 | Ga0105239_10742900 | 3300010375 | Unclassified | 1123 |
| 475 | Ga0105239_10895491 | 3300010375 | Bacteria | 1018 |
| 476 | Ga0105239_11018423 | 3300010375 | Bacteria | 952 |
| 477 | Ga0105239_11877208 | 3300010375 | Bacteria | 695 |
| 478 | Ga0105239_12861347 | 3300010375 | Bacteria | 563 |
| 479 | Ga0105246_10113015 | 3300011119 | Bacteria | 1999 |
| 480 | Ga0105246_10233583 | 3300011119 | Unclassified | 1449 |
| 481 | Ga0105246_11114392 | 3300011119 | Unclassified | 721 |
| 482 | Ga0157346_1024578 | 3300012480 | Unclassified | 550 |
| 483 | Ga0157324_1038236 | 3300012506 | Unclassified | 576 |
| 484 | Ga0157338_1044070 | 3300012515 | Unclassified | 618 |
| 485 | Ga0157373_10010996 | 3300013100 | Bacteria | 6664 |
| 486 | Ga0157373_10141077 | 3300013100 | Bacteria | 1694 |
| 487 | Ga0157373_10336502 | 3300013100 | Bacteria | 1075 |
| 488 | Ga0157373_10363929 | 3300013100 | Bacteria | 1033 |
| 489 | Ga0157373_10716935 | 3300013100 | Bacteria | 734 |
| 490 | Ga0157373_11044154 | 3300013100 | Unclassified | 611 |
| 491 | Ga0157373_11132765 | 3300013100 | Bacteria | 588 |
| 492 | Ga0157371_10088302 | 3300013102 | Bacteria | 2195 |
| 493 | Ga0157371_10139338 | 3300013102 | Bacteria | 1728 |
| 494 | Ga0157371_10263741 | 3300013102 | Bacteria | 1242 |
| 495 | Ga0157371_10296538 | 3300013102 | Bacteria | 1170 |
| 496 | Ga0157371_10628739 | 3300013102 | Bacteria | 800 |
| 497 | Ga0157371_10846475 | 3300013102 | Unclassified | 691 |
| 498 | Ga0157371_11154395 | 3300013102 | Bacteria | 596 |
| 499 | Ga0157370_10025355 | 3300013104 | Bacteria | 5869 |
| 500 | Ga0157370_10061119 | 3300013104 | Bacteria | 3575 |
| 501 | Ga0157370_10104600 | 3300013104 | Bacteria | 2650 |
| 502 | Ga0157370_10435297 | 3300013104 | Bacteria | 1206 |
| 503 | Ga0157370_10987783 | 3300013104 | Bacteria | 762 |
| 504 | Ga0157370_11832993 | 3300013104 | Unclassified | 544 |
| 505 | Ga0157370_11853130 | 3300013104 | Bacteria | 541 |
| 506 | Ga0157370_12117357 | 3300013104 | Unclassified | 504 |
| 507 | Ga0157369_10005226 | 3300013105 | Bacteria | 15146 |
| 508 | Ga0157369_10018754 | 3300013105 | Bacteria | 7756 |
| 509 | Ga0157369_10066593 | 3300013105 | Bacteria | 3874 |
| 510 | Ga0157369_10539134 | 3300013105 | Bacteria | 1206 |
| 511 | Ga0157369_10543737 | 3300013105 | Bacteria | 1201 |
| 512 | Ga0157369_10607392 | 3300013105 | Bacteria | 1129 |
| 513 | Ga0157369_10630602 | 3300013105 | Unclassified | 1106 |
| 514 | Ga0157369_10704940 | 3300013105 | Bacteria | 1039 |
| 515 | Ga0157369_10876624 | 3300013105 | Unclassified | 921 |
| 516 | Ga0157369_11347793 | 3300013105 | Bacteria | 727 |
| 517 | Ga0157369_11696909 | 3300013105 | Bacteria | 642 |
| 518 | Ga0157369_12290967 | 3300013105 | Bacteria | 547 |
| 519 | Ga0157369_12686523 | 3300013105 | Bacteria | 502 |
| 520 | Ga0157369_12703630 | 3300013105 | Bacteria | 500 |
| 521 | Ga0157374_10041383 | 3300013296 | Bacteria | 4246 |
| 522 | Ga0157374_10123570 | 3300013296 | Bacteria | 2500 |
| 523 | Ga0157374_10235158 | 3300013296 | Bacteria | 1801 |
| 524 | Ga0157374_10301590 | 3300013296 | Unclassified | 1585 |
| 525 | Ga0157374_10478136 | 3300013296 | Bacteria | 1249 |
| 526 | Ga0157374_10742852 | 3300013296 | Bacteria | 996 |
| 527 | Ga0157378_10465749 | 3300013297 | Bacteria | 1257 |
| 528 | Ga0163162_10107256 | 3300013306 | Bacteria | 2888 |
| 529 | Ga0163162_11593837 | 3300013306 | Bacteria | 745 |
| 530 | Ga0163162_11839419 | 3300013306 | Bacteria | 693 |
| 531 | Ga0157372_10029009 | 3300013307 | Bacteria | 6037 |
| 532 | Ga0157372_10052833 | 3300013307 | Bacteria | 4527 |
| 533 | Ga0157372_10098883 | 3300013307 | Bacteria | 3328 |
| 534 | Ga0157372_10109124 | 3300013307 | Bacteria | 3168 |
| 535 | Ga0157372_10214049 | 3300013307 | Bacteria | 2233 |
| 536 | Ga0157372_10600515 | 3300013307 | Bacteria | 1283 |
| 537 | Ga0157372_10634624 | 3300013307 | Bacteria | 1244 |
| 538 | Ga0157372_10803600 | 3300013307 | Bacteria | 1093 |
| 539 | Ga0157372_10921036 | 3300013307 | Bacteria | 1014 |
| 540 | Ga0157372_11369122 | 3300013307 | Bacteria | 816 |
| 541 | Ga0157375_10116806 | 3300013308 | Unclassified | 2773 |
| 542 | Ga0157375_10133720 | 3300013308 | Bacteria | 2602 |
| 543 | Ga0157375_10158611 | 3300013308 | Bacteria | 2403 |
| 544 | Ga0157375_10331494 | 3300013308 | Bacteria | 1687 |
| 545 | Ga0157375_10580280 | 3300013308 | Bacteria | 1281 |
| 546 | Ga0157375_11949213 | 3300013308 | Unclassified | 698 |
| 547 | Ga0157375_12668505 | 3300013308 | Bacteria | 597 |
| 548 | Ga0163163_10407054 | 3300014325 | Unclassified | 1419 |
| 549 | Ga0163163_10499640 | 3300014325 | Bacteria | 1278 |
| 550 | Ga0163163_12915226 | 3300014325 | Unclassified | 534 |
| 551 | Ga0157380_10199713 | 3300014326 | Bacteria | 1773 |
| 552 | Ga0157380_10407620 | 3300014326 | Bacteria | 1292 |
| 553 | Ga0182008_10014973 | 3300014497 | Bacteria | 4056 |
| 554 | Ga0182008_10069125 | 3300014497 | Bacteria | 1738 |
| 555 | Ga0182008_10148894 | 3300014497 | Bacteria | 1173 |
| 556 | Ga0182008_10222777 | 3300014497 | Archaea | 965 |
| 557 | Ga0182008_10679698 | 3300014497 | Unclassified | 586 |
| 558 | Ga0157377_10002430 | 3300014745 | Bacteria | 8224 |
| 559 | Ga0157377_10093953 | 3300014745 | Bacteria | 1776 |
| 560 | Ga0157377_10372596 | 3300014745 | Unclassified | 964 |
| 561 | Ga0157377_11212345 | 3300014745 | Unclassified | 585 |
| 562 | Ga0157377_11439542 | 3300014745 | Unclassified | 545 |
| 563 | Ga0157379_10022388 | 3300014968 | Bacteria | 5598 |
| 564 | Ga0157379_11305138 | 3300014968 | Unclassified | 701 |
| 565 | Ga0157376_10043518 | 3300014969 | Bacteria | 3685 |
| 566 | Ga0157376_10293133 | 3300014969 | Bacteria | 1537 |
| 567 | Ga0157376_10593473 | 3300014969 | Bacteria | 1102 |
| 568 | Ga0157376_10947761 | 3300014969 | Bacteria | 881 |
| 569 | Ga0157376_12079708 | 3300014969 | Unclassified | 606 |
| 570 | Ga0182007_10029036 | 3300015262 | Bacteria | 1895 |
| 571 | Ga0182007_10088733 | 3300015262 | Bacteria | 1017 |
| 572 | Ga0182007_10199042 | 3300015262 | Unclassified | 700 |
| 573 | Ga0182005_1076383 | 3300015265 | Bacteria | 923 |
| 574 | Ga0163161_10201836 | 3300017792 | Bacteria | 1533 |
| 575 | Ga0163161_10441741 | 3300017792 | Bacteria | 1050 |
| 576 | Ga0163161_10581101 | 3300017792 | Bacteria | 921 |
| 577 | Ga0197907_10233942 | 3300020069 | Bacteria | 711 |
| 578 | Ga0206356_10189341 | 3300020070 | Unclassified | 837 |
| 579 | Ga0206356_11742642 | 3300020070 | Bacteria | 1542 |
| 580 | Ga0206356_11809610 | 3300020070 | Bacteria | 949 |
| 581 | Ga0206354_10447037 | 3300020081 | Bacteria | 612 |
| 582 | Ga0206353_11320045 | 3300020082 | Bacteria | 2727 |
| 583 | Ga0206353_11345779 | 3300020082 | Bacteria | 950 |
| 584 | Ga0206353_11436958 | 3300020082 | Bacteria | 1470 |
| 585 | Ga0206353_11607184 | 3300020082 | Bacteria | 1263 |
| 586 | Ga0206353_11883755 | 3300020082 | Bacteria | 3741 |
| 587 | Ga0206353_11898338 | 3300020082 | Bacteria | 2085 |
| 588 | Ga0224712_10191935 | 3300022467 | Bacteria | 925 |
| 589 | Ga0224712_10332345 | 3300022467 | Unclassified | 716 |
| 590 | Ga0207656_10017665 | 3300025321 | Bacteria | 2798 |
| 591 | Ga0207653_10179811 | 3300025885 | Bacteria | 791 |
| 592 | Ga0207682_10033355 | 3300025893 | Bacteria | 2072 |
| 593 | Ga0207692_10005396 | 3300025898 | Bacteria | 5121 |
| 594 | Ga0207692_10076680 | 3300025898 | Bacteria | 1776 |
| 595 | Ga0207692_10238876 | 3300025898 | Bacteria | 1084 |
| 596 | Ga0207692_10442569 | 3300025898 | Unclassified | 817 |
| 597 | Ga0207692_10730138 | 3300025898 | Unclassified | 644 |
| 598 | Ga0207692_11087151 | 3300025898 | Unclassified | 529 |
| 599 | Ga0207710_10089088 | 3300025900 | Bacteria | 1442 |
| 600 | Ga0207688_10222435 | 3300025901 | Bacteria | 1137 |
| 601 | Ga0207680_10112914 | 3300025903 | Bacteria | 1765 |
| 602 | Ga0207647_10016364 | 3300025904 | Bacteria | 5063 |
| 603 | Ga0207685_10065257 | 3300025905 | Bacteria | 1457 |
| 604 | Ga0207685_10266185 | 3300025905 | Unclassified | 835 |
| 605 | Ga0207699_10320295 | 3300025906 | Bacteria | 1087 |
| 606 | Ga0207699_11285782 | 3300025906 | Bacteria | 541 |
| 607 | Ga0207643_10006034 | 3300025908 | Bacteria | 6478 |
| 608 | Ga0207643_10520256 | 3300025908 | Bacteria | 762 |
| 609 | Ga0207705_10015501 | 3300025909 | Bacteria | 5469 |
| 610 | Ga0207705_10074709 | 3300025909 | Bacteria | 2461 |
| 611 | Ga0207705_10106216 | 3300025909 | Bacteria | 2070 |
| 612 | Ga0207705_10297523 | 3300025909 | Bacteria | 1237 |
| 613 | Ga0207705_10724396 | 3300025909 | Bacteria | 773 |
| 614 | Ga0207684_10159662 | 3300025910 | Bacteria | 1941 |
| 615 | Ga0207684_10312493 | 3300025910 | Bacteria | 1355 |
| 616 | Ga0207684_10414598 | 3300025910 | Bacteria | 1157 |
| 617 | Ga0207684_10869513 | 3300025910 | Unclassified | 759 |
| 618 | Ga0207684_11068054 | 3300025910 | Bacteria | 673 |
| 619 | Ga0207654_10620749 | 3300025911 | Bacteria | 772 |
| 620 | Ga0207654_11176646 | 3300025911 | Unclassified | 559 |
| 621 | Ga0207654_11196207 | 3300025911 | Unclassified | 554 |
| 622 | Ga0207707_10002693 | 3300025912 | Bacteria | 15869 |
| 623 | Ga0207707_10019284 | 3300025912 | Bacteria | 5952 |
| 624 | Ga0207707_10024829 | 3300025912 | Bacteria | 5242 |
| 625 | Ga0207707_10043277 | 3300025912 | Bacteria | 3928 |
| 626 | Ga0207707_10133634 | 3300025912 | Bacteria | 2170 |
| 627 | Ga0207707_10241385 | 3300025912 | Bacteria | 1571 |
| 628 | Ga0207707_10290268 | 3300025912 | Bacteria | 1415 |
| 629 | Ga0207707_10317937 | 3300025912 | Bacteria | 1344 |
| 630 | Ga0207707_10379297 | 3300025912 | Bacteria | 1216 |
| 631 | Ga0207707_10475707 | 3300025912 | Bacteria | 1067 |
| 632 | Ga0207695_10016817 | 3300025913 | Bacteria | 8541 |
| 633 | Ga0207695_10046432 | 3300025913 | Bacteria | 4604 |
| 634 | Ga0207695_10467342 | 3300025913 | Bacteria | 1144 |
| 635 | Ga0207695_10949713 | 3300025913 | Bacteria | 739 |
| 636 | Ga0207695_11461432 | 3300025913 | Bacteria | 564 |
| 637 | Ga0207695_11538915 | 3300025913 | Unclassified | 546 |
| 638 | Ga0207671_10205800 | 3300025914 | Unclassified | 1538 |
| 639 | Ga0207671_10479120 | 3300025914 | Bacteria | 992 |
| 640 | Ga0207671_10828349 | 3300025914 | Bacteria | 733 |
| 641 | Ga0207671_11039773 | 3300025914 | Unclassified | 645 |
| 642 | Ga0207693_10000807 | 3300025915 | Bacteria | 28042 |
| 643 | Ga0207693_10157081 | 3300025915 | Bacteria | 1789 |
| 644 | Ga0207693_10277724 | 3300025915 | Bacteria | 1313 |
| 645 | Ga0207693_10802466 | 3300025915 | Unclassified | 725 |
| 646 | Ga0207693_11005022 | 3300025915 | Unclassified | 637 |
| 647 | Ga0207693_11182004 | 3300025915 | Bacteria | 577 |
| 648 | Ga0207663_10003697 | 3300025916 | Bacteria | 7526 |
| 649 | Ga0207663_10408305 | 3300025916 | Bacteria | 1040 |
| 650 | Ga0207663_10525705 | 3300025916 | Unclassified | 922 |
| 651 | Ga0207663_11039070 | 3300025916 | Unclassified | 658 |
| 652 | Ga0207660_10022356 | 3300025917 | Bacteria | 4260 |
| 653 | Ga0207660_10069045 | 3300025917 | Bacteria | 2565 |
| 654 | Ga0207660_10105664 | 3300025917 | Bacteria | 2110 |
| 655 | Ga0207660_10128420 | 3300025917 | Bacteria | 1927 |
| 656 | Ga0207660_10136161 | 3300025917 | Bacteria | 1874 |
| 657 | Ga0207660_10306774 | 3300025917 | Bacteria | 1265 |
| 658 | Ga0207660_10331251 | 3300025917 | Bacteria | 1217 |
| 659 | Ga0207660_11188416 | 3300025917 | Bacteria | 621 |
| 660 | Ga0207660_11382918 | 3300025917 | Bacteria | 570 |
| 661 | Ga0207660_11473573 | 3300025917 | Unclassified | 550 |
| 662 | Ga0207660_11555118 | 3300025917 | Bacteria | 534 |
| 663 | Ga0207662_10125436 | 3300025918 | Bacteria | 1614 |
| 664 | Ga0207657_10017815 | 3300025919 | Bacteria | 6800 |
| 665 | Ga0207657_10024580 | 3300025919 | Bacteria | 5573 |
| 666 | Ga0207657_10042137 | 3300025919 | Bacteria | 4030 |
| 667 | Ga0207657_10059280 | 3300025919 | Bacteria | 3290 |
| 668 | Ga0207657_10098078 | 3300025919 | Bacteria | 2436 |
| 669 | Ga0207657_10399085 | 3300025919 | Bacteria | 1082 |
| 670 | Ga0207657_10526261 | 3300025919 | Unclassified | 925 |
| 671 | Ga0207657_10535166 | 3300025919 | Bacteria | 916 |
| 672 | Ga0207649_10026908 | 3300025920 | Bacteria | 3370 |
| 673 | Ga0207649_10037316 | 3300025920 | Bacteria | 2935 |
| 674 | Ga0207649_10243880 | 3300025920 | Bacteria | 1291 |
| 675 | Ga0207649_10491678 | 3300025920 | Bacteria | 932 |
| 676 | Ga0207649_10846362 | 3300025920 | Bacteria | 715 |
| 677 | Ga0207652_10010839 | 3300025921 | Bacteria | 7346 |
| 678 | Ga0207652_10042313 | 3300025921 | Bacteria | 3877 |
| 679 | Ga0207652_10047170 | 3300025921 | Bacteria | 3679 |
| 680 | Ga0207652_10094302 | 3300025921 | Bacteria | 2635 |
| 681 | Ga0207652_10194339 | 3300025921 | Bacteria | 1825 |
| 682 | Ga0207652_10205165 | 3300025921 | Bacteria | 1774 |
| 683 | Ga0207652_10260921 | 3300025921 | Bacteria | 1563 |
| 684 | Ga0207652_10278035 | 3300025921 | Bacteria | 1510 |
| 685 | Ga0207652_10334461 | 3300025921 | Unclassified | 1367 |
| 686 | Ga0207652_10375781 | 3300025921 | Bacteria | 1283 |
| 687 | Ga0207652_10526498 | 3300025921 | Bacteria | 1063 |
| 688 | Ga0207652_10634302 | 3300025921 | Bacteria | 956 |
| 689 | Ga0207652_11042058 | 3300025921 | Bacteria | 717 |
| 690 | Ga0207652_11477949 | 3300025921 | Unclassified | 583 |
| 691 | Ga0207652_11670619 | 3300025921 | Unclassified | 541 |
| 692 | Ga0207646_10001597 | 3300025922 | Bacteria | 27663 |
| 693 | Ga0207646_10198651 | 3300025922 | Bacteria | 1811 |
| 694 | Ga0207646_10340023 | 3300025922 | Unclassified | 1356 |
| 695 | Ga0207646_10341241 | 3300025922 | Bacteria | 1353 |
| 696 | Ga0207646_10364212 | 3300025922 | Bacteria | 1306 |
| 697 | Ga0207681_11025098 | 3300025923 | Bacteria | 693 |
| 698 | Ga0207694_11344464 | 3300025924 | Bacteria | 604 |
| 699 | Ga0207650_10121084 | 3300025925 | Bacteria | 2037 |
| 700 | Ga0207650_10470409 | 3300025925 | Bacteria | 1048 |
| 701 | Ga0207659_10211288 | 3300025926 | Bacteria | 1555 |
| 702 | Ga0207659_10781151 | 3300025926 | Bacteria | 820 |
| 703 | Ga0207659_10982593 | 3300025926 | Bacteria | 726 |
| 704 | Ga0207687_10017154 | 3300025927 | Bacteria | 4761 |
| 705 | Ga0207687_10061467 | 3300025927 | Bacteria | 2653 |
| 706 | Ga0207687_10231625 | 3300025927 | Bacteria | 1459 |
| 707 | Ga0207687_10242276 | 3300025927 | Bacteria | 1430 |
| 708 | Ga0207687_10285810 | 3300025927 | Bacteria | 1324 |
| 709 | Ga0207687_10445443 | 3300025927 | Bacteria | 1073 |
| 710 | Ga0207687_10503622 | 3300025927 | Bacteria | 1011 |
| 711 | Ga0207687_11922570 | 3300025927 | Unclassified | 506 |
| 712 | Ga0207700_10006860 | 3300025928 | Bacteria | 6924 |
| 713 | Ga0207700_10046588 | 3300025928 | Bacteria | 3207 |
| 714 | Ga0207700_10185271 | 3300025928 | Bacteria | 1746 |
| 715 | Ga0207700_10356422 | 3300025928 | Bacteria | 1275 |
| 716 | Ga0207700_10643370 | 3300025928 | Bacteria | 945 |
| 717 | Ga0207700_10901806 | 3300025928 | Unclassified | 791 |
| 718 | Ga0207700_10977963 | 3300025928 | Bacteria | 757 |
| 719 | Ga0207664_10001655 | 3300025929 | Bacteria | 14675 |
| 720 | Ga0207664_10004892 | 3300025929 | Bacteria | 9106 |
| 721 | Ga0207664_10007705 | 3300025929 | Bacteria | 7473 |
| 722 | Ga0207664_10024336 | 3300025929 | Bacteria | 4550 |
| 723 | Ga0207664_10050473 | 3300025929 | Bacteria | 3280 |
| 724 | Ga0207664_10169528 | 3300025929 | Bacteria | 1867 |
| 725 | Ga0207664_10205175 | 3300025929 | Bacteria | 1703 |
| 726 | Ga0207664_10466589 | 3300025929 | Bacteria | 1128 |
| 727 | Ga0207664_10510287 | 3300025929 | Bacteria | 1077 |
| 728 | Ga0207664_10710401 | 3300025929 | Unclassified | 904 |
| 729 | Ga0207664_10999750 | 3300025929 | Unclassified | 750 |
| 730 | Ga0207664_11726434 | 3300025929 | Unclassified | 548 |
| 731 | Ga0207644_10024356 | 3300025931 | Bacteria | 4154 |
| 732 | Ga0207644_10104847 | 3300025931 | Bacteria | 2129 |
| 733 | Ga0207690_10124679 | 3300025932 | Bacteria | 1876 |
| 734 | Ga0207690_10146088 | 3300025932 | Bacteria | 1748 |
| 735 | Ga0207690_10172485 | 3300025932 | Bacteria | 1622 |
| 736 | Ga0207690_10293764 | 3300025932 | Bacteria | 1269 |
| 737 | Ga0207690_10543954 | 3300025932 | Bacteria | 943 |
| 738 | Ga0207690_11557826 | 3300025932 | Unclassified | 552 |
| 739 | Ga0207706_10003547 | 3300025933 | Bacteria | 14894 |
| 740 | Ga0207706_10094287 | 3300025933 | Bacteria | 2633 |
| 741 | Ga0207706_10381560 | 3300025933 | Unclassified | 1223 |
| 742 | Ga0207686_10031844 | 3300025934 | Bacteria | 3134 |
| 743 | Ga0207686_10178089 | 3300025934 | Bacteria | 1505 |
| 744 | Ga0207686_10196473 | 3300025934 | Unclassified | 1442 |
| 745 | Ga0207686_10253179 | 3300025934 | Bacteria | 1288 |
| 746 | Ga0207686_10274344 | 3300025934 | Bacteria | 1242 |
| 747 | Ga0207686_10481988 | 3300025934 | Bacteria | 959 |
| 748 | Ga0207686_10596909 | 3300025934 | Bacteria | 868 |
| 749 | Ga0207709_10030731 | 3300025935 | Bacteria | 3128 |
| 750 | Ga0207709_10476864 | 3300025935 | Unclassified | 969 |
| 751 | Ga0207670_10456364 | 3300025936 | Bacteria | 1031 |
| 752 | Ga0207669_10227965 | 3300025937 | Bacteria | 1372 |
| 753 | Ga0207669_10588022 | 3300025937 | Bacteria | 903 |
| 754 | Ga0207704_10021048 | 3300025938 | Bacteria | 3465 |
| 755 | Ga0207704_10771379 | 3300025938 | Bacteria | 801 |
| 756 | Ga0207665_10000058 | 3300025939 | Bacteria | 72882 |
| 757 | Ga0207665_10095284 | 3300025939 | Bacteria | 2068 |
| 758 | Ga0207665_11310218 | 3300025939 | Bacteria | 577 |
| 759 | Ga0207691_10012302 | 3300025940 | Bacteria | 8204 |
| 760 | Ga0207691_11454386 | 3300025940 | Bacteria | 562 |
| 761 | Ga0207711_10260493 | 3300025941 | Bacteria | 1594 |
| 762 | Ga0207711_11270147 | 3300025941 | Unclassified | 678 |
| 763 | Ga0207711_11723963 | 3300025941 | Unclassified | 570 |
| 764 | Ga0207689_10096218 | 3300025942 | Bacteria | 2432 |
| 765 | Ga0207661_10025485 | 3300025944 | Bacteria | 4495 |
| 766 | Ga0207661_10086505 | 3300025944 | Bacteria | 2601 |
| 767 | Ga0207661_10174014 | 3300025944 | Bacteria | 1876 |
| 768 | Ga0207661_10211823 | 3300025944 | Bacteria | 1708 |
| 769 | Ga0207661_10247845 | 3300025944 | Bacteria | 1582 |
| 770 | Ga0207661_10371899 | 3300025944 | Unclassified | 1292 |
| 771 | Ga0207661_10383848 | 3300025944 | Bacteria | 1272 |
| 772 | Ga0207661_10596686 | 3300025944 | Bacteria | 1013 |
| 773 | Ga0207661_10701666 | 3300025944 | Unclassified | 931 |
| 774 | Ga0207661_10945333 | 3300025944 | Unclassified | 794 |
| 775 | Ga0207661_11168512 | 3300025944 | Bacteria | 708 |
| 776 | Ga0207661_11281818 | 3300025944 | Unclassified | 673 |
| 777 | Ga0207661_11730815 | 3300025944 | Unclassified | 570 |
| 778 | Ga0207679_10429434 | 3300025945 | Bacteria | 1168 |
| 779 | Ga0207679_10554703 | 3300025945 | Bacteria | 1031 |
| 780 | Ga0207667_10133328 | 3300025949 | Bacteria | 2559 |
| 781 | Ga0207667_10164331 | 3300025949 | Bacteria | 2282 |
| 782 | Ga0207667_10281218 | 3300025949 | Bacteria | 1700 |
| 783 | Ga0207667_10589790 | 3300025949 | Bacteria | 1121 |
| 784 | Ga0207667_10603893 | 3300025949 | Bacteria | 1106 |
