F495811
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1825 | 429 | 3650 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_11330880|Ga0207681_113308802 |
| Length | 149 |
| Sequence | VSELREQIENVIQSEDVALFMKGTPQFVMCGNSSRALDALRAAGAPVAAVDVLPDPRIRQELSAVSSWPTIPQVFVRGELIGGADIVEELEASGELERTLAQRLGEAIAVALYMLPAMAAVRSAADALEGVVADDLWPLPSYQEMLYIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 108 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 109 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 131 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 262 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 263 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 269 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 270 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 271 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 272 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 273 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 276 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 294 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 372 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 405 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 429 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 11.73 |
| Rhizosphere | 87.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207681_11330880 | 3300025923 | Bacteria | 603 |
| 2 | Ga0058863_11731045 | 3300004799 | Bacteria | 657 |
| 3 | Ga0058862_12807872 | 3300004803 | Bacteria | 1202 |
| 4 | Ga0070658_10013364 | 3300005327 | Bacteria | 6585 |
| 5 | Ga0070676_11053314 | 3300005328 | Bacteria | 613 |
| 6 | Ga0070683_100001708 | 3300005329 | Bacteria | 17088 |
| 7 | Ga0070683_100006172 | 3300005329 | Bacteria | 10050 |
| 8 | Ga0070683_100015515 | 3300005329 | Bacteria | 6695 |
| 9 | Ga0070683_100044248 | 3300005329 | Bacteria | 4105 |
| 10 | Ga0070683_100057488 | 3300005329 | Bacteria | 3613 |
| 11 | Ga0070683_100100167 | 3300005329 | Bacteria | 2727 |
| 12 | Ga0070683_100165156 | 3300005329 | Bacteria | 2100 |
| 13 | Ga0070683_100219000 | 3300005329 | Bacteria | 1809 |
| 14 | Ga0070683_102369656 | 3300005329 | Bacteria | 509 |
| 15 | Ga0070690_100072267 | 3300005330 | Bacteria | 2243 |
| 16 | Ga0070690_100103547 | 3300005330 | Bacteria | 1890 |
| 17 | Ga0070690_100572717 | 3300005330 | Bacteria | 854 |
| 18 | Ga0070690_100928842 | 3300005330 | Unclassified | 682 |
| 19 | Ga0068869_100854770 | 3300005334 | Bacteria | 785 |
| 20 | Ga0070666_10061309 | 3300005335 | Unclassified | 2547 |
| 21 | Ga0070666_11327921 | 3300005335 | Bacteria | 537 |
| 22 | Ga0070680_100037505 | 3300005336 | Bacteria | 3916 |
| 23 | Ga0070680_100039529 | 3300005336 | Bacteria | 3817 |
| 24 | Ga0070680_100103365 | 3300005336 | Bacteria | 2367 |
| 25 | Ga0070680_100118799 | 3300005336 | Bacteria | 2205 |
| 26 | Ga0070680_100218396 | 3300005336 | Bacteria | 1609 |
| 27 | Ga0070680_100258182 | 3300005336 | Bacteria | 1474 |
| 28 | Ga0070680_100387139 | 3300005336 | Bacteria | 1191 |
| 29 | Ga0070680_100387419 | 3300005336 | Bacteria | 1190 |
| 30 | Ga0070680_100460417 | 3300005336 | Bacteria | 1086 |
| 31 | Ga0070680_100621589 | 3300005336 | Bacteria | 927 |
| 32 | Ga0070680_101813531 | 3300005336 | Bacteria | 529 |
| 33 | Ga0070682_100002331 | 3300005337 | Bacteria | 10498 |
| 34 | Ga0070682_100019799 | 3300005337 | Bacteria | 3952 |
| 35 | Ga0070682_100072527 | 3300005337 | Bacteria | 2207 |
| 36 | Ga0070682_100078787 | 3300005337 | Bacteria | 2126 |
| 37 | Ga0070682_100109769 | 3300005337 | Bacteria | 1836 |
| 38 | Ga0070682_100167241 | 3300005337 | Bacteria | 1525 |
| 39 | Ga0070682_100214342 | 3300005337 | Bacteria | 1366 |
| 40 | Ga0070682_100611904 | 3300005337 | Bacteria | 862 |
| 41 | Ga0068868_100166940 | 3300005338 | Bacteria | 1821 |
| 42 | Ga0068868_100201178 | 3300005338 | Bacteria | 1661 |
| 43 | Ga0068868_100342626 | 3300005338 | Bacteria | 1278 |
| 44 | Ga0068868_100429331 | 3300005338 | Bacteria | 1145 |
| 45 | Ga0068868_101192438 | 3300005338 | Bacteria | 704 |
| 46 | Ga0068868_101533074 | 3300005338 | Bacteria | 625 |
| 47 | Ga0068868_101914221 | 3300005338 | Bacteria | 562 |
| 48 | Ga0068868_102145999 | 3300005338 | Unclassified | 532 |
| 49 | Ga0070660_100004253 | 3300005339 | Bacteria | 9880 |
| 50 | Ga0070660_100012338 | 3300005339 | Bacteria | 6099 |
| 51 | Ga0070660_100024290 | 3300005339 | Bacteria | 4497 |
| 52 | Ga0070660_100036325 | 3300005339 | Bacteria | 3731 |
| 53 | Ga0070660_100038938 | 3300005339 | Bacteria | 3612 |
| 54 | Ga0070660_100047344 | 3300005339 | Bacteria | 3299 |
| 55 | Ga0070660_100074301 | 3300005339 | Bacteria | 2660 |
| 56 | Ga0070660_100112457 | 3300005339 | Bacteria | 2168 |
| 57 | Ga0070660_100315231 | 3300005339 | Bacteria | 1284 |
| 58 | Ga0070660_100710743 | 3300005339 | Bacteria | 843 |
| 59 | Ga0070660_101089372 | 3300005339 | Bacteria | 676 |
| 60 | Ga0070660_101301634 | 3300005339 | Bacteria | 617 |
| 61 | Ga0070689_100474441 | 3300005340 | Bacteria | 1068 |
| 62 | Ga0070689_102137612 | 3300005340 | Bacteria | 513 |
| 63 | Ga0070691_10331966 | 3300005341 | Bacteria | 839 |
| 64 | Ga0070691_10434298 | 3300005341 | Bacteria | 747 |
| 65 | Ga0070687_100341763 | 3300005343 | Bacteria | 963 |
| 66 | Ga0070661_100060435 | 3300005344 | Bacteria | 2781 |
| 67 | Ga0070661_100086785 | 3300005344 | Bacteria | 2314 |
| 68 | Ga0070661_100088452 | 3300005344 | Bacteria | 2292 |
| 69 | Ga0070661_100806084 | 3300005344 | Bacteria | 771 |
| 70 | Ga0070661_101203562 | 3300005344 | Bacteria | 634 |
| 71 | Ga0070692_10003563 | 3300005345 | Bacteria | 6339 |
| 72 | Ga0070692_10127680 | 3300005345 | Bacteria | 1425 |
| 73 | Ga0070668_100013432 | 3300005347 | Bacteria | 6113 |
| 74 | Ga0070669_100879021 | 3300005353 | Unclassified | 765 |
| 75 | Ga0070669_101664512 | 3300005353 | Bacteria | 556 |
| 76 | Ga0070675_100966101 | 3300005354 | Bacteria | 782 |
| 77 | Ga0070671_100043036 | 3300005355 | Bacteria | 3755 |
| 78 | Ga0070671_100046873 | 3300005355 | Bacteria | 3595 |
| 79 | Ga0070671_100352536 | 3300005355 | Bacteria | 1256 |
| 80 | Ga0070674_100020000 | 3300005356 | Bacteria | 4266 |
| 81 | Ga0070674_100290390 | 3300005356 | Bacteria | 1300 |
| 82 | Ga0070674_100608806 | 3300005356 | Bacteria | 924 |
| 83 | Ga0070673_100451084 | 3300005364 | Bacteria | 1157 |
| 84 | Ga0070688_100040381 | 3300005365 | Bacteria | 2859 |
| 85 | Ga0070659_100019066 | 3300005366 | Bacteria | 5189 |
| 86 | Ga0070659_100047606 | 3300005366 | Bacteria | 3364 |
| 87 | Ga0070659_100490970 | 3300005366 | Bacteria | 1046 |
| 88 | Ga0070659_100703158 | 3300005366 | Bacteria | 874 |
| 89 | Ga0070659_100713563 | 3300005366 | Unclassified | 868 |
| 90 | Ga0070703_10004706 | 3300005406 | Bacteria | 3818 |
| 91 | Ga0070703_10140157 | 3300005406 | Unclassified | 898 |
| 92 | Ga0070703_10212949 | 3300005406 | Bacteria | 765 |
| 93 | Ga0070709_10017895 | 3300005434 | Bacteria | 4071 |
| 94 | Ga0070709_10023373 | 3300005434 | Bacteria | 3628 |
| 95 | Ga0070709_10123336 | 3300005434 | Bacteria | 1759 |
| 96 | Ga0070709_10127106 | 3300005434 | Bacteria | 1735 |
| 97 | Ga0070709_10182249 | 3300005434 | Bacteria | 1475 |
| 98 | Ga0070709_10531003 | 3300005434 | Bacteria | 898 |
| 99 | Ga0070709_10702835 | 3300005434 | Bacteria | 787 |
| 100 | Ga0070714_100028835 | 3300005435 | Bacteria | 4609 |
| 101 | Ga0070714_100046168 | 3300005435 | Bacteria | 3694 |
| 102 | Ga0070714_100056564 | 3300005435 | Bacteria | 3355 |
| 103 | Ga0070714_100084933 | 3300005435 | Bacteria | 2763 |
| 104 | Ga0070714_100092072 | 3300005435 | Bacteria | 2657 |
| 105 | Ga0070714_100170924 | 3300005435 | Bacteria | 1972 |
| 106 | Ga0070714_100223446 | 3300005435 | Bacteria | 1732 |
| 107 | Ga0070714_100236558 | 3300005435 | Bacteria | 1684 |
| 108 | Ga0070714_100240876 | 3300005435 | Bacteria | 1669 |
| 109 | Ga0070714_100285364 | 3300005435 | Bacteria | 1535 |
| 110 | Ga0070714_100292885 | 3300005435 | Bacteria | 1515 |
| 111 | Ga0070714_100400961 | 3300005435 | Unclassified | 1296 |
| 112 | Ga0070714_100488233 | 3300005435 | Bacteria | 1173 |
| 113 | Ga0070714_100714312 | 3300005435 | Bacteria | 967 |
| 114 | Ga0070714_101067530 | 3300005435 | Unclassified | 787 |
| 115 | Ga0070713_100001385 | 3300005436 | Bacteria | 15525 |
| 116 | Ga0070713_100049209 | 3300005436 | Bacteria | 3476 |
| 117 | Ga0070713_100106240 | 3300005436 | Bacteria | 2440 |
| 118 | Ga0070713_100275311 | 3300005436 | Bacteria | 1542 |
| 119 | Ga0070713_100287937 | 3300005436 | Bacteria | 1509 |
| 120 | Ga0070713_100359453 | 3300005436 | Bacteria | 1352 |
| 121 | Ga0070713_101408739 | 3300005436 | Bacteria | 676 |
| 122 | Ga0070713_101720823 | 3300005436 | Bacteria | 609 |
| 123 | Ga0070713_102203499 | 3300005436 | Bacteria | 534 |
| 124 | Ga0070710_10004423 | 3300005437 | Bacteria | 6645 |
| 125 | Ga0070710_10026574 | 3300005437 | Bacteria | 3077 |
| 126 | Ga0070710_10033117 | 3300005437 | Bacteria | 2804 |
| 127 | Ga0070710_10049662 | 3300005437 | Bacteria | 2347 |
| 128 | Ga0070710_10056845 | 3300005437 | Bacteria | 2215 |
| 129 | Ga0070710_10400848 | 3300005437 | Bacteria | 919 |
| 130 | Ga0070710_10498263 | 3300005437 | Bacteria | 833 |
| 131 | Ga0070701_10040106 | 3300005438 | Bacteria | 2378 |
| 132 | Ga0070701_10521768 | 3300005438 | Bacteria | 775 |
| 133 | Ga0070701_10524942 | 3300005438 | Unclassified | 773 |
| 134 | Ga0070711_100011720 | 3300005439 | Bacteria | 5451 |
| 135 | Ga0070711_100012459 | 3300005439 | Bacteria | 5314 |
| 136 | Ga0070711_100040909 | 3300005439 | Bacteria | 3128 |
| 137 | Ga0070711_100071933 | 3300005439 | Bacteria | 2439 |
| 138 | Ga0070711_100095375 | 3300005439 | Bacteria | 2153 |
| 139 | Ga0070711_100259062 | 3300005439 | Bacteria | 1367 |
| 140 | Ga0070711_100358015 | 3300005439 | Bacteria | 1175 |
| 141 | Ga0070711_100425544 | 3300005439 | Bacteria | 1083 |
| 142 | Ga0070711_100575308 | 3300005439 | Unclassified | 937 |
| 143 | Ga0070705_100027122 | 3300005440 | Bacteria | 3124 |
| 144 | Ga0070705_100042434 | 3300005440 | Bacteria | 2600 |
| 145 | Ga0070705_100161460 | 3300005440 | Bacteria | 1498 |
| 146 | Ga0070705_100210125 | 3300005440 | Bacteria | 1341 |
| 147 | Ga0070705_100229931 | 3300005440 | Bacteria | 1289 |
| 148 | Ga0070705_100284812 | 3300005440 | Bacteria | 1177 |
| 149 | Ga0070700_100060803 | 3300005441 | Bacteria | 2382 |
| 150 | Ga0070694_100013842 | 3300005444 | Bacteria | 5045 |
| 151 | Ga0070694_100090601 | 3300005444 | Bacteria | 2145 |
| 152 | Ga0070694_100106381 | 3300005444 | Bacteria | 1992 |
| 153 | Ga0070694_100259555 | 3300005444 | Bacteria | 1317 |
| 154 | Ga0070694_100464265 | 3300005444 | Unclassified | 1002 |
| 155 | Ga0070708_100021151 | 3300005445 | Bacteria | 5496 |
| 156 | Ga0070708_100121492 | 3300005445 | Bacteria | 2410 |
| 157 | Ga0070708_100165815 | 3300005445 | Bacteria | 2061 |
| 158 | Ga0070708_100181039 | 3300005445 | Unclassified | 1970 |
| 159 | Ga0070708_100196478 | 3300005445 | Bacteria | 1887 |
| 160 | Ga0070708_100430108 | 3300005445 | Bacteria | 1245 |
| 161 | Ga0070708_100892397 | 3300005445 | Bacteria | 835 |
| 162 | Ga0070663_100225578 | 3300005455 | Bacteria | 1473 |
| 163 | Ga0070663_100425281 | 3300005455 | Bacteria | 1090 |
| 164 | Ga0070663_101319931 | 3300005455 | Unclassified | 637 |
| 165 | Ga0070678_100010155 | 3300005456 | Bacteria | 5737 |
| 166 | Ga0070678_100045649 | 3300005456 | Bacteria | 3136 |
| 167 | Ga0070678_100094242 | 3300005456 | Bacteria | 2304 |
| 168 | Ga0070678_100728215 | 3300005456 | Bacteria | 896 |
| 169 | Ga0070678_101449407 | 3300005456 | Bacteria | 642 |
| 170 | Ga0070678_101552219 | 3300005456 | Bacteria | 621 |
| 171 | Ga0070678_101908759 | 3300005456 | Bacteria | 561 |
| 172 | Ga0070678_101966689 | 3300005456 | Bacteria | 553 |
| 173 | Ga0070681_10001242 | 3300005458 | Bacteria | 22193 |
| 174 | Ga0070681_10013046 | 3300005458 | Bacteria | 8252 |
| 175 | Ga0070681_10019025 | 3300005458 | Bacteria | 6874 |
| 176 | Ga0070681_10023346 | 3300005458 | Bacteria | 6219 |
| 177 | Ga0070681_10028889 | 3300005458 | Bacteria | 5571 |
| 178 | Ga0070681_10042573 | 3300005458 | Bacteria | 4550 |
| 179 | Ga0070681_10051422 | 3300005458 | Bacteria | 4110 |
| 180 | Ga0070681_10065624 | 3300005458 | Bacteria | 3598 |
| 181 | Ga0070681_10077379 | 3300005458 | Bacteria | 3285 |
| 182 | Ga0070681_10096415 | 3300005458 | Bacteria | 2906 |
| 183 | Ga0070681_10108064 | 3300005458 | Bacteria | 2722 |
| 184 | Ga0070681_10187899 | 3300005458 | Bacteria | 1986 |
| 185 | Ga0070681_10213474 | 3300005458 | Bacteria | 1846 |
| 186 | Ga0070681_10359317 | 3300005458 | Bacteria | 1366 |