| 785 | Ga0207667_10612792 | 3300025949 | Bacteria | 1097 |
| 786 | Ga0207667_10639459 | 3300025949 | Bacteria | 1070 |
| 787 | Ga0207667_10640368 | 3300025949 | Bacteria | 1069 |
| 788 | Ga0207667_10653118 | 3300025949 | Bacteria | 1057 |
| 789 | Ga0207667_12155362 | 3300025949 | Unclassified | 515 |
| 790 | Ga0207651_10079436 | 3300025960 | Bacteria | 2357 |
| 791 | Ga0207651_10619703 | 3300025960 | Bacteria | 948 |
| 792 | Ga0207651_10657250 | 3300025960 | Bacteria | 920 |
| 793 | Ga0207651_11653224 | 3300025960 | Bacteria | 577 |
| 794 | Ga0207712_10299351 | 3300025961 | Bacteria | 1319 |
| 795 | Ga0207712_11957089 | 3300025961 | Unclassified | 525 |
| 796 | Ga0207668_11030750 | 3300025972 | Bacteria | 736 |
| 797 | Ga0207640_10952795 | 3300025981 | Bacteria | 752 |
| 798 | Ga0207677_10024006 | 3300026023 | Bacteria | 3778 |
| 799 | Ga0207677_10069121 | 3300026023 | Bacteria | 2482 |
| 800 | Ga0207677_10185740 | 3300026023 | Bacteria | 1639 |
| 801 | Ga0207677_10438548 | 3300026023 | Bacteria | 1116 |
| 802 | Ga0207677_11775233 | 3300026023 | Bacteria | 572 |
| 803 | Ga0207703_10366857 | 3300026035 | Bacteria | 1329 |
| 804 | Ga0207639_10499351 | 3300026041 | Bacteria | 1111 |
| 805 | Ga0207639_10499737 | 3300026041 | Unclassified | 1111 |
| 806 | Ga0207639_10542236 | 3300026041 | Bacteria | 1067 |
| 807 | Ga0207639_11109540 | 3300026041 | Unclassified | 742 |
| 808 | Ga0207639_11139616 | 3300026041 | Bacteria | 732 |
| 809 | Ga0207678_10017827 | 3300026067 | Bacteria | 6235 |
| 810 | Ga0207678_10177153 | 3300026067 | Bacteria | 1821 |
| 811 | Ga0207678_10520402 | 3300026067 | Archaea | 1038 |
| 812 | Ga0207678_10925787 | 3300026067 | Bacteria | 771 |
| 813 | Ga0207708_10018132 | 3300026075 | Bacteria | 5297 |
| 814 | Ga0207708_11857428 | 3300026075 | Unclassified | 528 |
| 815 | Ga0207702_10065774 | 3300026078 | Bacteria | 3106 |
| 816 | Ga0207702_10655458 | 3300026078 | Bacteria | 1033 |
| 817 | Ga0207702_11665191 | 3300026078 | Unclassified | 631 |
| 818 | Ga0207702_11843226 | 3300026078 | Bacteria | 596 |
| 819 | Ga0207702_12121978 | 3300026078 | Bacteria | 551 |
| 820 | Ga0207702_12171510 | 3300026078 | Bacteria | 544 |
| 821 | Ga0207641_11173680 | 3300026088 | Unclassified | 767 |
| 822 | Ga0207648_12039289 | 3300026089 | Unclassified | 535 |
| 823 | Ga0207676_10495787 | 3300026095 | Bacteria | 1159 |
| 824 | Ga0207676_10593997 | 3300026095 | Bacteria | 1062 |
| 825 | Ga0207674_10175430 | 3300026116 | Bacteria | 2096 |
| 826 | Ga0207674_10965545 | 3300026116 | Bacteria | 821 |
| 827 | Ga0207674_11119598 | 3300026116 | Bacteria | 757 |
| 828 | Ga0207675_101032618 | 3300026118 | Bacteria | 841 |
| 829 | Ga0207683_10120605 | 3300026121 | Unclassified | 2354 |
| 830 | Ga0207683_10128451 | 3300026121 | Bacteria | 2279 |
| 831 | Ga0207683_10381720 | 3300026121 | Unclassified | 1295 |
| 832 | Ga0207683_10402075 | 3300026121 | Bacteria | 1260 |
| 833 | Ga0207683_11385378 | 3300026121 | Unclassified | 650 |
| 834 | Ga0207698_10189992 | 3300026142 | Bacteria | 1828 |
| 835 | Ga0207698_10351923 | 3300026142 | Bacteria | 1392 |
| 836 | Ga0207698_10491629 | 3300026142 | Bacteria | 1192 |
| 837 | Ga0207698_11875972 | 3300026142 | Bacteria | 614 |
| 838 | Ga0207698_12273785 | 3300026142 | Bacteria | 554 |
| 839 | Ga0207698_12755562 | 3300026142 | Bacteria | 500 |
| 840 | Ga0207428_10010424 | 3300027907 | Bacteria | 8301 |
| 841 | Ga0207428_10297953 | 3300027907 | Unclassified | 1194 |
| 842 | Ga0207428_10829773 | 3300027907 | Unclassified | 656 |
| 843 | Ga0268266_11067221 | 3300028379 | Bacteria | 781 |
| 844 | Ga0268266_11876895 | 3300028379 | Bacteria | 573 |
| 845 | Ga0268265_10122129 | 3300028380 | Bacteria | 2148 |
| 846 | Ga0268264_10809964 | 3300028381 | Bacteria | 936 |
| 847 | Ga0265337_1044913 | 3300028556 | Bacteria | 1259 |
| 848 | Ga0265334_10057501 | 3300028573 | Bacteria | 1474 |
| 849 | Ga0265338_10004996 | 3300028800 | Bacteria | 17542 |
| 850 | Ga0265338_10006808 | 3300028800 | Bacteria | 14398 |
| 851 | Ga0265338_10013277 | 3300028800 | Bacteria | 9313 |
| 852 | Ga0265338_10044909 | 3300028800 | Bacteria | 4070 |
| 853 | Ga0265338_10099951 | 3300028800 | Bacteria | 2367 |
| 854 | Ga0265324_10020811 | 3300029957 | Bacteria | 2356 |
| 855 | Ga0265324_10180695 | 3300029957 | Unclassified | 716 |
| 856 | Ga0265339_10540141 | 3300031249 | Unclassified | 537 |
| 857 | Ga0265316_11048385 | 3300031344 | Unclassified | 566 |
| 858 | Ga0307408_100039441 | 3300031548 | Bacteria | 3339 |
| 859 | Ga0307408_101829322 | 3300031548 | Bacteria | 581 |
| 860 | Ga0307408_102115621 | 3300031548 | Bacteria | 543 |
| 861 | Ga0265313_10013075 | 3300031595 | Bacteria | 5013 |
| 862 | Ga0265314_10309812 | 3300031711 | Bacteria | 882 |
| 863 | Ga0265342_10065462 | 3300031712 | Bacteria | 2130 |
| 864 | Ga0307413_10146469 | 3300031824 | Bacteria | 1640 |
| 865 | Ga0307413_10336102 | 3300031824 | Bacteria | 1160 |
| 866 | Ga0307410_10327200 | 3300031852 | Bacteria | 1218 |
| 867 | Ga0307407_10541021 | 3300031903 | Bacteria | 859 |
| 868 | Ga0307407_10615959 | 3300031903 | Bacteria | 810 |
| 869 | Ga0307412_10054635 | 3300031911 | Bacteria | 2652 |
| 870 | Ga0307412_10245312 | 3300031911 | Bacteria | 1388 |
| 871 | Ga0307409_100249739 | 3300031995 | Bacteria | 1621 |
| 872 | Ga0307409_100512483 | 3300031995 | Bacteria | 1170 |
| 873 | Ga0307416_100023941 | 3300032002 | Bacteria | 4444 |
| 874 | Ga0307416_100076000 | 3300032002 | Bacteria | 2813 |
| 875 | Ga0307411_10764275 | 3300032005 | Bacteria | 848 |
| 876 | Ga0307411_11694983 | 3300032005 | Unclassified | 585 |
| 877 | Ga0307415_100005444 | 3300032126 | Bacteria | 6763 |
| 878 | Ga0307415_100200016 | 3300032126 | Bacteria | 1585 |
| 879 | Ga0307415_100697744 | 3300032126 | Unclassified | 915 |
| 880 | Ga0307415_101011768 | 3300032126 | Unclassified | 773 |
| 881 | Ga0307415_101769269 | 3300032126 | Unclassified | 597 |
| 882 | Ga0316583_10211566 | 3300032133 | Bacteria | 673 |
| 883 | Ga0373930_0005553 | 3300034816 | Bacteria | 2102 |
| 884 | Ga0373930_0166096 | 3300034816 | Bacteria | 560 |
| 885 | Ga0373948_0060567 | 3300034817 | Bacteria | 830 |
| 886 | Ga0373958_0107283 | 3300034819 | Unclassified | 662 |
| 887 | Ga0373938_0075782 | 3300034957 | Unclassified | 812 |
| 888 | Ga0373926_0020948 | 3300035083 | Bacteria | 2261 |
| 889 | Ga0373926_0460281 | 3300035083 | Unclassified | 505 |
| 890 | Ga0373928_0112426 | 3300035084 | Bacteria | 722 |
| 891 | Ga0373929_0075644 | 3300035085 | Bacteria | 813 |
| 892 | Ga0373934_0214825 | 3300035086 | Unclassified | 793 |
| 893 | Ga0373944_0034758 | 3300035089 | Unclassified | 1534 |
| 894 | Ga0373944_0356265 | 3300035089 | Unclassified | 558 |
| 895 | Ga0373949_0008878 | 3300035090 | Bacteria | 2201 |
| 896 | Ga0373949_0009281 | 3300035090 | Bacteria | 2155 |
| 897 | Ga0373949_0115455 | 3300035090 | Bacteria | 749 |
| 898 | Ga0373951_0136323 | 3300035091 | Unclassified | 678 |
| 899 | Ga0373952_0145666 | 3300035092 | Bacteria | 661 |
| 900 | Ga0373932_0083989 | 3300035112 | Bacteria | 1011 |
| 901 | Ga0373936_0029157 | 3300035113 | Bacteria | 2171 |
| 902 | Ga0373939_0229484 | 3300035114 | Unclassified | 714 |
| 903 | Ga0373939_0335634 | 3300035114 | Bacteria | 611 |
| 904 | Ga0373939_0428557 | 3300035114 | Unclassified | 553 |
| 905 | Ga0373941_0060967 | 3300035115 | Bacteria | 1227 |
| 906 | Ga0373941_0471433 | 3300035115 | Unclassified | 530 |
| 907 | Ga0373945_0011288 | 3300035116 | Bacteria | 2954 |
| 908 | Ga0373945_0011967 | 3300035116 | Bacteria | 2875 |
| 909 | Ga0373945_0039082 | 3300035116 | Bacteria | 1709 |
| 910 | Ga0373953_0492285 | 3300035117 | Unclassified | 543 |
| 911 | Ga0373954_0173398 | 3300035118 | Unclassified | 1057 |
| 912 | Ga0373954_0244693 | 3300035118 | Unclassified | 883 |
| 913 | Ga0373954_0451403 | 3300035118 | Unclassified | 636 |
| 914 | Ga0373956_0161371 | 3300035119 | Viruses | 1056 |
| 915 | Ga0373957_0162918 | 3300035120 | Unclassified | 919 |
| 916 | Ga0373960_0111802 | 3300035121 | Bacteria | 897 |
| 917 | Ga0373960_0302431 | 3300035121 | Unclassified | 595 |
| 918 | Ga0373943_0001568 | 3300035170 | Bacteria | 10348 |
| 919 | Ga0373943_0003697 | 3300035170 | Bacteria | 6959 |
| 920 | Ga0373943_0026784 | 3300035170 | Unclassified | 2703 |
| 921 | Ga0373946_0003435 | 3300035171 | Bacteria | 5620 |
| 922 | Ga0373946_0078530 | 3300035171 | Bacteria | 1440 |
| 923 | Ga0373946_0152029 | 3300035171 | Unclassified | 1080 |
| 924 | Ga0373955_0254364 | 3300035172 | Unclassified | 1053 |
| 925 | Ga0373955_0367660 | 3300035172 | Bacteria | 872 |
| 926 | Ga0373955_0626905 | 3300035172 | Unclassified | 659 |
| 927 | Ga0373942_0249752 | 3300035207 | Unclassified | 603 |
| 928 | Ga0373961_0122382 | 3300035241 | Bacteria | 863 |
| 929 | Ga0373962_0095911 | 3300035242 | Bacteria | 919 |
| 930 | Ga0373962_0115120 | 3300035242 | Bacteria | 852 |
| 931 | Ga0373924_0205525 | 3300035410 | Unclassified | 869 |
| 932 | Ga0373924_0432869 | 3300035410 | Bacteria | 589 |
| 933 | Ga0373931_0020259 | 3300035691 | Bacteria | 3326 |
| 934 | Ga0373931_0042536 | 3300035691 | Bacteria | 2389 |
| 935 | Ga0373931_0237896 | 3300035691 | Bacteria | 1103 |
| 936 | Ga0373931_0274635 | 3300035691 | Bacteria | 1033 |
| 937 | Ga0373935_0006819 | 3300035692 | Bacteria | 6823 |
| 938 | Ga0373935_0040457 | 3300035692 | Bacteria | 2926 |
| 939 | Ga0373935_0094813 | 3300035692 | Bacteria | 1959 |
| 940 | Ga0373935_0138280 | 3300035692 | Bacteria | 1643 |
| 941 | Ga0373927_0037158 | 3300035695 | Bacteria | 3166 |
| 942 | Ga0373927_0098377 | 3300035695 | Bacteria | 1902 |
| 943 | Ga0373933_0189842 | 3300035724 | Bacteria | 1312 |
| 944 | Ga0373933_0307520 | 3300035724 | Viruses | 1027 |
| 945 | Ga0373947_0000205 | 3300035725 | Bacteria | 32976 |
| 946 | Ga0373947_0000994 | 3300035725 | Bacteria | 17318 |
| 947 | Ga0373947_0001247 | 3300035725 | Bacteria | 15666 |
| 948 | Ga0373947_0295755 | 3300035725 | Bacteria | 1079 |
| 949 | Ga0373947_0315417 | 3300035725 | Unclassified | 1045 |
| 950 | Ga0373937_0020383 | 3300036401 | Bacteria | 5945 |
| 951 | Ga0373937_0035628 | 3300036401 | Bacteria | 4530 |
| 952 | Ga0373937_0387993 | 3300036401 | Bacteria | 1325 |
| 953 | Ga0373937_1977811 | 3300036401 | Unclassified | 529 |
| 954 | Ga0373925_0000604 | 3300037068 | Bacteria | 34210 |
| 955 | Ga0373925_0009362 | 3300037068 | Bacteria | 7132 |
| 956 | Ga0373925_0010158 | 3300037068 | Bacteria | 6834 |
| 957 | Ga0373925_0125982 | 3300037068 | Bacteria | 1993 |
| 958 | Ga0373925_0599596 | 3300037068 | Unclassified | 907 |
| 959 | Ga0373925_1098496 | 3300037068 | Unclassified | 654 |
| 960 | Ga0373925_1356282 | 3300037068 | Bacteria | 583 |
| 961 | Ga0395899_0021287 | 3300037312 | Bacteria | 4919 |
| 962 | Ga0395899_0037308 | 3300037312 | Bacteria | 3643 |
| 963 | Ga0395899_0127107 | 3300037312 | Bacteria | 1822 |
| 964 | Ga0395899_0211645 | 3300037312 | Unclassified | 1347 |
| 965 | Ga0395899_0367678 | 3300037312 | Bacteria | 958 |
| 966 | Ga0395899_0572632 | 3300037312 | Bacteria | 723 |
| 967 | Ga0395899_0711714 | 3300037312 | Bacteria | 629 |
| 968 | Ga0395899_0971455 | 3300037312 | Bacteria | 514 |
| 969 | Ga0395900_0001205 | 3300037418 | Bacteria | 31973 |
| 970 | Ga0395900_0025999 | 3300037418 | Bacteria | 5994 |
| 971 | Ga0395900_0026306 | 3300037418 | Bacteria | 5958 |
| 972 | Ga0395900_0030770 | 3300037418 | Bacteria | 5512 |
| 973 | Ga0395900_0135986 | 3300037418 | Bacteria | 2518 |
| 974 | Ga0395900_0165550 | 3300037418 | Bacteria | 2253 |
| 975 | Ga0395900_0169212 | 3300037418 | Bacteria | 2225 |
| 976 | Ga0395900_0174149 | 3300037418 | Bacteria | 2189 |
| 977 | Ga0395900_0442943 | 3300037418 | Unclassified | 1256 |
| 978 | Ga0395900_0522865 | 3300037418 | Bacteria | 1134 |
| 979 | Ga0395900_0536513 | 3300037418 | Bacteria | 1116 |
| 980 | Ga0395900_0801527 | 3300037418 | Bacteria | 870 |
| 981 | Ga0395900_1231372 | 3300037418 | Unclassified | 663 |
| 982 | Ga0395900_1469146 | 3300037418 | Unclassified | 594 |
| 983 | Ga0395898_0002267 | 3300037466 | Bacteria | 23291 |
| 984 | Ga0395898_0026278 | 3300037466 | Bacteria | 5860 |
| 985 | Ga0395898_0033467 | 3300037466 | Bacteria | 5129 |
| 986 | Ga0395898_0138281 | 3300037466 | Unclassified | 2332 |
| 987 | Ga0395898_0153719 | 3300037466 | Bacteria | 2201 |
| 988 | Ga0395898_0168486 | 3300037466 | Bacteria | 2094 |
| 989 | Ga0395898_0204241 | 3300037466 | Bacteria | 1885 |
| 990 | Ga0395898_0283954 | 3300037466 | Bacteria | 1579 |
| 991 | Ga0395898_0290750 | 3300037466 | Bacteria | 1559 |
| 992 | Ga0395898_0304340 | 3300037466 | Unclassified | 1521 |
| 993 | Ga0395898_0353689 | 3300037466 | Unclassified | 1401 |
| 994 | Ga0395898_0538993 | 3300037466 | Bacteria | 1109 |
| 995 | Ga0395898_0629374 | 3300037466 | Bacteria | 1015 |
| 996 | Ga0395898_0661973 | 3300037466 | Bacteria | 986 |
| 997 | Ga0395898_0764083 | 3300037466 | Unclassified | 907 |
| 998 | Ga0395898_0856233 | 3300037466 | Unclassified | 848 |
| 999 | Ga0395898_1032522 | 3300037466 | Unclassified | 757 |
| 1000 | Ga0395898_1521025 | 3300037466 | Unclassified | 595 |
| 1001 | Ga0395898_1649182 | 3300037466 | Unclassified | 565 |
| 1002 | Ga0395905_0003498 | 3300037471 | Bacteria | 16759 |
| 1003 | Ga0395905_0005462 | 3300037471 | Bacteria | 12965 |
| 1004 | Ga0395905_0025373 | 3300037471 | Bacteria | 5589 |
| 1005 | Ga0395905_0053283 | 3300037471 | Bacteria | 3786 |
| 1006 | Ga0395905_0095724 | 3300037471 | Bacteria | 2787 |
| 1007 | Ga0395905_0246609 | 3300037471 | Bacteria | 1669 |
| 1008 | Ga0395905_0279317 | 3300037471 | Bacteria | 1556 |
| 1009 | Ga0395905_0476685 | 3300037471 | Unclassified | 1147 |
| 1010 | Ga0395905_0742767 | 3300037471 | Bacteria | 884 |
| 1011 | Ga0395905_1219956 | 3300037471 | Unclassified | 656 |
| 1012 | Ga0395905_1504622 | 3300037471 | Unclassified | 577 |
| 1013 | Ga0395905_1677313 | 3300037471 | Unclassified | 541 |
| 1014 | Ga0395901_0003190 | 3300038443 | Bacteria | 16503 |
| 1015 | Ga0395901_0009698 | 3300038443 | Bacteria | 9765 |
| 1016 | Ga0395901_0019293 | 3300038443 | Bacteria | 6970 |
| 1017 | Ga0395901_0020575 | 3300038443 | Bacteria | 6753 |
| 1018 | Ga0395901_0028357 | 3300038443 | Bacteria | 5756 |
| 1019 | Ga0395901_0055391 | 3300038443 | Bacteria | 4124 |
| 1020 | Ga0395901_0068411 | 3300038443 | Bacteria | 3699 |
| 1021 | Ga0395901_0088813 | 3300038443 | Bacteria | 3233 |
| 1022 | Ga0395901_0156274 | 3300038443 | Bacteria | 2395 |
| 1023 | Ga0395901_0253899 | 3300038443 | Bacteria | 1831 |
| 1024 | Ga0395901_0257705 | 3300038443 | Bacteria | 1816 |
| 1025 | Ga0395901_0268292 | 3300038443 | Bacteria | 1776 |
| 1026 | Ga0395901_0340578 | 3300038443 | Bacteria | 1549 |
| 1027 | Ga0395901_0341572 | 3300038443 | Bacteria | 1547 |
| 1028 | Ga0395901_0423323 | 3300038443 | Bacteria | 1365 |
| 1029 | Ga0395901_0495760 | 3300038443 | Bacteria | 1244 |
| 1030 | Ga0395901_0593746 | 3300038443 | Bacteria | 1117 |
| 1031 | Ga0395901_0609281 | 3300038443 | Bacteria | 1100 |
| 1032 | Ga0395901_0673650 | 3300038443 | Unclassified | 1035 |
| 1033 | Ga0395901_0687815 | 3300038443 | Bacteria | 1022 |
| 1034 | Ga0395901_1198557 | 3300038443 | Unclassified | 725 |
| 1035 | Ga0395901_1287402 | 3300038443 | Bacteria | 693 |
| 1036 | Ga0395901_1313583 | 3300038443 | Bacteria | 685 |
| 1037 | Ga0395901_1336403 | 3300038443 | Bacteria | 677 |
| 1038 | Ga0395901_1342158 | 3300038443 | Bacteria | 675 |
| 1039 | Ga0395901_1783477 | 3300038443 | Bacteria | 565 |
| 1040 | Ga0395901_2036265 | 3300038443 | Bacteria | 520 |
| 1041 | Ga0436365_1179664 | 3300039437 | Bacteria | 684 |
| 1042 | Ga0436363_0223048 | 3300039450 | Unclassified | 1410 |
| 1043 | Ga0436363_0630452 | 3300039450 | Bacteria | 544 |
| 1044 | Ga0451787_572446 | 3300041441 | Archaea | 705 |
| 1045 | Ga0451800_0260483 | 3300041459 | Bacteria | 508 |
| 1046 | Ga0451800_0972975 | 3300041459 | Unclassified | 591 |
| 1047 | Ga0451802_0405929 | 3300041460 | Bacteria | 993 |
| 1048 | Ga0451807_1201553 | 3300041486 | Unclassified | 635 |
| 1049 | Ga0451835_0478302 | 3300041492 | Bacteria | 849 |
| 1050 | Ga0451849_0570757 | 3300041505 | Unclassified | 517 |
| 1051 | Ga0451849_1151008 | 3300041505 | Bacteria | 797 |
| 1052 | Ga0451851_0504909 | 3300041507 | Bacteria | 567 |
| 1053 | Ga0451853_0847260 | 3300041512 | Archaea | 1283 |
| 1054 | Ga0439448_0308852 | 3300042005 | Unclassified | 562 |
| 1055 | Ga0439454_030395 | 3300042011 | Bacteria | 844 |
| 1056 | Ga0450916_034766 | 3300042530 | Bacteria | 747 |
| 1057 | Ga0466969_0076993 | 3300044656 | Bacteria | 1596 |
| 1058 | Ga0466969_0098913 | 3300044656 | Bacteria | 1375 |
| 1059 | Ga0466972_0023847 | 3300044658 | Bacteria | 3040 |
| 1060 | Ga0466972_0622763 | 3300044658 | Bacteria | 511 |
| 1061 | Ga0466965_0001995 | 3300044683 | Bacteria | 8539 |
| 1062 | Ga0466965_0022743 | 3300044683 | Bacteria | 3024 |
| 1063 | Ga0466965_0356043 | 3300044683 | Bacteria | 802 |
| 1064 | Ga0466966_0059865 | 3300044684 | Bacteria | 2404 |
| 1065 | Ga0466966_0064626 | 3300044684 | Bacteria | 2303 |
| 1066 | Ga0466966_0269391 | 3300044684 | Bacteria | 1025 |
| 1067 | Ga0466966_0569483 | 3300044684 | Bacteria | 682 |
| 1068 | Ga0466966_0621030 | 3300044684 | Bacteria | 651 |
| 1069 | Ga0466966_0650543 | 3300044684 | Bacteria | 635 |
| 1070 | Ga0466966_0931590 | 3300044684 | Bacteria | 524 |
| 1071 | Ga0466961_0001476 | 3300044693 | Bacteria | 14609 |
| 1072 | Ga0466961_0002155 | 3300044693 | Bacteria | 12245 |
| 1073 | Ga0466961_0020936 | 3300044693 | Bacteria | 4207 |
| 1074 | Ga0466961_0031030 | 3300044693 | Bacteria | 3435 |
| 1075 | Ga0466961_0125290 | 3300044693 | Bacteria | 1612 |
| 1076 | Ga0466961_0195168 | 3300044693 | Bacteria | 1254 |
| 1077 | Ga0466961_0236999 | 3300044693 | Unclassified | 1122 |
| 1078 | Ga0466961_0801911 | 3300044693 | Bacteria | 562 |
| 1079 | Ga0466961_0909503 | 3300044693 | Bacteria | 524 |
| 1080 | Ga0466963_0000468 | 3300044694 | Bacteria | 18789 |
| 1081 | Ga0466963_0002921 | 3300044694 | Bacteria | 9653 |
| 1082 | Ga0466963_0005978 | 3300044694 | Bacteria | 7170 |
| 1083 | Ga0466963_0006777 | 3300044694 | Bacteria | 6811 |
| 1084 | Ga0466963_0009130 | 3300044694 | Bacteria | 5962 |
| 1085 | Ga0466963_0017839 | 3300044694 | Bacteria | 4429 |
| 1086 | Ga0466963_0026264 | 3300044694 | Bacteria | 3723 |
| 1087 | Ga0466963_0028057 | 3300044694 | Bacteria | 3611 |
| 1088 | Ga0466963_0032355 | 3300044694 | Bacteria | 3386 |
| 1089 | Ga0466963_0034993 | 3300044694 | Bacteria | 3271 |
| 1090 | Ga0466963_0047596 | 3300044694 | Bacteria | 2830 |
| 1091 | Ga0466963_0051861 | 3300044694 | Bacteria | 2720 |
| 1092 | Ga0466963_0072159 | 3300044694 | Bacteria | 2325 |
| 1093 | Ga0466963_0077748 | 3300044694 | Unclassified | 2243 |
| 1094 | Ga0466963_0090841 | 3300044694 | Bacteria | 2079 |
| 1095 | Ga0466963_0119653 | 3300044694 | Bacteria | 1812 |
| 1096 | Ga0466963_0191069 | 3300044694 | Bacteria | 1430 |
| 1097 | Ga0466963_0211975 | 3300044694 | Bacteria | 1355 |
| 1098 | Ga0466963_0321103 | 3300044694 | Bacteria | 1090 |
| 1099 | Ga0466963_0487154 | 3300044694 | Bacteria | 870 |
| 1100 | Ga0466963_0594996 | 3300044694 | Unclassified | 781 |
| 1101 | Ga0466963_0667815 | 3300044694 | Bacteria | 733 |
| 1102 | Ga0466963_0948266 | 3300044694 | Bacteria | 606 |
| 1103 | Ga0466963_1036502 | 3300044694 | Unclassified | 577 |
| 1104 | Ga0466963_1292575 | 3300044694 | Unclassified | 512 |
| 1105 | Ga0466963_1321349 | 3300044694 | Archaea | 506 |
| 1106 | Ga0466964_0001444 | 3300044706 | Bacteria | 8120 |
| 1107 | Ga0466964_0003124 | 3300044706 | Bacteria | 6021 |
| 1108 | Ga0466964_0003644 | 3300044706 | Bacteria | 5629 |
| 1109 | Ga0466964_0007381 | 3300044706 | Bacteria | 4111 |
| 1110 | Ga0466964_0010598 | 3300044706 | Bacteria | 3478 |
| 1111 | Ga0466964_0023879 | 3300044706 | Bacteria | 2379 |
| 1112 | Ga0466964_0035417 | 3300044706 | Bacteria | 1996 |
| 1113 | Ga0466964_0037494 | 3300044706 | Bacteria | 1947 |
| 1114 | Ga0466964_0045108 | 3300044706 | Unclassified | 1793 |
| 1115 | Ga0466964_0045164 | 3300044706 | Bacteria | 1792 |
| 1116 | Ga0466964_0101158 | 3300044706 | Bacteria | 1271 |
| 1117 | Ga0466964_0135781 | 3300044706 | Bacteria | 1125 |
| 1118 | Ga0466964_0340248 | 3300044706 | Unclassified | 768 |
| 1119 | Ga0466964_0609143 | 3300044706 | Unclassified | 600 |
| 1120 | Ga0466964_0646581 | 3300044706 | Unclassified | 584 |
| 1121 | Ga0453684_0479225 | 3300044712 | Bacteria | 1381 |
| 1122 | Ga0466971_0000500 | 3300044719 | Bacteria | 15356 |
| 1123 | Ga0466971_0000871 | 3300044719 | Bacteria | 12335 |
| 1124 | Ga0466971_0008787 | 3300044719 | Bacteria | 4408 |
| 1125 | Ga0466971_0020063 | 3300044719 | Bacteria | 2971 |
| 1126 | Ga0466971_0050651 | 3300044719 | Unclassified | 1869 |
| 1127 | Ga0466971_0182214 | 3300044719 | Bacteria | 988 |
| 1128 | Ga0466971_0313750 | 3300044719 | Bacteria | 755 |
| 1129 | Ga0466968_0013618 | 3300044735 | Bacteria | 3199 |
| 1130 | Ga0466968_0043280 | 3300044735 | Unclassified | 1906 |
| 1131 | Ga0466968_0057300 | 3300044735 | Bacteria | 1675 |
| 1132 | Ga0466968_0163875 | 3300044735 | Unclassified | 1027 |
| 1133 | Ga0466968_0668337 | 3300044735 | Unclassified | 528 |
| 1134 | Ga0466970_0035747 | 3300044765 | Bacteria | 2632 |
| 1135 | Ga0466970_0136948 | 3300044765 | Bacteria | 1347 |
| 1136 | Ga0466970_0430420 | 3300044765 | Unclassified | 755 |
| 1137 | Ga0466957_0000044 | 3300044842 | Bacteria | 46388 |
| 1138 | Ga0466957_0001119 | 3300044842 | Bacteria | 13890 |
| 1139 | Ga0466957_0025752 | 3300044842 | Bacteria | 3488 |
| 1140 | Ga0466957_0050631 | 3300044842 | Bacteria | 2527 |
| 1141 | Ga0466957_0059016 | 3300044842 | Bacteria | 2351 |
| 1142 | Ga0466957_0075657 | 3300044842 | Bacteria | 2089 |
| 1143 | Ga0466957_0133099 | 3300044842 | Bacteria | 1595 |
| 1144 | Ga0466957_0138725 | 3300044842 | Bacteria | 1565 |
| 1145 | Ga0466957_0181022 | 3300044842 | Bacteria | 1377 |
| 1146 | Ga0466957_0199622 | 3300044842 | Bacteria | 1313 |
| 1147 | Ga0466957_0335124 | 3300044842 | Bacteria | 1023 |
| 1148 | Ga0466957_0426217 | 3300044842 | Bacteria | 911 |
| 1149 | Ga0466957_0713562 | 3300044842 | Unclassified | 708 |
| 1150 | Ga0466957_0886357 | 3300044842 | Unclassified | 637 |
| 1151 | Ga0466957_0931770 | 3300044842 | Unclassified | 622 |
| 1152 | Ga0466957_0951205 | 3300044842 | Unclassified | 615 |
| 1153 | Ga0466957_0985354 | 3300044842 | Bacteria | 605 |
| 1154 | Ga0466957_0996039 | 3300044842 | Bacteria | 602 |
| 1155 | Ga0466957_1019425 | 3300044842 | Unclassified | 595 |
| 1156 | Ga0466960_0044869 | 3300044901 | Bacteria | 2109 |
| 1157 | Ga0466960_0108410 | 3300044901 | Bacteria | 1440 |
| 1158 | Ga0466960_0219088 | 3300044901 | Unclassified | 1046 |
| 1159 | Ga0466960_0459950 | 3300044901 | Bacteria | 741 |
| 1160 | Ga0466960_0810940 | 3300044901 | Bacteria | 567 |
| 1161 | Ga0466960_0986358 | 3300044901 | Unclassified | 517 |
| 1162 | Ga0466959_0004661 | 3300045049 | Bacteria | 9228 |
| 1163 | Ga0466959_0010363 | 3300045049 | Bacteria | 6659 |
| 1164 | Ga0466959_0048019 | 3300045049 | Bacteria | 3138 |
| 1165 | Ga0466959_0062090 | 3300045049 | Bacteria | 2716 |
| 1166 | Ga0466959_0076804 | 3300045049 | Bacteria | 2411 |
| 1167 | Ga0466959_0077095 | 3300045049 | Bacteria | 2406 |
| 1168 | Ga0466959_0122565 | 3300045049 | Unclassified | 1847 |
| 1169 | Ga0466959_0301846 | 3300045049 | Bacteria | 1096 |
| 1170 | Ga0466959_0431225 | 3300045049 | Unclassified | 894 |
| 1171 | Ga0466959_0444740 | 3300045049 | Bacteria | 879 |
| 1172 | Ga0466958_0000039 | 3300045836 | Bacteria | 37591 |
| 1173 | Ga0466958_0000364 | 3300045836 | Bacteria | 18311 |
| 1174 | Ga0466958_0000415 | 3300045836 | Bacteria | 17583 |
| 1175 | Ga0466958_0002981 | 3300045836 | Bacteria | 8675 |
| 1176 | Ga0466958_0004140 | 3300045836 | Bacteria | 7613 |
| 1177 | Ga0466958_0008142 | 3300045836 | Bacteria | 5803 |
| 1178 | Ga0466958_0025288 | 3300045836 | Bacteria | 3499 |
| 1179 | Ga0466958_0080480 | 3300045836 | Bacteria | 2004 |
| 1180 | Ga0466958_0194205 | 3300045836 | Unclassified | 1291 |
| 1181 | Ga0466958_0230794 | 3300045836 | Bacteria | 1182 |
| 1182 | Ga0466958_0435687 | 3300045836 | Bacteria | 848 |
| 1183 | Ga0466958_0577143 | 3300045836 | Unclassified | 731 |
| 1184 | Ga0466958_0590510 | 3300045836 | Bacteria | 722 |
| 1185 | Ga0466958_0688993 | 3300045836 | Bacteria | 665 |
| 1186 | Ga0466967_0003247 | 3300045976 | Bacteria | 10524 |
| 1187 | Ga0466967_0003452 | 3300045976 | Bacteria | 10315 |
| 1188 | Ga0466967_0007025 | 3300045976 | Bacteria | 8062 |
| 1189 | Ga0466967_0010550 | 3300045976 | Bacteria | 6939 |
| 1190 | Ga0466967_0012673 | 3300045976 | Bacteria | 6468 |
| 1191 | Ga0466967_0017960 | 3300045976 | Bacteria | 5637 |
| 1192 | Ga0466967_0023441 | 3300045976 | Bacteria | 5057 |
| 1193 | Ga0466967_0024275 | 3300045976 | Bacteria | 4982 |
| 1194 | Ga0466967_0030845 | 3300045976 | Bacteria | 4504 |
| 1195 | Ga0466967_0035077 | 3300045976 | Bacteria | 4266 |
| 1196 | Ga0466967_0041568 | 3300045976 | Bacteria | 3965 |
| 1197 | Ga0466967_0042216 | 3300045976 | Bacteria | 3939 |
| 1198 | Ga0466967_0049163 | 3300045976 | Bacteria | 3687 |
| 1199 | Ga0466967_0056294 | 3300045976 | Bacteria | 3466 |
| 1200 | Ga0466967_0070310 | 3300045976 | Bacteria | 3131 |
| 1201 | Ga0466967_0075764 | 3300045976 | Bacteria | 3024 |
| 1202 | Ga0466967_0084052 | 3300045976 | Bacteria | 2879 |
| 1203 | Ga0466967_0111443 | 3300045976 | Bacteria | 2515 |
| 1204 | Ga0466967_0168941 | 3300045976 | Bacteria | 2056 |
| 1205 | Ga0466967_0202412 | 3300045976 | Bacteria | 1881 |
| 1206 | Ga0466967_0251394 | 3300045976 | Bacteria | 1689 |
| 1207 | Ga0466967_0273226 | 3300045976 | Bacteria | 1620 |
| 1208 | Ga0466967_0382046 | 3300045976 | Bacteria | 1367 |
| 1209 | Ga0466967_0397075 | 3300045976 | Unclassified | 1341 |
| 1210 | Ga0466967_0763544 | 3300045976 | Unclassified | 959 |
| 1211 | Ga0466967_0811242 | 3300045976 | Bacteria | 929 |
| 1212 | Ga0466967_0865526 | 3300045976 | Unclassified | 898 |
| 1213 | Ga0466967_1031139 | 3300045976 | Unclassified | 819 |
| 1214 | Ga0466967_1064379 | 3300045976 | Bacteria | 806 |
| 1215 | Ga0466967_1351763 | 3300045976 | Unclassified | 709 |
| 1216 | Ga0466967_1455953 | 3300045976 | Bacteria | 682 |
| 1217 | Ga0466967_1594907 | 3300045976 | Unclassified | 650 |
| 1218 | Ga0466967_1767885 | 3300045976 | Bacteria | 615 |
| 1219 | Ga0466967_1780291 | 3300045976 | Bacteria | 613 |
| 1220 | Ga0466967_1879937 | 3300045976 | Unclassified | 595 |
| 1221 | Ga0466967_2184397 | 3300045976 | Bacteria | 549 |
| 1222 | Ga0466967_2341078 | 3300045976 | Unclassified | 529 |
| 1223 | Ga0466967_2392730 | 3300045976 | Bacteria | 523 |
| 1224 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 1225 | Ga0495592_0011459 | 3300046454 | Bacteria | 6709 |
| 1226 | Ga0495592_0187308 | 3300046454 | Bacteria | 1405 |
| 1227 | Ga0495592_0390888 | 3300046454 | Unclassified | 883 |
| 1228 | Ga0495603_0129446 | 3300046455 | Bacteria | 1470 |
| 1229 | Ga0495603_0143370 | 3300046455 | Unclassified | 1389 |
| 1230 | Ga0495603_0309242 | 3300046455 | Unclassified | 908 |
| 1231 | Ga0495603_0509952 | 3300046455 | Unclassified | 689 |
| 1232 | Ga0495603_0898718 | 3300046455 | Unclassified | 503 |
| 1233 | Ga0495629_0007444 | 3300046459 | Bacteria | 8064 |
| 1234 | Ga0495629_0011680 | 3300046459 | Bacteria | 6372 |
| 1235 | Ga0495629_0483869 | 3300046459 | Unclassified | 836 |
| 1236 | Ga0495629_0493907 | 3300046459 | Bacteria | 826 |
| 1237 | Ga0495629_0914935 | 3300046459 | Unclassified | 574 |
| 1238 | Ga0495641_0000612 | 3300046461 | Bacteria | 30028 |
| 1239 | Ga0495641_0014194 | 3300046461 | Bacteria | 4322 |
| 1240 | Ga0495641_0031683 | 3300046461 | Bacteria | 2524 |
| 1241 | Ga0495641_0063384 | 3300046461 | Unclassified | 1666 |
| 1242 | Ga0495641_0235932 | 3300046461 | Bacteria | 821 |
| 1243 | Ga0495651_0000080 | 3300046462 | Bacteria | 70453 |
| 1244 | Ga0495651_0031039 | 3300046462 | Bacteria | 4168 |
| 1245 | Ga0495651_0058505 | 3300046462 | Bacteria | 2957 |
| 1246 | Ga0495651_0069615 | 3300046462 | Bacteria | 2679 |
| 1247 | Ga0495651_0080518 | 3300046462 | Bacteria | 2460 |
| 1248 | Ga0495651_0136414 | 3300046462 | Unclassified | 1784 |
| 1249 | Ga0495651_0543499 | 3300046462 | Unclassified | 739 |
| 1250 | Ga0495653_0001358 | 3300046463 | Bacteria | 19003 |
| 1251 | Ga0495653_0032308 | 3300046463 | Bacteria | 4157 |
| 1252 | Ga0495653_0032895 | 3300046463 | Bacteria | 4113 |
| 1253 | Ga0495653_0125053 | 3300046463 | Bacteria | 1827 |
| 1254 | Ga0495653_0150544 | 3300046463 | Bacteria | 1626 |
| 1255 | Ga0495653_0204372 | 3300046463 | Bacteria | 1338 |
| 1256 | Ga0495653_0367939 | 3300046463 | Unclassified | 921 |
| 1257 | Ga0495580_0017501 | 3300046472 | Bacteria | 5358 |
| 1258 | Ga0495580_1033980 | 3300046472 | Unclassified | 522 |
| 1259 | Ga0495582_0001627 | 3300046473 | Bacteria | 12641 |
| 1260 | Ga0495582_0015784 | 3300046473 | Bacteria | 4141 |
| 1261 | Ga0495582_0169464 | 3300046473 | Bacteria | 1243 |
| 1262 | Ga0495582_0279218 | 3300046473 | Bacteria | 959 |
| 1263 | Ga0495582_0394037 | 3300046473 | Unclassified | 798 |
| 1264 | Ga0495582_0686529 | 3300046473 | Bacteria | 592 |
| 1265 | Ga0495605_0086559 | 3300046474 | Bacteria | 1458 |
| 1266 | Ga0495605_0406515 | 3300046474 | Unclassified | 565 |
| 1267 | Ga0495639_0000302 | 3300046475 | Bacteria | 24029 |
| 1268 | Ga0495639_0013887 | 3300046475 | Bacteria | 3482 |
| 1269 | Ga0495662_0000620 | 3300046476 | Bacteria | 16478 |
| 1270 | Ga0495662_0008518 | 3300046476 | Bacteria | 5040 |
| 1271 | Ga0495664_0009146 | 3300046477 | Bacteria | 5539 |
| 1272 | Ga0495664_0012689 | 3300046477 | Bacteria | 4771 |
| 1273 | Ga0495664_0082655 | 3300046477 | Bacteria | 1926 |
| 1274 | Ga0495664_0098187 | 3300046477 | Bacteria | 1763 |
| 1275 | Ga0495664_0436032 | 3300046477 | Unclassified | 785 |
| 1276 | Ga0495584_0113641 | 3300046491 | Bacteria | 1370 |
| 1277 | Ga0495584_0439949 | 3300046491 | Bacteria | 663 |
| 1278 | Ga0495584_0532124 | 3300046491 | Unclassified | 599 |
| 1279 | Ga0495585_0141432 | 3300046492 | Unclassified | 1260 |
| 1280 | Ga0495585_0154713 | 3300046492 | Bacteria | 1194 |
| 1281 | Ga0495594_0156457 | 3300046499 | Bacteria | 1295 |
| 1282 | Ga0495594_0230682 | 3300046499 | Bacteria | 1055 |
| 1283 | Ga0495594_0406642 | 3300046499 | Unclassified | 774 |
| 1284 | Ga0495596_0422800 | 3300046500 | Unclassified | 519 |
| 1285 | Ga0495607_0198153 | 3300046501 | Unclassified | 996 |
| 1286 | Ga0495607_0224047 | 3300046501 | Bacteria | 918 |
| 1287 | Ga0495607_0394787 | 3300046501 | Unclassified | 630 |
| 1288 | Ga0495583_0208249 | 3300046506 | Bacteria | 793 |
| 1289 | Ga0495608_0000669 | 3300046511 | Bacteria | 23647 |
| 1290 | Ga0495608_0027901 | 3300046511 | Bacteria | 3838 |
| 1291 | Ga0495608_0031450 | 3300046511 | Bacteria | 3589 |
| 1292 | Ga0495608_0101875 | 3300046511 | Unclassified | 1851 |
| 1293 | Ga0495618_0001062 | 3300046514 | Bacteria | 18742 |
| 1294 | Ga0495618_0029762 | 3300046514 | Bacteria | 3407 |
| 1295 | Ga0495618_0094144 | 3300046514 | Bacteria | 1915 |
| 1296 | Ga0495618_0099428 | 3300046514 | Bacteria | 1861 |
| 1297 | Ga0495618_0116091 | 3300046514 | Bacteria | 1714 |
| 1298 | Ga0495618_0299120 | 3300046514 | Bacteria | 1000 |
| 1299 | Ga0495618_0510826 | 3300046514 | Unclassified | 723 |
| 1300 | Ga0495628_0000292 | 3300046516 | Bacteria | 45065 |
| 1301 | Ga0495628_0061058 | 3300046516 | Bacteria | 2956 |
| 1302 | Ga0495628_0105857 | 3300046516 | Bacteria | 2167 |
| 1303 | Ga0495628_0458511 | 3300046516 | Unclassified | 925 |
| 1304 | Ga0495628_0863816 | 3300046516 | Unclassified | 630 |
| 1305 | Ga0495630_0001051 | 3300046517 | Bacteria | 19023 |
| 1306 | Ga0495630_0005492 | 3300046517 | Bacteria | 8947 |
| 1307 | Ga0495630_0158806 | 3300046517 | Unclassified | 1721 |
| 1308 | Ga0495630_0377496 | 3300046517 | Bacteria | 1086 |
| 1309 | Ga0495630_0478132 | 3300046517 | Bacteria | 955 |
| 1310 | Ga0495631_0094220 | 3300046518 | Unclassified | 1289 |
| 1311 | Ga0495637_0247369 | 3300046520 | Unclassified | 643 |
| 1312 | Ga0495637_0302948 | 3300046520 | Unclassified | 567 |
| 1313 | Ga0495644_0005471 | 3300046523 | Bacteria | 4962 |
| 1314 | Ga0495644_0309507 | 3300046523 | Bacteria | 619 |
| 1315 | Ga0495663_0092490 | 3300046525 | Unclassified | 987 |
| 1316 | Ga0495663_0292177 | 3300046525 | Unclassified | 585 |
| 1317 | Ga0495666_0000436 | 3300046526 | Bacteria | 18500 |
| 1318 | Ga0495666_0019916 | 3300046526 | Unclassified | 3328 |
| 1319 | Ga0495642_0479799 | 3300046528 | Unclassified | 550 |
| 1320 | Ga0495652_0000847 | 3300046529 | Bacteria | 35270 |
| 1321 | Ga0495652_0012788 | 3300046529 | Bacteria | 7560 |
| 1322 | Ga0495652_0016499 | 3300046529 | Bacteria | 6606 |
| 1323 | Ga0495652_0028410 | 3300046529 | Bacteria | 4921 |
| 1324 | Ga0495652_0227113 | 3300046529 | Unclassified | 1399 |
| 1325 | Ga0495652_0510870 | 3300046529 | Bacteria | 832 |
| 1326 | Ga0495652_0698805 | 3300046529 | Bacteria | 683 |
| 1327 | Ga0495665_0000038 | 3300046531 | Bacteria | 51967 |
| 1328 | Ga0495665_0060681 | 3300046531 | Bacteria | 1996 |
| 1329 | Ga0495640_0058926 | 3300046533 | Bacteria | 2617 |
| 1330 | Ga0495640_0178234 | 3300046533 | Unclassified | 1355 |
| 1331 | Ga0495640_0260817 | 3300046533 | Bacteria | 1083 |
| 1332 | Ga0495640_0364042 | 3300046533 | Bacteria | 891 |
| 1333 | Ga0495640_0385006 | 3300046533 | Unclassified | 862 |
| 1334 | Ga0495586_0006750 | 3300046535 | Bacteria | 6128 |
| 1335 | Ga0495586_0925259 | 3300046535 | Unclassified | 502 |
| 1336 | Ga0495587_0000060 | 3300046536 | Bacteria | 93780 |
| 1337 | Ga0495587_0014277 | 3300046536 | Bacteria | 4984 |
| 1338 | Ga0495587_0078213 | 3300046536 | Bacteria | 1919 |
| 1339 | Ga0495587_0236538 | 3300046536 | Unclassified | 1028 |
| 1340 | Ga0495587_0541779 | 3300046536 | Unclassified | 642 |
| 1341 | Ga0495587_0643800 | 3300046536 | Unclassified | 582 |
| 1342 | Ga0495609_0118773 | 3300046538 | Bacteria | 1138 |
| 1343 | Ga0495621_0137310 | 3300046539 | Bacteria | 955 |
| 1344 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 1345 | Ga0495645_0106741 | 3300046543 | Unclassified | 1985 |
| 1346 | Ga0495645_0249517 | 3300046543 | Unclassified | 1180 |
| 1347 | Ga0495645_0375660 | 3300046543 | Unclassified | 910 |
| 1348 | Ga0495645_0776882 | 3300046543 | Unclassified | 576 |
| 1349 | Ga0495667_0016306 | 3300046559 | Bacteria | 5020 |
| 1350 | Ga0495667_0033182 | 3300046559 | Bacteria | 3455 |
| 1351 | Ga0495667_0097352 | 3300046559 | Bacteria | 1905 |
| 1352 | Ga0495667_0099592 | 3300046559 | Bacteria | 1881 |
| 1353 | Ga0495667_0190761 | 3300046559 | Unclassified | 1313 |
| 1354 | Ga0495667_0215963 | 3300046559 | Bacteria | 1225 |
| 1355 | Ga0495667_0803988 | 3300046559 | Unclassified | 580 |
| 1356 | Ga0495656_0002919 | 3300046615 | Bacteria | 5730 |
| 1357 | Ga0495656_0035880 | 3300046615 | Unclassified | 2039 |
| 1358 | Ga0495656_0754613 | 3300046615 | Bacteria | 525 |
| 1359 | Ga0495668_0766569 | 3300046616 | Unclassified | 534 |
| 1360 | Ga0495634_0076666 | 3300046642 | Bacteria | 2194 |
| 1361 | Ga0495634_0115730 | 3300046642 | Bacteria | 1720 |
| 1362 | Ga0495634_0457531 | 3300046642 | Unclassified | 752 |
| 1363 | Ga0495634_0857436 | 3300046642 | Unclassified | 515 |
| 1364 | Ga0495611_0302653 | 3300046648 | Unclassified | 737 |
| 1365 | Ga0495635_0007673 | 3300046663 | Bacteria | 7529 |
| 1366 | Ga0495635_0010204 | 3300046663 | Bacteria | 6566 |
| 1367 | Ga0495635_0187176 | 3300046663 | Bacteria | 1406 |
| 1368 | Ga0495635_0196629 | 3300046663 | Unclassified | 1368 |
| 1369 | Ga0495635_0404468 | 3300046663 | Unclassified | 906 |
| 1370 | Ga0495635_0933450 | 3300046663 | Unclassified | 554 |
| 1371 | Ga0495635_1079595 | 3300046663 | Unclassified | 509 |
| 1372 | Ga0495659_0154188 | 3300046664 | Bacteria | 924 |
| 1373 | Ga0495661_0474226 | 3300046665 | Unclassified | 600 |
| 1374 | Ga0495588_0452066 | 3300046674 | Bacteria | 674 |
| 1375 | Ga0495588_0709422 | 3300046674 | Unclassified | 526 |
| 1376 | Ga0495657_0052504 | 3300046675 | Bacteria | 2732 |
| 1377 | Ga0495657_0103608 | 3300046675 | Unclassified | 1810 |
| 1378 | Ga0495657_0190419 | 3300046675 | Unclassified | 1254 |
| 1379 | Ga0495657_0295631 | 3300046675 | Bacteria | 967 |
| 1380 | Ga0495657_0414115 | 3300046675 | Bacteria | 792 |
| 1381 | Ga0495657_0591422 | 3300046675 | Unclassified | 642 |
| 1382 | Ga0495599_0001221 | 3300046678 | Bacteria | 14572 |
| 1383 | Ga0495599_0013291 | 3300046678 | Bacteria | 5087 |
| 1384 | Ga0495599_0060412 | 3300046678 | Bacteria | 2370 |
| 1385 | Ga0495599_0297680 | 3300046678 | Bacteria | 974 |
| 1386 | Ga0495599_0497529 | 3300046678 | Unclassified | 718 |
| 1387 | Ga0495599_0506195 | 3300046678 | Unclassified | 710 |
| 1388 | Ga0495623_0000442 | 3300046679 | Bacteria | 27277 |
| 1389 | Ga0495623_0176669 | 3300046679 | Unclassified | 1243 |
| 1390 | Ga0495646_0001935 | 3300046680 | Bacteria | 12469 |
| 1391 | Ga0495646_0033039 | 3300046680 | Bacteria | 3218 |
| 1392 | Ga0495646_0042988 | 3300046680 | Bacteria | 2770 |
| 1393 | Ga0495646_0130166 | 3300046680 | Bacteria | 1417 |
| 1394 | Ga0495647_0001012 | 3300046681 | Bacteria | 8560 |
| 1395 | Ga0495647_0384030 | 3300046681 | Archaea | 643 |
| 1396 | Ga0495658_0000950 | 3300046683 | Bacteria | 15450 |
| 1397 | Ga0495658_0001191 | 3300046683 | Bacteria | 13704 |
| 1398 | Ga0495658_0016785 | 3300046683 | Bacteria | 3772 |
| 1399 | Ga0495658_0990408 | 3300046683 | Bacteria | 537 |
| 1400 | Ga0495613_0001533 | 3300046689 | Bacteria | 17578 |
| 1401 | Ga0495613_0093037 | 3300046689 | Bacteria | 2182 |
| 1402 | Ga0495613_0250665 | 3300046689 | Unclassified | 1235 |
| 1403 | Ga0495613_0589611 | 3300046689 | Unclassified | 740 |
| 1404 | Ga0495624_0006249 | 3300046690 | Bacteria | 8471 |