| 187 | Ga0070681_10608961 | 3300005458 | Bacteria | 1007 |
| 188 | Ga0068867_100028830 | 3300005459 | Bacteria | 3997 |
| 189 | Ga0068867_100081773 | 3300005459 | Bacteria | 2436 |
| 190 | Ga0068867_100253810 | 3300005459 | Bacteria | 1431 |
| 191 | Ga0068867_100880084 | 3300005459 | Bacteria | 804 |
| 192 | Ga0070706_100043493 | 3300005467 | Bacteria | 4151 |
| 193 | Ga0070706_100137266 | 3300005467 | Bacteria | 2282 |
| 194 | Ga0070706_100201402 | 3300005467 | Bacteria | 1859 |
| 195 | Ga0070706_100235755 | 3300005467 | Bacteria | 1708 |
| 196 | Ga0070706_100284698 | 3300005467 | Bacteria | 1542 |
| 197 | Ga0070707_100009757 | 3300005468 | Bacteria | 8925 |
| 198 | Ga0070707_100023210 | 3300005468 | Bacteria | 5867 |
| 199 | Ga0070707_100069548 | 3300005468 | Bacteria | 3389 |
| 200 | Ga0070707_100290385 | 3300005468 | Bacteria | 1589 |
| 201 | Ga0070707_101702177 | 3300005468 | Bacteria | 598 |
| 202 | Ga0070707_101882547 | 3300005468 | Unclassified | 565 |
| 203 | Ga0070698_100010227 | 3300005471 | Bacteria | 10020 |
| 204 | Ga0070698_100025668 | 3300005471 | Bacteria | 6139 |
| 205 | Ga0070698_100055291 | 3300005471 | Bacteria | 4026 |
| 206 | Ga0070698_100305002 | 3300005471 | Bacteria | 1523 |
| 207 | Ga0070698_101201140 | 3300005471 | Bacteria | 708 |
| 208 | Ga0070698_101429049 | 3300005471 | Bacteria | 643 |
| 209 | Ga0070698_101683858 | 3300005471 | Bacteria | 587 |
| 210 | Ga0070699_100029838 | 3300005518 | Bacteria | 4703 |
| 211 | Ga0070699_100078981 | 3300005518 | Bacteria | 2866 |
| 212 | Ga0070699_100160571 | 3300005518 | Bacteria | 1989 |
| 213 | Ga0070699_100211051 | 3300005518 | Bacteria | 1728 |
| 214 | Ga0070699_100653334 | 3300005518 | Bacteria | 960 |
| 215 | Ga0070699_100696827 | 3300005518 | Bacteria | 928 |
| 216 | Ga0070679_100002714 | 3300005530 | Bacteria | 16116 |
| 217 | Ga0070679_100003063 | 3300005530 | Bacteria | 15280 |
| 218 | Ga0070679_100004177 | 3300005530 | Bacteria | 13315 |
| 219 | Ga0070679_100008713 | 3300005530 | Bacteria | 9562 |
| 220 | Ga0070679_100025308 | 3300005530 | Bacteria | 5822 |
| 221 | Ga0070679_100033799 | 3300005530 | Bacteria | 5064 |
| 222 | Ga0070679_100040623 | 3300005530 | Bacteria | 4628 |
| 223 | Ga0070679_100097900 | 3300005530 | Bacteria | 2921 |
| 224 | Ga0070679_100100501 | 3300005530 | Bacteria | 2878 |
| 225 | Ga0070679_100107428 | 3300005530 | Bacteria | 2776 |
| 226 | Ga0070679_100149742 | 3300005530 | Unclassified | 2311 |
| 227 | Ga0070679_100209394 | 3300005530 | Archaea | 1914 |
| 228 | Ga0070679_100254456 | 3300005530 | Bacteria | 1712 |
| 229 | Ga0070679_100254828 | 3300005530 | Bacteria | 1710 |
| 230 | Ga0070679_100261912 | 3300005530 | Bacteria | 1684 |
| 231 | Ga0070679_100269761 | 3300005530 | Bacteria | 1656 |
| 232 | Ga0070679_100326036 | 3300005530 | Bacteria | 1484 |
| 233 | Ga0070679_101307909 | 3300005530 | Bacteria | 671 |
| 234 | Ga0070684_100000634 | 3300005535 | Bacteria | 24130 |
| 235 | Ga0070684_100001095 | 3300005535 | Bacteria | 19436 |
| 236 | Ga0070684_100009770 | 3300005535 | Bacteria | 7575 |
| 237 | Ga0070684_100012986 | 3300005535 | Bacteria | 6699 |
| 238 | Ga0070684_100017852 | 3300005535 | Bacteria | 5832 |
| 239 | Ga0070684_100035568 | 3300005535 | Bacteria | 4264 |
| 240 | Ga0070684_100041689 | 3300005535 | Bacteria | 3959 |
| 241 | Ga0070684_100115181 | 3300005535 | Bacteria | 2414 |
| 242 | Ga0070684_100172679 | 3300005535 | Bacteria | 1963 |
| 243 | Ga0070684_100256642 | 3300005535 | Bacteria | 1598 |
| 244 | Ga0070684_100275496 | 3300005535 | Bacteria | 1541 |
| 245 | Ga0070684_101480245 | 3300005535 | Bacteria | 640 |
| 246 | Ga0070684_102246469 | 3300005535 | Bacteria | 515 |
| 247 | Ga0070697_100136942 | 3300005536 | Bacteria | 2057 |
| 248 | Ga0070697_100352380 | 3300005536 | Bacteria | 1271 |
| 249 | Ga0070697_100793715 | 3300005536 | Bacteria | 838 |
| 250 | Ga0068853_100069721 | 3300005539 | Bacteria | 3059 |
| 251 | Ga0068853_100353736 | 3300005539 | Bacteria | 1367 |
| 252 | Ga0068853_100675639 | 3300005539 | Bacteria | 984 |
| 253 | Ga0068853_101183623 | 3300005539 | Bacteria | 738 |
| 254 | Ga0068853_101637044 | 3300005539 | Unclassified | 624 |
| 255 | Ga0070686_100053085 | 3300005544 | Bacteria | 2586 |
| 256 | Ga0070686_100092266 | 3300005544 | Bacteria | 2028 |
| 257 | Ga0070686_100092533 | 3300005544 | Bacteria | 2025 |
| 258 | Ga0070686_100799943 | 3300005544 | Bacteria | 760 |
| 259 | Ga0070695_100000149 | 3300005545 | Bacteria | 32802 |
| 260 | Ga0070695_100105738 | 3300005545 | Bacteria | 1902 |
| 261 | Ga0070695_100484809 | 3300005545 | Bacteria | 953 |
| 262 | Ga0070695_100932749 | 3300005545 | Bacteria | 703 |
| 263 | Ga0070695_101004550 | 3300005545 | Bacteria | 679 |
| 264 | Ga0070696_100013480 | 3300005546 | Bacteria | 5485 |
| 265 | Ga0070696_100075151 | 3300005546 | Bacteria | 2383 |
| 266 | Ga0070696_100085664 | 3300005546 | Bacteria | 2236 |
| 267 | Ga0070696_100124018 | 3300005546 | Bacteria | 1872 |
| 268 | Ga0070696_100355183 | 3300005546 | Bacteria | 1136 |
| 269 | Ga0070696_100386439 | 3300005546 | Bacteria | 1092 |
| 270 | Ga0070696_100517404 | 3300005546 | Bacteria | 952 |
| 271 | Ga0070696_101106618 | 3300005546 | Unclassified | 666 |
| 272 | Ga0070696_101107165 | 3300005546 | Unclassified | 666 |
| 273 | Ga0070696_101656264 | 3300005546 | Bacteria | 551 |
| 274 | Ga0070696_101884421 | 3300005546 | Bacteria | 518 |
| 275 | Ga0070693_100024148 | 3300005547 | Bacteria | 3256 |
| 276 | Ga0070693_100219174 | 3300005547 | Bacteria | 1246 |
| 277 | Ga0070693_100222624 | 3300005547 | Bacteria | 1237 |
| 278 | Ga0070693_100276086 | 3300005547 | Bacteria | 1124 |
| 279 | Ga0070693_100491704 | 3300005547 | Bacteria | 869 |
| 280 | Ga0070665_100015545 | 3300005548 | Bacteria | 7646 |
| 281 | Ga0070704_100024006 | 3300005549 | Bacteria | 3994 |
| 282 | Ga0070704_100191457 | 3300005549 | Bacteria | 1644 |
| 283 | Ga0070704_100209814 | 3300005549 | Bacteria | 1577 |
| 284 | Ga0070704_100428818 | 3300005549 | Bacteria | 1134 |
| 285 | Ga0070704_100496955 | 3300005549 | Bacteria | 1058 |
| 286 | Ga0070704_101232193 | 3300005549 | Bacteria | 683 |
| 287 | Ga0068855_100007584 | 3300005563 | Bacteria | 13127 |
| 288 | Ga0068855_100032107 | 3300005563 | Bacteria | 6269 |
| 289 | Ga0068855_100043181 | 3300005563 | Bacteria | 5341 |
| 290 | Ga0068855_100106284 | 3300005563 | Bacteria | 3226 |
| 291 | Ga0068855_100216726 | 3300005563 | Bacteria | 2148 |
| 292 | Ga0068855_100506102 | 3300005563 | Bacteria | 1312 |
| 293 | Ga0068855_100513656 | 3300005563 | Bacteria | 1301 |
| 294 | Ga0068855_100586154 | 3300005563 | Bacteria | 1204 |
| 295 | Ga0068855_100601229 | 3300005563 | Bacteria | 1186 |
| 296 | Ga0068855_100838960 | 3300005563 | Bacteria | 974 |
| 297 | Ga0068855_100843166 | 3300005563 | Bacteria | 972 |
| 298 | Ga0068855_101498589 | 3300005563 | Bacteria | 693 |
| 299 | Ga0070664_100491758 | 3300005564 | Bacteria | 1130 |
| 300 | Ga0070664_100601216 | 3300005564 | Unclassified | 1020 |
| 301 | Ga0070664_100611796 | 3300005564 | Bacteria | 1011 |
| 302 | Ga0070664_101096333 | 3300005564 | Bacteria | 750 |
| 303 | Ga0068857_100052206 | 3300005577 | Bacteria | 3627 |
| 304 | Ga0068857_100128207 | 3300005577 | Bacteria | 2287 |
| 305 | Ga0068857_100148013 | 3300005577 | Bacteria | 2125 |
| 306 | Ga0068857_100721695 | 3300005577 | Bacteria | 948 |
| 307 | Ga0068857_101626126 | 3300005577 | Bacteria | 631 |
| 308 | Ga0068854_100168208 | 3300005578 | Bacteria | 1703 |
| 309 | Ga0068854_100328269 | 3300005578 | Bacteria | 1246 |
| 310 | Ga0068854_100945290 | 3300005578 | Bacteria | 760 |
| 311 | Ga0068854_101805155 | 3300005578 | Bacteria | 561 |
| 312 | Ga0068856_100005850 | 3300005614 | Bacteria | 12119 |
| 313 | Ga0068856_100029736 | 3300005614 | Bacteria | 5336 |
| 314 | Ga0068856_100059390 | 3300005614 | Bacteria | 3778 |
| 315 | Ga0068856_100067378 | 3300005614 | Bacteria | 3538 |
| 316 | Ga0068856_100073506 | 3300005614 | Bacteria | 3385 |
| 317 | Ga0068856_100084897 | 3300005614 | Bacteria | 3145 |
| 318 | Ga0068856_100106040 | 3300005614 | Bacteria | 2804 |
| 319 | Ga0068856_100108111 | 3300005614 | Bacteria | 2777 |
| 320 | Ga0068856_100184179 | 3300005614 | Bacteria | 2102 |
| 321 | Ga0068856_100193144 | 3300005614 | Bacteria | 2049 |
| 322 | Ga0068856_100280290 | 3300005614 | Bacteria | 1684 |
| 323 | Ga0068856_100285395 | 3300005614 | Bacteria | 1667 |
| 324 | Ga0068856_100633706 | 3300005614 | Bacteria | 1090 |
| 325 | Ga0068856_100651260 | 3300005614 | Bacteria | 1074 |
| 326 | Ga0068856_100936609 | 3300005614 | Unclassified | 885 |
| 327 | Ga0070702_100030227 | 3300005615 | Bacteria | 2951 |
| 328 | Ga0070702_100059691 | 3300005615 | Bacteria | 2214 |
| 329 | Ga0070702_100133455 | 3300005615 | Bacteria | 1571 |
| 330 | Ga0070702_100137437 | 3300005615 | Bacteria | 1552 |
| 331 | Ga0070702_100203691 | 3300005615 | Bacteria | 1312 |
| 332 | Ga0070702_100368934 | 3300005615 | Bacteria | 1017 |
| 333 | Ga0070702_100396548 | 3300005615 | Bacteria | 986 |
| 334 | Ga0070702_101480695 | 3300005615 | Bacteria | 558 |
| 335 | Ga0068852_100026148 | 3300005616 | Bacteria | 4739 |
| 336 | Ga0068852_100040177 | 3300005616 | Bacteria | 3945 |
| 337 | Ga0068852_100070992 | 3300005616 | Bacteria | 3057 |
| 338 | Ga0068852_100269603 | 3300005616 | Bacteria | 1638 |
| 339 | Ga0068852_100790557 | 3300005616 | Bacteria | 963 |
| 340 | Ga0068852_100934740 | 3300005616 | Bacteria | 885 |
| 341 | Ga0068852_101610983 | 3300005616 | Bacteria | 672 |
| 342 | Ga0068852_101857816 | 3300005616 | Bacteria | 625 |
| 343 | Ga0068859_100159693 | 3300005617 | Bacteria | 2333 |
| 344 | Ga0068859_100507915 | 3300005617 | Bacteria | 1300 |
| 345 | Ga0068864_100883778 | 3300005618 | Bacteria | 882 |
| 346 | Ga0068864_101839956 | 3300005618 | Unclassified | 611 |
| 347 | Ga0068866_10013281 | 3300005718 | Bacteria | 3610 |
| 348 | Ga0068861_100136643 | 3300005719 | Bacteria | 1995 |
| 349 | Ga0068861_100327242 | 3300005719 | Bacteria | 1337 |
| 350 | Ga0068861_100607123 | 3300005719 | Bacteria | 1005 |
| 351 | Ga0068861_100780972 | 3300005719 | Unclassified | 895 |
| 352 | Ga0068870_10248381 | 3300005840 | Bacteria | 1102 |
| 353 | Ga0068863_100779696 | 3300005841 | Bacteria | 953 |
| 354 | Ga0068863_101416066 | 3300005841 | Bacteria | 703 |
| 355 | Ga0068858_100629348 | 3300005842 | Bacteria | 1042 |
| 356 | Ga0068860_100045868 | 3300005843 | Bacteria | 4168 |
| 357 | Ga0068860_102076824 | 3300005843 | Bacteria | 590 |
| 358 | Ga0068862_100067203 | 3300005844 | Bacteria | 3090 |
| 359 | Ga0068862_100117096 | 3300005844 | Bacteria | 2345 |
| 360 | Ga0081455_10124410 | 3300005937 | Bacteria | 2026 |
| 361 | Ga0081455_10518823 | 3300005937 | Bacteria | 796 |
| 362 | Ga0081538_10034811 | 3300005981 | Bacteria | 3321 |
| 363 | Ga0081540_1002235 | 3300005983 | Bacteria | 15947 |
| 364 | Ga0081540_1026664 | 3300005983 | Bacteria | 3291 |
| 365 | Ga0070717_10003333 | 3300006028 | Bacteria | 11468 |
| 366 | Ga0070717_10041814 | 3300006028 | Bacteria | 3737 |
| 367 | Ga0070717_10083984 | 3300006028 | Bacteria | 2678 |
| 368 | Ga0070717_10093381 | 3300006028 | Bacteria | 2543 |
| 369 | Ga0070717_10116255 | 3300006028 | Bacteria | 2287 |
| 370 | Ga0070717_10168699 | 3300006028 | Bacteria | 1903 |
| 371 | Ga0070717_10242891 | 3300006028 | Bacteria | 1589 |
| 372 | Ga0070717_10453528 | 3300006028 | Bacteria | 1156 |
| 373 | Ga0070717_10845184 | 3300006028 | Bacteria | 833 |
| 374 | Ga0075365_10075561 | 3300006038 | Bacteria | 2274 |
| 375 | Ga0075365_10179228 | 3300006038 | Bacteria | 1481 |
| 376 | Ga0075432_10036241 | 3300006058 | Bacteria | 1714 |
| 377 | Ga0075432_10126901 | 3300006058 | Bacteria | 963 |
| 378 | Ga0070715_10002066 | 3300006163 | Bacteria | 6058 |
| 379 | Ga0070715_10005055 | 3300006163 | Bacteria | 4374 |
| 380 | Ga0070715_10057194 | 3300006163 | Bacteria | 1699 |
| 381 | Ga0070715_10074650 | 3300006163 | Bacteria | 1524 |
| 382 | Ga0070715_10406901 | 3300006163 | Bacteria | 758 |
| 383 | Ga0070716_100010488 | 3300006173 | Bacteria | 4646 |
| 384 | Ga0070716_100071624 | 3300006173 | Bacteria | 2038 |
| 385 | Ga0070716_100092788 | 3300006173 | Bacteria | 1831 |
| 386 | Ga0070716_100385000 | 3300006173 | Bacteria | 1004 |
| 387 | Ga0070712_100009318 | 3300006175 | Bacteria | 6187 |
| 388 | Ga0070712_100015768 | 3300006175 | Bacteria | 4871 |
| 389 | Ga0070712_100015819 | 3300006175 | Bacteria | 4864 |
| 390 | Ga0070712_100040377 | 3300006175 | Bacteria | 3199 |
| 391 | Ga0070712_100063298 | 3300006175 | Bacteria | 2618 |
| 392 | Ga0070712_100122379 | 3300006175 | Unclassified | 1959 |
| 393 | Ga0070712_100139598 | 3300006175 | Bacteria | 1847 |