| 1405 | Ga0495624_0008918 | 3300046690 | Bacteria | 6971 |
| 1406 | Ga0495624_0114425 | 3300046690 | Bacteria | 1658 |
| 1407 | Ga0495624_0454906 | 3300046690 | Unclassified | 767 |
| 1408 | Ga0495624_0928658 | 3300046690 | Bacteria | 512 |
| 1409 | Ga0495670_0747763 | 3300046691 | Bacteria | 533 |
| 1410 | Ga0495589_0195129 | 3300046794 | Unclassified | 957 |
| 1411 | Ga0495589_0345091 | 3300046794 | Unclassified | 686 |
| 1412 | Ga0495600_0010197 | 3300046809 | Bacteria | 5824 |
| 1413 | Ga0495600_0120642 | 3300046809 | Bacteria | 1705 |
| 1414 | Ga0495600_0266830 | 3300046809 | Bacteria | 1086 |
| 1415 | Ga0495600_0345264 | 3300046809 | Bacteria | 933 |
| 1416 | Ga0495600_0533232 | 3300046809 | Bacteria | 719 |
| 1417 | Ga0495581_0000231 | 3300047315 | Bacteria | 26359 |
| 1418 | Ga0495581_0008754 | 3300047315 | Bacteria | 5858 |
| 1419 | Ga0495581_0232285 | 3300047315 | Bacteria | 1079 |
| 1420 | Ga0495581_0315095 | 3300047315 | Unclassified | 914 |
| 1421 | Ga0495581_0432986 | 3300047315 | Unclassified | 766 |
| 1422 | Ga0495581_0867552 | 3300047315 | Bacteria | 516 |
| 1423 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 1424 | Ga0495604_0257631 | 3300047317 | Unclassified | 1187 |
| 1425 | Ga0495604_0437145 | 3300047317 | Unclassified | 856 |
| 1426 | Ga0495674_0034792 | 3300047319 | Bacteria | 4551 |
| 1427 | Ga0495674_0317760 | 3300047319 | Bacteria | 1269 |
| 1428 | Ga0495674_0536374 | 3300047319 | Bacteria | 933 |
| 1429 | Ga0495674_0555989 | 3300047319 | Bacteria | 913 |
| 1430 | Ga0495674_0556369 | 3300047319 | Unclassified | 913 |
| 1431 | Ga0495674_0797931 | 3300047319 | Unclassified | 734 |
| 1432 | Ga0495676_0004932 | 3300047321 | Bacteria | 12238 |
| 1433 | Ga0495676_0033454 | 3300047321 | Bacteria | 4329 |
| 1434 | Ga0495676_0072612 | 3300047321 | Bacteria | 2641 |
| 1435 | Ga0495676_0118224 | 3300047321 | Bacteria | 1933 |
| 1436 | Ga0495676_0204961 | 3300047321 | Bacteria | 1368 |
| 1437 | Ga0495676_0993549 | 3300047321 | Unclassified | 536 |
| 1438 | Ga0495680_0005589 | 3300047322 | Bacteria | 11792 |
| 1439 | Ga0495680_0007172 | 3300047322 | Bacteria | 10265 |
| 1440 | Ga0495680_0008993 | 3300047322 | Bacteria | 9025 |
| 1441 | Ga0495680_0030489 | 3300047322 | Bacteria | 4403 |
| 1442 | Ga0495680_0087862 | 3300047322 | Unclassified | 2337 |
| 1443 | Ga0495680_0220358 | 3300047322 | Bacteria | 1354 |
| 1444 | Ga0495680_0286460 | 3300047322 | Unclassified | 1160 |
| 1445 | Ga0495680_0891105 | 3300047322 | Unclassified | 575 |
| 1446 | Ga0495683_0113608 | 3300047323 | Bacteria | 1291 |
| 1447 | Ga0495675_0000821 | 3300047444 | Bacteria | 19062 |
| 1448 | Ga0495675_0265387 | 3300047444 | Unclassified | 1027 |
| 1449 | Ga0495677_0116216 | 3300047445 | Bacteria | 1019 |
| 1450 | Ga0495677_0193898 | 3300047445 | Unclassified | 789 |
| 1451 | Ga0495685_277405 | 3300047447 | Bacteria | 529 |
| 1452 | Ga0495684_0012093 | 3300047471 | Bacteria | 6659 |
| 1453 | Ga0495684_0076278 | 3300047471 | Bacteria | 2546 |
| 1454 | Ga0495684_0143057 | 3300047471 | Bacteria | 1793 |
| 1455 | Ga0495684_0193693 | 3300047471 | Bacteria | 1502 |
| 1456 | Ga0495684_0326984 | 3300047471 | Unclassified | 1094 |
| 1457 | Ga0495684_0565349 | 3300047471 | Unclassified | 772 |
| 1458 | Ga0495684_0610684 | 3300047471 | Unclassified | 734 |
| 1459 | Ga0495593_0001083 | 3300047673 | Bacteria | 15906 |
| 1460 | Ga0495593_0001951 | 3300047673 | Bacteria | 12308 |
| 1461 | Ga0495602_0000536 | 3300048088 | Bacteria | 35263 |
| 1462 | Ga0495602_0061759 | 3300048088 | Unclassified | 3255 |
| 1463 | Ga0495602_0334967 | 3300048088 | Unclassified | 1096 |
| 1464 | Ga0495602_0499732 | 3300048088 | Bacteria | 850 |
| 1465 | Ga0495602_0589962 | 3300048088 | Bacteria | 765 |
| 1466 | Ga0495602_0645557 | 3300048088 | Unclassified | 723 |
| 1467 | Ga0495614_0002623 | 3300048089 | Bacteria | 7993 |
| 1468 | Ga0495614_0002797 | 3300048089 | Bacteria | 7760 |
| 1469 | Ga0495614_0401684 | 3300048089 | Bacteria | 644 |
| 1470 | Ga0495615_0066305 | 3300048090 | Bacteria | 964 |
| 1471 | Ga0496100_0006620 | 3300048903 | Bacteria | 6332 |
| 1472 | Ga0496100_0012889 | 3300048903 | Bacteria | 4806 |
| 1473 | Ga0496100_0076035 | 3300048903 | Bacteria | 2254 |
| 1474 | Ga0496100_0106184 | 3300048903 | Bacteria | 1943 |
| 1475 | Ga0496100_0122962 | 3300048903 | Bacteria | 1818 |
| 1476 | Ga0496100_0131402 | 3300048903 | Bacteria | 1764 |
| 1477 | Ga0496100_0263908 | 3300048903 | Bacteria | 1278 |
| 1478 | Ga0496100_0341441 | 3300048903 | Bacteria | 1129 |
| 1479 | Ga0496100_0416767 | 3300048903 | Bacteria | 1025 |
| 1480 | Ga0496100_0492880 | 3300048903 | Unclassified | 943 |
| 1481 | Ga0496100_0537149 | 3300048903 | Bacteria | 903 |
| 1482 | Ga0496100_0587761 | 3300048903 | Unclassified | 864 |
| 1483 | Ga0496100_0980172 | 3300048903 | Bacteria | 665 |
| 1484 | Ga0496101_0005869 | 3300048904 | Bacteria | 7861 |
| 1485 | Ga0496101_0034463 | 3300048904 | Bacteria | 3575 |
| 1486 | Ga0496101_0076566 | 3300048904 | Bacteria | 2464 |
| 1487 | Ga0496101_0183468 | 3300048904 | Bacteria | 1612 |
| 1488 | Ga0496101_0198979 | 3300048904 | Bacteria | 1548 |
| 1489 | Ga0496101_0356153 | 3300048904 | Bacteria | 1150 |
| 1490 | Ga0496101_1268221 | 3300048904 | Unclassified | 577 |
| 1491 | Ga0496102_0005454 | 3300048905 | Bacteria | 10789 |
| 1492 | Ga0496102_0010968 | 3300048905 | Bacteria | 7808 |
| 1493 | Ga0496102_0039141 | 3300048905 | Bacteria | 4283 |
| 1494 | Ga0496102_0050483 | 3300048905 | Bacteria | 3787 |
| 1495 | Ga0496102_0051928 | 3300048905 | Bacteria | 3735 |
| 1496 | Ga0496102_0076066 | 3300048905 | Bacteria | 3087 |
| 1497 | Ga0496102_0154760 | 3300048905 | Bacteria | 2155 |
| 1498 | Ga0496102_0467396 | 3300048905 | Bacteria | 1182 |
| 1499 | Ga0496102_0612132 | 3300048905 | Bacteria | 1012 |
| 1500 | Ga0496102_0843881 | 3300048905 | Bacteria | 838 |
| 1501 | Ga0496102_0848288 | 3300048905 | Bacteria | 836 |
| 1502 | Ga0496102_0927722 | 3300048905 | Bacteria | 792 |
| 1503 | Ga0496102_1785257 | 3300048905 | Unclassified | 532 |
| 1504 | Ga0496103_0004954 | 3300048906 | Bacteria | 8036 |
| 1505 | Ga0496103_0035205 | 3300048906 | Bacteria | 3065 |
| 1506 | Ga0496103_0055301 | 3300048906 | Bacteria | 2461 |
| 1507 | Ga0496103_0105035 | 3300048906 | Bacteria | 1791 |
| 1508 | Ga0496103_0118383 | 3300048906 | Unclassified | 1686 |
| 1509 | Ga0496103_0197984 | 3300048906 | Bacteria | 1292 |
| 1510 | Ga0496103_0271450 | 3300048906 | Unclassified | 1091 |
| 1511 | Ga0496103_0412138 | 3300048906 | Unclassified | 868 |
| 1512 | Ga0496103_0459568 | 3300048906 | Unclassified | 816 |
| 1513 | Ga0496103_0609060 | 3300048906 | Unclassified | 695 |
| 1514 | Ga0496103_0624429 | 3300048906 | Unclassified | 686 |
| 1515 | Ga0496103_0961046 | 3300048906 | Archaea | 533 |
| 1516 | Ga0496104_0000329 | 3300048907 | Bacteria | 42355 |
| 1517 | Ga0496104_0011979 | 3300048907 | Bacteria | 7780 |
| 1518 | Ga0496104_0080833 | 3300048907 | Bacteria | 3099 |
| 1519 | Ga0496104_0082800 | 3300048907 | Unclassified | 3060 |
| 1520 | Ga0496104_0120065 | 3300048907 | Bacteria | 2524 |
| 1521 | Ga0496104_0401649 | 3300048907 | Bacteria | 1282 |
| 1522 | Ga0496104_0405266 | 3300048907 | Bacteria | 1276 |
| 1523 | Ga0496104_0421129 | 3300048907 | Unclassified | 1247 |
| 1524 | Ga0496104_0635760 | 3300048907 | Unclassified | 976 |
| 1525 | Ga0496104_0715298 | 3300048907 | Bacteria | 909 |
| 1526 | Ga0496104_0935011 | 3300048907 | Unclassified | 772 |
| 1527 | Ga0496104_1560503 | 3300048907 | Unclassified | 563 |
| 1528 | Ga0496105_0000128 | 3300048908 | Bacteria | 51033 |
| 1529 | Ga0496105_0004531 | 3300048908 | Bacteria | 10471 |
| 1530 | Ga0496105_0008583 | 3300048908 | Bacteria | 7938 |
| 1531 | Ga0496105_0186977 | 3300048908 | Bacteria | 1695 |
| 1532 | Ga0496105_0209973 | 3300048908 | Bacteria | 1587 |
| 1533 | Ga0496105_0214614 | 3300048908 | Bacteria | 1568 |
| 1534 | Ga0496105_0215711 | 3300048908 | Bacteria | 1563 |
| 1535 | Ga0496105_0254983 | 3300048908 | Bacteria | 1420 |
| 1536 | Ga0496105_0317004 | 3300048908 | Bacteria | 1250 |
| 1537 | Ga0496105_0478364 | 3300048908 | Unclassified | 980 |
| 1538 | Ga0496106_0002754 | 3300048909 | Bacteria | 13019 |
| 1539 | Ga0496106_0007074 | 3300048909 | Bacteria | 8291 |
| 1540 | Ga0496106_0101800 | 3300048909 | Bacteria | 2228 |
| 1541 | Ga0496106_0253067 | 3300048909 | Bacteria | 1409 |
| 1542 | Ga0496106_0278920 | 3300048909 | Bacteria | 1339 |
| 1543 | Ga0496106_0489664 | 3300048909 | Unclassified | 988 |
| 1544 | Ga0496106_0980428 | 3300048909 | Bacteria | 665 |
| 1545 | Ga0496106_0994796 | 3300048909 | Bacteria | 660 |
| 1546 | Ga0496106_1025468 | 3300048909 | Unclassified | 648 |
| 1547 | Ga0496106_1272455 | 3300048909 | Bacteria | 572 |
| 1548 | Ga0496107_0004881 | 3300048910 | Bacteria | 9110 |
| 1549 | Ga0496107_0019954 | 3300048910 | Bacteria | 4733 |
| 1550 | Ga0496107_0179353 | 3300048910 | Bacteria | 1573 |
| 1551 | Ga0496107_0253595 | 3300048910 | Bacteria | 1309 |
| 1552 | Ga0496107_0311157 | 3300048910 | Bacteria | 1172 |
| 1553 | Ga0496107_0342635 | 3300048910 | Archaea | 1112 |
| 1554 | Ga0496107_0367757 | 3300048910 | Unclassified | 1070 |
| 1555 | Ga0496107_0646873 | 3300048910 | Bacteria | 779 |
| 1556 | Ga0496108_0009805 | 3300048911 | Bacteria | 7758 |
| 1557 | Ga0496108_0011419 | 3300048911 | Bacteria | 7220 |
| 1558 | Ga0496108_0016676 | 3300048911 | Bacteria | 6000 |
| 1559 | Ga0496108_0223034 | 3300048911 | Bacteria | 1638 |
| 1560 | Ga0496108_0226115 | 3300048911 | Bacteria | 1626 |
| 1561 | Ga0496108_0306630 | 3300048911 | Bacteria | 1383 |
| 1562 | Ga0496108_0564443 | 3300048911 | Bacteria | 992 |
| 1563 | Ga0496108_0653219 | 3300048911 | Unclassified | 914 |
| 1564 | Ga0496108_1150793 | 3300048911 | Bacteria | 658 |
| 1565 | Ga0496108_1221908 | 3300048911 | Unclassified | 635 |
| 1566 | Ga0496109_0000408 | 3300048912 | Bacteria | 38367 |
| 1567 | Ga0496109_0000650 | 3300048912 | Bacteria | 28852 |
| 1568 | Ga0496109_0008289 | 3300048912 | Bacteria | 8822 |
| 1569 | Ga0496109_0139926 | 3300048912 | Bacteria | 2263 |
| 1570 | Ga0496109_0199752 | 3300048912 | Bacteria | 1879 |
| 1571 | Ga0496109_0202727 | 3300048912 | Bacteria | 1865 |
| 1572 | Ga0496109_0340405 | 3300048912 | Bacteria | 1416 |
| 1573 | Ga0496109_0344490 | 3300048912 | Bacteria | 1407 |
| 1574 | Ga0496109_0432613 | 3300048912 | Bacteria | 1243 |
| 1575 | Ga0496109_0531540 | 3300048912 | Bacteria | 1110 |
| 1576 | Ga0496109_0815473 | 3300048912 | Bacteria | 871 |
| 1577 | Ga0496109_0887476 | 3300048912 | Bacteria | 829 |
| 1578 | Ga0496109_1216657 | 3300048912 | Unclassified | 690 |
| 1579 | Ga0496109_1411998 | 3300048912 | Unclassified | 631 |
| 1580 | Ga0496109_1503255 | 3300048912 | Unclassified | 608 |
| 1581 | Ga0496109_1536442 | 3300048912 | Bacteria | 600 |
| 1582 | Ga0496109_1768022 | 3300048912 | Unclassified | 551 |
| 1583 | Ga0496110_0013395 | 3300048913 | Bacteria | 6778 |
| 1584 | Ga0496110_0024222 | 3300048913 | Bacteria | 5170 |
| 1585 | Ga0496110_0034879 | 3300048913 | Bacteria | 4361 |
| 1586 | Ga0496110_0065495 | 3300048913 | Bacteria | 3212 |
| 1587 | Ga0496110_0081077 | 3300048913 | Bacteria | 2892 |
| 1588 | Ga0496110_0095898 | 3300048913 | Bacteria | 2657 |
| 1589 | Ga0496110_0301401 | 3300048913 | Bacteria | 1460 |
| 1590 | Ga0496110_0417116 | 3300048913 | Unclassified | 1224 |
| 1591 | Ga0496110_1393990 | 3300048913 | Unclassified | 610 |
| 1592 | Ga0496110_1493848 | 3300048913 | Unclassified | 585 |
| 1593 | Ga0496111_0001006 | 3300048914 | Bacteria | 15459 |
| 1594 | Ga0496111_0007379 | 3300048914 | Bacteria | 7198 |
| 1595 | Ga0496111_0017036 | 3300048914 | Bacteria | 5016 |
| 1596 | Ga0496111_0028954 | 3300048914 | Bacteria | 3929 |
| 1597 | Ga0496111_0036301 | 3300048914 | Bacteria | 3524 |
| 1598 | Ga0496111_0039067 | 3300048914 | Bacteria | 3401 |
| 1599 | Ga0496111_0085976 | 3300048914 | Bacteria | 2300 |
| 1600 | Ga0496111_0087795 | 3300048914 | Bacteria | 2276 |
| 1601 | Ga0496111_0143275 | 3300048914 | Bacteria | 1771 |
| 1602 | Ga0496111_0174414 | 3300048914 | Bacteria | 1598 |
| 1603 | Ga0496111_0311364 | 3300048914 | Bacteria | 1167 |
| 1604 | Ga0496111_0320472 | 3300048914 | Bacteria | 1148 |
| 1605 | Ga0496111_0818985 | 3300048914 | Unclassified | 673 |
| 1606 | Ga0496112_0000799 | 3300048915 | Bacteria | 22235 |
| 1607 | Ga0496112_0004783 | 3300048915 | Bacteria | 11549 |
| 1608 | Ga0496112_0015500 | 3300048915 | Bacteria | 7117 |
| 1609 | Ga0496112_0035538 | 3300048915 | Bacteria | 4855 |
| 1610 | Ga0496112_0047812 | 3300048915 | Bacteria | 4196 |
| 1611 | Ga0496112_0086216 | 3300048915 | Bacteria | 3107 |
| 1612 | Ga0496112_0235354 | 3300048915 | Bacteria | 1785 |
| 1613 | Ga0496112_0387038 | 3300048915 | Unclassified | 1339 |
| 1614 | Ga0496112_0749367 | 3300048915 | Bacteria | 903 |
| 1615 | Ga0496112_1051671 | 3300048915 | Bacteria | 733 |
| 1616 | Ga0496112_1543744 | 3300048915 | Unclassified | 578 |
| 1617 | Ga0496112_1873181 | 3300048915 | Bacteria | 511 |
| 1618 | Ga0496113_0020933 | 3300048916 | Bacteria | 4607 |
| 1619 | Ga0496113_0022709 | 3300048916 | Bacteria | 4442 |
| 1620 | Ga0496113_0398376 | 3300048916 | Bacteria | 1105 |
| 1621 | Ga0496113_0573402 | 3300048916 | Unclassified | 904 |
| 1622 | Ga0496113_0618645 | 3300048916 | Bacteria | 867 |
| 1623 | Ga0496113_0765209 | 3300048916 | Bacteria | 768 |
| 1624 | Ga0496113_0771359 | 3300048916 | Unclassified | 765 |
| 1625 | Ga0496113_0843245 | 3300048916 | Bacteria | 727 |
| 1626 | Ga0496113_0859006 | 3300048916 | Unclassified | 719 |
| 1627 | Ga0496113_1188275 | 3300048916 | Unclassified | 596 |
| 1628 | Ga0496114_0002097 | 3300048917 | Bacteria | 15151 |
| 1629 | Ga0496114_0011172 | 3300048917 | Bacteria | 7169 |
| 1630 | Ga0496114_0012282 | 3300048917 | Bacteria | 6852 |
| 1631 | Ga0496114_0019690 | 3300048917 | Bacteria | 5469 |
| 1632 | Ga0496114_0041071 | 3300048917 | Bacteria | 3833 |
| 1633 | Ga0496114_0059034 | 3300048917 | Bacteria | 3204 |
| 1634 | Ga0496114_0060788 | 3300048917 | Bacteria | 3158 |
| 1635 | Ga0496114_0130924 | 3300048917 | Bacteria | 2166 |
| 1636 | Ga0496114_0240944 | 3300048917 | Bacteria | 1590 |
| 1637 | Ga0496114_0311884 | 3300048917 | Unclassified | 1389 |
| 1638 | Ga0496114_0367340 | 3300048917 | Bacteria | 1273 |
| 1639 | Ga0496114_0417576 | 3300048917 | Bacteria | 1188 |
| 1640 | Ga0496114_0570115 | 3300048917 | Bacteria | 999 |
| 1641 | Ga0496114_0625324 | 3300048917 | Unclassified | 948 |
| 1642 | Ga0496114_0886655 | 3300048917 | Bacteria | 773 |
| 1643 | Ga0496114_0997715 | 3300048917 | Unclassified | 720 |
| 1644 | Ga0496115_0008023 | 3300048918 | Bacteria | 7792 |
| 1645 | Ga0496115_0011448 | 3300048918 | Bacteria | 6649 |
| 1646 | Ga0496115_0045492 | 3300048918 | Bacteria | 3504 |
| 1647 | Ga0496115_0110070 | 3300048918 | Bacteria | 2263 |
| 1648 | Ga0496115_0152885 | 3300048918 | Bacteria | 1906 |
| 1649 | Ga0496115_0458068 | 3300048918 | Bacteria | 1029 |
| 1650 | Ga0496115_0738681 | 3300048918 | Bacteria | 771 |
| 1651 | Ga0496115_0882794 | 3300048918 | Bacteria | 690 |
| 1652 | Ga0496115_1294343 | 3300048918 | Unclassified | 543 |
| 1653 | Ga0501031_0000858 | 3300049568 | Bacteria | 18263 |
| 1654 | Ga0501032_0013884 | 3300049569 | Bacteria | 5714 |
| 1655 | Ga0501033_0084129 | 3300049570 | Bacteria | 2331 |
| 1656 | Ga0501033_1028275 | 3300049570 | Unclassified | 550 |
| 1657 | Ga0501034_0013382 | 3300049571 | Bacteria | 8445 |
| 1658 | Ga0501034_0182694 | 3300049571 | Bacteria | 2062 |
| 1659 | Ga0501036_0018602 | 3300049572 | Bacteria | 5824 |
| 1660 | Ga0501036_0807781 | 3300049572 | Bacteria | 772 |
| 1661 | Ga0501036_0818662 | 3300049572 | Unclassified | 766 |
| 1662 | Ga0501037_0015224 | 3300049573 | Bacteria | 5658 |
| 1663 | Ga0501038_0001801 | 3300049574 | Bacteria | 19835 |
| 1664 | Ga0501039_0277297 | 3300049575 | Bacteria | 1318 |
| 1665 | Ga0501039_0408385 | 3300049575 | Bacteria | 1066 |
| 1666 | Ga0501040_0015722 | 3300049576 | Bacteria | 5002 |
| 1667 | Ga0501040_0254397 | 3300049576 | Unclassified | 1253 |
| 1668 | Ga0501040_0315675 | 3300049576 | Bacteria | 1118 |
| 1669 | Ga0501041_0019315 | 3300049577 | Bacteria | 4068 |
| 1670 | Ga0501041_1082963 | 3300049577 | Unclassified | 516 |
| 1671 | Ga0501042_0022331 | 3300049578 | Bacteria | 4420 |
| 1672 | Ga0501042_0062687 | 3300049578 | Bacteria | 2657 |
| 1673 | Ga0501043_0003971 | 3300049579 | Bacteria | 12114 |
| 1674 | Ga0501043_1230069 | 3300049579 | Bacteria | 525 |
| 1675 | Ga0501046_0003064 | 3300049580 | Bacteria | 15435 |
| 1676 | Ga0501046_1083575 | 3300049580 | Bacteria | 554 |
| 1677 | Ga0501047_0370744 | 3300049581 | Bacteria | 1267 |
| 1678 | Ga0501048_0005026 | 3300049582 | Bacteria | 10082 |
| 1679 | Ga0501067_0000577 | 3300049583 | Bacteria | 19841 |
| 1680 | Ga0501067_0008977 | 3300049583 | Bacteria | 5542 |
| 1681 | Ga0501067_0016714 | 3300049583 | Bacteria | 4054 |
| 1682 | Ga0501067_0028017 | 3300049583 | Bacteria | 3122 |
| 1683 | Ga0501067_0055596 | 3300049583 | Bacteria | 2193 |
| 1684 | Ga0501067_0099320 | 3300049583 | Bacteria | 1616 |
| 1685 | Ga0501067_0104350 | 3300049583 | Bacteria | 1575 |
| 1686 | Ga0501067_0180276 | 3300049583 | Bacteria | 1176 |
| 1687 | Ga0501067_0285579 | 3300049583 | Unclassified | 919 |
| 1688 | Ga0501067_0480226 | 3300049583 | Bacteria | 695 |
| 1689 | Ga0501067_0645547 | 3300049583 | Unclassified | 594 |
| 1690 | Ga0501067_0778727 | 3300049583 | Bacteria | 539 |
| 1691 | Ga0501067_0817051 | 3300049583 | Unclassified | 525 |
| 1692 | Ga0501068_0003580 | 3300049584 | Bacteria | 8390 |
| 1693 | Ga0501068_0021014 | 3300049584 | Bacteria | 3809 |
| 1694 | Ga0501068_0257003 | 3300049584 | Bacteria | 1114 |
| 1695 | Ga0501068_0408265 | 3300049584 | Bacteria | 876 |
| 1696 | Ga0501069_0000923 | 3300049585 | Bacteria | 14014 |
| 1697 | Ga0501069_0001675 | 3300049585 | Bacteria | 11011 |
| 1698 | Ga0501069_0013845 | 3300049585 | Bacteria | 4306 |
| 1699 | Ga0501069_0029573 | 3300049585 | Bacteria | 3007 |
| 1700 | Ga0501069_0075960 | 3300049585 | Bacteria | 1888 |
| 1701 | Ga0501069_0140465 | 3300049585 | Bacteria | 1385 |
| 1702 | Ga0501069_0145720 | 3300049585 | Unclassified | 1359 |
| 1703 | Ga0501069_0291045 | 3300049585 | Bacteria | 957 |
| 1704 | Ga0501069_0304949 | 3300049585 | Bacteria | 934 |
| 1705 | Ga0501069_0646482 | 3300049585 | Unclassified | 636 |
| 1706 | Ga0501069_0859860 | 3300049585 | Unclassified | 551 |
| 1707 | Ga0501070_0000619 | 3300049586 | Bacteria | 32593 |
| 1708 | Ga0501070_0002536 | 3300049586 | Bacteria | 16014 |
| 1709 | Ga0501070_0169794 | 3300049586 | Bacteria | 1797 |
| 1710 | Ga0501070_0243421 | 3300049586 | Bacteria | 1472 |
| 1711 | Ga0501070_0281586 | 3300049586 | Bacteria | 1357 |
| 1712 | Ga0501070_1315112 | 3300049586 | Bacteria | 551 |
| 1713 | Ga0501071_0016157 | 3300049587 | Bacteria | 5130 |
| 1714 | Ga0501071_0669345 | 3300049587 | Bacteria | 799 |
| 1715 | Ga0501071_0821911 | 3300049587 | Unclassified | 717 |
| 1716 | Ga0501071_0867530 | 3300049587 | Unclassified | 696 |
| 1717 | Ga0501071_1121464 | 3300049587 | Unclassified | 608 |
| 1718 | Ga0501072_0111169 | 3300049588 | Bacteria | 2181 |
| 1719 | Ga0501072_0117052 | 3300049588 | Bacteria | 2123 |
| 1720 | Ga0501072_0181565 | 3300049588 | Bacteria | 1678 |
| 1721 | Ga0501072_0475955 | 3300049588 | Bacteria | 988 |
| 1722 | Ga0501073_0006279 | 3300049589 | Bacteria | 8855 |
| 1723 | Ga0501073_0067798 | 3300049589 | Bacteria | 2487 |
| 1724 | Ga0501074_0029245 | 3300049590 | Bacteria | 3991 |
| 1725 | Ga0501074_0045468 | 3300049590 | Bacteria | 3176 |
| 1726 | Ga0501074_0052934 | 3300049590 | Bacteria | 2929 |
| 1727 | Ga0501074_0523183 | 3300049590 | Unclassified | 840 |
| 1728 | Ga0501074_1275098 | 3300049590 | Unclassified | 515 |
| 1729 | Ga0501074_1275495 | 3300049590 | Bacteria | 515 |
| 1730 | Ga0501075_0007361 | 3300049591 | Bacteria | 7636 |
| 1731 | Ga0501075_0141586 | 3300049591 | Bacteria | 1833 |
| 1732 | Ga0501075_0634281 | 3300049591 | Bacteria | 815 |
| 1733 | Ga0501076_0086214 | 3300049592 | Bacteria | 2523 |
| 1734 | Ga0501076_0607730 | 3300049592 | Unclassified | 902 |
| 1735 | Ga0501076_1180305 | 3300049592 | Bacteria | 630 |
| 1736 | Ga0501077_0019787 | 3300049593 | Bacteria | 4257 |
| 1737 | Ga0501077_0048711 | 3300049593 | Bacteria | 2692 |
| 1738 | Ga0501077_0657392 | 3300049593 | Unclassified | 673 |
| 1739 | Ga0501077_0829592 | 3300049593 | Unclassified | 595 |
| 1740 | Ga0501077_1144756 | 3300049593 | Unclassified | 501 |
| 1741 | Ga0501079_0055083 | 3300049741 | Bacteria | 3068 |
| 1742 | Ga0501079_0070705 | 3300049741 | Bacteria | 2695 |
| 1743 | Ga0501079_0083566 | 3300049741 | Bacteria | 2470 |
| 1744 | Ga0501079_0156083 | 3300049741 | Bacteria | 1779 |
| 1745 | Ga0501079_0454678 | 3300049741 | Bacteria | 1006 |
| 1746 | Ga0501079_0821600 | 3300049741 | Unclassified | 732 |
| 1747 | Ga0501080_0002707 | 3300049742 | Bacteria | 15537 |
| 1748 | Ga0501080_0004326 | 3300049742 | Bacteria | 12610 |
| 1749 | Ga0501080_0192569 | 3300049742 | Bacteria | 1873 |
| 1750 | Ga0501080_0728504 | 3300049742 | Bacteria | 873 |
| 1751 | Ga0501080_1718975 | 3300049742 | Unclassified | 529 |
| 1752 | Ga0501081_0032274 | 3300049743 | Bacteria | 3552 |
| 1753 | Ga0501081_0073089 | 3300049743 | Bacteria | 2391 |
| 1754 | Ga0501081_0525284 | 3300049743 | Bacteria | 883 |
| 1755 | Ga0501081_0947995 | 3300049743 | Unclassified | 650 |
| 1756 | Ga0501083_0000255 | 3300049744 | Bacteria | 33719 |
| 1757 | Ga0501083_0001268 | 3300049744 | Bacteria | 17096 |
| 1758 | Ga0501035_0020625 | 3300049822 | Bacteria | 6053 |
| 1759 | Ga0501035_0273970 | 3300049822 | Bacteria | 1428 |
| 1760 | Ga0501035_0776945 | 3300049822 | Bacteria | 767 |
| 1761 | Ga0501035_0910795 | 3300049822 | Bacteria | 696 |
| 1762 | Ga0501044_0099015 | 3300049823 | Bacteria | 2934 |
| 1763 | Ga0501044_0171229 | 3300049823 | Bacteria | 2143 |
| 1764 | Ga0501045_0015946 | 3300049824 | Bacteria | 5330 |
| 1765 | Ga0501045_0261599 | 3300049824 | Bacteria | 1288 |
| 1766 | Ga0501045_1127809 | 3300049824 | Unclassified | 573 |
| 1767 | nmdc:mga00v17_717451_c1 | 3300050491 | Unclassified | 640 |
| 1768 | nmdc:mga0yw44_273950_c1 | 3300050492 | Bacteria | 1127 |
| 1769 | nmdc:mga0yw44_346457_c1 | 3300050492 | Bacteria | 1000 |
| 1770 | nmdc:mga06z11_1001169_c1 | 3300050494 | Bacteria | 509 |
| 1771 | nmdc:mga06z11_604054_c1 | 3300050494 | Unclassified | 667 |
| 1772 | nmdc:mga06z11_808924_c1 | 3300050494 | Bacteria | 571 |
| 1773 | nmdc:mga04h51_90274_c1 | 3300050495 | Bacteria | 1101 |
| 1774 | nmdc:mga05p37_12158_c1 | 3300050507 | Bacteria | 4132 |
| 1775 | nmdc:mga05p37_1960779_c1 | 3300050507 | Unclassified | 556 |
| 1776 | nmdc:mga05p37_32383_c1 | 3300050507 | Bacteria | 6392 |
| 1777 | nmdc:mga05p37_32998_c1 | 3300050507 | Bacteria | 6339 |
| 1778 | nmdc:mga05p37_624063_c1 | 3300050507 | Bacteria | 1212 |
| 1779 | nmdc:mga06r32_134643_c1 | 3300050510 | Bacteria | 2445 |
| 1780 | nmdc:mga06r32_1392004_c1 | 3300050510 | Bacteria | 643 |
| 1781 | nmdc:mga08y16_233091_c1 | 3300050511 | Bacteria | 1904 |
| 1782 | nmdc:mga08y16_355948_c1 | 3300050511 | Bacteria | 1503 |
| 1783 | nmdc:mga08y16_379863_c1 | 3300050511 | Unclassified | 1448 |
| 1784 | nmdc:mga08y16_41355_c1 | 3300050511 | Bacteria | 4828 |
| 1785 | nmdc:mga08y16_68861_c1 | 3300050511 | Bacteria | 3690 |
| 1786 | nmdc:mga0n895_106066_c1 | 3300050512 | Bacteria | 2823 |
| 1787 | nmdc:mga0n895_1130997_c1 | 3300050512 | Bacteria | 759 |
| 1788 | nmdc:mga0n895_1230667_c1 | 3300050512 | Unclassified | 722 |
| 1789 | nmdc:mga0n895_203505_c1 | 3300050512 | Bacteria | 2010 |
| 1790 | nmdc:mga0n895_381459_c1 | 3300050512 | Bacteria | 1426 |
| 1791 | nmdc:mga0n895_429170_c1 | 3300050512 | Bacteria | 1336 |
| 1792 | nmdc:mga0n895_568865_c1 | 3300050512 | Bacteria | 1138 |
| 1793 | nmdc:mga0n895_612470_c1 | 3300050512 | Unclassified | 1090 |
| 1794 | nmdc:mga0n895_77355_c1 | 3300050512 | Bacteria | 3310 |
| 1795 | nmdc:mga0n895_787446_c1 | 3300050512 | Unclassified | 942 |
| 1796 | nmdc:mga0n895_944526_c1 | 3300050512 | Bacteria | 846 |
| 1797 | nmdc:mga0rr50_10932_c1 | 3300050513 | Bacteria | 5789 |
| 1798 | nmdc:mga0rr50_1430030_c1 | 3300050513 | Unclassified | 585 |
| 1799 | nmdc:mga0rr50_32093_c1 | 3300050513 | Bacteria | 3738 |
| 1800 | nmdc:mga0rr50_347178_c1 | 3300050513 | Unclassified | 1247 |
| 1801 | nmdc:mga0rr50_432474_c1 | 3300050513 | Bacteria | 1114 |
| 1802 | nmdc:mga0rr50_785118_c1 | 3300050513 | Bacteria | 813 |
| 1803 | nmdc:mga0rr50_963504_c1 | 3300050513 | Bacteria | 727 |
| 1804 | nmdc:mga08x19_228150_c1 | 3300050514 | Unclassified | 1281 |
| 1805 | nmdc:mga08x19_25301_c1 | 3300050514 | Bacteria | 3697 |
| 1806 | nmdc:mga08x19_354728_c1 | 3300050514 | Bacteria | 1024 |
| 1807 | nmdc:mga08x19_378126_c1 | 3300050514 | Bacteria | 992 |
| 1808 | nmdc:mga08x19_580713_c1 | 3300050514 | Unclassified | 794 |
| 1809 | nmdc:mga08x19_658893_c1 | 3300050514 | Bacteria | 742 |
| 1810 | nmdc:mga08x19_823026_c1 | 3300050514 | Unclassified | 659 |
| 1811 | nmdc:mga08x19_89428_c1 | 3300050514 | Bacteria | 2031 |
| 1812 | nmdc:mga0a205_25342_c1 | 3300050515 | Bacteria | 5650 |
| 1813 | nmdc:mga0a205_355440_c1 | 3300050515 | Bacteria | 1332 |
| 1814 | nmdc:mga0a205_494058_c1 | 3300050515 | Bacteria | 1081 |
| 1815 | nmdc:mga0a205_504131_c1 | 3300050515 | Bacteria | 1067 |
| 1816 | nmdc:mga0a205_642062_c1 | 3300050515 | Bacteria | 913 |
| 1817 | nmdc:mga0a205_67020_c1 | 3300050515 | Bacteria | 3468 |
| 1818 | nmdc:mga0a205_697617_c1 | 3300050515 | Bacteria | 865 |
| 1819 | nmdc:mga0a205_795570_c1 | 3300050515 | Bacteria | 793 |
| 1820 | nmdc:mga0a205_817942_c1 | 3300050515 | Bacteria | 779 |
| 1821 | nmdc:mga0a205_849877_c1 | 3300050515 | Unclassified | 760 |
| 1822 | Ga0495601_0000178 | 3300053077 | Bacteria | 33686 |
| 1823 | Ga0495601_0002405 | 3300053077 | Bacteria | 10626 |
| 1824 | Ga0495601_0016364 | 3300053077 | Bacteria | 4493 |
| 1825 | Ga0495601_0570217 | 3300053077 | Unclassified | 727 |
| 1826 | Ga0495601_0662250 | 3300053077 | Unclassified | 667 |
| 1827 | Ga0495601_0791262 | 3300053077 | Bacteria | 602 |
| 1828 | Ga0495612_0000968 | 3300053078 | Bacteria | 11805 |
| 1829 | Ga0495612_0090134 | 3300053078 | Bacteria | 1297 |
| 1830 | Ga0495612_0215924 | 3300053078 | Unclassified | 848 |
| 1831 | Ga0495655_0341659 | 3300053083 | Unclassified | 522 |
| 1832 | Ga0495595_0044172 | 3300053084 | Bacteria | 2046 |
| 1833 | Ga0495595_0114493 | 3300053084 | Bacteria | 1310 |
| 1834 | Ga0495595_0138981 | 3300053084 | Bacteria | 1191 |
| 1835 | Ga0495595_0344760 | 3300053084 | Unclassified | 751 |
| 1836 | Ga0495595_0381065 | 3300053084 | Unclassified | 714 |
| 1837 | Ga0495595_0541467 | 3300053084 | Bacteria | 594 |
| 1838 | Ga0495595_0565685 | 3300053084 | Unclassified | 581 |
| 1839 | Ga0495619_0002984 | 3300053085 | Bacteria | 10991 |
| 1840 | Ga0495619_0003721 | 3300053085 | Bacteria | 9829 |
| 1841 | Ga0495619_0039602 | 3300053085 | Bacteria | 3077 |
| 1842 | Ga0495619_0095355 | 3300053085 | Bacteria | 2018 |
| 1843 | Ga0495619_0119616 | 3300053085 | Unclassified | 1805 |
| 1844 | Ga0495619_0216300 | 3300053085 | Bacteria | 1327 |
| 1845 | Ga0495619_0221285 | 3300053085 | Unclassified | 1311 |
| 1846 | Ga0495619_0267636 | 3300053085 | Unclassified | 1184 |
| 1847 | Ga0500566_0074479 | 3300053094 | Unclassified | 1901 |
| 1848 | Ga0500566_0517332 | 3300053094 | Unclassified | 511 |
| 1849 | Ga0500641_0376603 | 3300053096 | Unclassified | 564 |
| 1850 | Ga0501084_0051409 | 3300054114 | Bacteria | 3448 |
| 1851 | Ga0501084_0181846 | 3300054114 | Bacteria | 1775 |
| 1852 | Ga0501084_0192817 | 3300054114 | Bacteria | 1719 |
| 1853 | Ga0501084_1508615 | 3300054114 | Unclassified | 562 |
| 1854 | Ga0501084_1666556 | 3300054114 | Unclassified | 533 |
| 1855 | Ga0590071_018863 | 3300059421 | Bacteria | 1623 |
| 1856 | Ga0501082_0025935 | 3300060353 | Bacteria | 5052 |
| 1857 | Ga0501082_0077692 | 3300060353 | Bacteria | 2862 |
| 1858 | Ga0501082_0542214 | 3300060353 | Bacteria | 1017 |
| 1859 | Ga0501082_0800258 | 3300060353 | Bacteria | 825 |
| 1860 | Ga0501082_1268027 | 3300060353 | Unclassified | 644 |
| 1861 | Ga0501082_1572657 | 3300060353 | Unclassified | 574 |
| 1862 | Ga0466962_0001476 | 3300061719 | Bacteria | 10970 |
| 1863 | Ga0466962_0005000 | 3300061719 | Bacteria | 6376 |
| 1864 | Ga0466962_0018925 | 3300061719 | Bacteria | 3309 |
| 1865 | Ga0466962_0020707 | 3300061719 | Bacteria | 3160 |
| 1866 | Ga0466962_0098907 | 3300061719 | Unclassified | 1400 |
| 1867 | Ga0466962_0112722 | 3300061719 | Bacteria | 1310 |
| 1868 | Ga0466962_0154711 | 3300061719 | Unclassified | 1113 |
| 1869 | Ga0466962_0437102 | 3300061719 | Unclassified | 658 |
| 1870 | Ga0530510_0016362 | 3300061734 | Bacteria | 5248 |
| 1871 | Ga0530510_0036725 | 3300061734 | Bacteria | 3531 |
| 1872 | Ga0530510_0088199 | 3300061734 | Bacteria | 2260 |
| 1873 | Ga0530510_0195171 | 3300061734 | Unclassified | 1503 |
| 1874 | Ga0530510_0411334 | 3300061734 | Bacteria | 1020 |
| 1875 | Ga0530510_1282518 | 3300061734 | Unclassified | 562 |
| 1876 | Ga0395900_0219340 | |||
| 1877 | JGI24744J21845_10060472 | |||
| 1878 | JGI24034J26672_10070579 | |||
| 1879 | JGI24742J22300_10023254 | |||
| 1880 | rootH1_10088161 | |||
| 1881 | rootH1_10123228 | |||
| 1882 | JGI25407J50210_10145706 | |||
| 1883 | JGI25405J52794_10093891 | |||
| 1884 | Ga0070658_10016040 | |||
| 1885 | Ga0070658_10071183 | |||
| 1886 | Ga0070658_10092282 | |||
| 1887 | Ga0070658_10098885 | |||
| 1888 | Ga0070658_10248193 | |||
| 1889 | Ga0070658_10486786 | |||
| 1890 | Ga0070658_10608776 | |||
| 1891 | Ga0070658_10852836 | |||
| 1892 | Ga0070658_11426435 | |||
| 1893 | Ga0070676_11441949 | |||
| 1894 | Ga0070683_100003297 | |||
| 1895 | Ga0070683_100016747 | |||
| 1896 | Ga0070683_100069425 | |||
| 1897 | Ga0070683_100187814 | |||
| 1898 | Ga0070683_100217466 | |||
| 1899 | Ga0070683_100384919 | |||
| 1900 | Ga0070683_100453469 | |||
| 1901 | Ga0070683_100706519 | |||
| 1902 | Ga0070683_100957991 | |||
| 1903 | Ga0070683_101101856 | |||
| 1904 | Ga0070683_101593325 | |||
| 1905 | Ga0070683_101622317 | |||
| 1906 | Ga0070690_100093286 | |||
| 1907 | Ga0070670_100201731 | |||
| 1908 | Ga0070670_101837657 | |||
| 1909 | Ga0070677_10537699 | |||
| 1910 | Ga0070666_10725538 | |||
| 1911 | Ga0070680_100041318 | |||
| 1912 | Ga0070680_100073155 | |||
| 1913 | Ga0070680_100107739 | |||
| 1914 | Ga0070680_100153099 | |||
| 1915 | Ga0070680_100382902 | |||
| 1916 | Ga0070680_100433600 | |||
| 1917 | Ga0070680_100597787 | |||
| 1918 | Ga0070680_100614679 | |||
| 1919 | Ga0070680_101472557 | |||
| 1920 | Ga0070682_100008033 | |||
| 1921 | Ga0070682_100011913 | |||
| 1922 | Ga0070682_100140015 | |||
| 1923 | Ga0070682_100204361 | |||
| 1924 | Ga0070682_100583439 | |||
| 1925 | Ga0070682_100630025 | |||
| 1926 | Ga0070682_101481337 | |||
| 1927 | Ga0068868_100058188 | |||
| 1928 | Ga0068868_100059813 | |||
| 1929 | Ga0068868_100195298 | |||
| 1930 | Ga0068868_100208432 | |||
| 1931 | Ga0068868_100313275 | |||
| 1932 | Ga0070660_100006179 | |||
| 1933 | Ga0070660_100006340 | |||
| 1934 | Ga0070660_100019025 | |||
| 1935 | Ga0070660_100049000 | |||
| 1936 | Ga0070660_100053966 | |||
| 1937 | Ga0070660_100576591 | |||
| 1938 | Ga0070660_100579003 | |||
| 1939 | Ga0070660_100623911 | |||
| 1940 | Ga0070660_100653010 | |||
| 1941 | Ga0070660_100792180 | |||
| 1942 | Ga0070660_101636740 | |||
| 1943 | Ga0070689_100021517 | |||
| 1944 | Ga0070691_10005264 | |||
| 1945 | Ga0070691_10288227 | |||
| 1946 | Ga0070687_100233370 | |||
| 1947 | Ga0070687_100612511 | |||
| 1948 | Ga0070661_100002698 | |||
| 1949 | Ga0070661_100024528 | |||
| 1950 | Ga0070661_100032768 | |||
| 1951 | Ga0070661_100184776 | |||
| 1952 | Ga0070661_100239234 | |||
| 1953 | Ga0070661_100246963 | |||
| 1954 | Ga0070661_100465372 | |||
| 1955 | Ga0070661_100471181 | |||
| 1956 | Ga0070661_100485109 | |||
| 1957 | Ga0070661_100611922 | |||
| 1958 | Ga0070692_10024853 | |||
| 1959 | Ga0070692_10206319 | |||
| 1960 | Ga0070668_100032668 | |||
| 1961 | Ga0070668_101399040 | |||
| 1962 | Ga0070669_100105406 | |||
| 1963 | Ga0070675_100036438 | |||
| 1964 | Ga0070675_100731917 | |||
| 1965 | Ga0070675_100920607 | |||
| 1966 | Ga0070675_101131549 | |||
| 1967 | Ga0070671_100170323 | |||
| 1968 | Ga0070671_100567965 | |||
| 1969 | Ga0070671_101850570 | |||
| 1970 | Ga0070674_100108970 | |||
| 1971 | Ga0070674_100203027 | |||
| 1972 | Ga0070674_100496712 | |||
| 1973 | Ga0070674_100664772 | |||
| 1974 | Ga0070674_100683219 | |||
| 1975 | Ga0070674_101151166 | |||
| 1976 | Ga0070673_100179388 | |||
| 1977 | Ga0070673_100303062 | |||
| 1978 | Ga0070688_100132736 | |||
| 1979 | Ga0070659_100048745 | |||
| 1980 | Ga0070659_100090277 | |||
| 1981 | Ga0070659_100137994 | |||
| 1982 | Ga0070659_100268979 | |||
| 1983 | Ga0070659_100377470 | |||
| 1984 | Ga0070659_100556793 | |||
| 1985 | Ga0070659_101151062 | |||
| 1986 | Ga0070659_101324562 | |||
| 1987 | Ga0070659_101412871 | |||
| 1988 | Ga0070667_100851317 | |||
| 1989 | Ga0070709_10012572 | |||
| 1990 | Ga0070709_11573929 | |||
| 1991 | Ga0070714_100098934 | |||
| 1992 | Ga0070714_100130514 | |||
| 1993 | Ga0070714_100143950 | |||
| 1994 | Ga0070714_100224394 | |||
| 1995 | Ga0070714_100314709 | |||
| 1996 | Ga0070714_100342032 | |||
| 1997 | Ga0070714_100386341 | |||
| 1998 | Ga0070714_100655985 | |||
| 1999 | Ga0070714_100682127 | |||
| 2000 | Ga0070714_100915305 | |||
| 2001 | Ga0070713_100005633 | |||
| 2002 | Ga0070713_100231110 | |||
| 2003 | Ga0070713_100280432 | |||
| 2004 | Ga0070713_100326946 | |||
| 2005 | Ga0070713_100403459 | |||
| 2006 | Ga0070713_100465303 | |||
| 2007 | Ga0070713_100531479 | |||
| 2008 | Ga0070713_100938935 | |||
| 2009 | Ga0070713_101357593 | |||
| 2010 | Ga0070713_102240771 | |||
| 2011 | Ga0070710_10018740 | |||
| 2012 | Ga0070710_10290935 | |||
| 2013 | Ga0070710_10330810 | |||
| 2014 | Ga0070710_10575359 | |||
| 2015 | Ga0070710_11077429 | |||
| 2016 | Ga0070701_10041529 | |||
| 2017 | Ga0070701_10271170 | |||
| 2018 | Ga0070711_100006744 | |||
| 2019 | Ga0070711_100287240 | |||
| 2020 | Ga0070711_100476821 | |||
| 2021 | Ga0070711_100611666 | |||
| 2022 | Ga0070711_100761389 | |||
| 2023 | Ga0070711_101093843 | |||
| 2024 | Ga0070711_101770697 | |||
| 2025 | Ga0070711_101880465 | |||
| 2026 | Ga0070705_100080692 | |||
| 2027 | Ga0070705_101596276 | |||
| 2028 | Ga0070700_100040120 | |||
| 2029 | Ga0070694_100023433 | |||
| 2030 | Ga0070694_100079789 | |||
| 2031 | Ga0070708_100467683 | |||
| 2032 | Ga0070708_100495288 | |||
| 2033 | Ga0070708_100895718 | |||
| 2034 | Ga0070708_101378864 | |||
| 2035 | Ga0070663_100078961 | |||
| 2036 | Ga0070663_100522326 | |||
| 2037 | Ga0070663_100656783 | |||
| 2038 | Ga0070663_100740155 | |||
| 2039 | Ga0070663_100820686 | |||
| 2040 | Ga0070663_100945173 | |||
| 2041 | Ga0070663_101415188 | |||
| 2042 | Ga0070663_101843643 | |||
| 2043 | Ga0070678_100073123 | |||
| 2044 | Ga0070678_100199702 | |||
| 2045 | Ga0070678_100272808 | |||
| 2046 | Ga0070678_100773283 | |||
| 2047 | Ga0070678_100783034 | |||
| 2048 | Ga0070662_100004795 | |||
| 2049 | Ga0070662_100059662 | |||
| 2050 | Ga0070662_100166555 | |||
| 2051 | Ga0070662_100893283 | |||
| 2052 | Ga0070681_10001709 | |||
| 2053 | Ga0070681_10008931 | |||
| 2054 | Ga0070681_10097777 | |||
| 2055 | Ga0070681_10116678 | |||
| 2056 | Ga0070681_10145227 | |||
| 2057 | Ga0070681_10156623 | |||
| 2058 | Ga0070681_10277901 | |||
| 2059 | Ga0070681_10305474 | |||
| 2060 | Ga0070681_10401722 | |||
| 2061 | Ga0070681_11179128 | |||
| 2062 | Ga0068867_100186236 | |||
| 2063 | Ga0070685_10033217 | |||
| 2064 | Ga0070706_100016897 | |||
| 2065 | Ga0070706_100299789 | |||
| 2066 | Ga0070706_100373109 | |||
| 2067 | Ga0070706_100866528 | |||
| 2068 | Ga0070707_100001116 | |||
| 2069 | Ga0070707_100068961 | |||
| 2070 | Ga0070707_100655848 | |||
| 2071 | Ga0070707_100848147 | |||
| 2072 | Ga0070698_100031926 | |||
| 2073 | Ga0070698_100045050 | |||
| 2074 | Ga0070698_100068838 | |||
| 2075 | Ga0070698_100072305 | |||
| 2076 | Ga0070698_100578955 | |||
| 2077 | Ga0070698_100897443 | |||
| 2078 | Ga0070698_101212677 | |||
| 2079 | Ga0070699_100186910 | |||
| 2080 | Ga0070699_100370696 | |||
| 2081 | Ga0070699_100472617 | |||
| 2082 | Ga0070699_100637952 | |||
| 2083 | Ga0070699_100847821 | |||
| 2084 | Ga0070699_101763869 | |||
| 2085 | Ga0070679_100009015 | |||
| 2086 | Ga0070679_100048061 | |||
| 2087 | Ga0070679_100053369 | |||
| 2088 | Ga0070679_100067233 | |||
| 2089 | Ga0070679_100071325 | |||
| 2090 | Ga0070679_100121152 | |||
| 2091 | Ga0070679_100143070 | |||
| 2092 | Ga0070679_100348594 | |||
| 2093 | Ga0070679_100623649 | |||
| 2094 | Ga0070679_100744792 | |||
| 2095 | Ga0070679_100824911 | |||
| 2096 | Ga0070679_101101705 | |||
| 2097 | Ga0070679_101304481 | |||
| 2098 | Ga0070679_101311044 | |||
| 2099 | Ga0070679_101369575 | |||
| 2100 | Ga0070679_101818370 | |||
| 2101 | Ga0070684_100001346 | |||
| 2102 | Ga0070684_100003380 | |||
| 2103 | Ga0070684_100053716 | |||
| 2104 | Ga0070684_100108551 | |||
| 2105 | Ga0070684_100250311 | |||
| 2106 | Ga0070684_100428355 | |||
| 2107 | Ga0070684_100496145 | |||
| 2108 | Ga0070684_100625416 | |||
| 2109 | Ga0070684_100633781 | |||
| 2110 | Ga0070684_101016851 | |||
| 2111 | Ga0070697_101956650 | |||
| 2112 | Ga0068853_100168512 | |||
| 2113 | Ga0068853_100475111 | |||
| 2114 | Ga0068853_100656223 | |||
| 2115 | Ga0068853_100709751 | |||
| 2116 | Ga0068853_100835890 | |||
| 2117 | Ga0068853_100919773 | |||
| 2118 | Ga0068853_101602356 | |||
| 2119 | Ga0070672_100013324 | |||
| 2120 | Ga0070672_100095092 | |||
| 2121 | Ga0070672_100553620 | |||
| 2122 | Ga0070686_100019696 | |||
| 2123 | Ga0070695_100000005 | |||