| 394 | Ga0070712_100154799 | 3300006175 | Bacteria | 1764 |
| 395 | Ga0070712_100340568 | 3300006175 | Bacteria | 1224 |
| 396 | Ga0070712_100436683 | 3300006175 | Bacteria | 1088 |
| 397 | Ga0070712_100585071 | 3300006175 | Unclassified | 943 |
| 398 | Ga0070712_100649023 | 3300006175 | Unclassified | 896 |
| 399 | Ga0070712_100662329 | 3300006175 | Bacteria | 888 |
| 400 | Ga0070712_101410614 | 3300006175 | Unclassified | 608 |
| 401 | Ga0097621_100308869 | 3300006237 | Bacteria | 1398 |
| 402 | Ga0068871_100004038 | 3300006358 | Bacteria | 10141 |
| 403 | Ga0068871_100122770 | 3300006358 | Bacteria | 2196 |
| 404 | Ga0068871_100191377 | 3300006358 | Bacteria | 1762 |
| 405 | Ga0068871_100408102 | 3300006358 | Bacteria | 1211 |
| 406 | Ga0068871_100491063 | 3300006358 | Bacteria | 1106 |
| 407 | Ga0068871_100608126 | 3300006358 | Unclassified | 995 |
| 408 | Ga0075428_101108153 | 3300006844 | Bacteria | 836 |
| 409 | Ga0075431_100028374 | 3300006847 | Bacteria | 5750 |
| 410 | Ga0075431_100143449 | 3300006847 | Bacteria | 2461 |
| 411 | Ga0075431_100384711 | 3300006847 | Bacteria | 1406 |
| 412 | Ga0075431_101049626 | 3300006847 | Unclassified | 781 |
| 413 | Ga0075431_101852658 | 3300006847 | Bacteria | 559 |
| 414 | Ga0075433_10000234 | 3300006852 | Bacteria | 31714 |
| 415 | Ga0075433_10010777 | 3300006852 | Bacteria | 7351 |
| 416 | Ga0075433_10036141 | 3300006852 | Bacteria | 4253 |
| 417 | Ga0075433_10066498 | 3300006852 | Bacteria | 3163 |
| 418 | Ga0075433_10093461 | 3300006852 | Bacteria | 2661 |
| 419 | Ga0075433_10179930 | 3300006852 | Bacteria | 1881 |
| 420 | Ga0075433_10204458 | 3300006852 | Bacteria | 1755 |
| 421 | Ga0075433_10321968 | 3300006852 | Bacteria | 1368 |
| 422 | Ga0075433_10388230 | 3300006852 | Bacteria | 1232 |
| 423 | Ga0075433_10567591 | 3300006852 | Bacteria | 997 |
| 424 | Ga0075433_11421051 | 3300006852 | Unclassified | 600 |
| 425 | Ga0075433_11483405 | 3300006852 | Bacteria | 586 |
| 426 | Ga0075434_100004422 | 3300006871 | Bacteria | 12671 |
| 427 | Ga0075434_100071055 | 3300006871 | Bacteria | 3472 |
| 428 | Ga0075434_100140704 | 3300006871 | Bacteria | 2432 |
| 429 | Ga0075434_100373976 | 3300006871 | Bacteria | 1446 |
| 430 | Ga0075434_100384317 | 3300006871 | Unclassified | 1425 |
| 431 | Ga0075434_100499372 | 3300006871 | Bacteria | 1237 |
| 432 | Ga0075434_100650344 | 3300006871 | Bacteria | 1072 |
| 433 | Ga0075434_100668418 | 3300006871 | Bacteria | 1057 |
| 434 | Ga0075434_100788371 | 3300006871 | Bacteria | 967 |
| 435 | Ga0075434_100908203 | 3300006871 | Bacteria | 895 |
| 436 | Ga0068865_100002544 | 3300006881 | Bacteria | 10808 |
| 437 | Ga0068865_100113633 | 3300006881 | Bacteria | 2001 |
| 438 | Ga0068865_100223836 | 3300006881 | Bacteria | 1472 |
| 439 | Ga0075436_100007169 | 3300006914 | Bacteria | 7626 |
| 440 | Ga0075436_100014405 | 3300006914 | Bacteria | 5414 |
| 441 | Ga0075436_100052256 | 3300006914 | Bacteria | 2820 |
| 442 | Ga0075436_100139650 | 3300006914 | Bacteria | 1702 |
| 443 | Ga0097620_100159695 | 3300006931 | Bacteria | 2333 |
| 444 | Ga0097620_100507915 | 3300006931 | Bacteria | 1300 |
| 445 | Ga0075435_100004443 | 3300007076 | Bacteria | 9634 |
| 446 | Ga0075435_100005187 | 3300007076 | Bacteria | 9062 |
| 447 | Ga0075435_100030814 | 3300007076 | Bacteria | 4221 |
| 448 | Ga0075435_100036941 | 3300007076 | Bacteria | 3886 |
| 449 | Ga0075435_100050817 | 3300007076 | Bacteria | 3337 |
| 450 | Ga0075435_100289067 | 3300007076 | Bacteria | 1400 |
| 451 | Ga0075435_101547354 | 3300007076 | Bacteria | 582 |
| 452 | Ga0099795_10312983 | 3300007788 | Bacteria | 693 |
| 453 | Ga0105244_10393381 | 3300009036 | Bacteria | 638 |
| 454 | Ga0105240_10020003 | 3300009093 | Bacteria | 8937 |
| 455 | Ga0105240_10092626 | 3300009093 | Bacteria | 3690 |
| 456 | Ga0105240_10133761 | 3300009093 | Bacteria | 2971 |
| 457 | Ga0105240_10141561 | 3300009093 | Bacteria | 2875 |
| 458 | Ga0105240_10182685 | 3300009093 | Bacteria | 2474 |
| 459 | Ga0105240_10272459 | 3300009093 | Bacteria | 1948 |
| 460 | Ga0105240_10425326 | 3300009093 | Bacteria | 1491 |
| 461 | Ga0105240_10435580 | 3300009093 | Bacteria | 1470 |
| 462 | Ga0105240_10640305 | 3300009093 | Bacteria | 1166 |
| 463 | Ga0105240_11382467 | 3300009093 | Bacteria | 740 |
| 464 | Ga0111539_10201203 | 3300009094 | Bacteria | 2323 |
| 465 | Ga0111539_10293607 | 3300009094 | Bacteria | 1891 |
| 466 | Ga0111539_11950381 | 3300009094 | Bacteria | 681 |
| 467 | Ga0111539_12010099 | 3300009094 | Bacteria | 670 |
| 468 | Ga0105245_10038631 | 3300009098 | Bacteria | 4247 |
| 469 | Ga0105245_10039040 | 3300009098 | Bacteria | 4226 |
| 470 | Ga0105245_10133867 | 3300009098 | Bacteria | 2327 |
| 471 | Ga0105245_10196137 | 3300009098 | Bacteria | 1937 |
| 472 | Ga0105245_10408868 | 3300009098 | Bacteria | 1358 |
| 473 | Ga0105245_10556325 | 3300009098 | Bacteria | 1169 |
| 474 | Ga0105245_10583528 | 3300009098 | Bacteria | 1143 |
| 475 | Ga0105245_10610048 | 3300009098 | Bacteria | 1118 |
| 476 | Ga0105245_10690795 | 3300009098 | Bacteria | 1053 |
| 477 | Ga0105245_11185071 | 3300009098 | Bacteria | 811 |
| 478 | Ga0105245_11496094 | 3300009098 | Bacteria | 726 |
| 479 | Ga0105245_11762534 | 3300009098 | Unclassified | 672 |
| 480 | Ga0105247_10225374 | 3300009101 | Bacteria | 1271 |
| 481 | Ga0105247_11670328 | 3300009101 | Bacteria | 525 |
| 482 | Ga0114129_10010266 | 3300009147 | Bacteria | 13362 |
| 483 | Ga0114129_10033703 | 3300009147 | Bacteria | 7236 |
| 484 | Ga0114129_10124835 | 3300009147 | Bacteria | 3540 |
| 485 | Ga0114129_10485830 | 3300009147 | Bacteria | 1615 |
| 486 | Ga0114129_10598034 | 3300009147 | Bacteria | 1429 |
| 487 | Ga0114129_10888454 | 3300009147 | Bacteria | 1130 |
| 488 | Ga0114129_11055888 | 3300009147 | Bacteria | 1019 |
| 489 | Ga0105243_10028603 | 3300009148 | Bacteria | 4280 |
| 490 | Ga0105243_10251139 | 3300009148 | Bacteria | 1579 |
| 491 | Ga0105243_10311261 | 3300009148 | Bacteria | 1431 |
| 492 | Ga0105243_10542943 | 3300009148 | Archaea | 1109 |
| 493 | Ga0105243_10688683 | 3300009148 | Bacteria | 995 |
| 494 | Ga0105243_10840728 | 3300009148 | Unclassified | 908 |
| 495 | Ga0105243_10880820 | 3300009148 | Bacteria | 889 |
| 496 | Ga0105243_10972234 | 3300009148 | Bacteria | 850 |
| 497 | Ga0105243_11080792 | 3300009148 | Bacteria | 809 |
| 498 | Ga0105243_11189443 | 3300009148 | Unclassified | 775 |
| 499 | Ga0105243_11318962 | 3300009148 | Bacteria | 739 |
| 500 | Ga0105241_10031940 | 3300009174 | Bacteria | 3943 |
| 501 | Ga0105241_10046297 | 3300009174 | Bacteria | 3303 |
| 502 | Ga0105241_10079452 | 3300009174 | Bacteria | 2565 |
| 503 | Ga0105241_10104276 | 3300009174 | Bacteria | 2259 |
| 504 | Ga0105241_10287181 | 3300009174 | Bacteria | 1407 |
| 505 | Ga0105241_10402576 | 3300009174 | Unclassified | 1201 |
| 506 | Ga0105241_10490765 | 3300009174 | Bacteria | 1093 |
| 507 | Ga0105241_12195476 | 3300009174 | Bacteria | 547 |
| 508 | Ga0105242_10006583 | 3300009176 | Bacteria | 8949 |
| 509 | Ga0105242_10033342 | 3300009176 | Bacteria | 4123 |
| 510 | Ga0105242_10128870 | 3300009176 | Bacteria | 2181 |
| 511 | Ga0105242_10207246 | 3300009176 | Bacteria | 1745 |
| 512 | Ga0105242_10229933 | 3300009176 | Bacteria | 1662 |
| 513 | Ga0105242_10355360 | 3300009176 | Bacteria | 1355 |
| 514 | Ga0105242_10418824 | 3300009176 | Bacteria | 1254 |
| 515 | Ga0105242_10501721 | 3300009176 | Bacteria | 1154 |
| 516 | Ga0105242_10557638 | 3300009176 | Bacteria | 1100 |
| 517 | Ga0105248_10015477 | 3300009177 | Bacteria | 8409 |
| 518 | Ga0105248_10381449 | 3300009177 | Unclassified | 1587 |
| 519 | Ga0105248_10777088 | 3300009177 | Bacteria | 1081 |
| 520 | Ga0105248_11034067 | 3300009177 | Unclassified | 928 |
| 521 | Ga0105248_11225327 | 3300009177 | Bacteria | 849 |
| 522 | Ga0105248_11752982 | 3300009177 | Bacteria | 704 |
| 523 | Ga0105248_12182794 | 3300009177 | Bacteria | 630 |
| 524 | Ga0105237_10021997 | 3300009545 | Bacteria | 6546 |
| 525 | Ga0105237_10053974 | 3300009545 | Bacteria | 4028 |
| 526 | Ga0105237_10064887 | 3300009545 | Bacteria | 3647 |
| 527 | Ga0105237_10207702 | 3300009545 | Bacteria | 1958 |
| 528 | Ga0105237_10208430 | 3300009545 | Bacteria | 1955 |
| 529 | Ga0105237_10989364 | 3300009545 | Bacteria | 848 |
| 530 | Ga0105237_11147742 | 3300009545 | Bacteria | 784 |
| 531 | Ga0105238_10042846 | 3300009551 | Bacteria | 4582 |
| 532 | Ga0105238_10085418 | 3300009551 | Bacteria | 3143 |
| 533 | Ga0105238_10715963 | 3300009551 | Bacteria | 1013 |
| 534 | Ga0105238_10933842 | 3300009551 | Bacteria | 887 |
| 535 | Ga0105249_10053947 | 3300009553 | Bacteria | 3675 |
| 536 | Ga0105249_10144561 | 3300009553 | Bacteria | 2284 |
| 537 | Ga0105249_10161606 | 3300009553 | Bacteria | 2165 |
| 538 | Ga0105249_10289899 | 3300009553 | Bacteria | 1638 |
| 539 | Ga0105239_10021863 | 3300010375 | Bacteria | 7051 |
| 540 | Ga0105239_10095199 | 3300010375 | Bacteria | 3290 |
| 541 | Ga0105239_10551159 | 3300010375 | Bacteria | 1313 |
| 542 | Ga0105239_10555505 | 3300010375 | Bacteria | 1308 |
| 543 | Ga0105239_11816970 | 3300010375 | Bacteria | 706 |
| 544 | Ga0105239_11818473 | 3300010375 | Unclassified | 706 |
| 545 | Ga0105239_12187089 | 3300010375 | Bacteria | 643 |
| 546 | Ga0105239_12196874 | 3300010375 | Bacteria | 642 |
| 547 | Ga0105239_12787022 | 3300010375 | Bacteria | 570 |
| 548 | Ga0105246_10153466 | 3300011119 | Bacteria | 1746 |
| 549 | Ga0105246_10215989 | 3300011119 | Bacteria | 1500 |
| 550 | Ga0157340_1009891 | 3300012473 | Bacteria | 662 |
| 551 | Ga0157340_1019491 | 3300012473 | Bacteria | 561 |
| 552 | Ga0157329_1035890 | 3300012491 | Bacteria | 536 |
| 553 | Ga0157338_1001489 | 3300012515 | Bacteria | 1686 |
| 554 | Ga0157373_10139196 | 3300013100 | Bacteria | 1707 |
| 555 | Ga0157373_10140835 | 3300013100 | Bacteria | 1696 |
| 556 | Ga0157373_10210799 | 3300013100 | Bacteria | 1370 |
| 557 | Ga0157373_10858979 | 3300013100 | Bacteria | 672 |
| 558 | Ga0157373_11264629 | 3300013100 | Bacteria | 558 |
| 559 | Ga0157371_10221787 | 3300013102 | Bacteria | 1358 |
| 560 | Ga0157371_10270943 | 3300013102 | Bacteria | 1225 |
| 561 | Ga0157371_10398773 | 3300013102 | Bacteria | 1006 |
| 562 | Ga0157371_10490224 | 3300013102 | Bacteria | 907 |
| 563 | Ga0157371_10492456 | 3300013102 | Bacteria | 905 |
| 564 | Ga0157371_10799652 | 3300013102 | Bacteria | 711 |
| 565 | Ga0157371_10840313 | 3300013102 | Bacteria | 694 |
| 566 | Ga0157370_10004179 | 3300013104 | Bacteria | 16709 |
| 567 | Ga0157370_10030932 | 3300013104 | Bacteria | 5242 |
| 568 | Ga0157370_10075505 | 3300013104 | Bacteria | 3177 |
| 569 | Ga0157370_10235463 | 3300013104 | Bacteria | 1694 |
| 570 | Ga0157370_10277534 | 3300013104 | Bacteria | 1548 |
| 571 | Ga0157370_10288527 | 3300013104 | Bacteria | 1516 |
| 572 | Ga0157370_10353586 | 3300013104 | Bacteria | 1354 |
| 573 | Ga0157369_10005342 | 3300013105 | Bacteria | 14966 |
| 574 | Ga0157369_10037155 | 3300013105 | Bacteria | 5333 |
| 575 | Ga0157369_10037291 | 3300013105 | Bacteria | 5322 |
| 576 | Ga0157369_10176788 | 3300013105 | Bacteria | 2247 |
| 577 | Ga0157369_10205525 | 3300013105 | Bacteria | 2066 |
| 578 | Ga0157369_10358034 | 3300013105 | Bacteria | 1515 |
| 579 | Ga0157369_10409315 | 3300013105 | Bacteria | 1407 |
| 580 | Ga0157369_10536911 | 3300013105 | Unclassified | 1209 |
| 581 | Ga0157369_10561378 | 3300013105 | Bacteria | 1179 |
| 582 | Ga0157369_10610589 | 3300013105 | Bacteria | 1126 |
| 583 | Ga0157369_10846707 | 3300013105 | Bacteria | 939 |
| 584 | Ga0157369_10851924 | 3300013105 | Unclassified | 936 |
| 585 | Ga0157369_11343692 | 3300013105 | Bacteria | 728 |
| 586 | Ga0157374_10058576 | 3300013296 | Bacteria | 3600 |
| 587 | Ga0157374_10069343 | 3300013296 | Bacteria | 3320 |
| 588 | Ga0157374_10097387 | 3300013296 | Bacteria | 2815 |
| 589 | Ga0157374_10198977 | 3300013296 | Bacteria | 1962 |
| 590 | Ga0157374_10522726 | 3300013296 | Bacteria | 1193 |
| 591 | Ga0157374_10624159 | 3300013296 | Bacteria | 1089 |
| 592 | Ga0157374_11497534 | 3300013296 | Bacteria | 698 |
| 593 | Ga0157378_10244342 | 3300013297 | Bacteria | 1716 |
| 594 | Ga0157378_10268584 | 3300013297 | Unclassified | 1640 |
| 595 | Ga0157378_11240292 | 3300013297 | Unclassified | 786 |
| 596 | Ga0163162_10195359 | 3300013306 | Bacteria | 2152 |
| 597 | Ga0163162_10284009 | 3300013306 | Bacteria | 1787 |
| 598 | Ga0163162_10504085 | 3300013306 | Bacteria | 1341 |
| 599 | Ga0157372_10012713 | 3300013307 | Bacteria | 8966 |
| 600 | Ga0157372_10022568 | 3300013307 | Bacteria | 6811 |
| 601 | Ga0157372_10106332 | 3300013307 | Bacteria | 3210 |