| 2124 | Ga0070695_100011656 | |||
| 2125 | Ga0070695_100841576 | |||
| 2126 | Ga0070695_100991516 | |||
| 2127 | Ga0070696_100166395 | |||
| 2128 | Ga0070696_100510140 | |||
| 2129 | Ga0070693_100004489 | |||
| 2130 | Ga0070693_100129487 | |||
| 2131 | Ga0070693_100150667 | |||
| 2132 | Ga0070693_100517621 | |||
| 2133 | Ga0070665_100593888 | |||
| 2134 | Ga0070665_101101562 | |||
| 2135 | Ga0070665_101334748 | |||
| 2136 | Ga0070704_100025533 | |||
| 2137 | Ga0070704_100377249 | |||
| 2138 | Ga0070704_100858345 | |||
| 2139 | Ga0068855_100015403 | |||
| 2140 | Ga0068855_100235191 | |||
| 2141 | Ga0068855_100408025 | |||
| 2142 | Ga0068855_100484169 | |||
| 2143 | Ga0068855_100725644 | |||
| 2144 | Ga0068855_101092612 | |||
| 2145 | Ga0068855_101315071 | |||
| 2146 | Ga0068855_102062283 | |||
| 2147 | Ga0070664_100299077 | |||
| 2148 | Ga0070664_101980440 | |||
| 2149 | Ga0068857_100163799 | |||
| 2150 | Ga0068857_100400219 | |||
| 2151 | Ga0068857_100608132 | |||
| 2152 | Ga0068857_100995106 | |||
| 2153 | Ga0068857_101579600 | |||
| 2154 | Ga0068857_101914792 | |||
| 2155 | Ga0068854_100037494 | |||
| 2156 | Ga0068854_100538973 | |||
| 2157 | Ga0068854_101583529 | |||
| 2158 | Ga0068854_101634330 | |||
| 2159 | Ga0068856_100034463 | |||
| 2160 | Ga0068856_100098033 | |||
| 2161 | Ga0068856_100120218 | |||
| 2162 | Ga0068856_100331366 | |||
| 2163 | Ga0068856_100368886 | |||
| 2164 | Ga0068856_100658363 | |||
| 2165 | Ga0068856_100701143 | |||
| 2166 | Ga0068856_101121585 | |||
| 2167 | Ga0068856_101939767 | |||
| 2168 | Ga0070702_100286244 | |||
| 2169 | Ga0068852_100063458 | |||
| 2170 | Ga0068852_100400716 | |||
| 2171 | Ga0068852_100428481 | |||
| 2172 | Ga0068852_102136329 | |||
| 2173 | Ga0068859_100269591 | |||
| 2174 | Ga0068864_100269034 | |||
| 2175 | Ga0068864_101440182 | |||
| 2176 | Ga0068866_10045682 | |||
| 2177 | Ga0068866_10305028 | |||
| 2178 | Ga0068866_10365597 | |||
| 2179 | Ga0068866_10368733 | |||
| 2180 | Ga0068861_100074770 | |||
| 2181 | Ga0068851_10002070 | |||
| 2182 | Ga0068863_100086259 | |||
| 2183 | Ga0068863_100288516 | |||
| 2184 | Ga0068858_100085497 | |||
| 2185 | Ga0068858_102094484 | |||
| 2186 | Ga0068860_100067666 | |||
| 2187 | Ga0068860_100517562 | |||
| 2188 | Ga0068862_100330463 | |||
| 2189 | Ga0081455_10003816 | |||
| 2190 | Ga0081455_10006745 | |||
| 2191 | Ga0081455_10024297 | |||
| 2192 | Ga0081455_10050355 | |||
| 2193 | Ga0081455_10063627 | |||
| 2194 | Ga0081455_10132784 | |||
| 2195 | Ga0081538_10007043 | |||
| 2196 | Ga0081539_10097199 | |||
| 2197 | Ga0081539_10115576 | |||
| 2198 | Ga0070717_10003220 | |||
| 2199 | Ga0070717_10012743 | |||
| 2200 | Ga0070717_10030743 | |||
| 2201 | Ga0070717_10170919 | |||
| 2202 | Ga0070717_10221896 | |||
| 2203 | Ga0070717_10259625 | |||
| 2204 | Ga0070717_10357267 | |||
| 2205 | Ga0070717_11244775 | |||
| 2206 | Ga0075365_10010226 | |||
| 2207 | Ga0075365_10153559 | |||
| 2208 | Ga0075368_10267828 | |||
| 2209 | Ga0075363_100240246 | |||
| 2210 | Ga0075364_10524643 | |||
| 2211 | Ga0075364_10775196 | |||
| 2212 | Ga0075364_10841228 | |||
| 2213 | Ga0075432_10040899 | |||
| 2214 | Ga0075432_10192675 | |||
| 2215 | Ga0070715_10031348 | |||
| 2216 | Ga0070715_10324433 | |||
| 2217 | Ga0070716_100003399 | |||
| 2218 | Ga0070716_100287821 | |||
| 2219 | Ga0070716_100403003 | |||
| 2220 | Ga0070716_100503260 | |||
| 2221 | Ga0070716_101816962 | |||
| 2222 | Ga0070712_100081747 | |||
| 2223 | Ga0070712_100305097 | |||
| 2224 | Ga0070712_100436581 | |||
| 2225 | Ga0070712_100465396 | |||
| 2226 | Ga0070712_101222068 | |||
| 2227 | Ga0070712_101392229 | |||
| 2228 | Ga0070712_101685356 | |||
| 2229 | Ga0070712_101982486 | |||
| 2230 | Ga0075367_10408568 | |||
| 2231 | Ga0075367_10685351 | |||
| 2232 | Ga0075427_10081102 | |||
| 2233 | Ga0097621_100071797 | |||
| 2234 | Ga0097621_100499444 | |||
| 2235 | Ga0097621_101178287 | |||
| 2236 | Ga0068871_100111316 | |||
| 2237 | Ga0068871_101112090 | |||
| 2238 | Ga0068871_101332491 | |||
| 2239 | Ga0075431_100151018 | |||
| 2240 | Ga0075431_101011051 | |||
| 2241 | Ga0075433_10047993 | |||
| 2242 | Ga0075433_10055599 | |||
| 2243 | Ga0075433_10129823 | |||
| 2244 | Ga0075433_10179494 | |||
| 2245 | Ga0075433_10321564 | |||
| 2246 | Ga0075433_10478564 | |||
| 2247 | Ga0075433_10478665 | |||
| 2248 | Ga0075433_10577305 | |||
| 2249 | Ga0075433_11223287 | |||
| 2250 | Ga0075434_100003166 | |||
| 2251 | Ga0075434_100016920 | |||
| 2252 | Ga0075434_100153440 | |||
| 2253 | Ga0075434_100221740 | |||
| 2254 | Ga0075434_100266345 | |||
| 2255 | Ga0075434_100302477 | |||
| 2256 | Ga0075434_100599381 | |||
| 2257 | Ga0075434_101055084 | |||
| 2258 | Ga0075434_101113124 | |||
| 2259 | Ga0075429_100545619 | |||
| 2260 | Ga0068865_100069957 | |||
| 2261 | Ga0068865_100191110 | |||
| 2262 | Ga0068865_101170725 | |||
| 2263 | Ga0075436_100015420 | |||
| 2264 | Ga0075436_100199176 | |||
| 2265 | Ga0075436_100242960 | |||
| 2266 | Ga0075436_100470264 | |||
| 2267 | Ga0075436_100702882 | |||
| 2268 | Ga0075436_101143891 | |||
| 2269 | Ga0097620_100269570 | |||
| 2270 | Ga0075435_100002887 | |||
| 2271 | Ga0075435_100024812 | |||
| 2272 | Ga0075435_100538495 | |||
| 2273 | Ga0075435_100576966 | |||
| 2274 | Ga0075435_100916597 | |||
| 2275 | Ga0075435_101127506 | |||
| 2276 | Ga0099795_10163697 | |||
| 2277 | Ga0105244_10453584 | |||
| 2278 | Ga0105240_10057664 | |||
| 2279 | Ga0105240_10081524 | |||
| 2280 | Ga0105240_10188879 | |||
| 2281 | Ga0105240_10320364 | |||
| 2282 | Ga0105240_10437306 | |||
| 2283 | Ga0105240_11463306 | |||
| 2284 | Ga0105240_12258862 | |||
| 2285 | Ga0105240_12697635 | |||
| 2286 | Ga0111539_10181783 | |||
| 2287 | Ga0111539_10414434 | |||
| 2288 | Ga0111539_10595014 | |||
| 2289 | Ga0111539_10649507 | |||
| 2290 | Ga0111539_10733701 | |||
| 2291 | Ga0111539_10898619 | |||
| 2292 | Ga0111539_11624889 | |||
| 2293 | Ga0105245_10028407 | |||
| 2294 | Ga0105245_10042251 | |||
| 2295 | Ga0105245_10105558 | |||
| 2296 | Ga0105245_10324044 | |||
| 2297 | Ga0105245_10526847 | |||
| 2298 | Ga0105245_10754483 | |||
| 2299 | Ga0105245_11080129 | |||
| 2300 | Ga0105245_13284950 | |||
| 2301 | Ga0105247_10146499 | |||
| 2302 | Ga0105247_10478840 | |||
| 2303 | Ga0114129_10017839 | |||
| 2304 | Ga0114129_10040101 | |||
| 2305 | Ga0114129_10323206 | |||
| 2306 | Ga0114129_11018950 | |||
| 2307 | Ga0114129_11288816 | |||
| 2308 | Ga0114129_11708312 | |||
| 2309 | Ga0105243_10048038 | |||
| 2310 | Ga0105243_10439161 | |||
| 2311 | Ga0105243_11133986 | |||
| 2312 | Ga0105241_10419178 | |||
| 2313 | Ga0105241_10476533 | |||
| 2314 | Ga0105241_10992912 | |||
| 2315 | Ga0105241_11078927 | |||
| 2316 | Ga0105241_11083456 | |||
| 2317 | Ga0105241_12253919 | |||
| 2318 | Ga0105241_12365976 | |||
| 2319 | Ga0105242_10028905 | |||
| 2320 | Ga0105242_10047642 | |||
| 2321 | Ga0105242_10308279 | |||
| 2322 | Ga0105242_10598492 | |||
| 2323 | Ga0105242_10743469 | |||
| 2324 | Ga0105242_10837481 | |||
| 2325 | Ga0105242_10954724 | |||
| 2326 | Ga0105242_11549173 | |||
| 2327 | Ga0105242_11756877 | |||
| 2328 | Ga0105242_12807429 | |||
| 2329 | Ga0105248_10075747 | |||
| 2330 | Ga0105248_10545490 | |||
| 2331 | Ga0105248_10712017 | |||
| 2332 | Ga0105248_11063767 | |||
| 2333 | Ga0105248_11768615 | |||
| 2334 | Ga0105237_10047231 | |||
| 2335 | Ga0105237_10130509 | |||
| 2336 | Ga0105237_10522395 | |||
| 2337 | Ga0105237_10771175 | |||
| 2338 | Ga0105237_10817692 | |||
| 2339 | Ga0105238_10027833 | |||
| 2340 | Ga0105238_10151827 | |||
| 2341 | Ga0105238_11111453 | |||
| 2342 | Ga0105238_11619344 | |||
| 2343 | Ga0105238_12457276 | |||
| 2344 | Ga0105249_10303992 | |||
| 2345 | Ga0105239_10103161 | |||
| 2346 | Ga0105239_10301886 | |||
| 2347 | Ga0105239_10364199 | |||
| 2348 | Ga0105239_10739199 | |||
| 2349 | Ga0105239_10742900 | |||
| 2350 | Ga0105239_10895491 | |||
| 2351 | Ga0105239_11018423 | |||
| 2352 | Ga0105239_11877208 | |||
| 2353 | Ga0105239_12861347 | |||
| 2354 | Ga0105246_10113015 | |||
| 2355 | Ga0105246_10233583 | |||
| 2356 | Ga0105246_11114392 | |||
| 2357 | Ga0157346_1024578 | |||
| 2358 | Ga0157324_1038236 | |||
| 2359 | Ga0157338_1044070 | |||
| 2360 | Ga0157373_10010996 | |||
| 2361 | Ga0157373_10141077 | |||
| 2362 | Ga0157373_10336502 | |||
| 2363 | Ga0157373_10363929 | |||
| 2364 | Ga0157373_10716935 | |||
| 2365 | Ga0157373_11044154 | |||
| 2366 | Ga0157373_11132765 | |||
| 2367 | Ga0157371_10088302 | |||
| 2368 | Ga0157371_10139338 | |||
| 2369 | Ga0157371_10263741 | |||
| 2370 | Ga0157371_10296538 | |||
| 2371 | Ga0157371_10628739 | |||
| 2372 | Ga0157371_10846475 | |||
| 2373 | Ga0157371_11154395 | |||
| 2374 | Ga0157370_10025355 | |||
| 2375 | Ga0157370_10061119 | |||
| 2376 | Ga0157370_10104600 | |||
| 2377 | Ga0157370_10435297 | |||
| 2378 | Ga0157370_10987783 | |||
| 2379 | Ga0157370_11832993 | |||
| 2380 | Ga0157370_11853130 | |||
| 2381 | Ga0157370_12117357 | |||
| 2382 | Ga0157369_10005226 | |||
| 2383 | Ga0157369_10018754 | |||
| 2384 | Ga0157369_10066593 | |||
| 2385 | Ga0157369_10539134 | |||
| 2386 | Ga0157369_10543737 | |||
| 2387 | Ga0157369_10607392 | |||
| 2388 | Ga0157369_10630602 | |||
| 2389 | Ga0157369_10704940 | |||
| 2390 | Ga0157369_10876624 | |||
| 2391 | Ga0157369_11347793 | |||
| 2392 | Ga0157369_11696909 | |||
| 2393 | Ga0157369_12290967 | |||
| 2394 | Ga0157369_12686523 | |||
| 2395 | Ga0157369_12703630 | |||
| 2396 | Ga0157374_10041383 | |||
| 2397 | Ga0157374_10123570 | |||
| 2398 | Ga0157374_10235158 | |||
| 2399 | Ga0157374_10301590 | |||
| 2400 | Ga0157374_10478136 | |||
| 2401 | Ga0157374_10742852 | |||
| 2402 | Ga0157378_10465749 | |||
| 2403 | Ga0163162_10107256 | |||
| 2404 | Ga0163162_11593837 | |||
| 2405 | Ga0163162_11839419 | |||
| 2406 | Ga0157372_10029009 | |||
| 2407 | Ga0157372_10052833 | |||
| 2408 | Ga0157372_10098883 | |||
| 2409 | Ga0157372_10109124 | |||
| 2410 | Ga0157372_10214049 | |||
| 2411 | Ga0157372_10600515 | |||
| 2412 | Ga0157372_10634624 | |||
| 2413 | Ga0157372_10803600 | |||
| 2414 | Ga0157372_10921036 | |||
| 2415 | Ga0157372_11369122 | |||
| 2416 | Ga0157375_10116806 | |||
| 2417 | Ga0157375_10133720 | |||
| 2418 | Ga0157375_10158611 | |||
| 2419 | Ga0157375_10331494 | |||
| 2420 | Ga0157375_10580280 | |||
| 2421 | Ga0157375_11949213 | |||
| 2422 | Ga0157375_12668505 | |||
| 2423 | Ga0163163_10407054 | |||
| 2424 | Ga0163163_10499640 | |||
| 2425 | Ga0163163_12915226 | |||
| 2426 | Ga0157380_10199713 | |||
| 2427 | Ga0157380_10407620 | |||
| 2428 | Ga0182008_10014973 | |||
| 2429 | Ga0182008_10069125 | |||
| 2430 | Ga0182008_10148894 | |||
| 2431 | Ga0182008_10222777 | |||
| 2432 | Ga0182008_10679698 | |||
| 2433 | Ga0157377_10002430 | |||
| 2434 | Ga0157377_10093953 | |||
| 2435 | Ga0157377_10372596 | |||
| 2436 | Ga0157377_11212345 | |||
| 2437 | Ga0157377_11439542 | |||
| 2438 | Ga0157379_10022388 | |||
| 2439 | Ga0157379_11305138 | |||
| 2440 | Ga0157376_10043518 | |||
| 2441 | Ga0157376_10293133 | |||
| 2442 | Ga0157376_10593473 | |||
| 2443 | Ga0157376_10947761 | |||
| 2444 | Ga0157376_12079708 | |||
| 2445 | Ga0182007_10029036 | |||
| 2446 | Ga0182007_10088733 | |||
| 2447 | Ga0182007_10199042 | |||
| 2448 | Ga0182005_1076383 | |||
| 2449 | Ga0163161_10201836 | |||
| 2450 | Ga0163161_10441741 | |||
| 2451 | Ga0163161_10581101 | |||
| 2452 | Ga0197907_10233942 | |||
| 2453 | Ga0206356_10189341 | |||
| 2454 | Ga0206356_11742642 | |||
| 2455 | Ga0206356_11809610 | |||
| 2456 | Ga0206354_10447037 | |||
| 2457 | Ga0206353_11320045 | |||
| 2458 | Ga0206353_11345779 | |||
| 2459 | Ga0206353_11436958 | |||
| 2460 | Ga0206353_11607184 | |||
| 2461 | Ga0206353_11883755 | |||
| 2462 | Ga0206353_11898338 | |||
| 2463 | Ga0224712_10191935 | |||
| 2464 | Ga0224712_10332345 | |||
| 2465 | Ga0207656_10017665 | |||
| 2466 | Ga0207653_10179811 | |||
| 2467 | Ga0207682_10033355 | |||
| 2468 | Ga0207692_10005396 | |||
| 2469 | Ga0207692_10076680 | |||
| 2470 | Ga0207692_10238876 | |||
| 2471 | Ga0207692_10442569 | |||
| 2472 | Ga0207692_10730138 | |||
| 2473 | Ga0207692_11087151 | |||
| 2474 | Ga0207710_10089088 | |||
| 2475 | Ga0207688_10222435 | |||
| 2476 | Ga0207680_10112914 | |||
| 2477 | Ga0207647_10016364 | |||
| 2478 | Ga0207685_10065257 | |||
| 2479 | Ga0207685_10266185 | |||
| 2480 | Ga0207699_10320295 | |||
| 2481 | Ga0207699_11285782 | |||
| 2482 | Ga0207643_10006034 | |||
| 2483 | Ga0207643_10520256 | |||
| 2484 | Ga0207705_10015501 | |||
| 2485 | Ga0207705_10074709 | |||
| 2486 | Ga0207705_10106216 | |||
| 2487 | Ga0207705_10297523 | |||
| 2488 | Ga0207705_10724396 | |||
| 2489 | Ga0207684_10159662 | |||
| 2490 | Ga0207684_10312493 | |||
| 2491 | Ga0207684_10414598 | |||
| 2492 | Ga0207684_10869513 | |||
| 2493 | Ga0207684_11068054 | |||
| 2494 | Ga0207654_10620749 | |||
| 2495 | Ga0207654_11176646 | |||
| 2496 | Ga0207654_11196207 | |||
| 2497 | Ga0207707_10002693 | |||
| 2498 | Ga0207707_10019284 | |||
| 2499 | Ga0207707_10024829 | |||
| 2500 | Ga0207707_10043277 | |||
| 2501 | Ga0207707_10133634 | |||
| 2502 | Ga0207707_10241385 | |||
| 2503 | Ga0207707_10290268 | |||
| 2504 | Ga0207707_10317937 | |||
| 2505 | Ga0207707_10379297 | |||
| 2506 | Ga0207707_10475707 | |||
| 2507 | Ga0207695_10016817 | |||
| 2508 | Ga0207695_10046432 | |||
| 2509 | Ga0207695_10467342 | |||
| 2510 | Ga0207695_10949713 | |||
| 2511 | Ga0207695_11461432 | |||
| 2512 | Ga0207695_11538915 | |||
| 2513 | Ga0207671_10205800 | |||
| 2514 | Ga0207671_10479120 | |||
| 2515 | Ga0207671_10828349 | |||
| 2516 | Ga0207671_11039773 | |||
| 2517 | Ga0207693_10000807 | |||
| 2518 | Ga0207693_10157081 | |||
| 2519 | Ga0207693_10277724 | |||
| 2520 | Ga0207693_10802466 | |||
| 2521 | Ga0207693_11005022 | |||
| 2522 | Ga0207693_11182004 | |||
| 2523 | Ga0207663_10003697 | |||
| 2524 | Ga0207663_10408305 | |||
| 2525 | Ga0207663_10525705 | |||
| 2526 | Ga0207663_11039070 | |||
| 2527 | Ga0207660_10022356 | |||
| 2528 | Ga0207660_10069045 | |||
| 2529 | Ga0207660_10105664 | |||
| 2530 | Ga0207660_10128420 | |||
| 2531 | Ga0207660_10136161 | |||
| 2532 | Ga0207660_10306774 | |||
| 2533 | Ga0207660_10331251 | |||
| 2534 | Ga0207660_11188416 | |||
| 2535 | Ga0207660_11382918 | |||
| 2536 | Ga0207660_11473573 | |||
| 2537 | Ga0207660_11555118 | |||
| 2538 | Ga0207662_10125436 | |||
| 2539 | Ga0207657_10017815 | |||
| 2540 | Ga0207657_10024580 | |||
| 2541 | Ga0207657_10042137 | |||
| 2542 | Ga0207657_10059280 | |||
| 2543 | Ga0207657_10098078 | |||
| 2544 | Ga0207657_10399085 | |||
| 2545 | Ga0207657_10526261 | |||
| 2546 | Ga0207657_10535166 | |||
| 2547 | Ga0207649_10026908 | |||
| 2548 | Ga0207649_10037316 | |||
| 2549 | Ga0207649_10243880 | |||
| 2550 | Ga0207649_10491678 | |||
| 2551 | Ga0207649_10846362 | |||
| 2552 | Ga0207652_10010839 | |||
| 2553 | Ga0207652_10042313 | |||
| 2554 | Ga0207652_10047170 | |||
| 2555 | Ga0207652_10094302 | |||
| 2556 | Ga0207652_10194339 | |||
| 2557 | Ga0207652_10205165 | |||
| 2558 | Ga0207652_10260921 | |||
| 2559 | Ga0207652_10278035 | |||
| 2560 | Ga0207652_10334461 | |||
| 2561 | Ga0207652_10375781 | |||
| 2562 | Ga0207652_10526498 | |||
| 2563 | Ga0207652_10634302 | |||
| 2564 | Ga0207652_11042058 | |||
| 2565 | Ga0207652_11477949 | |||
| 2566 | Ga0207652_11670619 | |||
| 2567 | Ga0207646_10001597 | |||
| 2568 | Ga0207646_10198651 | |||
| 2569 | Ga0207646_10340023 | |||
| 2570 | Ga0207646_10341241 | |||
| 2571 | Ga0207646_10364212 | |||
| 2572 | Ga0207681_11025098 | |||
| 2573 | Ga0207694_11344464 | |||
| 2574 | Ga0207650_10121084 | |||
| 2575 | Ga0207650_10470409 | |||
| 2576 | Ga0207659_10211288 | |||
| 2577 | Ga0207659_10781151 | |||
| 2578 | Ga0207659_10982593 | |||
| 2579 | Ga0207687_10017154 | |||
| 2580 | Ga0207687_10061467 | |||
| 2581 | Ga0207687_10231625 | |||
| 2582 | Ga0207687_10242276 | |||
| 2583 | Ga0207687_10285810 | |||
| 2584 | Ga0207687_10445443 | |||
| 2585 | Ga0207687_10503622 | |||
| 2586 | Ga0207687_11922570 | |||
| 2587 | Ga0207700_10006860 | |||
| 2588 | Ga0207700_10046588 | |||
| 2589 | Ga0207700_10185271 | |||
| 2590 | Ga0207700_10356422 | |||
| 2591 | Ga0207700_10643370 | |||
| 2592 | Ga0207700_10901806 | |||
| 2593 | Ga0207700_10977963 | |||
| 2594 | Ga0207664_10001655 | |||
| 2595 | Ga0207664_10004892 | |||
| 2596 | Ga0207664_10007705 | |||
| 2597 | Ga0207664_10024336 | |||
| 2598 | Ga0207664_10050473 | |||
| 2599 | Ga0207664_10169528 | |||
| 2600 | Ga0207664_10205175 | |||
| 2601 | Ga0207664_10466589 | |||
| 2602 | Ga0207664_10510287 | |||
| 2603 | Ga0207664_10710401 | |||
| 2604 | Ga0207664_10999750 | |||
| 2605 | Ga0207664_11726434 | |||
| 2606 | Ga0207644_10024356 | |||
| 2607 | Ga0207644_10104847 | |||
| 2608 | Ga0207690_10124679 | |||
| 2609 | Ga0207690_10146088 | |||
| 2610 | Ga0207690_10172485 | |||
| 2611 | Ga0207690_10293764 | |||
| 2612 | Ga0207690_10543954 | |||
| 2613 | Ga0207690_11557826 | |||
| 2614 | Ga0207706_10003547 | |||
| 2615 | Ga0207706_10094287 | |||
| 2616 | Ga0207706_10381560 | |||
| 2617 | Ga0207686_10031844 | |||
| 2618 | Ga0207686_10178089 | |||
| 2619 | Ga0207686_10196473 | |||
| 2620 | Ga0207686_10253179 | |||
| 2621 | Ga0207686_10274344 | |||
| 2622 | Ga0207686_10481988 | |||
| 2623 | Ga0207686_10596909 | |||
| 2624 | Ga0207709_10030731 | |||
| 2625 | Ga0207709_10476864 | |||
| 2626 | Ga0207670_10456364 | |||
| 2627 | Ga0207669_10227965 | |||
| 2628 | Ga0207669_10588022 | |||
| 2629 | Ga0207704_10021048 | |||
| 2630 | Ga0207704_10771379 | |||
| 2631 | Ga0207665_10000058 | |||
| 2632 | Ga0207665_10095284 | |||
| 2633 | Ga0207665_11310218 | |||
| 2634 | Ga0207691_10012302 | |||
| 2635 | Ga0207691_11454386 | |||
| 2636 | Ga0207711_10260493 | |||
| 2637 | Ga0207711_11270147 | |||
| 2638 | Ga0207711_11723963 | |||
| 2639 | Ga0207689_10096218 | |||
| 2640 | Ga0207661_10025485 | |||
| 2641 | Ga0207661_10086505 | |||
| 2642 | Ga0207661_10174014 | |||
| 2643 | Ga0207661_10211823 | |||
| 2644 | Ga0207661_10247845 | |||
| 2645 | Ga0207661_10371899 | |||
| 2646 | Ga0207661_10383848 | |||
| 2647 | Ga0207661_10596686 | |||
| 2648 | Ga0207661_10701666 | |||
| 2649 | Ga0207661_10945333 | |||
| 2650 | Ga0207661_11168512 | |||
| 2651 | Ga0207661_11281818 | |||
| 2652 | Ga0207661_11730815 | |||
| 2653 | Ga0207679_10429434 | |||
| 2654 | Ga0207679_10554703 | |||
| 2655 | Ga0207667_10133328 | |||
| 2656 | Ga0207667_10164331 | |||
| 2657 | Ga0207667_10281218 | |||
| 2658 | Ga0207667_10589790 | |||
| 2659 | Ga0207667_10603893 | |||
| 2660 | Ga0207667_10612792 | |||
| 2661 | Ga0207667_10639459 | |||
| 2662 | Ga0207667_10640368 | |||
| 2663 | Ga0207667_10653118 | |||
| 2664 | Ga0207667_12155362 | |||
| 2665 | Ga0207651_10079436 | |||
| 2666 | Ga0207651_10619703 | |||
| 2667 | Ga0207651_10657250 | |||
| 2668 | Ga0207651_11653224 | |||
| 2669 | Ga0207712_10299351 | |||
| 2670 | Ga0207712_11957089 | |||
| 2671 | Ga0207668_11030750 | |||
| 2672 | Ga0207640_10952795 | |||