| 602 | Ga0157372_10110209 | 3300013307 | Bacteria | 3153 |
| 603 | Ga0157372_10113951 | 3300013307 | Bacteria | 3099 |
| 604 | Ga0157372_10128688 | 3300013307 | Bacteria | 2912 |
| 605 | Ga0157372_10149835 | 3300013307 | Bacteria | 2692 |
| 606 | Ga0157372_10303254 | 3300013307 | Bacteria | 1858 |
| 607 | Ga0157372_10580179 | 3300013307 | Bacteria | 1307 |
| 608 | Ga0157372_10771748 | 3300013307 | Bacteria | 1117 |
| 609 | Ga0157372_11994921 | 3300013307 | Bacteria | 667 |
| 610 | Ga0157372_12156146 | 3300013307 | Bacteria | 640 |
| 611 | Ga0157375_10188691 | 3300013308 | Bacteria | 2216 |
| 612 | Ga0157375_10580016 | 3300013308 | Bacteria | 1282 |
| 613 | Ga0157375_11224460 | 3300013308 | Bacteria | 881 |
| 614 | Ga0157375_11696372 | 3300013308 | Bacteria | 748 |
| 615 | Ga0157375_12660126 | 3300013308 | Bacteria | 598 |
| 616 | Ga0163163_10103660 | 3300014325 | Bacteria | 2869 |
| 617 | Ga0163163_10177306 | 3300014325 | Unclassified | 2178 |
| 618 | Ga0163163_10317257 | 3300014325 | Bacteria | 1612 |
| 619 | Ga0163163_10693821 | 3300014325 | Bacteria | 1082 |
| 620 | Ga0163163_11326689 | 3300014325 | Unclassified | 781 |
| 621 | Ga0163163_11890387 | 3300014325 | Bacteria | 657 |
| 622 | Ga0157380_10075326 | 3300014326 | Bacteria | 2742 |
| 623 | Ga0157380_10106664 | 3300014326 | Bacteria | 2345 |
| 624 | Ga0157380_11671359 | 3300014326 | Bacteria | 694 |
| 625 | Ga0157380_12400617 | 3300014326 | Bacteria | 592 |
| 626 | Ga0182008_10112521 | 3300014497 | Bacteria | 1349 |
| 627 | Ga0182008_10129261 | 3300014497 | Bacteria | 1259 |
| 628 | Ga0182008_10264600 | 3300014497 | Bacteria | 890 |
| 629 | Ga0157377_10309440 | 3300014745 | Bacteria | 1046 |
| 630 | Ga0157377_10407634 | 3300014745 | Unclassified | 927 |
| 631 | Ga0157379_10436783 | 3300014968 | Bacteria | 1207 |
| 632 | Ga0157379_10811926 | 3300014968 | Bacteria | 883 |
| 633 | Ga0157376_10087743 | 3300014969 | Bacteria | 2685 |
| 634 | Ga0157376_10116016 | 3300014969 | Bacteria | 2365 |
| 635 | Ga0157376_10388378 | 3300014969 | Bacteria | 1346 |
| 636 | Ga0157376_10765546 | 3300014969 | Unclassified | 976 |
| 637 | Ga0157376_11189195 | 3300014969 | Unclassified | 790 |
| 638 | Ga0182006_1006904 | 3300015261 | Bacteria | 5232 |
| 639 | Ga0182007_10015269 | 3300015262 | Bacteria | 2870 |
| 640 | Ga0197907_10686216 | 3300020069 | Bacteria | 1391 |
| 641 | Ga0197907_10795793 | 3300020069 | Bacteria | 998 |
| 642 | Ga0197907_10998639 | 3300020069 | Bacteria | 946 |
| 643 | Ga0197907_11173570 | 3300020069 | Bacteria | 1395 |
| 644 | Ga0197907_11290110 | 3300020069 | Bacteria | 656 |
| 645 | Ga0206356_10326962 | 3300020070 | Bacteria | 10002 |
| 646 | Ga0206356_10433530 | 3300020070 | Bacteria | 1000 |
| 647 | Ga0206356_10685410 | 3300020070 | Bacteria | 1575 |
| 648 | Ga0206356_10963825 | 3300020070 | Bacteria | 1966 |
| 649 | Ga0206356_11112730 | 3300020070 | Bacteria | 1666 |
| 650 | Ga0206356_11210167 | 3300020070 | Bacteria | 814 |
| 651 | Ga0206356_11728640 | 3300020070 | Bacteria | 1379 |
| 652 | Ga0206356_11892795 | 3300020070 | Bacteria | 855 |
| 653 | Ga0206349_1921883 | 3300020075 | Bacteria | 757 |
| 654 | Ga0206355_1000829 | 3300020076 | Bacteria | 808 |
| 655 | Ga0206355_1512630 | 3300020076 | Bacteria | 726 |
| 656 | Ga0206351_10325921 | 3300020077 | Bacteria | 741 |
| 657 | Ga0206352_10022792 | 3300020078 | Bacteria | 649 |
| 658 | Ga0206352_10134720 | 3300020078 | Bacteria | 855 |
| 659 | Ga0206352_10607688 | 3300020078 | Bacteria | 689 |
| 660 | Ga0206350_10539958 | 3300020080 | Bacteria | 796 |
| 661 | Ga0206350_11204617 | 3300020080 | Bacteria | 741 |
| 662 | Ga0206354_10112960 | 3300020081 | Bacteria | 3584 |
| 663 | Ga0206354_10297273 | 3300020081 | Bacteria | 1068 |
| 664 | Ga0206354_10928523 | 3300020081 | Bacteria | 813 |
| 665 | Ga0206354_11376546 | 3300020081 | Bacteria | 927 |
| 666 | Ga0206354_11427068 | 3300020081 | Bacteria | 671 |
| 667 | Ga0206354_11480520 | 3300020081 | Bacteria | 1642 |
| 668 | Ga0206354_11650294 | 3300020081 | Bacteria | 646 |
| 669 | Ga0206353_10517639 | 3300020082 | Bacteria | 1289 |
| 670 | Ga0206353_10654202 | 3300020082 | Bacteria | 4406 |
| 671 | Ga0206353_10824057 | 3300020082 | Bacteria | 1817 |
| 672 | Ga0206353_10898624 | 3300020082 | Bacteria | 3373 |
| 673 | Ga0206353_11970468 | 3300020082 | Bacteria | 1330 |
| 674 | Ga0224712_10172386 | 3300022467 | Bacteria | 971 |
| 675 | Ga0224712_10288465 | 3300022467 | Bacteria | 765 |
| 676 | Ga0224712_10313845 | 3300022467 | Bacteria | 735 |
| 677 | Ga0224712_10410822 | 3300022467 | Unclassified | 646 |
| 678 | Ga0207653_10000411 | 3300025885 | Bacteria | 18524 |
| 679 | Ga0207692_10013727 | 3300025898 | Bacteria | 3521 |
| 680 | Ga0207692_10018366 | 3300025898 | Bacteria | 3138 |
| 681 | Ga0207692_10031200 | 3300025898 | Bacteria | 2550 |
| 682 | Ga0207692_10035221 | 3300025898 | Bacteria | 2431 |
| 683 | Ga0207692_10061987 | 3300025898 | Bacteria | 1940 |
| 684 | Ga0207692_10147586 | 3300025898 | Unclassified | 1344 |
| 685 | Ga0207692_10495575 | 3300025898 | Bacteria | 775 |
| 686 | Ga0207642_10041691 | 3300025899 | Bacteria | 2012 |
| 687 | Ga0207642_11107642 | 3300025899 | Bacteria | 512 |
| 688 | Ga0207688_10093184 | 3300025901 | Bacteria | 1732 |
| 689 | Ga0207688_10189542 | 3300025901 | Bacteria | 1229 |
| 690 | Ga0207647_10333181 | 3300025904 | Bacteria | 861 |
| 691 | Ga0207685_10020128 | 3300025905 | Bacteria | 2212 |
| 692 | Ga0207685_10035688 | 3300025905 | Bacteria | 1816 |
| 693 | Ga0207685_10101330 | 3300025905 | Bacteria | 1232 |
| 694 | Ga0207685_10516853 | 3300025905 | Bacteria | 630 |
| 695 | Ga0207699_10047880 | 3300025906 | Bacteria | 2508 |
| 696 | Ga0207699_10095147 | 3300025906 | Bacteria | 1878 |
| 697 | Ga0207699_10552390 | 3300025906 | Bacteria | 835 |
| 698 | Ga0207645_10633696 | 3300025907 | Bacteria | 726 |
| 699 | Ga0207643_10072386 | 3300025908 | Bacteria | 1985 |
| 700 | Ga0207705_10033277 | 3300025909 | Bacteria | 3682 |
| 701 | Ga0207705_10118060 | 3300025909 | Bacteria | 1966 |
| 702 | Ga0207705_10165165 | 3300025909 | Bacteria | 1665 |
| 703 | Ga0207705_10610449 | 3300025909 | Bacteria | 848 |
| 704 | Ga0207684_10046933 | 3300025910 | Bacteria | 3664 |
| 705 | Ga0207684_10101301 | 3300025910 | Bacteria | 2462 |
| 706 | Ga0207684_10188568 | 3300025910 | Bacteria | 1778 |
| 707 | Ga0207684_10377929 | 3300025910 | Unclassified | 1218 |
| 708 | Ga0207684_10758650 | 3300025910 | Unclassified | 822 |
| 709 | Ga0207684_11388694 | 3300025910 | Bacteria | 575 |
| 710 | Ga0207654_10030702 | 3300025911 | Bacteria | 2952 |
| 711 | Ga0207654_10041780 | 3300025911 | Bacteria | 2592 |
| 712 | Ga0207654_11174171 | 3300025911 | Bacteria | 559 |
| 713 | Ga0207707_10003875 | 3300025912 | Bacteria | 13267 |
| 714 | Ga0207707_10007128 | 3300025912 | Bacteria | 9738 |
| 715 | Ga0207707_10040791 | 3300025912 | Bacteria | 4054 |
| 716 | Ga0207707_10049450 | 3300025912 | Bacteria | 3663 |
| 717 | Ga0207707_10064843 | 3300025912 | Bacteria | 3181 |
| 718 | Ga0207707_10065998 | 3300025912 | Bacteria | 3151 |
| 719 | Ga0207707_10067978 | 3300025912 | Bacteria | 3104 |
| 720 | Ga0207707_10081465 | 3300025912 | Bacteria | 2825 |
| 721 | Ga0207707_11329946 | 3300025912 | Bacteria | 576 |
| 722 | Ga0207695_10066551 | 3300025913 | Bacteria | 3700 |
| 723 | Ga0207695_10133411 | 3300025913 | Bacteria | 2439 |
| 724 | Ga0207695_10419355 | 3300025913 | Bacteria | 1223 |
| 725 | Ga0207671_10595512 | 3300025914 | Bacteria | 881 |
| 726 | Ga0207693_10002010 | 3300025915 | Bacteria | 17848 |
| 727 | Ga0207693_10002850 | 3300025915 | Bacteria | 14973 |
| 728 | Ga0207693_10004399 | 3300025915 | Bacteria | 11916 |
| 729 | Ga0207693_10010709 | 3300025915 | Bacteria | 7444 |
| 730 | Ga0207693_10012106 | 3300025915 | Bacteria | 6974 |
| 731 | Ga0207693_10039628 | 3300025915 | Bacteria | 3710 |
| 732 | Ga0207693_10064591 | 3300025915 | Bacteria | 2867 |
| 733 | Ga0207693_10065933 | 3300025915 | Bacteria | 2835 |
| 734 | Ga0207693_10066160 | 3300025915 | Bacteria | 2830 |
| 735 | Ga0207693_10095453 | 3300025915 | Bacteria | 2331 |
| 736 | Ga0207693_10133403 | 3300025915 | Unclassified | 1952 |
| 737 | Ga0207693_10199885 | 3300025915 | Bacteria | 1572 |
| 738 | Ga0207693_10328877 | 3300025915 | Bacteria | 1196 |
| 739 | Ga0207663_10016159 | 3300025916 | Bacteria | 4131 |
| 740 | Ga0207663_10027714 | 3300025916 | Bacteria | 3306 |
| 741 | Ga0207663_10049700 | 3300025916 | Bacteria | 2603 |
| 742 | Ga0207663_10191969 | 3300025916 | Bacteria | 1467 |
| 743 | Ga0207663_10812354 | 3300025916 | Bacteria | 745 |
| 744 | Ga0207663_11172132 | 3300025916 | Unclassified | 618 |
| 745 | Ga0207660_10001253 | 3300025917 | Bacteria | 17006 |
| 746 | Ga0207660_10015474 | 3300025917 | Bacteria | 5037 |
| 747 | Ga0207660_10332189 | 3300025917 | Bacteria | 1215 |
| 748 | Ga0207660_10660773 | 3300025917 | Bacteria | 852 |
| 749 | Ga0207660_10750244 | 3300025917 | Bacteria | 796 |
| 750 | Ga0207662_10183702 | 3300025918 | Bacteria | 1347 |
| 751 | Ga0207662_10208417 | 3300025918 | Bacteria | 1268 |
| 752 | Ga0207657_10001344 | 3300025919 | Bacteria | 26151 |
| 753 | Ga0207657_10003362 | 3300025919 | Bacteria | 17097 |
| 754 | Ga0207657_10005637 | 3300025919 | Bacteria | 13064 |
| 755 | Ga0207657_10011355 | 3300025919 | Bacteria | 8847 |
| 756 | Ga0207657_10042200 | 3300025919 | Bacteria | 4026 |
| 757 | Ga0207657_10047842 | 3300025919 | Bacteria | 3737 |
| 758 | Ga0207657_10127884 | 3300025919 | Bacteria | 2085 |
| 759 | Ga0207657_10396786 | 3300025919 | Bacteria | 1085 |
| 760 | Ga0207657_10623685 | 3300025919 | Bacteria | 840 |
| 761 | Ga0207657_10740604 | 3300025919 | Bacteria | 762 |
| 762 | Ga0207657_11011119 | 3300025919 | Bacteria | 637 |
| 763 | Ga0207649_10037277 | 3300025920 | Bacteria | 2936 |
| 764 | Ga0207652_10002068 | 3300025921 | Bacteria | 17274 |
| 765 | Ga0207652_10008528 | 3300025921 | Bacteria | 8250 |
| 766 | Ga0207652_10019536 | 3300025921 | Bacteria | 5573 |
| 767 | Ga0207652_10068716 | 3300025921 | Bacteria | 3075 |
| 768 | Ga0207652_10075250 | 3300025921 | Bacteria | 2942 |
| 769 | Ga0207652_10131356 | 3300025921 | Bacteria | 2234 |
| 770 | Ga0207652_10139498 | 3300025921 | Bacteria | 2167 |
| 771 | Ga0207652_10176415 | 3300025921 | Bacteria | 1919 |
| 772 | Ga0207652_10183796 | 3300025921 | Bacteria | 1879 |
| 773 | Ga0207652_10342097 | 3300025921 | Bacteria | 1350 |
| 774 | Ga0207652_11523155 | 3300025921 | Bacteria | 573 |
| 775 | Ga0207646_10013145 | 3300025922 | Bacteria | 7924 |
| 776 | Ga0207646_10016422 | 3300025922 | Bacteria | 6946 |
| 777 | Ga0207646_10114968 | 3300025922 | Bacteria | 2416 |
| 778 | Ga0207646_10290026 | 3300025922 | Bacteria | 1479 |
| 779 | Ga0207646_10358206 | 3300025922 | Bacteria | 1318 |
| 780 | Ga0207646_10394056 | 3300025922 | Bacteria | 1251 |
| 781 | Ga0207646_10536157 | 3300025922 | Bacteria | 1053 |
| 782 | Ga0207646_10859406 | 3300025922 | Bacteria | 806 |
| 783 | Ga0207681_10364496 | 3300025923 | Bacteria | 1160 |
| 784 | Ga0207694_10464342 | 3300025924 | Bacteria | 1058 |
| 785 | Ga0207694_10523109 | 3300025924 | Bacteria | 994 |
| 786 | Ga0207659_10046872 | 3300025926 | Bacteria | 3055 |
| 787 | Ga0207659_10394930 | 3300025926 | Bacteria | 1156 |
| 788 | Ga0207687_10004309 | 3300025927 | Bacteria | 9502 |
| 789 | Ga0207687_10109369 | 3300025927 | Bacteria | 2048 |
| 790 | Ga0207687_10250943 | 3300025927 | Bacteria | 1407 |
| 791 | Ga0207687_10402386 | 3300025927 | Unclassified | 1126 |
| 792 | Ga0207687_10484761 | 3300025927 | Bacteria | 1030 |
| 793 | Ga0207687_10722705 | 3300025927 | Unclassified | 846 |
| 794 | Ga0207687_10839431 | 3300025927 | Bacteria | 785 |
| 795 | Ga0207687_11300613 | 3300025927 | Bacteria | 625 |
| 796 | Ga0207700_10000024 | 3300025928 | Bacteria | 147545 |
| 797 | Ga0207700_10046031 | 3300025928 | Bacteria | 3224 |
| 798 | Ga0207700_10270783 | 3300025928 | Bacteria | 1458 |
| 799 | Ga0207700_10307360 | 3300025928 | Unclassified | 1371 |
| 800 | Ga0207700_10506741 | 3300025928 | Bacteria | 1068 |
| 801 | Ga0207700_10565430 | 3300025928 | Bacteria | 1010 |
| 802 | Ga0207664_10002612 | 3300025929 | Bacteria | 11927 |
| 803 | Ga0207664_10025419 | 3300025929 | Bacteria | 4461 |
| 804 | Ga0207664_10060905 | 3300025929 | Bacteria | 3010 |
| 805 | Ga0207664_10073858 | 3300025929 | Bacteria | 2753 |
| 806 | Ga0207664_10139485 | 3300025929 | Bacteria | 2049 |
| 807 | Ga0207664_10187236 | 3300025929 | Bacteria | 1780 |
| 808 | Ga0207664_10216177 | 3300025929 | Bacteria | 1660 |
| 809 | Ga0207664_10237450 | 3300025929 | Bacteria | 1586 |
| 810 | Ga0207664_10240931 | 3300025929 | Bacteria | 1575 |
| 811 | Ga0207664_10271937 | 3300025929 | Unclassified | 1484 |
| 812 | Ga0207664_10293062 | 3300025929 | Bacteria | 1430 |
| 813 | Ga0207664_10309140 | 3300025929 | Bacteria | 1392 |
| 814 | Ga0207664_10414337 | 3300025929 | Bacteria | 1199 |
| 815 | Ga0207664_10462033 | 3300025929 | Bacteria | 1134 |
| 816 | Ga0207644_10100055 | 3300025931 | Bacteria | 2177 |
| 817 | Ga0207644_10324060 | 3300025931 | Bacteria | 1246 |
| 818 | Ga0207690_10872026 | 3300025932 | Bacteria | 746 |
| 819 | Ga0207690_10997686 | 3300025932 | Bacteria | 696 |
| 820 | Ga0207690_11329689 | 3300025932 | Bacteria | 601 |
| 821 | Ga0207686_10007885 | 3300025934 | Bacteria | 5739 |
| 822 | Ga0207686_10291524 | 3300025934 | Bacteria | 1208 |
| 823 | Ga0207686_10521124 | 3300025934 | Bacteria | 925 |
| 824 | Ga0207686_10901075 | 3300025934 | Bacteria | 714 |
| 825 | Ga0207686_11463251 | 3300025934 | Bacteria | 563 |
| 826 | Ga0207709_10009766 | 3300025935 | Bacteria | 5289 |
| 827 | Ga0207709_10023343 | 3300025935 | Bacteria | 3520 |
| 828 | Ga0207709_10287721 | 3300025935 | Bacteria | 1217 |
| 829 | Ga0207709_10533976 | 3300025935 | Bacteria | 920 |
| 830 | Ga0207709_11358009 | 3300025935 | Bacteria | 588 |
| 831 | Ga0207669_10203990 | 3300025937 | Bacteria | 1438 |
| 832 | Ga0207704_10233568 | 3300025938 | Bacteria | 1369 |
| 833 | Ga0207704_10241856 | 3300025938 | Bacteria | 1349 |
| 834 | Ga0207704_10439320 | 3300025938 | Bacteria | 1039 |
| 835 | Ga0207665_10001313 | 3300025939 | Bacteria | 16753 |
| 836 | Ga0207665_10001721 | 3300025939 | Bacteria | 14710 |
| 837 | Ga0207665_10007331 | 3300025939 | Bacteria | 7297 |
| 838 | Ga0207665_10009738 | 3300025939 | Bacteria | 6308 |
| 839 | Ga0207665_10010704 | 3300025939 | Bacteria | 6024 |
| 840 | Ga0207665_10182922 | 3300025939 | Bacteria | 1519 |
| 841 | Ga0207665_10553468 | 3300025939 | Unclassified | 894 |
| 842 | Ga0207711_10051394 | 3300025941 | Bacteria | 3529 |
| 843 | Ga0207711_11052394 | 3300025941 | Unclassified | 754 |
| 844 | Ga0207689_10795007 | 3300025942 | Bacteria | 798 |
| 845 | Ga0207689_10927952 | 3300025942 | Bacteria | 735 |
| 846 | Ga0207661_10001504 | 3300025944 | Bacteria | 15791 |
| 847 | Ga0207661_10009335 | 3300025944 | Bacteria | 7030 |
| 848 | Ga0207661_10045306 | 3300025944 | Bacteria | 3481 |
| 849 | Ga0207661_10086948 | 3300025944 | Bacteria | 2595 |
| 850 | Ga0207661_11292534 | 3300025944 | Unclassified | 670 |
| 851 | Ga0207661_11953729 | 3300025944 | Bacteria | 532 |
| 852 | Ga0207679_10730514 | 3300025945 | Bacteria | 900 |
| 853 | Ga0207679_11039416 | 3300025945 | Bacteria | 751 |
| 854 | Ga0207667_10083557 | 3300025949 | Bacteria | 3306 |
| 855 | Ga0207667_10231048 | 3300025949 | Bacteria | 1894 |
| 856 | Ga0207667_10466697 | 3300025949 | Bacteria | 1282 |
| 857 | Ga0207667_11171198 | 3300025949 | Bacteria | 749 |
| 858 | Ga0207667_11223828 | 3300025949 | Bacteria | 730 |
| 859 | Ga0207651_10352362 | 3300025960 | Bacteria | 1240 |
| 860 | Ga0207651_10504655 | 3300025960 | Bacteria | 1046 |
| 861 | Ga0207712_10383739 | 3300025961 | Bacteria | 1177 |
| 862 | Ga0207712_10390720 | 3300025961 | Bacteria | 1167 |
| 863 | Ga0207668_10356053 | 3300025972 | Bacteria | 1225 |
| 864 | Ga0207668_10797453 | 3300025972 | Bacteria | 836 |
| 865 | Ga0207640_10124217 | 3300025981 | Bacteria | 1855 |
| 866 | Ga0207658_10526110 | 3300025986 | Bacteria | 1056 |
| 867 | Ga0207658_11127935 | 3300025986 | Bacteria | 717 |
| 868 | Ga0207677_10193379 | 3300026023 | Bacteria | 1611 |
| 869 | Ga0207677_10375312 | 3300026023 | Bacteria | 1199 |
| 870 | Ga0207677_12073956 | 3300026023 | Bacteria | 529 |
| 871 | Ga0207703_11476638 | 3300026035 | Bacteria | 654 |
| 872 | Ga0207639_10216173 | 3300026041 | Bacteria | 1653 |
| 873 | Ga0207639_10623525 | 3300026041 | Bacteria | 996 |
| 874 | Ga0207678_10128276 | 3300026067 | Bacteria | 2163 |
| 875 | Ga0207678_10165911 | 3300026067 | Bacteria | 1886 |
| 876 | Ga0207678_10183412 | 3300026067 | Bacteria | 1787 |
| 877 | Ga0207678_10196544 | 3300026067 | Bacteria | 1724 |
| 878 | Ga0207702_10007087 | 3300026078 | Bacteria | 9590 |
| 879 | Ga0207702_10049036 | 3300026078 | Bacteria | 3562 |
| 880 | Ga0207702_10082982 | 3300026078 | Bacteria | 2788 |
| 881 | Ga0207702_10150149 | 3300026078 | Bacteria | 2119 |
| 882 | Ga0207702_10429217 | 3300026078 | Bacteria | 1279 |
| 883 | Ga0207702_10608678 | 3300026078 | Bacteria | 1072 |
| 884 | Ga0207702_10913170 | 3300026078 | Bacteria | 870 |
| 885 | Ga0207702_11823454 | 3300026078 | Unclassified | 600 |
| 886 | Ga0207641_10354941 | 3300026088 | Bacteria | 1398 |
| 887 | Ga0207648_10493848 | 3300026089 | Bacteria | 1119 |
| 888 | Ga0207648_10549292 | 3300026089 | Bacteria | 1061 |
| 889 | Ga0207648_11008048 | 3300026089 | Bacteria | 780 |
| 890 | Ga0207676_11776464 | 3300026095 | Unclassified | 615 |
| 891 | Ga0207674_10017076 | 3300026116 | Bacteria | 7921 |
| 892 | Ga0207675_100052212 | 3300026118 | Bacteria | 3815 |
| 893 | Ga0207675_100093929 | 3300026118 | Bacteria | 2822 |
| 894 | Ga0207675_100311620 | 3300026118 | Bacteria | 1535 |
| 895 | Ga0207683_10001368 | 3300026121 | Bacteria | 22057 |
| 896 | Ga0207683_10008480 | 3300026121 | Bacteria | 8796 |
| 897 | Ga0207683_10025949 | 3300026121 | Bacteria | 5057 |
| 898 | Ga0207683_10043811 | 3300026121 | Bacteria | 3911 |
| 899 | Ga0207683_10176320 | 3300026121 | Bacteria | 1937 |
| 900 | Ga0207683_10176889 | 3300026121 | Bacteria | 1934 |
| 901 | Ga0207683_11084444 | 3300026121 | Bacteria | 743 |
| 902 | Ga0207698_10737479 | 3300026142 | Unclassified | 983 |
| 903 | Ga0207698_10797152 | 3300026142 | Bacteria | 947 |
| 904 | Ga0209966_1046847 | 3300027695 | Unclassified | 913 |
| 905 | Ga0209998_10018089 | 3300027717 | Bacteria | 1494 |
| 906 | Ga0207428_10024080 | 3300027907 | Bacteria | 5112 |
| 907 | Ga0207428_10150693 | 3300027907 | Bacteria | 1770 |
| 908 | Ga0207428_10206782 | 3300027907 | Unclassified | 1476 |
| 909 | Ga0207428_10649030 | 3300027907 | Bacteria | 758 |
| 910 | Ga0207428_10833069 | 3300027907 | Bacteria | 654 |
| 911 | Ga0268265_10568339 | 3300028380 | Unclassified | 1079 |
| 912 | Ga0268265_10749286 | 3300028380 | Bacteria | 948 |
| 913 | Ga0268264_10516690 | 3300028381 | Bacteria | 1167 |
| 914 | Ga0268264_11546521 | 3300028381 | Bacteria | 674 |
| 915 | Ga0265337_1022122 | 3300028556 | Bacteria | 1974 |
| 916 | Ga0265326_10016113 | 3300028558 | Bacteria | 2162 |
| 917 | Ga0265326_10233983 | 3300028558 | Bacteria | 530 |
| 918 | Ga0265319_1002094 | 3300028563 | Bacteria | 11181 |
| 919 | Ga0265319_1020804 | 3300028563 | Bacteria | 2422 |
| 920 | Ga0265334_10000322 | 3300028573 | Bacteria | 26260 |
| 921 | Ga0265334_10127963 | 3300028573 | Bacteria | 905 |
| 922 | Ga0265318_10001871 | 3300028577 | Bacteria | 11838 |
| 923 | Ga0265318_10038011 | 3300028577 | Bacteria | 1842 |
| 924 | Ga0265318_10050008 | 3300028577 | Bacteria | 1572 |
| 925 | Ga0265323_10108406 | 3300028653 | Bacteria | 913 |
| 926 | Ga0265338_10007305 | 3300028800 | Bacteria | 13782 |
| 927 | Ga0265338_10022905 | 3300028800 | Bacteria | 6445 |
| 928 | Ga0265338_10090464 | 3300028800 | Bacteria | 2532 |
| 929 | Ga0265338_10194067 | 3300028800 | Bacteria | 1537 |
| 930 | Ga0265338_10228151 | 3300028800 | Bacteria | 1386 |
| 931 | Ga0265338_10393586 | 3300028800 | Bacteria | 989 |
| 932 | Ga0265324_10055753 | 3300029957 | Bacteria | 1355 |
| 933 | Ga0265330_10003034 | 3300031235 | Bacteria | 8912 |
| 934 | Ga0265330_10139923 | 3300031235 | Bacteria | 1029 |
| 935 | Ga0265332_10006572 | 3300031238 | Bacteria | 5272 |
| 936 | Ga0265328_10004790 | 3300031239 | Bacteria | 5842 |
| 937 | Ga0265320_10040066 | 3300031240 | Bacteria | 2338 |
| 938 | Ga0265320_10067175 | 3300031240 | Unclassified | 1697 |
| 939 | Ga0265325_10011495 | 3300031241 | Bacteria | 5084 |
| 940 | Ga0265325_10113488 | 3300031241 | Bacteria | 1314 |
| 941 | Ga0265325_10349855 | 3300031241 | Bacteria | 653 |
| 942 | Ga0265329_10019276 | 3300031242 | Bacteria | 2318 |
| 943 | Ga0265329_10022685 | 3300031242 | Bacteria | 2098 |
| 944 | Ga0265340_10008992 | 3300031247 | Bacteria | 5379 |
| 945 | Ga0265340_10117009 | 3300031247 | Bacteria | 1228 |
| 946 | Ga0265339_10007646 | 3300031249 | Bacteria | 6959 |
| 947 | Ga0265339_10047116 | 3300031249 | Bacteria | 2367 |
| 948 | Ga0265339_10143175 | 3300031249 | Bacteria | 1214 |
| 949 | Ga0265331_10002581 | 3300031250 | Bacteria | 12179 |
| 950 | Ga0265331_10187156 | 3300031250 | Bacteria | 934 |
| 951 | Ga0265327_10003692 | 3300031251 | Bacteria | 14307 |
| 952 | Ga0265327_10004211 | 3300031251 | Bacteria | 12930 |
| 953 | Ga0265316_10021439 | 3300031344 | Bacteria | 5471 |
| 954 | Ga0265316_10035212 | 3300031344 | Bacteria | 4059 |
| 955 | Ga0265316_10315273 | 3300031344 | Bacteria | 1137 |
| 956 | Ga0265316_10721044 | 3300031344 | Bacteria | 702 |
| 957 | Ga0265313_10014033 | 3300031595 | Bacteria | 4768 |
| 958 | Ga0265313_10068841 | 3300031595 | Bacteria | 1634 |
| 959 | Ga0265314_10105890 | 3300031711 | Bacteria | 1797 |
| 960 | Ga0265314_10191953 | 3300031711 | Bacteria | 1214 |
| 961 | Ga0265314_10613716 | 3300031711 | Bacteria | 559 |
| 962 | Ga0265342_10064746 | 3300031712 | Bacteria | 2144 |
| 963 | Ga0265342_10075846 | 3300031712 | Bacteria | 1949 |
| 964 | Ga0265342_10079898 | 3300031712 | Unclassified | 1891 |
| 965 | Ga0265342_10537058 | 3300031712 | Bacteria | 594 |
| 966 | Ga0307412_12206309 | 3300031911 | Bacteria | 513 |
| 967 | Ga0307416_100098406 | 3300032002 | Bacteria | 2537 |
| 968 | Ga0307415_100431053 | 3300032126 | Bacteria | 1134 |
| 969 | Ga0316583_10135778 | 3300032133 | Bacteria | 857 |
| 970 | Ga0373930_0091094 | 3300034816 | Bacteria | 715 |
| 971 | Ga0373948_0048284 | 3300034817 | Bacteria | 908 |
| 972 | Ga0373959_0010326 | 3300034820 | Bacteria | 1629 |
| 973 | Ga0373959_0054997 | 3300034820 | Bacteria | 868 |
| 974 | Ga0373938_0000401 | 3300034957 | Bacteria | 6974 |
| 975 | Ga0373938_0006357 | 3300034957 | Bacteria | 2040 |
| 976 | Ga0373928_0021015 | 3300035084 | Bacteria | 1373 |
| 977 | Ga0373928_0035594 | 3300035084 | Bacteria | 1122 |
| 978 | Ga0373929_0006199 | 3300035085 | Bacteria | 2160 |
| 979 | Ga0373940_0038002 | 3300035088 | Bacteria | 1312 |
| 980 | Ga0373944_0230545 | 3300035089 | Bacteria | 678 |
| 981 | Ga0373949_0037003 | 3300035090 | Unclassified | 1186 |
| 982 | Ga0373949_0205739 | 3300035090 | Unclassified | 593 |
| 983 | Ga0373951_0001208 | 3300035091 | Bacteria | 6822 |
| 984 | Ga0373952_0023677 | 3300035092 | Bacteria | 1313 |
| 985 | Ga0373952_0046104 | 3300035092 | Bacteria | 1024 |
| 986 | Ga0373952_0088868 | 3300035092 | Unclassified | 800 |
| 987 | Ga0373952_0143352 | 3300035092 | Bacteria | 665 |
| 988 | Ga0373932_0019702 | 3300035112 | Bacteria | 1761 |
| 989 | Ga0373932_0078652 | 3300035112 | Bacteria | 1037 |
| 990 | Ga0373936_0193832 | 3300035113 | Bacteria | 895 |
| 991 | Ga0373936_0307099 | 3300035113 | Bacteria | 717 |
| 992 | Ga0373939_0036368 | 3300035114 | Bacteria | 1456 |
| 993 | Ga0373941_0115430 | 3300035115 | Bacteria | 951 |
| 994 | Ga0373956_0353540 | 3300035119 | Bacteria | 700 |
| 995 | Ga0373957_0172186 | 3300035120 | Bacteria | 895 |
| 996 | Ga0373957_0469877 | 3300035120 | Bacteria | 546 |
| 997 | Ga0373960_0000437 | 3300035121 | Bacteria | 8168 |
| 998 | Ga0373960_0081466 | 3300035121 | Bacteria | 1020 |
| 999 | Ga0373943_0000825 | 3300035170 | Bacteria | 13638 |
| 1000 | Ga0373946_0000490 | 3300035171 | Bacteria | 13102 |
| 1001 | Ga0373946_0183312 | 3300035171 | Bacteria | 995 |
| 1002 | Ga0373955_0273622 | 3300035172 | Bacteria | 1015 |
| 1003 | Ga0373955_0447337 | 3300035172 | Bacteria | 787 |
| 1004 | Ga0373942_0026992 | 3300035207 | Unclassified | 1491 |
| 1005 | Ga0373961_0004360 | 3300035241 | Bacteria | 3424 |
| 1006 | Ga0373962_0008737 | 3300035242 | Bacteria | 2499 |
| 1007 | Ga0373962_0118361 | 3300035242 | Bacteria | 842 |
| 1008 | Ga0373962_0231066 | 3300035242 | Unclassified | 636 |
| 1009 | Ga0373962_0298700 | 3300035242 | Bacteria | 571 |
| 1010 | Ga0373931_0051279 | 3300035691 | Bacteria | 2197 |
| 1011 | Ga0373931_0162682 | 3300035691 | Bacteria | 1309 |
| 1012 | Ga0373931_0163498 | 3300035691 | Bacteria | 1307 |
| 1013 | Ga0373931_0321360 | 3300035691 | Unclassified | 961 |
| 1014 | Ga0373931_0858784 | 3300035691 | Bacteria | 608 |
| 1015 | Ga0373935_0001745 | 3300035692 | Bacteria | 12199 |
| 1016 | Ga0373935_0030392 | 3300035692 | Bacteria | 3348 |
| 1017 | Ga0373927_0011613 | 3300035695 | Bacteria | 5865 |
| 1018 | Ga0373933_0062569 | 3300035724 | Bacteria | 2248 |
| 1019 | Ga0373933_0554922 | 3300035724 | Bacteria | 754 |