| 2673 | Ga0207677_10024006 | |||
| 2674 | Ga0207677_10069121 | |||
| 2675 | Ga0207677_10185740 | |||
| 2676 | Ga0207677_10438548 | |||
| 2677 | Ga0207677_11775233 | |||
| 2678 | Ga0207703_10366857 | |||
| 2679 | Ga0207639_10499351 | |||
| 2680 | Ga0207639_10499737 | |||
| 2681 | Ga0207639_10542236 | |||
| 2682 | Ga0207639_11109540 | |||
| 2683 | Ga0207639_11139616 | |||
| 2684 | Ga0207678_10017827 | |||
| 2685 | Ga0207678_10177153 | |||
| 2686 | Ga0207678_10520402 | |||
| 2687 | Ga0207678_10925787 | |||
| 2688 | Ga0207708_10018132 | |||
| 2689 | Ga0207708_11857428 | |||
| 2690 | Ga0207702_10065774 | |||
| 2691 | Ga0207702_10655458 | |||
| 2692 | Ga0207702_11665191 | |||
| 2693 | Ga0207702_11843226 | |||
| 2694 | Ga0207702_12121978 | |||
| 2695 | Ga0207702_12171510 | |||
| 2696 | Ga0207641_11173680 | |||
| 2697 | Ga0207648_12039289 | |||
| 2698 | Ga0207676_10495787 | |||
| 2699 | Ga0207676_10593997 | |||
| 2700 | Ga0207674_10175430 | |||
| 2701 | Ga0207674_10965545 | |||
| 2702 | Ga0207674_11119598 | |||
| 2703 | Ga0207675_101032618 | |||
| 2704 | Ga0207683_10120605 | |||
| 2705 | Ga0207683_10128451 | |||
| 2706 | Ga0207683_10381720 | |||
| 2707 | Ga0207683_10402075 | |||
| 2708 | Ga0207683_11385378 | |||
| 2709 | Ga0207698_10189992 | |||
| 2710 | Ga0207698_10351923 | |||
| 2711 | Ga0207698_10491629 | |||
| 2712 | Ga0207698_11875972 | |||
| 2713 | Ga0207698_12273785 | |||
| 2714 | Ga0207698_12755562 | |||
| 2715 | Ga0207428_10010424 | |||
| 2716 | Ga0207428_10297953 | |||
| 2717 | Ga0207428_10829773 | |||
| 2718 | Ga0268266_11067221 | |||
| 2719 | Ga0268266_11876895 | |||
| 2720 | Ga0268265_10122129 | |||
| 2721 | Ga0268264_10809964 | |||
| 2722 | Ga0265337_1044913 | |||
| 2723 | Ga0265334_10057501 | |||
| 2724 | Ga0265338_10004996 | |||
| 2725 | Ga0265338_10006808 | |||
| 2726 | Ga0265338_10013277 | |||
| 2727 | Ga0265338_10044909 | |||
| 2728 | Ga0265338_10099951 | |||
| 2729 | Ga0265324_10020811 | |||
| 2730 | Ga0265324_10180695 | |||
| 2731 | Ga0265339_10540141 | |||
| 2732 | Ga0265316_11048385 | |||
| 2733 | Ga0307408_100039441 | |||
| 2734 | Ga0307408_101829322 | |||
| 2735 | Ga0307408_102115621 | |||
| 2736 | Ga0265313_10013075 | |||
| 2737 | Ga0265314_10309812 | |||
| 2738 | Ga0265342_10065462 | |||
| 2739 | Ga0307413_10146469 | |||
| 2740 | Ga0307413_10336102 | |||
| 2741 | Ga0307410_10327200 | |||
| 2742 | Ga0307407_10541021 | |||
| 2743 | Ga0307407_10615959 | |||
| 2744 | Ga0307412_10054635 | |||
| 2745 | Ga0307412_10245312 | |||
| 2746 | Ga0307409_100249739 | |||
| 2747 | Ga0307409_100512483 | |||
| 2748 | Ga0307416_100023941 | |||
| 2749 | Ga0307416_100076000 | |||
| 2750 | Ga0307411_10764275 | |||
| 2751 | Ga0307411_11694983 | |||
| 2752 | Ga0307415_100005444 | |||
| 2753 | Ga0307415_100200016 | |||
| 2754 | Ga0307415_100697744 | |||
| 2755 | Ga0307415_101011768 | |||
| 2756 | Ga0307415_101769269 | |||
| 2757 | Ga0316583_10211566 | |||
| 2758 | Ga0373930_0005553 | |||
| 2759 | Ga0373930_0166096 | |||
| 2760 | Ga0373948_0060567 | |||
| 2761 | Ga0373958_0107283 | |||
| 2762 | Ga0373938_0075782 | |||
| 2763 | Ga0373926_0020948 | |||
| 2764 | Ga0373926_0460281 | |||
| 2765 | Ga0373928_0112426 | |||
| 2766 | Ga0373929_0075644 | |||
| 2767 | Ga0373934_0214825 | |||
| 2768 | Ga0373944_0034758 | |||
| 2769 | Ga0373944_0356265 | |||
| 2770 | Ga0373949_0008878 | |||
| 2771 | Ga0373949_0009281 | |||
| 2772 | Ga0373949_0115455 | |||
| 2773 | Ga0373951_0136323 | |||
| 2774 | Ga0373952_0145666 | |||
| 2775 | Ga0373932_0083989 | |||
| 2776 | Ga0373936_0029157 | |||
| 2777 | Ga0373939_0229484 | |||
| 2778 | Ga0373939_0335634 | |||
| 2779 | Ga0373939_0428557 | |||
| 2780 | Ga0373941_0060967 | |||
| 2781 | Ga0373941_0471433 | |||
| 2782 | Ga0373945_0011288 | |||
| 2783 | Ga0373945_0011967 | |||
| 2784 | Ga0373945_0039082 | |||
| 2785 | Ga0373953_0492285 | |||
| 2786 | Ga0373954_0173398 | |||
| 2787 | Ga0373954_0244693 | |||
| 2788 | Ga0373954_0451403 | |||
| 2789 | Ga0373956_0161371 | |||
| 2790 | Ga0373957_0162918 | |||
| 2791 | Ga0373960_0111802 | |||
| 2792 | Ga0373960_0302431 | |||
| 2793 | Ga0373943_0001568 | |||
| 2794 | Ga0373943_0003697 | |||
| 2795 | Ga0373943_0026784 | |||
| 2796 | Ga0373946_0003435 | |||
| 2797 | Ga0373946_0078530 | |||
| 2798 | Ga0373946_0152029 | |||
| 2799 | Ga0373955_0254364 | |||
| 2800 | Ga0373955_0367660 | |||
| 2801 | Ga0373955_0626905 | |||
| 2802 | Ga0373942_0249752 | |||
| 2803 | Ga0373961_0122382 | |||
| 2804 | Ga0373962_0095911 | |||
| 2805 | Ga0373962_0115120 | |||
| 2806 | Ga0373924_0205525 | |||
| 2807 | Ga0373924_0432869 | |||
| 2808 | Ga0373931_0020259 | |||
| 2809 | Ga0373931_0042536 | |||
| 2810 | Ga0373931_0237896 | |||
| 2811 | Ga0373931_0274635 | |||
| 2812 | Ga0373935_0006819 | |||
| 2813 | Ga0373935_0040457 | |||
| 2814 | Ga0373935_0094813 | |||
| 2815 | Ga0373935_0138280 | |||
| 2816 | Ga0373927_0037158 | |||
| 2817 | Ga0373927_0098377 | |||
| 2818 | Ga0373933_0189842 | |||
| 2819 | Ga0373933_0307520 | |||
| 2820 | Ga0373947_0000205 | |||
| 2821 | Ga0373947_0000994 | |||
| 2822 | Ga0373947_0001247 | |||
| 2823 | Ga0373947_0295755 | |||
| 2824 | Ga0373947_0315417 | |||
| 2825 | Ga0373937_0020383 | |||
| 2826 | Ga0373937_0035628 | |||
| 2827 | Ga0373937_0387993 | |||
| 2828 | Ga0373937_1977811 | |||
| 2829 | Ga0373925_0000604 | |||
| 2830 | Ga0373925_0009362 | |||
| 2831 | Ga0373925_0010158 | |||
| 2832 | Ga0373925_0125982 | |||
| 2833 | Ga0373925_0599596 | |||
| 2834 | Ga0373925_1098496 | |||
| 2835 | Ga0373925_1356282 | |||
| 2836 | Ga0395899_0021287 | |||
| 2837 | Ga0395899_0037308 | |||
| 2838 | Ga0395899_0127107 | |||
| 2839 | Ga0395899_0211645 | |||
| 2840 | Ga0395899_0367678 | |||
| 2841 | Ga0395899_0572632 | |||
| 2842 | Ga0395899_0711714 | |||
| 2843 | Ga0395899_0971455 | |||
| 2844 | Ga0395900_0001205 | |||
| 2845 | Ga0395900_0025999 | |||
| 2846 | Ga0395900_0026306 | |||
| 2847 | Ga0395900_0030770 | |||
| 2848 | Ga0395900_0135986 | |||
| 2849 | Ga0395900_0165550 | |||
| 2850 | Ga0395900_0169212 | |||
| 2851 | Ga0395900_0174149 | |||
| 2852 | Ga0395900_0442943 | |||
| 2853 | Ga0395900_0522865 | |||
| 2854 | Ga0395900_0536513 | |||
| 2855 | Ga0395900_0801527 | |||
| 2856 | Ga0395900_1231372 | |||
| 2857 | Ga0395900_1469146 | |||
| 2858 | Ga0395898_0002267 | |||
| 2859 | Ga0395898_0026278 | |||
| 2860 | Ga0395898_0033467 | |||
| 2861 | Ga0395898_0138281 | |||
| 2862 | Ga0395898_0153719 | |||
| 2863 | Ga0395898_0168486 | |||
| 2864 | Ga0395898_0204241 | |||
| 2865 | Ga0395898_0283954 | |||
| 2866 | Ga0395898_0290750 | |||
| 2867 | Ga0395898_0304340 | |||
| 2868 | Ga0395898_0353689 | |||
| 2869 | Ga0395898_0538993 | |||
| 2870 | Ga0395898_0629374 | |||
| 2871 | Ga0395898_0661973 | |||
| 2872 | Ga0395898_0764083 | |||
| 2873 | Ga0395898_0856233 | |||
| 2874 | Ga0395898_1032522 | |||
| 2875 | Ga0395898_1521025 | |||
| 2876 | Ga0395898_1649182 | |||
| 2877 | Ga0395905_0003498 | |||
| 2878 | Ga0395905_0005462 | |||
| 2879 | Ga0395905_0025373 | |||
| 2880 | Ga0395905_0053283 | |||
| 2881 | Ga0395905_0095724 | |||
| 2882 | Ga0395905_0246609 | |||
| 2883 | Ga0395905_0279317 | |||
| 2884 | Ga0395905_0476685 | |||
| 2885 | Ga0395905_0742767 | |||
| 2886 | Ga0395905_1219956 | |||
| 2887 | Ga0395905_1504622 | |||
| 2888 | Ga0395905_1677313 | |||
| 2889 | Ga0395901_0003190 | |||
| 2890 | Ga0395901_0009698 | |||
| 2891 | Ga0395901_0019293 | |||
| 2892 | Ga0395901_0020575 | |||
| 2893 | Ga0395901_0028357 | |||
| 2894 | Ga0395901_0055391 | |||
| 2895 | Ga0395901_0068411 | |||
| 2896 | Ga0395901_0088813 | |||
| 2897 | Ga0395901_0156274 | |||
| 2898 | Ga0395901_0253899 | |||
| 2899 | Ga0395901_0257705 | |||
| 2900 | Ga0395901_0268292 | |||
| 2901 | Ga0395901_0340578 | |||
| 2902 | Ga0395901_0341572 | |||
| 2903 | Ga0395901_0423323 | |||
| 2904 | Ga0395901_0495760 | |||
| 2905 | Ga0395901_0593746 | |||
| 2906 | Ga0395901_0609281 | |||
| 2907 | Ga0395901_0673650 | |||
| 2908 | Ga0395901_0687815 | |||
| 2909 | Ga0395901_1198557 | |||
| 2910 | Ga0395901_1287402 | |||
| 2911 | Ga0395901_1313583 | |||
| 2912 | Ga0395901_1336403 | |||
| 2913 | Ga0395901_1342158 | |||
| 2914 | Ga0395901_1783477 | |||
| 2915 | Ga0395901_2036265 | |||
| 2916 | Ga0436365_1179664 | |||
| 2917 | Ga0436363_0223048 | |||
| 2918 | Ga0436363_0630452 | |||
| 2919 | Ga0451787_572446 | |||
| 2920 | Ga0451800_0260483 | |||
| 2921 | Ga0451800_0972975 | |||
| 2922 | Ga0451802_0405929 | |||
| 2923 | Ga0451807_1201553 | |||
| 2924 | Ga0451835_0478302 | |||
| 2925 | Ga0451849_0570757 | |||
| 2926 | Ga0451849_1151008 | |||
| 2927 | Ga0451851_0504909 | |||
| 2928 | Ga0451853_0847260 | |||
| 2929 | Ga0439448_0308852 | |||
| 2930 | Ga0439454_030395 | |||
| 2931 | Ga0450916_034766 | |||
| 2932 | Ga0466969_0076993 | |||
| 2933 | Ga0466969_0098913 | |||
| 2934 | Ga0466972_0023847 | |||
| 2935 | Ga0466972_0622763 | |||
| 2936 | Ga0466965_0001995 | |||
| 2937 | Ga0466965_0022743 | |||
| 2938 | Ga0466965_0356043 | |||
| 2939 | Ga0466966_0059865 | |||
| 2940 | Ga0466966_0064626 | |||
| 2941 | Ga0466966_0269391 | |||
| 2942 | Ga0466966_0569483 | |||
| 2943 | Ga0466966_0621030 | |||
| 2944 | Ga0466966_0650543 | |||
| 2945 | Ga0466966_0931590 | |||
| 2946 | Ga0466961_0001476 | |||
| 2947 | Ga0466961_0002155 | |||
| 2948 | Ga0466961_0020936 | |||
| 2949 | Ga0466961_0031030 | |||
| 2950 | Ga0466961_0125290 | |||
| 2951 | Ga0466961_0195168 | |||
| 2952 | Ga0466961_0236999 | |||
| 2953 | Ga0466961_0801911 | |||
| 2954 | Ga0466961_0909503 | |||
| 2955 | Ga0466963_0000468 | |||
| 2956 | Ga0466963_0002921 | |||
| 2957 | Ga0466963_0005978 | |||
| 2958 | Ga0466963_0006777 | |||
| 2959 | Ga0466963_0009130 | |||
| 2960 | Ga0466963_0017839 | |||
| 2961 | Ga0466963_0026264 | |||
| 2962 | Ga0466963_0028057 | |||
| 2963 | Ga0466963_0032355 | |||
| 2964 | Ga0466963_0034993 | |||
| 2965 | Ga0466963_0047596 | |||
| 2966 | Ga0466963_0051861 | |||
| 2967 | Ga0466963_0072159 | |||
| 2968 | Ga0466963_0077748 | |||
| 2969 | Ga0466963_0090841 | |||
| 2970 | Ga0466963_0119653 | |||
| 2971 | Ga0466963_0191069 | |||
| 2972 | Ga0466963_0211975 | |||
| 2973 | Ga0466963_0321103 | |||
| 2974 | Ga0466963_0487154 | |||
| 2975 | Ga0466963_0594996 | |||
| 2976 | Ga0466963_0667815 | |||
| 2977 | Ga0466963_0948266 | |||
| 2978 | Ga0466963_1036502 | |||
| 2979 | Ga0466963_1292575 | |||
| 2980 | Ga0466963_1321349 | |||
| 2981 | Ga0466964_0001444 | |||
| 2982 | Ga0466964_0003124 | |||
| 2983 | Ga0466964_0003644 | |||
| 2984 | Ga0466964_0007381 | |||
| 2985 | Ga0466964_0010598 | |||
| 2986 | Ga0466964_0023879 | |||
| 2987 | Ga0466964_0035417 | |||
| 2988 | Ga0466964_0037494 | |||
| 2989 | Ga0466964_0045108 | |||
| 2990 | Ga0466964_0045164 | |||
| 2991 | Ga0466964_0101158 | |||
| 2992 | Ga0466964_0135781 | |||
| 2993 | Ga0466964_0340248 | |||
| 2994 | Ga0466964_0609143 | |||
| 2995 | Ga0466964_0646581 | |||
| 2996 | Ga0453684_0479225 | |||
| 2997 | Ga0466971_0000500 | |||
| 2998 | Ga0466971_0000871 | |||
| 2999 | Ga0466971_0008787 | |||
| 3000 | Ga0466971_0020063 | |||
| 3001 | Ga0466971_0050651 | |||
| 3002 | Ga0466971_0182214 | |||
| 3003 | Ga0466971_0313750 | |||
| 3004 | Ga0466968_0013618 | |||
| 3005 | Ga0466968_0043280 | |||
| 3006 | Ga0466968_0057300 | |||
| 3007 | Ga0466968_0163875 | |||
| 3008 | Ga0466968_0668337 | |||
| 3009 | Ga0466970_0035747 | |||
| 3010 | Ga0466970_0136948 | |||
| 3011 | Ga0466970_0430420 | |||
| 3012 | Ga0466957_0000044 | |||
| 3013 | Ga0466957_0001119 | |||
| 3014 | Ga0466957_0025752 | |||
| 3015 | Ga0466957_0050631 | |||
| 3016 | Ga0466957_0059016 | |||
| 3017 | Ga0466957_0075657 | |||
| 3018 | Ga0466957_0133099 | |||
| 3019 | Ga0466957_0138725 | |||
| 3020 | Ga0466957_0181022 | |||
| 3021 | Ga0466957_0199622 | |||
| 3022 | Ga0466957_0335124 | |||
| 3023 | Ga0466957_0426217 | |||
| 3024 | Ga0466957_0713562 | |||
| 3025 | Ga0466957_0886357 | |||
| 3026 | Ga0466957_0931770 | |||
| 3027 | Ga0466957_0951205 | |||
| 3028 | Ga0466957_0985354 | |||
| 3029 | Ga0466957_0996039 | |||
| 3030 | Ga0466957_1019425 | |||
| 3031 | Ga0466960_0044869 | |||
| 3032 | Ga0466960_0108410 | |||
| 3033 | Ga0466960_0219088 | |||
| 3034 | Ga0466960_0459950 | |||
| 3035 | Ga0466960_0810940 | |||
| 3036 | Ga0466960_0986358 | |||
| 3037 | Ga0466959_0004661 | |||
| 3038 | Ga0466959_0010363 | |||
| 3039 | Ga0466959_0048019 | |||
| 3040 | Ga0466959_0062090 | |||
| 3041 | Ga0466959_0076804 | |||
| 3042 | Ga0466959_0077095 | |||
| 3043 | Ga0466959_0122565 | |||
| 3044 | Ga0466959_0301846 | |||
| 3045 | Ga0466959_0431225 | |||
| 3046 | Ga0466959_0444740 | |||
| 3047 | Ga0466958_0000039 | |||
| 3048 | Ga0466958_0000364 | |||
| 3049 | Ga0466958_0000415 | |||
| 3050 | Ga0466958_0002981 | |||
| 3051 | Ga0466958_0004140 | |||
| 3052 | Ga0466958_0008142 | |||
| 3053 | Ga0466958_0025288 | |||
| 3054 | Ga0466958_0080480 | |||
| 3055 | Ga0466958_0194205 | |||
| 3056 | Ga0466958_0230794 | |||
| 3057 | Ga0466958_0435687 | |||
| 3058 | Ga0466958_0577143 | |||
| 3059 | Ga0466958_0590510 | |||
| 3060 | Ga0466958_0688993 | |||
| 3061 | Ga0466967_0003247 | |||
| 3062 | Ga0466967_0003452 | |||
| 3063 | Ga0466967_0007025 | |||
| 3064 | Ga0466967_0010550 | |||
| 3065 | Ga0466967_0012673 | |||
| 3066 | Ga0466967_0017960 | |||
| 3067 | Ga0466967_0023441 | |||
| 3068 | Ga0466967_0024275 | |||
| 3069 | Ga0466967_0030845 | |||
| 3070 | Ga0466967_0035077 | |||
| 3071 | Ga0466967_0041568 | |||
| 3072 | Ga0466967_0042216 | |||
| 3073 | Ga0466967_0049163 | |||
| 3074 | Ga0466967_0056294 | |||
| 3075 | Ga0466967_0070310 | |||
| 3076 | Ga0466967_0075764 | |||
| 3077 | Ga0466967_0084052 | |||
| 3078 | Ga0466967_0111443 | |||
| 3079 | Ga0466967_0168941 | |||
| 3080 | Ga0466967_0202412 | |||
| 3081 | Ga0466967_0251394 | |||
| 3082 | Ga0466967_0273226 | |||
| 3083 | Ga0466967_0382046 | |||
| 3084 | Ga0466967_0397075 | |||
| 3085 | Ga0466967_0763544 | |||
| 3086 | Ga0466967_0811242 | |||
| 3087 | Ga0466967_0865526 | |||
| 3088 | Ga0466967_1031139 | |||
| 3089 | Ga0466967_1064379 | |||
| 3090 | Ga0466967_1351763 | |||
| 3091 | Ga0466967_1455953 | |||
| 3092 | Ga0466967_1594907 | |||
| 3093 | Ga0466967_1767885 | |||
| 3094 | Ga0466967_1780291 | |||
| 3095 | Ga0466967_1879937 | |||
| 3096 | Ga0466967_2184397 | |||
| 3097 | Ga0466967_2341078 | |||
| 3098 | Ga0466967_2392730 | |||
| 3099 | Ga0495592_0000082 | |||
| 3100 | Ga0495592_0011459 | |||
| 3101 | Ga0495592_0187308 | |||
| 3102 | Ga0495592_0390888 | |||
| 3103 | Ga0495603_0129446 | |||
| 3104 | Ga0495603_0143370 | |||
| 3105 | Ga0495603_0309242 | |||
| 3106 | Ga0495603_0509952 | |||
| 3107 | Ga0495603_0898718 | |||
| 3108 | Ga0495629_0007444 | |||
| 3109 | Ga0495629_0011680 | |||
| 3110 | Ga0495629_0483869 | |||
| 3111 | Ga0495629_0493907 | |||
| 3112 | Ga0495629_0914935 | |||
| 3113 | Ga0495641_0000612 | |||
| 3114 | Ga0495641_0014194 | |||
| 3115 | Ga0495641_0031683 | |||
| 3116 | Ga0495641_0063384 | |||
| 3117 | Ga0495641_0235932 | |||
| 3118 | Ga0495651_0000080 | |||
| 3119 | Ga0495651_0031039 | |||
| 3120 | Ga0495651_0058505 | |||
| 3121 | Ga0495651_0069615 | |||
| 3122 | Ga0495651_0080518 | |||
| 3123 | Ga0495651_0136414 | |||
| 3124 | Ga0495651_0543499 | |||
| 3125 | Ga0495653_0001358 | |||
| 3126 | Ga0495653_0032308 | |||
| 3127 | Ga0495653_0032895 | |||
| 3128 | Ga0495653_0125053 | |||
| 3129 | Ga0495653_0150544 | |||
| 3130 | Ga0495653_0204372 | |||
| 3131 | Ga0495653_0367939 | |||
| 3132 | Ga0495580_0017501 | |||
| 3133 | Ga0495580_1033980 | |||
| 3134 | Ga0495582_0001627 | |||
| 3135 | Ga0495582_0015784 | |||
| 3136 | Ga0495582_0169464 | |||
| 3137 | Ga0495582_0279218 | |||
| 3138 | Ga0495582_0394037 | |||
| 3139 | Ga0495582_0686529 | |||
| 3140 | Ga0495605_0086559 | |||
| 3141 | Ga0495605_0406515 | |||
| 3142 | Ga0495639_0000302 | |||
| 3143 | Ga0495639_0013887 | |||
| 3144 | Ga0495662_0000620 | |||
| 3145 | Ga0495662_0008518 | |||
| 3146 | Ga0495664_0009146 | |||
| 3147 | Ga0495664_0012689 | |||
| 3148 | Ga0495664_0082655 | |||
| 3149 | Ga0495664_0098187 | |||
| 3150 | Ga0495664_0436032 | |||
| 3151 | Ga0495584_0113641 | |||
| 3152 | Ga0495584_0439949 | |||
| 3153 | Ga0495584_0532124 | |||
| 3154 | Ga0495585_0141432 | |||
| 3155 | Ga0495585_0154713 | |||
| 3156 | Ga0495594_0156457 | |||
| 3157 | Ga0495594_0230682 | |||
| 3158 | Ga0495594_0406642 | |||
| 3159 | Ga0495596_0422800 | |||
| 3160 | Ga0495607_0198153 | |||
| 3161 | Ga0495607_0224047 | |||
| 3162 | Ga0495607_0394787 | |||
| 3163 | Ga0495583_0208249 | |||
| 3164 | Ga0495608_0000669 | |||
| 3165 | Ga0495608_0027901 | |||
| 3166 | Ga0495608_0031450 | |||
| 3167 | Ga0495608_0101875 | |||
| 3168 | Ga0495618_0001062 | |||
| 3169 | Ga0495618_0029762 | |||
| 3170 | Ga0495618_0094144 | |||
| 3171 | Ga0495618_0099428 | |||
| 3172 | Ga0495618_0116091 | |||
| 3173 | Ga0495618_0299120 | |||
| 3174 | Ga0495618_0510826 | |||
| 3175 | Ga0495628_0000292 | |||
| 3176 | Ga0495628_0061058 | |||
| 3177 | Ga0495628_0105857 | |||
| 3178 | Ga0495628_0458511 | |||
| 3179 | Ga0495628_0863816 | |||
| 3180 | Ga0495630_0001051 | |||
| 3181 | Ga0495630_0005492 | |||
| 3182 | Ga0495630_0158806 | |||
| 3183 | Ga0495630_0377496 | |||
| 3184 | Ga0495630_0478132 | |||
| 3185 | Ga0495631_0094220 | |||
| 3186 | Ga0495637_0247369 | |||
| 3187 | Ga0495637_0302948 | |||
| 3188 | Ga0495644_0005471 | |||
| 3189 | Ga0495644_0309507 | |||
| 3190 | Ga0495663_0092490 | |||
| 3191 | Ga0495663_0292177 | |||
| 3192 | Ga0495666_0000436 | |||
| 3193 | Ga0495666_0019916 | |||
| 3194 | Ga0495642_0479799 | |||
| 3195 | Ga0495652_0000847 | |||
| 3196 | Ga0495652_0012788 | |||
| 3197 | Ga0495652_0016499 | |||
| 3198 | Ga0495652_0028410 | |||
| 3199 | Ga0495652_0227113 | |||
| 3200 | Ga0495652_0510870 | |||
| 3201 | Ga0495652_0698805 | |||
| 3202 | Ga0495665_0000038 | |||
| 3203 | Ga0495665_0060681 | |||
| 3204 | Ga0495640_0058926 | |||
| 3205 | Ga0495640_0178234 | |||
| 3206 | Ga0495640_0260817 | |||
| 3207 | Ga0495640_0364042 | |||
| 3208 | Ga0495640_0385006 | |||
| 3209 | Ga0495586_0006750 | |||
| 3210 | Ga0495586_0925259 | |||
| 3211 | Ga0495587_0000060 | |||
| 3212 | Ga0495587_0014277 | |||
| 3213 | Ga0495587_0078213 | |||
| 3214 | Ga0495587_0236538 | |||
| 3215 | Ga0495587_0541779 | |||
| 3216 | Ga0495587_0643800 | |||
| 3217 | Ga0495609_0118773 | |||
| 3218 | Ga0495621_0137310 | |||
| 3219 | Ga0495645_0000038 | |||
| 3220 | Ga0495645_0106741 | |||
| 3221 | Ga0495645_0249517 | |||
| 3222 | Ga0495645_0375660 | |||
| 3223 | Ga0495645_0776882 | |||
| 3224 | Ga0495667_0016306 | |||
| 3225 | Ga0495667_0033182 | |||
| 3226 | Ga0495667_0097352 | |||
| 3227 | Ga0495667_0099592 | |||
| 3228 | Ga0495667_0190761 | |||
| 3229 | Ga0495667_0215963 | |||
| 3230 | Ga0495667_0803988 | |||
| 3231 | Ga0495656_0002919 | |||
| 3232 | Ga0495656_0035880 | |||
| 3233 | Ga0495656_0754613 | |||
| 3234 | Ga0495668_0766569 | |||
| 3235 | Ga0495634_0076666 | |||
| 3236 | Ga0495634_0115730 | |||
| 3237 | Ga0495634_0457531 | |||
| 3238 | Ga0495634_0857436 | |||
| 3239 | Ga0495611_0302653 | |||
| 3240 | Ga0495635_0007673 | |||
| 3241 | Ga0495635_0010204 | |||
| 3242 | Ga0495635_0187176 | |||
| 3243 | Ga0495635_0196629 | |||
| 3244 | Ga0495635_0404468 | |||
| 3245 | Ga0495635_0933450 | |||
| 3246 | Ga0495635_1079595 | |||
| 3247 | Ga0495659_0154188 | |||
| 3248 | Ga0495661_0474226 | |||
| 3249 | Ga0495588_0452066 | |||
| 3250 | Ga0495588_0709422 | |||
| 3251 | Ga0495657_0052504 | |||
| 3252 | Ga0495657_0103608 | |||
| 3253 | Ga0495657_0190419 | |||
| 3254 | Ga0495657_0295631 | |||
| 3255 | Ga0495657_0414115 | |||
| 3256 | Ga0495657_0591422 | |||
| 3257 | Ga0495599_0001221 | |||
| 3258 | Ga0495599_0013291 | |||
| 3259 | Ga0495599_0060412 | |||
| 3260 | Ga0495599_0297680 | |||
| 3261 | Ga0495599_0497529 | |||
| 3262 | Ga0495599_0506195 | |||
| 3263 | Ga0495623_0000442 | |||
| 3264 | Ga0495623_0176669 | |||
| 3265 | Ga0495646_0001935 | |||
| 3266 | Ga0495646_0033039 | |||
| 3267 | Ga0495646_0042988 | |||
| 3268 | Ga0495646_0130166 | |||
| 3269 | Ga0495647_0001012 | |||
| 3270 | Ga0495647_0384030 | |||
| 3271 | Ga0495658_0000950 | |||
| 3272 | Ga0495658_0001191 | |||
| 3273 | Ga0495658_0016785 | |||
| 3274 | Ga0495658_0990408 | |||
| 3275 | Ga0495613_0001533 | |||
| 3276 | Ga0495613_0093037 | |||
| 3277 | Ga0495613_0250665 | |||
| 3278 | Ga0495613_0589611 | |||
| 3279 | Ga0495624_0006249 | |||
| 3280 | Ga0495624_0008918 | |||
| 3281 | Ga0495624_0114425 | |||
| 3282 | Ga0495624_0454906 | |||
| 3283 | Ga0495624_0928658 | |||
| 3284 | Ga0495670_0747763 | |||
| 3285 | Ga0495589_0195129 | |||
| 3286 | Ga0495589_0345091 | |||
| 3287 | Ga0495600_0010197 | |||
| 3288 | Ga0495600_0120642 | |||
| 3289 | Ga0495600_0266830 | |||
| 3290 | Ga0495600_0345264 | |||
| 3291 | Ga0495600_0533232 | |||
| 3292 | Ga0495581_0000231 | |||
| 3293 | Ga0495581_0008754 | |||
| 3294 | Ga0495581_0232285 | |||
| 3295 | Ga0495581_0315095 | |||
| 3296 | Ga0495581_0432986 | |||
| 3297 | Ga0495581_0867552 | |||
| 3298 | Ga0495604_0000043 | |||
| 3299 | Ga0495604_0257631 | |||
| 3300 | Ga0495604_0437145 | |||
| 3301 | Ga0495674_0034792 | |||
| 3302 | Ga0495674_0317760 | |||
| 3303 | Ga0495674_0536374 | |||
| 3304 | Ga0495674_0555989 | |||
| 3305 | Ga0495674_0556369 | |||
| 3306 | Ga0495674_0797931 | |||
| 3307 | Ga0495676_0004932 | |||
| 3308 | Ga0495676_0033454 | |||
| 3309 | Ga0495676_0072612 | |||
| 3310 | Ga0495676_0118224 | |||
| 3311 | Ga0495676_0204961 | |||
| 3312 | Ga0495676_0993549 | |||
| 3313 | Ga0495680_0005589 | |||
| 3314 | Ga0495680_0007172 | |||
| 3315 | Ga0495680_0008993 | |||
| 3316 | Ga0495680_0030489 | |||
| 3317 | Ga0495680_0087862 | |||
| 3318 | Ga0495680_0220358 | |||
| 3319 | Ga0495680_0286460 | |||
| 3320 | Ga0495680_0891105 | |||
| 3321 | Ga0495683_0113608 | |||
| 3322 | Ga0495675_0000821 | |||
| 3323 | Ga0495675_0265387 | |||
| 3324 | Ga0495677_0116216 | |||
| 3325 | Ga0495677_0193898 | |||
| 3326 | Ga0495685_277405 | |||
| 3327 | Ga0495684_0012093 | |||
| 3328 | Ga0495684_0076278 | |||
| 3329 | Ga0495684_0143057 | |||
| 3330 | Ga0495684_0193693 | |||
| 3331 | Ga0495684_0326984 | |||
| 3332 | Ga0495684_0565349 | |||
| 3333 | Ga0495684_0610684 | |||
| 3334 | Ga0495593_0001083 | |||
| 3335 | Ga0495593_0001951 | |||
| 3336 | Ga0495602_0000536 | |||
| 3337 | Ga0495602_0061759 | |||
| 3338 | Ga0495602_0334967 | |||
| 3339 | Ga0495602_0499732 | |||
| 3340 | Ga0495602_0589962 | |||
| 3341 | Ga0495602_0645557 | |||
| 3342 | Ga0495614_0002623 | |||
| 3343 | Ga0495614_0002797 | |||
| 3344 | Ga0495614_0401684 | |||
| 3345 | Ga0495615_0066305 | |||
| 3346 | Ga0496100_0006620 | |||
| 3347 | Ga0496100_0012889 | |||
| 3348 | Ga0496100_0076035 | |||
| 3349 | Ga0496100_0106184 | |||
| 3350 | Ga0496100_0122962 | |||
| 3351 | Ga0496100_0131402 | |||
| 3352 | Ga0496100_0263908 | |||
| 3353 | Ga0496100_0341441 | |||
| 3354 | Ga0496100_0416767 | |||
| 3355 | Ga0496100_0492880 | |||
| 3356 | Ga0496100_0537149 | |||
| 3357 | Ga0496100_0587761 | |||
| 3358 | Ga0496100_0980172 | |||
| 3359 | Ga0496101_0005869 | |||
| 3360 | Ga0496101_0034463 | |||
| 3361 | Ga0496101_0076566 | |||
| 3362 | Ga0496101_0183468 | |||
| 3363 | Ga0496101_0198979 | |||
| 3364 | Ga0496101_0356153 | |||
| 3365 | Ga0496101_1268221 | |||
| 3366 | Ga0496102_0005454 | |||
| 3367 | Ga0496102_0010968 | |||
| 3368 | Ga0496102_0039141 | |||
| 3369 | Ga0496102_0050483 | |||
| 3370 | Ga0496102_0051928 | |||
| 3371 | Ga0496102_0076066 | |||
| 3372 | Ga0496102_0154760 | |||
| 3373 | Ga0496102_0467396 | |||
| 3374 | Ga0496102_0612132 | |||
| 3375 | Ga0496102_0843881 | |||
| 3376 | Ga0496102_0848288 | |||
| 3377 | Ga0496102_0927722 | |||
| 3378 | Ga0496102_1785257 | |||
| 3379 | Ga0496103_0004954 | |||
| 3380 | Ga0496103_0035205 | |||
| 3381 | Ga0496103_0055301 | |||
| 3382 | Ga0496103_0105035 | |||
| 3383 | Ga0496103_0118383 | |||
| 3384 | Ga0496103_0197984 | |||
| 3385 | Ga0496103_0271450 | |||
| 3386 | Ga0496103_0412138 | |||
| 3387 | Ga0496103_0459568 | |||
| 3388 | Ga0496103_0609060 | |||
| 3389 | Ga0496103_0624429 | |||
| 3390 | Ga0496103_0961046 | |||
| 3391 | Ga0496104_0000329 | |||
| 3392 | Ga0496104_0011979 | |||
| 3393 | Ga0496104_0080833 | |||
| 3394 | Ga0496104_0082800 | |||
| 3395 | Ga0496104_0120065 | |||
| 3396 | Ga0496104_0401649 | |||
| 3397 | Ga0496104_0405266 | |||
| 3398 | Ga0496104_0421129 | |||
| 3399 | Ga0496104_0635760 | |||
| 3400 | Ga0496104_0715298 | |||
| 3401 | Ga0496104_0935011 | |||
| 3402 | Ga0496104_1560503 | |||
| 3403 | Ga0496105_0000128 | |||
| 3404 | Ga0496105_0004531 | |||
| 3405 | Ga0496105_0008583 | |||
| 3406 | Ga0496105_0186977 | |||
| 3407 | Ga0496105_0209973 | |||
| 3408 | Ga0496105_0214614 | |||
| 3409 | Ga0496105_0215711 | |||
| 3410 | Ga0496105_0254983 | |||
| 3411 | Ga0496105_0317004 | |||
| 3412 | Ga0496105_0478364 | |||
| 3413 | Ga0496106_0002754 | |||
| 3414 | Ga0496106_0007074 | |||
| 3415 | Ga0496106_0101800 | |||
| 3416 | Ga0496106_0253067 | |||
| 3417 | Ga0496106_0278920 | |||
| 3418 | Ga0496106_0489664 | |||
| 3419 | Ga0496106_0980428 | |||
| 3420 | Ga0496106_0994796 | |||
| 3421 | Ga0496106_1025468 | |||
| 3422 | Ga0496106_1272455 | |||
| 3423 | Ga0496107_0004881 | |||
| 3424 | Ga0496107_0019954 | |||
| 3425 | Ga0496107_0179353 | |||
| 3426 | Ga0496107_0253595 | |||
| 3427 | Ga0496107_0311157 | |||
| 3428 | Ga0496107_0342635 | |||
| 3429 | Ga0496107_0367757 | |||
| 3430 | Ga0496107_0646873 | |||
| 3431 | Ga0496108_0009805 | |||
| 3432 | Ga0496108_0011419 | |||
| 3433 | Ga0496108_0016676 | |||
| 3434 | Ga0496108_0223034 | |||
| 3435 | Ga0496108_0226115 | |||
| 3436 | Ga0496108_0306630 | |||
| 3437 | Ga0496108_0564443 | |||
| 3438 | Ga0496108_0653219 | |||
| 3439 | Ga0496108_1150793 | |||
| 3440 | Ga0496108_1221908 | |||
| 3441 | Ga0496109_0000408 | |||
| 3442 | Ga0496109_0000650 | |||
| 3443 | Ga0496109_0008289 | |||
| 3444 | Ga0496109_0139926 | |||
| 3445 | Ga0496109_0199752 | |||
| 3446 | Ga0496109_0202727 | |||
| 3447 | Ga0496109_0340405 | |||
| 3448 | Ga0496109_0344490 | |||
| 3449 | Ga0496109_0432613 | |||
| 3450 | Ga0496109_0531540 | |||
| 3451 | Ga0496109_0815473 | |||
| 3452 | Ga0496109_0887476 | |||
| 3453 | Ga0496109_1216657 | |||
| 3454 | Ga0496109_1411998 | |||
| 3455 | Ga0496109_1503255 | |||
| 3456 | Ga0496109_1536442 | |||
| 3457 | Ga0496109_1768022 | |||
| 3458 | Ga0496110_0013395 | |||
| 3459 | Ga0496110_0024222 | |||
| 3460 | Ga0496110_0034879 | |||
| 3461 | Ga0496110_0065495 | |||
| 3462 | Ga0496110_0081077 | |||
| 3463 | Ga0496110_0095898 | |||
| 3464 | Ga0496110_0301401 | |||
| 3465 | Ga0496110_0417116 | |||
| 3466 | Ga0496110_1393990 | |||
| 3467 | Ga0496110_1493848 | |||
| 3468 | Ga0496111_0001006 | |||
| 3469 | Ga0496111_0007379 | |||
| 3470 | Ga0496111_0017036 | |||
| 3471 | Ga0496111_0028954 | |||
| 3472 | Ga0496111_0036301 | |||
| 3473 | Ga0496111_0039067 | |||
| 3474 | Ga0496111_0085976 | |||
| 3475 | Ga0496111_0087795 | |||
| 3476 | Ga0496111_0143275 | |||
| 3477 | Ga0496111_0174414 | |||
| 3478 | Ga0496111_0311364 | |||
| 3479 | Ga0496111_0320472 | |||
| 3480 | Ga0496111_0818985 | |||
| 3481 | Ga0496112_0000799 | |||
| 3482 | Ga0496112_0004783 | |||
| 3483 | Ga0496112_0015500 | |||
| 3484 | Ga0496112_0035538 | |||
| 3485 | Ga0496112_0047812 | |||
| 3486 | Ga0496112_0086216 | |||
| 3487 | Ga0496112_0235354 | |||
| 3488 | Ga0496112_0387038 | |||
| 3489 | Ga0496112_0749367 | |||
| 3490 | Ga0496112_1051671 | |||
| 3491 | Ga0496112_1543744 | |||
| 3492 | Ga0496112_1873181 | |||
| 3493 | Ga0496113_0020933 | |||
| 3494 | Ga0496113_0022709 | |||
| 3495 | Ga0496113_0398376 | |||
| 3496 | Ga0496113_0573402 | |||
| 3497 | Ga0496113_0618645 | |||
| 3498 | Ga0496113_0765209 | |||
| 3499 | Ga0496113_0771359 | |||
| 3500 | Ga0496113_0843245 | |||
| 3501 | Ga0496113_0859006 | |||
| 3502 | Ga0496113_1188275 | |||
| 3503 | Ga0496114_0002097 | |||
| 3504 | Ga0496114_0011172 | |||
| 3505 | Ga0496114_0012282 | |||
| 3506 | Ga0496114_0019690 | |||
| 3507 | Ga0496114_0041071 | |||
| 3508 | Ga0496114_0059034 | |||
| 3509 | Ga0496114_0060788 | |||
| 3510 | Ga0496114_0130924 | |||
| 3511 | Ga0496114_0240944 | |||
| 3512 | Ga0496114_0311884 | |||
| 3513 | Ga0496114_0367340 | |||
| 3514 | Ga0496114_0417576 | |||
| 3515 | Ga0496114_0570115 | |||
| 3516 | Ga0496114_0625324 | |||
| 3517 | Ga0496114_0886655 | |||
| 3518 | Ga0496114_0997715 | |||
| 3519 | Ga0496115_0008023 | |||
| 3520 | Ga0496115_0011448 | |||
| 3521 | Ga0496115_0045492 | |||
| 3522 | Ga0496115_0110070 | |||
| 3523 | Ga0496115_0152885 | |||
| 3524 | Ga0496115_0458068 | |||
| 3525 | Ga0496115_0738681 | |||
| 3526 | Ga0496115_0882794 | |||
| 3527 | Ga0496115_1294343 | |||
| 3528 | Ga0501031_0000858 | |||
| 3529 | Ga0501032_0013884 | |||
| 3530 | Ga0501033_0084129 | |||
| 3531 | Ga0501033_1028275 | |||
| 3532 | Ga0501034_0013382 | |||
| 3533 | Ga0501034_0182694 | |||
| 3534 | Ga0501036_0018602 | |||
| 3535 | Ga0501036_0807781 | |||
| 3536 | Ga0501036_0818662 | |||
| 3537 | Ga0501037_0015224 | |||
| 3538 | Ga0501038_0001801 | |||
| 3539 | Ga0501039_0277297 | |||
| 3540 | Ga0501039_0408385 | |||
| 3541 | Ga0501040_0015722 | |||
| 3542 | Ga0501040_0254397 | |||
| 3543 | Ga0501040_0315675 | |||
| 3544 | Ga0501041_0019315 | |||
| 3545 | Ga0501041_1082963 | |||
| 3546 | Ga0501042_0022331 | |||
| 3547 | Ga0501042_0062687 | |||
| 3548 | Ga0501043_0003971 | |||
| 3549 | Ga0501043_1230069 | |||
| 3550 | Ga0501046_0003064 | |||
| 3551 | Ga0501046_1083575 | |||
| 3552 | Ga0501047_0370744 | |||
| 3553 | Ga0501048_0005026 | |||
| 3554 | Ga0501067_0000577 | |||
| 3555 | Ga0501067_0008977 | |||
| 3556 | Ga0501067_0016714 | |||
| 3557 | Ga0501067_0028017 | |||
| 3558 | Ga0501067_0055596 | |||
| 3559 | Ga0501067_0099320 | |||
| 3560 | Ga0501067_0104350 | |||
| 3561 | Ga0501067_0180276 | |||
| 3562 | Ga0501067_0285579 | |||
| 3563 | Ga0501067_0480226 | |||
| 3564 | Ga0501067_0645547 | |||
| 3565 | Ga0501067_0778727 | |||
| 3566 | Ga0501067_0817051 | |||
| 3567 | Ga0501068_0003580 | |||
| 3568 | Ga0501068_0021014 | |||
| 3569 | Ga0501068_0257003 | |||
| 3570 | Ga0501068_0408265 | |||
| 3571 | Ga0501069_0000923 | |||
| 3572 | Ga0501069_0001675 | |||
| 3573 | Ga0501069_0013845 | |||
| 3574 | Ga0501069_0029573 | |||
| 3575 | Ga0501069_0075960 | |||
| 3576 | Ga0501069_0140465 | |||
| 3577 | Ga0501069_0145720 | |||
| 3578 | Ga0501069_0291045 | |||
| 3579 | Ga0501069_0304949 | |||
| 3580 | Ga0501069_0646482 | |||
| 3581 | Ga0501069_0859860 | |||
| 3582 | Ga0501070_0000619 | |||
| 3583 | Ga0501070_0002536 | |||
| 3584 | Ga0501070_0169794 | |||
| 3585 | Ga0501070_0243421 | |||
| 3586 | Ga0501070_0281586 | |||
| 3587 | Ga0501070_1315112 | |||
| 3588 | Ga0501071_0016157 | |||
| 3589 | Ga0501071_0669345 | |||
| 3590 | Ga0501071_0821911 | |||
| 3591 | Ga0501071_0867530 | |||
| 3592 | Ga0501071_1121464 | |||
| 3593 | Ga0501072_0111169 | |||
| 3594 | Ga0501072_0117052 | |||
| 3595 | Ga0501072_0181565 | |||
| 3596 | Ga0501072_0475955 | |||
| 3597 | Ga0501073_0006279 | |||
| 3598 | Ga0501073_0067798 | |||
| 3599 | Ga0501074_0029245 | |||
| 3600 | Ga0501074_0045468 | |||
| 3601 | Ga0501074_0052934 | |||
| 3602 | Ga0501074_0523183 | |||
| 3603 | Ga0501074_1275098 | |||
| 3604 | Ga0501074_1275495 | |||
| 3605 | Ga0501075_0007361 | |||
| 3606 | Ga0501075_0141586 | |||
| 3607 | Ga0501075_0634281 | |||
| 3608 | Ga0501076_0086214 | |||
| 3609 | Ga0501076_0607730 | |||
| 3610 | Ga0501076_1180305 | |||
| 3611 | Ga0501077_0019787 | |||
| 3612 | Ga0501077_0048711 | |||
| 3613 | Ga0501077_0657392 | |||
| 3614 | Ga0501077_0829592 | |||
| 3615 | Ga0501077_1144756 | |||
| 3616 | Ga0501079_0055083 | |||
| 3617 | Ga0501079_0070705 | |||
| 3618 | Ga0501079_0083566 | |||
| 3619 | Ga0501079_0156083 | |||
| 3620 | Ga0501079_0454678 | |||
| 3621 | Ga0501079_0821600 | |||
| 3622 | Ga0501080_0002707 | |||
| 3623 | Ga0501080_0004326 | |||
| 3624 | Ga0501080_0192569 | |||
| 3625 | Ga0501080_0728504 | |||
| 3626 | Ga0501080_1718975 | |||
| 3627 | Ga0501081_0032274 | |||
| 3628 | Ga0501081_0073089 | |||
| 3629 | Ga0501081_0525284 | |||
| 3630 | Ga0501081_0947995 | |||
| 3631 | Ga0501083_0000255 | |||
| 3632 | Ga0501083_0001268 | |||
| 3633 | Ga0501035_0020625 | |||
| 3634 | Ga0501035_0273970 | |||
| 3635 | Ga0501035_0776945 | |||
| 3636 | Ga0501035_0910795 | |||
| 3637 | Ga0501044_0099015 | |||
| 3638 | Ga0501044_0171229 | |||
| 3639 | Ga0501045_0015946 | |||
| 3640 | Ga0501045_0261599 | |||
| 3641 | Ga0501045_1127809 | |||
| 3642 | nmdc:mga00v17_717451_c1 | |||
| 3643 | nmdc:mga0yw44_273950_c1 | |||
| 3644 | nmdc:mga0yw44_346457_c1 | |||
| 3645 | nmdc:mga06z11_1001169_c1 | |||
| 3646 | nmdc:mga06z11_604054_c1 | |||
| 3647 | nmdc:mga06z11_808924_c1 | |||
| 3648 | nmdc:mga04h51_90274_c1 | |||
| 3649 | nmdc:mga05p37_12158_c1 | |||
| 3650 | nmdc:mga05p37_1960779_c1 | |||
| 3651 | nmdc:mga05p37_32383_c1 | |||
| 3652 | nmdc:mga05p37_32998_c1 | |||
| 3653 | nmdc:mga05p37_624063_c1 | |||
| 3654 | nmdc:mga06r32_134643_c1 | |||
| 3655 | nmdc:mga06r32_1392004_c1 | |||
| 3656 | nmdc:mga08y16_233091_c1 | |||
| 3657 | nmdc:mga08y16_355948_c1 | |||
| 3658 | nmdc:mga08y16_379863_c1 | |||
| 3659 | nmdc:mga08y16_41355_c1 | |||
| 3660 | nmdc:mga08y16_68861_c1 | |||
| 3661 | nmdc:mga0n895_106066_c1 | |||
| 3662 | nmdc:mga0n895_1130997_c1 | |||
| 3663 | nmdc:mga0n895_1230667_c1 | |||
| 3664 | nmdc:mga0n895_203505_c1 | |||
| 3665 | nmdc:mga0n895_381459_c1 | |||
| 3666 | nmdc:mga0n895_429170_c1 | |||
| 3667 | nmdc:mga0n895_568865_c1 | |||
| 3668 | nmdc:mga0n895_612470_c1 | |||
| 3669 | nmdc:mga0n895_77355_c1 | |||
| 3670 | nmdc:mga0n895_787446_c1 | |||
| 3671 | nmdc:mga0n895_944526_c1 | |||
| 3672 | nmdc:mga0rr50_10932_c1 | |||
| 3673 | nmdc:mga0rr50_1430030_c1 | |||
| 3674 | nmdc:mga0rr50_32093_c1 | |||
| 3675 | nmdc:mga0rr50_347178_c1 | |||
| 3676 | nmdc:mga0rr50_432474_c1 | |||
| 3677 | nmdc:mga0rr50_785118_c1 | |||
| 3678 | nmdc:mga0rr50_963504_c1 | |||
| 3679 | nmdc:mga08x19_228150_c1 | |||
| 3680 | nmdc:mga08x19_25301_c1 | |||
| 3681 | nmdc:mga08x19_354728_c1 | |||
| 3682 | nmdc:mga08x19_378126_c1 | |||
| 3683 | nmdc:mga08x19_580713_c1 | |||
| 3684 | nmdc:mga08x19_658893_c1 | |||
| 3685 | nmdc:mga08x19_823026_c1 | |||
| 3686 | nmdc:mga08x19_89428_c1 | |||
| 3687 | nmdc:mga0a205_25342_c1 | |||
| 3688 | nmdc:mga0a205_355440_c1 | |||
| 3689 | nmdc:mga0a205_494058_c1 | |||
| 3690 | nmdc:mga0a205_504131_c1 | |||
| 3691 | nmdc:mga0a205_642062_c1 | |||
| 3692 | nmdc:mga0a205_67020_c1 | |||
| 3693 | nmdc:mga0a205_697617_c1 | |||
| 3694 | nmdc:mga0a205_795570_c1 | |||
| 3695 | nmdc:mga0a205_817942_c1 | |||
| 3696 | nmdc:mga0a205_849877_c1 | |||
| 3697 | Ga0495601_0000178 | |||
| 3698 | Ga0495601_0002405 | |||
| 3699 | Ga0495601_0016364 | |||
| 3700 | Ga0495601_0570217 | |||
| 3701 | Ga0495601_0662250 | |||
| 3702 | Ga0495601_0791262 | |||
| 3703 | Ga0495612_0000968 | |||
| 3704 | Ga0495612_0090134 | |||
| 3705 | Ga0495612_0215924 | |||
| 3706 | Ga0495655_0341659 | |||
| 3707 | Ga0495595_0044172 | |||
| 3708 | Ga0495595_0114493 | |||
| 3709 | Ga0495595_0138981 | |||
| 3710 | Ga0495595_0344760 | |||
| 3711 | Ga0495595_0381065 | |||
| 3712 | Ga0495595_0541467 | |||
| 3713 | Ga0495595_0565685 | |||
| 3714 | Ga0495619_0002984 | |||
| 3715 | Ga0495619_0003721 | |||
| 3716 | Ga0495619_0039602 | |||
| 3717 | Ga0495619_0095355 | |||
| 3718 | Ga0495619_0119616 | |||
| 3719 | Ga0495619_0216300 | |||
| 3720 | Ga0495619_0221285 | |||
| 3721 | Ga0495619_0267636 | |||
| 3722 | Ga0500566_0074479 | |||
| 3723 | Ga0500566_0517332 | |||
| 3724 | Ga0500641_0376603 | |||
| 3725 | Ga0501084_0051409 | |||
| 3726 | Ga0501084_0181846 | |||
| 3727 | Ga0501084_0192817 | |||
| 3728 | Ga0501084_1508615 | |||
| 3729 | Ga0501084_1666556 | |||
| 3730 | Ga0590071_018863 | |||
| 3731 | Ga0501082_0025935 | |||
| 3732 | Ga0501082_0077692 | |||
| 3733 | Ga0501082_0542214 | |||
| 3734 | Ga0501082_0800258 | |||
| 3735 | Ga0501082_1268027 | |||
| 3736 | Ga0501082_1572657 | |||
| 3737 | Ga0466962_0001476 | |||
| 3738 | Ga0466962_0005000 | |||
| 3739 | Ga0466962_0018925 | |||
| 3740 | Ga0466962_0020707 | |||
| 3741 | Ga0466962_0098907 | |||
| 3742 | Ga0466962_0112722 | |||
| 3743 | Ga0466962_0154711 | |||
| 3744 | Ga0466962_0437102 | |||
| 3745 | Ga0530510_0016362 | |||
| 3746 | Ga0530510_0036725 | |||
| 3747 | Ga0530510_0088199 | |||
| 3748 | Ga0530510_0195171 | |||
| 3749 | Ga0530510_0411334 | |||
| 3750 | Ga0530510_1282518 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhn-assembly1.cif.gz_0 | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.6958 | 2 | 61 |
| 7enj-assembly1.cif.gz_1 | human mediator (deletion of med1-idr) in a tail-bent conformation (med-b) | 0.675 | 11 | 54 |
| 4l0r-assembly1.cif.gz_B | crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. | 0.6742 | 2 | 60 |
| 7nhn-assembly1.cif.gz_0 | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.6538 | 2 | 61 |
| 4l0r-assembly1.cif.gz_B | crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. | 0.6275 | 2 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8RJJ3_18_104_1.10.110.10 | Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins | 0.7991 | 11 | 54 | 1.10.110.10 |
| af_O08957_31_117_1.10.110.10 | Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins | 0.739 | 9 | 52 | 1.10.110.10 |
| af_O62075_1_88_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7386 | 2 | 59 | 1.20.58.90 |
| af_Q8IQE6_1_221_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.7368 | 2 | 59 | 1.20.1270.60 |
| af_A5JYW3_1_91_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7212 | 4 | 59 | 1.20.58.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D3F5P0-F1-model_v4 | Uncharacterized protein | 1.001 | 3 | 59 |
|
| AF-A0A538L6T8-F1-model_v4 | Uncharacterized protein | 0.9972 | 2 | 59 |
|
| AF-A0A538IZS1-F1-model_v4 | Uncharacterized protein | 0.9954 | 2 | 59 |
|
| AF-A0A840IJM2-F1-model_v4 | Signal transduction histidine kinase | 0.9953 | 3 | 59 |
GO:0016301
|
| AF-A0A2W6CH49-F1-model_v4 | Uncharacterized protein | 0.9948 | 2 | 59 |
|