| 1020 | Ga0373933_1041342 | 3300035724 | Unclassified | 539 |
| 1021 | Ga0373947_0116651 | 3300035725 | Bacteria | 1693 |
| 1022 | Ga0373947_0253345 | 3300035725 | Bacteria | 1165 |
| 1023 | Ga0373937_0045110 | 3300036401 | Bacteria | 4027 |
| 1024 | Ga0373937_0246157 | 3300036401 | Bacteria | 1685 |
| 1025 | Ga0373937_0484160 | 3300036401 | Bacteria | 1175 |
| 1026 | Ga0373925_0046465 | 3300037068 | Bacteria | 3228 |
| 1027 | Ga0373925_1453423 | 3300037068 | Bacteria | 561 |
| 1028 | Ga0395899_0003270 | 3300037312 | Bacteria | 12847 |
| 1029 | Ga0395899_0017307 | 3300037312 | Bacteria | 5493 |
| 1030 | Ga0395899_0030979 | 3300037312 | Bacteria | 4022 |
| 1031 | Ga0395899_0052645 | 3300037312 | Bacteria | 3016 |
| 1032 | Ga0395899_0139187 | 3300037312 | Bacteria | 1728 |
| 1033 | Ga0395899_0167387 | 3300037312 | Bacteria | 1550 |
| 1034 | Ga0395899_0305254 | 3300037312 | Bacteria | 1076 |
| 1035 | Ga0395899_0330700 | 3300037312 | Bacteria | 1024 |
| 1036 | Ga0395899_0341163 | 3300037312 | Bacteria | 1004 |
| 1037 | Ga0395899_0351591 | 3300037312 | Bacteria | 986 |
| 1038 | Ga0395899_0414557 | 3300037312 | Bacteria | 888 |
| 1039 | Ga0395899_0659628 | 3300037312 | Bacteria | 660 |
| 1040 | Ga0395900_0005798 | 3300037418 | Bacteria | 12901 |
| 1041 | Ga0395900_0024871 | 3300037418 | Bacteria | 6128 |
| 1042 | Ga0395900_0029196 | 3300037418 | Bacteria | 5656 |
| 1043 | Ga0395900_0032345 | 3300037418 | Bacteria | 5379 |
| 1044 | Ga0395900_0048614 | 3300037418 | Bacteria | 4369 |
| 1045 | Ga0395900_0054431 | 3300037418 | Bacteria | 4120 |
| 1046 | Ga0395900_0072310 | 3300037418 | Bacteria | 3546 |
| 1047 | Ga0395900_0171449 | 3300037418 | Unclassified | 2209 |
| 1048 | Ga0395900_0192036 | 3300037418 | Bacteria | 2071 |
| 1049 | Ga0395900_0224921 | 3300037418 | Bacteria | 1890 |
| 1050 | Ga0395900_0241082 | 3300037418 | Bacteria | 1813 |
| 1051 | Ga0395900_0247475 | 3300037418 | Bacteria | 1785 |
| 1052 | Ga0395900_0294325 | 3300037418 | Bacteria | 1611 |
| 1053 | Ga0395900_0303437 | 3300037418 | Bacteria | 1582 |
| 1054 | Ga0395900_0336417 | 3300037418 | Bacteria | 1486 |
| 1055 | Ga0395900_0352304 | 3300037418 | Bacteria | 1445 |
| 1056 | Ga0395900_0409407 | 3300037418 | Unclassified | 1319 |
| 1057 | Ga0395900_0944738 | 3300037418 | Bacteria | 784 |
| 1058 | Ga0395900_1100388 | 3300037418 | Bacteria | 712 |
| 1059 | Ga0395900_1168634 | 3300037418 | Bacteria | 685 |
| 1060 | Ga0395898_0009931 | 3300037466 | Bacteria | 9969 |
| 1061 | Ga0395898_0023845 | 3300037466 | Bacteria | 6176 |
| 1062 | Ga0395898_0054391 | 3300037466 | Bacteria | 3906 |
| 1063 | Ga0395898_0093041 | 3300037466 | Bacteria | 2898 |
| 1064 | Ga0395898_0099988 | 3300037466 | Bacteria | 2785 |
| 1065 | Ga0395898_0103258 | 3300037466 | Bacteria | 2735 |
| 1066 | Ga0395898_0117726 | 3300037466 | Bacteria | 2545 |
| 1067 | Ga0395898_0165404 | 3300037466 | Bacteria | 2116 |
| 1068 | Ga0395898_0186275 | 3300037466 | Bacteria | 1983 |
| 1069 | Ga0395898_0221203 | 3300037466 | Bacteria | 1806 |
| 1070 | Ga0395898_0270216 | 3300037466 | Bacteria | 1622 |
| 1071 | Ga0395898_0316980 | 3300037466 | Bacteria | 1488 |
| 1072 | Ga0395898_0414711 | 3300037466 | Unclassified | 1283 |
| 1073 | Ga0395898_0463177 | 3300037466 | Bacteria | 1207 |
| 1074 | Ga0395898_0505539 | 3300037466 | Bacteria | 1149 |
| 1075 | Ga0395898_0538648 | 3300037466 | Bacteria | 1109 |
| 1076 | Ga0395898_0578424 | 3300037466 | Bacteria | 1065 |
| 1077 | Ga0395898_0745153 | 3300037466 | Bacteria | 921 |
| 1078 | Ga0395898_0845506 | 3300037466 | Bacteria | 854 |
| 1079 | Ga0395898_1379847 | 3300037466 | Bacteria | 633 |
| 1080 | Ga0395898_1477653 | 3300037466 | Bacteria | 606 |
| 1081 | Ga0395898_1574835 | 3300037466 | Bacteria | 582 |
| 1082 | Ga0395898_1699064 | 3300037466 | Unclassified | 554 |
| 1083 | Ga0395898_1701814 | 3300037466 | Bacteria | 553 |
| 1084 | Ga0395898_1799738 | 3300037466 | Bacteria | 534 |
| 1085 | Ga0395898_1948716 | 3300037466 | Bacteria | 507 |
| 1086 | Ga0395905_0052710 | 3300037471 | Bacteria | 3808 |
| 1087 | Ga0395905_0066323 | 3300037471 | Bacteria | 3380 |
| 1088 | Ga0395905_0095226 | 3300037471 | Bacteria | 2794 |
| 1089 | Ga0395905_0115076 | 3300037471 | Bacteria | 2527 |
| 1090 | Ga0395905_0158398 | 3300037471 | Bacteria | 2129 |
| 1091 | Ga0395905_0173424 | 3300037471 | Bacteria | 2025 |
| 1092 | Ga0395905_0436503 | 3300037471 | Bacteria | 1206 |
| 1093 | Ga0395905_0533429 | 3300037471 | Bacteria | 1074 |
| 1094 | Ga0395905_0650399 | 3300037471 | Bacteria | 956 |
| 1095 | Ga0395905_0776444 | 3300037471 | Bacteria | 861 |
| 1096 | Ga0395905_0789925 | 3300037471 | Bacteria | 852 |
| 1097 | Ga0395901_0000904 | 3300038443 | Bacteria | 32610 |
| 1098 | Ga0395901_0017197 | 3300038443 | Bacteria | 7377 |
| 1099 | Ga0395901_0018774 | 3300038443 | Bacteria | 7065 |
| 1100 | Ga0395901_0023458 | 3300038443 | Bacteria | 6326 |
| 1101 | Ga0395901_0024550 | 3300038443 | Bacteria | 6189 |
| 1102 | Ga0395901_0035865 | 3300038443 | Bacteria | 5125 |
| 1103 | Ga0395901_0056092 | 3300038443 | Bacteria | 4098 |
| 1104 | Ga0395901_0118962 | 3300038443 | Bacteria | 2776 |
| 1105 | Ga0395901_0138911 | 3300038443 | Bacteria | 2554 |
| 1106 | Ga0395901_0145076 | 3300038443 | Bacteria | 2495 |
| 1107 | Ga0395901_0167884 | 3300038443 | Bacteria | 2303 |
| 1108 | Ga0395901_0193398 | 3300038443 | Bacteria | 2133 |
| 1109 | Ga0395901_0276457 | 3300038443 | Bacteria | 1746 |
| 1110 | Ga0395901_0283990 | 3300038443 | Bacteria | 1719 |
| 1111 | Ga0395901_0398144 | 3300038443 | Bacteria | 1415 |
| 1112 | Ga0395901_0445513 | 3300038443 | Bacteria | 1325 |
| 1113 | Ga0395901_0474508 | 3300038443 | Bacteria | 1277 |
| 1114 | Ga0395901_0933678 | 3300038443 | Bacteria | 847 |
| 1115 | Ga0395901_1145076 | 3300038443 | Bacteria | 746 |
| 1116 | Ga0395901_1408575 | 3300038443 | Bacteria | 655 |
| 1117 | Ga0395901_1479834 | 3300038443 | Bacteria | 635 |
| 1118 | Ga0439453_0041567 | 3300041408 | Bacteria | 903 |
| 1119 | Ga0439461_0016847 | 3300041410 | Bacteria | 1415 |
| 1120 | Ga0451789_0438069 | 3300041443 | Bacteria | 1319 |
| 1121 | Ga0451793_0195234 | 3300041452 | Bacteria | 3524 |
| 1122 | Ga0451797_0978418 | 3300041453 | Bacteria | 755 |
| 1123 | Ga0451800_0468763 | 3300041459 | Bacteria | 1972 |
| 1124 | Ga0451802_0307848 | 3300041460 | Bacteria | 3649 |
| 1125 | Ga0451835_0292133 | 3300041492 | Bacteria | 601 |
| 1126 | Ga0451835_1200421 | 3300041492 | Bacteria | 813 |
| 1127 | Ga0451839_1075735 | 3300041496 | Bacteria | 2742 |
| 1128 | Ga0451841_1021978 | 3300041498 | Bacteria | 1590 |
| 1129 | Ga0451847_0572655 | 3300041503 | Bacteria | 1301 |
| 1130 | Ga0451849_0919081 | 3300041505 | Bacteria | 1574 |
| 1131 | Ga0451851_1303484 | 3300041507 | Bacteria | 1079 |
| 1132 | Ga0451853_0084396 | 3300041512 | Bacteria | 1682 |
| 1133 | Ga0451853_0994657 | 3300041512 | Bacteria | 1692 |
| 1134 | Ga0451853_2728074 | 3300041512 | Bacteria | 782 |
| 1135 | Ga0439448_0046614 | 3300042005 | Bacteria | 1413 |
| 1136 | Ga0439451_055619 | 3300042009 | Bacteria | 792 |
| 1137 | Ga0439462_0052538 | 3300042015 | Unclassified | 1096 |
| 1138 | Ga0439446_0001096 | 3300042156 | Bacteria | 5985 |
| 1139 | Ga0439434_0011094 | 3300042435 | Bacteria | 2662 |
| 1140 | Ga0466969_0009066 | 3300044656 | Bacteria | 5272 |
| 1141 | Ga0466969_0016781 | 3300044656 | Bacteria | 3828 |
| 1142 | Ga0466972_0034513 | 3300044658 | Bacteria | 2478 |
| 1143 | Ga0466965_0009748 | 3300044683 | Bacteria | 4468 |
| 1144 | Ga0466965_0030427 | 3300044683 | Bacteria | 2631 |
| 1145 | Ga0466965_0389264 | 3300044683 | Bacteria | 769 |
| 1146 | Ga0466965_0775773 | 3300044683 | Bacteria | 553 |
| 1147 | Ga0466966_0070776 | 3300044684 | Bacteria | 2186 |
| 1148 | Ga0466966_0080650 | 3300044684 | Bacteria | 2027 |
| 1149 | Ga0466966_0231525 | 3300044684 | Bacteria | 1114 |
| 1150 | Ga0466966_0326412 | 3300044684 | Bacteria | 922 |
| 1151 | Ga0466961_0003458 | 3300044693 | Bacteria | 9847 |
| 1152 | Ga0466961_0005030 | 3300044693 | Bacteria | 8315 |
| 1153 | Ga0466961_0007918 | 3300044693 | Bacteria | 6769 |
| 1154 | Ga0466961_0008115 | 3300044693 | Bacteria | 6684 |
| 1155 | Ga0466961_0020292 | 3300044693 | Bacteria | 4275 |
| 1156 | Ga0466961_0056816 | 3300044693 | Bacteria | 2493 |
| 1157 | Ga0466963_0000496 | 3300044694 | Bacteria | 18307 |
| 1158 | Ga0466963_0000527 | 3300044694 | Bacteria | 17925 |
| 1159 | Ga0466963_0000758 | 3300044694 | Bacteria | 15967 |
| 1160 | Ga0466963_0000939 | 3300044694 | Bacteria | 14894 |
| 1161 | Ga0466963_0001062 | 3300044694 | Bacteria | 14300 |
| 1162 | Ga0466963_0001466 | 3300044694 | Bacteria | 12736 |
| 1163 | Ga0466963_0003947 | 3300044694 | Bacteria | 8578 |
| 1164 | Ga0466963_0007572 | 3300044694 | Bacteria | 6479 |
| 1165 | Ga0466963_0009286 | 3300044694 | Bacteria | 5922 |
| 1166 | Ga0466963_0011261 | 3300044694 | Bacteria | 5443 |
| 1167 | Ga0466963_0023706 | 3300044694 | Bacteria | 3900 |
| 1168 | Ga0466963_0029091 | 3300044694 | Bacteria | 3553 |
| 1169 | Ga0466963_0039079 | 3300044694 | Bacteria | 3106 |
| 1170 | Ga0466963_0043688 | 3300044694 | Bacteria | 2948 |
| 1171 | Ga0466963_0047488 | 3300044694 | Bacteria | 2833 |
| 1172 | Ga0466963_0062688 | 3300044694 | Bacteria | 2487 |
| 1173 | Ga0466963_0086795 | 3300044694 | Bacteria | 2127 |
| 1174 | Ga0466963_0108550 | 3300044694 | Bacteria | 1903 |
| 1175 | Ga0466963_0120056 | 3300044694 | Bacteria | 1808 |
| 1176 | Ga0466963_0129580 | 3300044694 | Bacteria | 1741 |
| 1177 | Ga0466963_0290050 | 3300044694 | Bacteria | 1150 |
| 1178 | Ga0466963_0375373 | 3300044694 | Bacteria | 1002 |
| 1179 | Ga0466963_1102772 | 3300044694 | Bacteria | 558 |
| 1180 | Ga0466963_1162737 | 3300044694 | Bacteria | 542 |
| 1181 | Ga0466964_0010892 | 3300044706 | Bacteria | 3435 |
| 1182 | Ga0466964_0011398 | 3300044706 | Bacteria | 3358 |
| 1183 | Ga0466964_0037411 | 3300044706 | Bacteria | 1949 |
| 1184 | Ga0466964_0048840 | 3300044706 | Bacteria | 1731 |
| 1185 | Ga0466964_0074592 | 3300044706 | Bacteria | 1442 |
| 1186 | Ga0466964_0085023 | 3300044706 | Bacteria | 1365 |
| 1187 | Ga0466964_0112214 | 3300044706 | Unclassified | 1217 |
| 1188 | Ga0466964_0229454 | 3300044706 | Bacteria | 905 |
| 1189 | Ga0466964_0316519 | 3300044706 | Bacteria | 791 |
| 1190 | Ga0466971_0000165 | 3300044719 | Bacteria | 24707 |
| 1191 | Ga0466971_0000768 | 3300044719 | Bacteria | 12889 |
| 1192 | Ga0466971_0033712 | 3300044719 | Bacteria | 2294 |
| 1193 | Ga0466971_0043043 | 3300044719 | Bacteria | 2029 |
| 1194 | Ga0466971_0073162 | 3300044719 | Bacteria | 1557 |
| 1195 | Ga0466971_0137194 | 3300044719 | Bacteria | 1138 |
| 1196 | Ga0466971_0178759 | 3300044719 | Bacteria | 997 |
| 1197 | Ga0466971_0260422 | 3300044719 | Bacteria | 827 |
| 1198 | Ga0466971_0400448 | 3300044719 | Bacteria | 669 |
| 1199 | Ga0466968_0016704 | 3300044735 | Bacteria | 2924 |
| 1200 | Ga0466968_0018342 | 3300044735 | Bacteria | 2806 |
| 1201 | Ga0466968_0022953 | 3300044735 | Bacteria | 2539 |
| 1202 | Ga0466968_0023049 | 3300044735 | Bacteria | 2535 |
| 1203 | Ga0466968_0047795 | 3300044735 | Bacteria | 1820 |
| 1204 | Ga0466968_0058532 | 3300044735 | Bacteria | 1658 |
| 1205 | Ga0466968_0176123 | 3300044735 | Unclassified | 993 |
| 1206 | Ga0466968_0262615 | 3300044735 | Bacteria | 822 |
| 1207 | Ga0466968_0297620 | 3300044735 | Archaea | 775 |
| 1208 | Ga0466970_0044726 | 3300044765 | Bacteria | 2357 |
| 1209 | Ga0466970_0142540 | 3300044765 | Bacteria | 1320 |
| 1210 | Ga0466970_0519000 | 3300044765 | Bacteria | 687 |
| 1211 | Ga0466957_0001076 | 3300044842 | Bacteria | 14082 |
| 1212 | Ga0466957_0008958 | 3300044842 | Bacteria | 5705 |
| 1213 | Ga0466957_0010572 | 3300044842 | Bacteria | 5303 |
| 1214 | Ga0466957_0013493 | 3300044842 | Bacteria | 4739 |
| 1215 | Ga0466957_0021711 | 3300044842 | Bacteria | 3783 |
| 1216 | Ga0466957_0031108 | 3300044842 | Bacteria | 3188 |
| 1217 | Ga0466957_0037977 | 3300044842 | Bacteria | 2900 |
| 1218 | Ga0466957_0044363 | 3300044842 | Bacteria | 2694 |
| 1219 | Ga0466957_0053182 | 3300044842 | Bacteria | 2468 |
| 1220 | Ga0466957_0107622 | 3300044842 | Bacteria | 1765 |
| 1221 | Ga0466957_0146339 | 3300044842 | Bacteria | 1525 |
| 1222 | Ga0466957_0158532 | 3300044842 | Bacteria | 1468 |
| 1223 | Ga0466957_0243664 | 3300044842 | Bacteria | 1193 |
| 1224 | Ga0466960_0002610 | 3300044901 | Bacteria | 6786 |
| 1225 | Ga0466960_0006392 | 3300044901 | Bacteria | 4727 |
| 1226 | Ga0466960_0032481 | 3300044901 | Bacteria | 2417 |
| 1227 | Ga0466960_0034986 | 3300044901 | Bacteria | 2344 |
| 1228 | Ga0466960_0080725 | 3300044901 | Bacteria | 1638 |
| 1229 | Ga0466960_0155647 | 3300044901 | Bacteria | 1224 |
| 1230 | Ga0466960_0492583 | 3300044901 | Unclassified | 717 |
| 1231 | Ga0466960_0734137 | 3300044901 | Bacteria | 594 |
| 1232 | Ga0466960_0985796 | 3300044901 | Bacteria | 517 |
| 1233 | Ga0466959_0003485 | 3300045049 | Bacteria | 10306 |
| 1234 | Ga0466959_0004630 | 3300045049 | Bacteria | 9248 |
| 1235 | Ga0466959_0017388 | 3300045049 | Bacteria | 5271 |
| 1236 | Ga0466959_0095442 | 3300045049 | Bacteria | 2133 |
| 1237 | Ga0466959_0238230 | 3300045049 | Bacteria | 1257 |
| 1238 | Ga0466959_0313111 | 3300045049 | Bacteria | 1074 |
| 1239 | Ga0451576_0334886 | 3300045051 | Unclassified | 1584 |
| 1240 | Ga0451576_1941075 | 3300045051 | Bacteria | 607 |
| 1241 | Ga0466958_0000198 | 3300045836 | Bacteria | 22183 |
| 1242 | Ga0466958_0003169 | 3300045836 | Bacteria | 8473 |
| 1243 | Ga0466958_0006052 | 3300045836 | Bacteria | 6557 |
| 1244 | Ga0466958_0015836 | 3300045836 | Bacteria | 4331 |
| 1245 | Ga0466958_0035946 | 3300045836 | Bacteria | 2962 |
| 1246 | Ga0466958_0179913 | 3300045836 | Bacteria | 1341 |
| 1247 | Ga0466958_0189601 | 3300045836 | Bacteria | 1306 |
| 1248 | Ga0466958_0239300 | 3300045836 | Bacteria | 1160 |
| 1249 | Ga0466958_0332226 | 3300045836 | Bacteria | 977 |
| 1250 | Ga0466958_0520308 | 3300045836 | Unclassified | 772 |
| 1251 | Ga0466967_0006078 | 3300045976 | Bacteria | 8490 |
| 1252 | Ga0466967_0006133 | 3300045976 | Bacteria | 8460 |
| 1253 | Ga0466967_0012007 | 3300045976 | Bacteria | 6600 |
| 1254 | Ga0466967_0016889 | 3300045976 | Bacteria | 5771 |
| 1255 | Ga0466967_0017816 | 3300045976 | Bacteria | 5655 |
| 1256 | Ga0466967_0026937 | 3300045976 | Bacteria | 4772 |
| 1257 | Ga0466967_0027798 | 3300045976 | Bacteria | 4710 |
| 1258 | Ga0466967_0029506 | 3300045976 | Bacteria | 4591 |
| 1259 | Ga0466967_0041361 | 3300045976 | Bacteria | 3973 |
| 1260 | Ga0466967_0061814 | 3300045976 | Bacteria | 3323 |
| 1261 | Ga0466967_0079098 | 3300045976 | Bacteria | 2963 |
| 1262 | Ga0466967_0085588 | 3300045976 | Bacteria | 2854 |
| 1263 | Ga0466967_0095758 | 3300045976 | Bacteria | 2706 |
| 1264 | Ga0466967_0104468 | 3300045976 | Bacteria | 2593 |
| 1265 | Ga0466967_0124591 | 3300045976 | Bacteria | 2385 |
| 1266 | Ga0466967_0134831 | 3300045976 | Bacteria | 2295 |
| 1267 | Ga0466967_0139362 | 3300045976 | Bacteria | 2258 |
| 1268 | Ga0466967_0143791 | 3300045976 | Bacteria | 2223 |
| 1269 | Ga0466967_0175606 | 3300045976 | Bacteria | 2018 |
| 1270 | Ga0466967_0181682 | 3300045976 | Bacteria | 1984 |
| 1271 | Ga0466967_0196297 | 3300045976 | Bacteria | 1909 |
| 1272 | Ga0466967_0212899 | 3300045976 | Bacteria | 1833 |
| 1273 | Ga0466967_0301564 | 3300045976 | Bacteria | 1541 |
| 1274 | Ga0466967_0471783 | 3300045976 | Unclassified | 1228 |
| 1275 | Ga0466967_0505439 | 3300045976 | Bacteria | 1186 |
| 1276 | Ga0466967_0520255 | 3300045976 | Bacteria | 1169 |
| 1277 | Ga0466967_0609103 | 3300045976 | Bacteria | 1078 |
| 1278 | Ga0466967_0740979 | 3300045976 | Archaea | 974 |
| 1279 | Ga0466967_0915081 | 3300045976 | Bacteria | 872 |
| 1280 | Ga0466967_1463582 | 3300045976 | Bacteria | 680 |
| 1281 | Ga0466967_1497153 | 3300045976 | Bacteria | 672 |
| 1282 | Ga0466967_2308905 | 3300045976 | Bacteria | 533 |
| 1283 | Ga0466967_2359140 | 3300045976 | Bacteria | 527 |
| 1284 | Ga0466967_2474608 | 3300045976 | Bacteria | 514 |
| 1285 | Ga0495592_0000089 | 3300046454 | Bacteria | 80990 |
| 1286 | Ga0495592_0028996 | 3300046454 | Bacteria | 4190 |
| 1287 | Ga0495592_0098656 | 3300046454 | Bacteria | 2085 |
| 1288 | Ga0495592_0464927 | 3300046454 | Bacteria | 790 |
| 1289 | Ga0495603_0018644 | 3300046455 | Bacteria | 4198 |
| 1290 | Ga0495629_0004338 | 3300046459 | Bacteria | 10633 |
| 1291 | Ga0495629_0034591 | 3300046459 | Bacteria | 3572 |
| 1292 | Ga0495629_0053496 | 3300046459 | Bacteria | 2824 |
| 1293 | Ga0495629_0302793 | 3300046459 | Bacteria | 1094 |
| 1294 | Ga0495629_0621825 | 3300046459 | Bacteria | 721 |
| 1295 | Ga0495641_0000709 | 3300046461 | Bacteria | 28205 |
| 1296 | Ga0495641_0008635 | 3300046461 | Bacteria | 6170 |
| 1297 | Ga0495641_0026722 | 3300046461 | Bacteria | 2814 |
| 1298 | Ga0495641_0127189 | 3300046461 | Bacteria | 1137 |
| 1299 | Ga0495641_0210620 | 3300046461 | Bacteria | 871 |
| 1300 | Ga0495641_0223148 | 3300046461 | Bacteria | 845 |
| 1301 | Ga0495651_0000057 | 3300046462 | Bacteria | 82943 |
| 1302 | Ga0495651_0122698 | 3300046462 | Bacteria | 1906 |
| 1303 | Ga0495651_0513589 | 3300046462 | Bacteria | 765 |
| 1304 | Ga0495653_0009358 | 3300046463 | Bacteria | 8016 |
| 1305 | Ga0495653_0010557 | 3300046463 | Bacteria | 7563 |
| 1306 | Ga0495653_0075955 | 3300046463 | Bacteria | 2499 |
| 1307 | Ga0495653_0325315 | 3300046463 | Bacteria | 995 |
| 1308 | Ga0495653_0506740 | 3300046463 | Bacteria | 752 |
| 1309 | Ga0495582_0000237 | 3300046473 | Bacteria | 30675 |
| 1310 | Ga0495582_0009627 | 3300046473 | Bacteria | 5322 |
| 1311 | Ga0495582_0285752 | 3300046473 | Bacteria | 947 |
| 1312 | Ga0495605_0226456 | 3300046474 | Bacteria | 806 |
| 1313 | Ga0495639_0005828 | 3300046475 | Bacteria | 5299 |
| 1314 | Ga0495639_0273015 | 3300046475 | Bacteria | 839 |
| 1315 | Ga0495639_0504413 | 3300046475 | Bacteria | 618 |
| 1316 | Ga0495662_0000484 | 3300046476 | Bacteria | 18104 |
| 1317 | Ga0495662_0104834 | 3300046476 | Bacteria | 1384 |
| 1318 | Ga0495662_0117298 | 3300046476 | Bacteria | 1306 |
| 1319 | Ga0495662_0637883 | 3300046476 | Bacteria | 520 |
| 1320 | Ga0495664_0115589 | 3300046477 | Bacteria | 1621 |
| 1321 | Ga0495664_0150755 | 3300046477 | Bacteria | 1410 |
| 1322 | Ga0495664_0319139 | 3300046477 | Bacteria | 937 |
| 1323 | Ga0495664_0641340 | 3300046477 | Bacteria | 630 |
| 1324 | Ga0495664_0860754 | 3300046477 | Bacteria | 531 |
| 1325 | Ga0495584_0063028 | 3300046491 | Bacteria | 1863 |
| 1326 | Ga0495584_0328131 | 3300046491 | Bacteria | 777 |
| 1327 | Ga0495594_0241792 | 3300046499 | Bacteria | 1029 |
| 1328 | Ga0495596_0452774 | 3300046500 | Bacteria | 501 |
| 1329 | Ga0495607_0026370 | 3300046501 | Bacteria | 3606 |
| 1330 | Ga0495608_0002880 | 3300046511 | Bacteria | 12324 |
| 1331 | Ga0495608_0008254 | 3300046511 | Bacteria | 7312 |
| 1332 | Ga0495608_0048333 | 3300046511 | Bacteria | 2827 |
| 1333 | Ga0495608_0094899 | 3300046511 | Bacteria | 1927 |
| 1334 | Ga0495608_0142843 | 3300046511 | Bacteria | 1527 |
| 1335 | Ga0495618_0011414 | 3300046514 | Bacteria | 5387 |
| 1336 | Ga0495618_0101505 | 3300046514 | Bacteria | 1842 |
| 1337 | Ga0495618_0150230 | 3300046514 | Bacteria | 1488 |
| 1338 | Ga0495628_0000066 | 3300046516 | Bacteria | 85699 |
| 1339 | Ga0495628_0045716 | 3300046516 | Bacteria | 3480 |
| 1340 | Ga0495628_0207794 | 3300046516 | Bacteria | 1473 |
| 1341 | Ga0495628_0243995 | 3300046516 | Bacteria | 1343 |
| 1342 | Ga0495628_0324054 | 3300046516 | Bacteria | 1136 |
| 1343 | Ga0495628_0379390 | 3300046516 | Bacteria | 1035 |
| 1344 | Ga0495630_0055324 | 3300046517 | Bacteria | 2973 |
| 1345 | Ga0495630_0090331 | 3300046517 | Bacteria | 2314 |
| 1346 | Ga0495630_0135396 | 3300046517 | Bacteria | 1872 |
| 1347 | Ga0495630_0232175 | 3300046517 | Bacteria | 1409 |
| 1348 | Ga0495630_1014408 | 3300046517 | Bacteria | 630 |
| 1349 | Ga0495631_0035672 | 3300046518 | Bacteria | 2224 |
| 1350 | Ga0495631_0230514 | 3300046518 | Bacteria | 790 |
| 1351 | Ga0495637_0249762 | 3300046520 | Bacteria | 639 |
| 1352 | Ga0495644_0023749 | 3300046523 | Bacteria | 2333 |
| 1353 | Ga0495644_0296041 | 3300046523 | Bacteria | 633 |
| 1354 | Ga0495663_0235328 | 3300046525 | Bacteria | 647 |
| 1355 | Ga0495642_0040762 | 3300046528 | Bacteria | 1887 |
| 1356 | Ga0495642_0088740 | 3300046528 | Unclassified | 1308 |
| 1357 | Ga0495652_0000118 | 3300046529 | Bacteria | 85706 |
| 1358 | Ga0495652_0027906 | 3300046529 | Bacteria | 4972 |
| 1359 | Ga0495652_0061355 | 3300046529 | Bacteria | 3174 |
| 1360 | Ga0495652_0240341 | 3300046529 | Bacteria | 1348 |
| 1361 | Ga0495652_0320341 | 3300046529 | Bacteria | 1120 |
| 1362 | Ga0495665_0001276 | 3300046531 | Bacteria | 13430 |
| 1363 | Ga0495665_0151752 | 3300046531 | Bacteria | 1209 |
| 1364 | Ga0495640_0011148 | 3300046533 | Bacteria | 6921 |
| 1365 | Ga0495640_0027749 | 3300046533 | Bacteria | 4080 |
| 1366 | Ga0495640_0255831 | 3300046533 | Bacteria | 1095 |
| 1367 | Ga0495640_0628717 | 3300046533 | Bacteria | 647 |
| 1368 | Ga0495586_0052557 | 3300046535 | Bacteria | 2206 |
| 1369 | Ga0495586_0175388 | 3300046535 | Bacteria | 1212 |
| 1370 | Ga0495587_0000096 | 3300046536 | Bacteria | 68520 |
| 1371 | Ga0495587_0047693 | 3300046536 | Bacteria | 2539 |
| 1372 | Ga0495587_0108139 | 3300046536 | Bacteria | 1599 |
| 1373 | Ga0495587_0333721 | 3300046536 | Bacteria | 846 |
| 1374 | Ga0495609_0088539 | 3300046538 | Bacteria | 1348 |
| 1375 | Ga0495645_0000052 | 3300046543 | Bacteria | 86470 |
| 1376 | Ga0495645_0053773 | 3300046543 | Unclassified | 2926 |
| 1377 | Ga0495645_0519607 | 3300046543 | Unclassified | 742 |
| 1378 | Ga0495645_0737307 | 3300046543 | Bacteria | 595 |
| 1379 | Ga0495633_0132186 | 3300046558 | Bacteria | 1155 |
| 1380 | Ga0495667_0010006 | 3300046559 | Bacteria | 6422 |
| 1381 | Ga0495667_0090735 | 3300046559 | Bacteria | 1979 |
| 1382 | Ga0495667_0283497 | 3300046559 | Unclassified | 1051 |
| 1383 | Ga0495667_0396192 | 3300046559 | Bacteria | 870 |
| 1384 | Ga0495656_0005086 | 3300046615 | Bacteria | 4534 |
| 1385 | Ga0495656_0046893 | 3300046615 | Bacteria | 1830 |
| 1386 | Ga0495656_0329591 | 3300046615 | Bacteria | 788 |
| 1387 | Ga0495634_0017218 | 3300046642 | Bacteria | 5160 |
| 1388 | Ga0495634_0037586 | 3300046642 | Bacteria | 3307 |
| 1389 | Ga0495634_0052232 | 3300046642 | Bacteria | 2740 |
| 1390 | Ga0495635_0010241 | 3300046663 | Bacteria | 6555 |
| 1391 | Ga0495635_0052437 | 3300046663 | Bacteria | 2810 |
| 1392 | Ga0495635_0706270 | 3300046663 | Bacteria | 653 |
| 1393 | Ga0495659_0008068 | 3300046664 | Bacteria | 3344 |
| 1394 | Ga0495659_0141202 | 3300046664 | Unclassified | 961 |
| 1395 | Ga0495659_0303203 | 3300046664 | Bacteria | 675 |
| 1396 | Ga0495588_0090691 | 3300046674 | Bacteria | 1601 |
| 1397 | Ga0495588_0112405 | 3300046674 | Bacteria | 1435 |
| 1398 | Ga0495657_0004760 | 3300046675 | Bacteria | 10821 |
| 1399 | Ga0495657_0012143 | 3300046675 | Bacteria | 6407 |
| 1400 | Ga0495657_0081250 | 3300046675 | Bacteria | 2096 |
| 1401 | Ga0495657_0207378 | 3300046675 | Bacteria | 1192 |
| 1402 | Ga0495657_0542524 | 3300046675 | Bacteria | 676 |
| 1403 | Ga0495599_0000046 | 3300046678 | Bacteria | 85727 |
| 1404 | Ga0495599_0016285 | 3300046678 | Bacteria | 4616 |
| 1405 | Ga0495599_0751531 | 3300046678 | Bacteria | 559 |
| 1406 | Ga0495623_0000061 | 3300046679 | Bacteria | 67279 |
| 1407 | Ga0495623_0087137 | 3300046679 | Unclassified | 1924 |
| 1408 | Ga0495646_0081327 | 3300046680 | Unclassified | 1888 |
| 1409 | Ga0495646_0238702 | 3300046680 | Bacteria | 977 |
| 1410 | Ga0495647_0010802 | 3300046681 | Bacteria | 3118 |
| 1411 | Ga0495647_0021233 | 3300046681 | Bacteria | 2336 |
| 1412 | Ga0495647_0039368 | 3300046681 | Bacteria | 1792 |
| 1413 | Ga0495647_0040462 | 3300046681 | Bacteria | 1771 |
| 1414 | Ga0495658_0000690 | 3300046683 | Bacteria | 18283 |
| 1415 | Ga0495658_0311028 | 3300046683 | Bacteria | 997 |
| 1416 | Ga0495658_0320485 | 3300046683 | Bacteria | 982 |
| 1417 | Ga0495658_0767741 | 3300046683 | Bacteria | 617 |
| 1418 | Ga0495669_0583933 | 3300046684 | Bacteria | 544 |
| 1419 | Ga0495613_0074518 | 3300046689 | Bacteria | 2471 |
| 1420 | Ga0495613_0095494 | 3300046689 | Bacteria | 2150 |
| 1421 | Ga0495613_0255313 | 3300046689 | Bacteria | 1222 |
| 1422 | Ga0495613_0298169 | 3300046689 | Bacteria | 1116 |
| 1423 | Ga0495613_0450315 | 3300046689 | Unclassified | 872 |
| 1424 | Ga0495613_0514260 | 3300046689 | Bacteria | 805 |
| 1425 | Ga0495624_0019594 | 3300046690 | Bacteria | 4513 |
| 1426 | Ga0495624_0049223 | 3300046690 | Bacteria | 2673 |
| 1427 | Ga0495624_0125350 | 3300046690 | Unclassified | 1576 |
| 1428 | Ga0495624_0455793 | 3300046690 | Bacteria | 766 |
| 1429 | Ga0495624_0587498 | 3300046690 | Bacteria | 664 |
| 1430 | Ga0495670_0125502 | 3300046691 | Bacteria | 1336 |
| 1431 | Ga0495670_0287962 | 3300046691 | Bacteria | 879 |
| 1432 | Ga0495670_0413608 | 3300046691 | Unclassified | 729 |
| 1433 | Ga0495671_0289877 | 3300046692 | Bacteria | 788 |
| 1434 | Ga0495600_0090023 | 3300046809 | Bacteria | 2001 |
| 1435 | Ga0495600_0247630 | 3300046809 | Bacteria | 1134 |
| 1436 | Ga0495600_0725031 | 3300046809 | Bacteria | 596 |
| 1437 | Ga0495581_0001253 | 3300047315 | Bacteria | 13954 |
| 1438 | Ga0495581_0001600 | 3300047315 | Bacteria | 12638 |
| 1439 | Ga0495581_0179822 | 3300047315 | Bacteria | 1237 |
| 1440 | Ga0495604_0000075 | 3300047317 | Bacteria | 85370 |
| 1441 | Ga0495604_0055376 | 3300047317 | Bacteria | 3057 |
| 1442 | Ga0495604_0080405 | 3300047317 | Unclassified | 2442 |
| 1443 | Ga0495604_0376981 | 3300047317 | Bacteria | 938 |
| 1444 | Ga0495604_0792616 | 3300047317 | Bacteria | 597 |
| 1445 | Ga0495636_0199483 | 3300047318 | Bacteria | 913 |
| 1446 | Ga0495674_0041297 | 3300047319 | Bacteria | 4121 |
| 1447 | Ga0495674_0320691 | 3300047319 | Bacteria | 1262 |
| 1448 | Ga0495674_0693720 | 3300047319 | Bacteria | 799 |
| 1449 | Ga0495674_0768415 | 3300047319 | Bacteria | 752 |
| 1450 | Ga0495674_1136872 | 3300047319 | Bacteria | 593 |
| 1451 | Ga0495676_0011861 | 3300047321 | Bacteria | 7862 |
| 1452 | Ga0495676_0047337 | 3300047321 | Bacteria | 3478 |
| 1453 | Ga0495676_0249982 | 3300047321 | Bacteria | 1210 |
| 1454 | Ga0495676_0277111 | 3300047321 | Bacteria | 1136 |
| 1455 | Ga0495676_0298462 | 3300047321 | Bacteria | 1087 |
| 1456 | Ga0495676_0969544 | 3300047321 | Bacteria | 543 |
| 1457 | Ga0495680_0001905 | 3300047322 | Bacteria | 21903 |
| 1458 | Ga0495680_0006191 | 3300047322 | Bacteria | 11154 |
| 1459 | Ga0495680_0037232 | 3300047322 | Bacteria | 3898 |
| 1460 | Ga0495680_0056729 | 3300047322 | Bacteria | 3031 |
| 1461 | Ga0495680_0287801 | 3300047322 | Bacteria | 1156 |
| 1462 | Ga0495680_0674159 | 3300047322 | Bacteria | 685 |
| 1463 | Ga0495680_0714312 | 3300047322 | Bacteria | 661 |
| 1464 | Ga0495683_0433346 | 3300047323 | Bacteria | 542 |
| 1465 | Ga0495683_0456273 | 3300047323 | Bacteria | 524 |
| 1466 | Ga0495675_0000089 | 3300047444 | Bacteria | 64853 |
| 1467 | Ga0495684_0003909 | 3300047471 | Bacteria | 11609 |
| 1468 | Ga0495593_0014087 | 3300047673 | Bacteria | 4551 |
| 1469 | Ga0495602_0000140 | 3300048088 | Bacteria | 68037 |
| 1470 | Ga0495602_0261263 | 3300048088 | Bacteria | 1284 |
| 1471 | Ga0496100_0004732 | 3300048903 | Bacteria | 7257 |
| 1472 | Ga0496100_0010338 | 3300048903 | Bacteria | 5280 |
| 1473 | Ga0496100_0020599 | 3300048903 | Bacteria | 3956 |
| 1474 | Ga0496100_0064483 | 3300048903 | Bacteria | 2424 |
| 1475 | Ga0496100_0110162 | 3300048903 | Bacteria | 1911 |
| 1476 | Ga0496100_0151612 | 3300048903 | Bacteria | 1654 |
| 1477 | Ga0496100_0308610 | 3300048903 | Bacteria | 1186 |
| 1478 | Ga0496100_0397149 | 3300048903 | Bacteria | 1049 |
| 1479 | Ga0496100_0411232 | 3300048903 | Bacteria | 1032 |
| 1480 | Ga0496100_0445117 | 3300048903 | Bacteria | 992 |
| 1481 | Ga0496101_0004530 | 3300048904 | Bacteria | 8771 |
| 1482 | Ga0496101_0012096 | 3300048904 | Bacteria | 5752 |
| 1483 | Ga0496101_0017691 | 3300048904 | Bacteria | 4834 |
| 1484 | Ga0496101_0027136 | 3300048904 | Bacteria | 3985 |
| 1485 | Ga0496101_0053116 | 3300048904 | Bacteria | 2922 |
| 1486 | Ga0496101_0055464 | 3300048904 | Bacteria | 2862 |
| 1487 | Ga0496101_0084510 | 3300048904 | Bacteria | 2350 |
| 1488 | Ga0496101_0113050 | 3300048904 | Bacteria | 2046 |
| 1489 | Ga0496101_0163593 | 3300048904 | Bacteria | 1708 |
| 1490 | Ga0496101_0341321 | 3300048904 | Bacteria | 1176 |
| 1491 | Ga0496101_0407874 | 3300048904 | Bacteria | 1070 |
| 1492 | Ga0496101_0587011 | 3300048904 | Bacteria | 881 |
| 1493 | Ga0496101_0671515 | 3300048904 | Bacteria | 818 |
| 1494 | Ga0496101_0903107 | 3300048904 | Bacteria | 695 |
| 1495 | Ga0496101_1369153 | 3300048904 | Bacteria | 552 |
| 1496 | Ga0496102_0001619 | 3300048905 | Bacteria | 19836 |
| 1497 | Ga0496102_0019419 | 3300048905 | Bacteria | 5987 |
| 1498 | Ga0496102_0031138 | 3300048905 | Bacteria | 4783 |
| 1499 | Ga0496102_0052127 | 3300048905 | Bacteria | 3727 |
| 1500 | Ga0496102_0115683 | 3300048905 | Bacteria | 2502 |
| 1501 | Ga0496102_0125287 | 3300048905 | Bacteria | 2401 |
| 1502 | Ga0496102_0157860 | 3300048905 | Bacteria | 2133 |
| 1503 | Ga0496102_0300191 | 3300048905 | Bacteria | 1514 |
| 1504 | Ga0496102_0305497 | 3300048905 | Bacteria | 1499 |
| 1505 | Ga0496102_0341605 | 3300048905 | Bacteria | 1410 |
| 1506 | Ga0496102_0352560 | 3300048905 | Bacteria | 1385 |
| 1507 | Ga0496102_0626905 | 3300048905 | Bacteria | 998 |
| 1508 | Ga0496102_1168181 | 3300048905 | Unclassified | 689 |
| 1509 | Ga0496102_1500844 | 3300048905 | Bacteria | 593 |
| 1510 | Ga0496103_0003260 | 3300048906 | Bacteria | 9944 |
| 1511 | Ga0496103_0011323 | 3300048906 | Bacteria | 5282 |
| 1512 | Ga0496103_0029954 | 3300048906 | Bacteria | 3309 |
| 1513 | Ga0496103_0044530 | 3300048906 | Bacteria | 2734 |
| 1514 | Ga0496103_0169078 | 3300048906 | Bacteria | 1403 |
| 1515 | Ga0496103_0189656 | 3300048906 | Bacteria | 1322 |
| 1516 | Ga0496103_0459737 | 3300048906 | Bacteria | 816 |
| 1517 | Ga0496103_0541414 | 3300048906 | Bacteria | 744 |
| 1518 | Ga0496104_0000698 | 3300048907 | Bacteria | 28892 |
| 1519 | Ga0496104_0001046 | 3300048907 | Bacteria | 23659 |
| 1520 | Ga0496104_0005959 | 3300048907 | Bacteria | 10676 |
| 1521 | Ga0496104_0006253 | 3300048907 | Bacteria | 10464 |
| 1522 | Ga0496104_0010896 | 3300048907 | Bacteria | 8133 |
| 1523 | Ga0496104_0011416 | 3300048907 | Bacteria | 7955 |
| 1524 | Ga0496104_0037752 | 3300048907 | Bacteria | 4516 |
| 1525 | Ga0496104_0052023 | 3300048907 | Bacteria | 3868 |
| 1526 | Ga0496104_0123420 | 3300048907 | Bacteria | 2486 |
| 1527 | Ga0496104_0243349 | 3300048907 | Bacteria | 1711 |
| 1528 | Ga0496104_0267593 | 3300048907 | Unclassified | 1621 |
| 1529 | Ga0496104_0393914 | 3300048907 | Unclassified | 1297 |
| 1530 | Ga0496104_0434813 | 3300048907 | Bacteria | 1224 |
| 1531 | Ga0496104_0443285 | 3300048907 | Bacteria | 1210 |
| 1532 | Ga0496105_0000377 | 3300048908 | Bacteria | 29481 |
| 1533 | Ga0496105_0032083 | 3300048908 | Bacteria | 4308 |
| 1534 | Ga0496105_0053178 | 3300048908 | Bacteria | 3344 |
| 1535 | Ga0496105_0065374 | 3300048908 | Unclassified | 3002 |
| 1536 | Ga0496105_0090952 | 3300048908 | Unclassified | 2520 |
| 1537 | Ga0496105_0106665 | 3300048908 | Bacteria | 2312 |
| 1538 | Ga0496105_0143228 | 3300048908 | Bacteria | 1966 |
| 1539 | Ga0496105_0172719 | 3300048908 | Bacteria | 1771 |
| 1540 | Ga0496105_0232354 | 3300048908 | Bacteria | 1498 |
| 1541 | Ga0496105_0325512 | 3300048908 | Bacteria | 1231 |
| 1542 | Ga0496105_0381444 | 3300048908 | Bacteria | 1122 |
| 1543 | Ga0496105_0395622 | 3300048908 | Bacteria | 1097 |
| 1544 | Ga0496105_0644661 | 3300048908 | Bacteria | 818 |
| 1545 | Ga0496105_0850135 | 3300048908 | Bacteria | 691 |
| 1546 | Ga0496106_0005023 | 3300048909 | Bacteria | 9789 |
| 1547 | Ga0496106_0010051 | 3300048909 | Bacteria | 6990 |
| 1548 | Ga0496106_0015786 | 3300048909 | Bacteria | 5585 |
| 1549 | Ga0496106_0034593 | 3300048909 | Bacteria | 3774 |
| 1550 | Ga0496106_0234914 | 3300048909 | Bacteria | 1464 |
| 1551 | Ga0496106_0263059 | 3300048909 | Bacteria | 1380 |
| 1552 | Ga0496106_0290547 | 3300048909 | Bacteria | 1310 |
| 1553 | Ga0496106_0358212 | 3300048909 | Bacteria | 1172 |
| 1554 | Ga0496106_0358915 | 3300048909 | Bacteria | 1171 |
| 1555 | Ga0496106_0586223 | 3300048909 | Bacteria | 893 |
| 1556 | Ga0496107_0007323 | 3300048910 | Bacteria | 7607 |
| 1557 | Ga0496107_0015370 | 3300048910 | Bacteria | 5364 |
| 1558 | Ga0496107_0020725 | 3300048910 | Bacteria | 4646 |
| 1559 | Ga0496107_0054065 | 3300048910 | Bacteria | 2897 |
| 1560 | Ga0496107_0055332 | 3300048910 | Bacteria | 2866 |
| 1561 | Ga0496107_0081995 | 3300048910 | Bacteria | 2352 |
| 1562 | Ga0496107_0098586 | 3300048910 | Bacteria | 2140 |
| 1563 | Ga0496107_0116854 | 3300048910 | Bacteria | 1964 |
| 1564 | Ga0496107_0171207 | 3300048910 | Bacteria | 1611 |
| 1565 | Ga0496107_0186511 | 3300048910 | Bacteria | 1541 |
| 1566 | Ga0496107_0394265 | 3300048910 | Unclassified | 1030 |
| 1567 | Ga0496107_0591326 | 3300048910 | Bacteria | 821 |
| 1568 | Ga0496107_0710546 | 3300048910 | Bacteria | 739 |
| 1569 | Ga0496108_0010471 | 3300048911 | Bacteria | 7531 |
| 1570 | Ga0496108_0017267 | 3300048911 | Bacteria | 5903 |
| 1571 | Ga0496108_0020646 | 3300048911 | Bacteria | 5412 |
| 1572 | Ga0496108_0021100 | 3300048911 | Bacteria | 5352 |
| 1573 | Ga0496108_0085622 | 3300048911 | Bacteria | 2675 |
| 1574 | Ga0496108_0087262 | 3300048911 | Bacteria | 2650 |
| 1575 | Ga0496108_0104019 | 3300048911 | Bacteria | 2423 |
| 1576 | Ga0496108_0198216 | 3300048911 | Bacteria | 1742 |
| 1577 | Ga0496108_0219645 | 3300048911 | Bacteria | 1651 |
| 1578 | Ga0496108_0431573 | 3300048911 | Bacteria | 1151 |
| 1579 | Ga0496108_0558838 | 3300048911 | Bacteria | 998 |
| 1580 | Ga0496108_0687574 | 3300048911 | Bacteria | 888 |
| 1581 | Ga0496108_0902702 | 3300048911 | Bacteria | 758 |
| 1582 | Ga0496108_1187795 | 3300048911 | Bacteria | 645 |
| 1583 | Ga0496109_0000283 | 3300048912 | Bacteria | 48503 |
| 1584 | Ga0496109_0004017 | 3300048912 | Bacteria | 12285 |
| 1585 | Ga0496109_0006743 | 3300048912 | Bacteria | 9669 |
| 1586 | Ga0496109_0012833 | 3300048912 | Bacteria | 7242 |
| 1587 | Ga0496109_0018246 | 3300048912 | Bacteria | 6163 |
| 1588 | Ga0496109_0032576 | 3300048912 | Bacteria | 4685 |
| 1589 | Ga0496109_0038118 | 3300048912 | Bacteria | 4344 |
| 1590 | Ga0496109_0162906 | 3300048912 | Bacteria | 2090 |
| 1591 | Ga0496109_0172234 | 3300048912 | Unclassified | 2031 |
| 1592 | Ga0496109_0185355 | 3300048912 | Bacteria | 1955 |
| 1593 | Ga0496109_0316614 | 3300048912 | Bacteria | 1472 |
| 1594 | Ga0496109_0336530 | 3300048912 | Bacteria | 1425 |
| 1595 | Ga0496109_0350998 | 3300048912 | Bacteria | 1393 |
| 1596 | Ga0496109_0602839 | 3300048912 | Bacteria | 1034 |
| 1597 | Ga0496109_1141414 | 3300048912 | Bacteria | 716 |
| 1598 | Ga0496109_1506322 | 3300048912 | Bacteria | 608 |
| 1599 | Ga0496110_0000421 | 3300048913 | Bacteria | 28725 |
| 1600 | Ga0496110_0006569 | 3300048913 | Bacteria | 9234 |
| 1601 | Ga0496110_0013754 | 3300048913 | Bacteria | 6704 |
| 1602 | Ga0496110_0022751 | 3300048913 | Bacteria | 5326 |
| 1603 | Ga0496110_0024549 | 3300048913 | Bacteria | 5138 |
| 1604 | Ga0496110_0035182 | 3300048913 | Bacteria | 4344 |
| 1605 | Ga0496110_0070437 | 3300048913 | Bacteria | 3098 |
| 1606 | Ga0496110_0131141 | 3300048913 | Bacteria | 2263 |
| 1607 | Ga0496110_0166999 | 3300048913 | Bacteria | 1996 |
| 1608 | Ga0496110_0232283 | 3300048913 | Bacteria | 1678 |
| 1609 | Ga0496110_0432630 | 3300048913 | Unclassified | 1199 |
| 1610 | Ga0496110_0481737 | 3300048913 | Bacteria | 1130 |
| 1611 | Ga0496110_0561471 | 3300048913 | Bacteria | 1037 |
| 1612 | Ga0496110_0778333 | 3300048913 | Bacteria | 861 |
| 1613 | Ga0496110_1004964 | 3300048913 | Bacteria | 741 |
| 1614 | Ga0496111_0002126 | 3300048914 | Bacteria | 11844 |
| 1615 | Ga0496111_0011579 | 3300048914 | Bacteria | 5947 |
| 1616 | Ga0496111_0041373 | 3300048914 | Bacteria | 3307 |
| 1617 | Ga0496111_0065481 | 3300048914 | Bacteria | 2638 |
| 1618 | Ga0496111_0076320 | 3300048914 | Bacteria | 2442 |
| 1619 | Ga0496111_0080299 | 3300048914 | Bacteria | 2379 |
| 1620 | Ga0496111_0084865 | 3300048914 | Bacteria | 2315 |
| 1621 | Ga0496111_0094587 | 3300048914 | Bacteria | 2192 |
| 1622 | Ga0496111_0121276 | 3300048914 | Bacteria | 1931 |
| 1623 | Ga0496111_0165030 | 3300048914 | Bacteria | 1645 |
| 1624 | Ga0496111_0165245 | 3300048914 | Bacteria | 1644 |
| 1625 | Ga0496111_0259744 | 3300048914 | Bacteria | 1289 |
| 1626 | Ga0496111_0346647 | 3300048914 | Unclassified | 1099 |
| 1627 | Ga0496111_0403777 | 3300048914 | Unclassified | 1010 |
| 1628 | Ga0496111_0442135 | 3300048914 | Bacteria | 960 |
| 1629 | Ga0496111_0520511 | 3300048914 | Bacteria | 875 |
| 1630 | Ga0496111_1039137 | 3300048914 | Bacteria | 586 |
| 1631 | Ga0496112_0000741 | 3300048915 | Bacteria | 22777 |
| 1632 | Ga0496112_0014699 | 3300048915 | Bacteria | 7277 |
| 1633 | Ga0496112_0032585 | 3300048915 | Bacteria | 5061 |
| 1634 | Ga0496112_0054122 | 3300048915 | Bacteria | 3942 |
| 1635 | Ga0496112_0056912 | 3300048915 | Bacteria | 3849 |
| 1636 | Ga0496112_0103793 | 3300048915 | Bacteria | 2813 |
| 1637 | Ga0496112_0112123 | 3300048915 | Bacteria | 2697 |
| 1638 | Ga0496112_0136477 | 3300048915 | Bacteria | 2423 |
| 1639 | Ga0496112_0184167 | 3300048915 | Bacteria | 2052 |
| 1640 | Ga0496112_0314331 | 3300048915 | Bacteria | 1511 |
| 1641 | Ga0496112_0342348 | 3300048915 | Bacteria | 1438 |
| 1642 | Ga0496112_0497632 | 3300048915 | Bacteria | 1154 |
| 1643 | Ga0496112_0615163 | 3300048915 | Bacteria | 1017 |
| 1644 | Ga0496112_0632172 | 3300048915 | Bacteria | 1001 |
| 1645 | Ga0496112_1483803 | 3300048915 | Bacteria | 592 |
| 1646 | Ga0496112_1667470 | 3300048915 | Bacteria | 550 |
| 1647 | Ga0496113_0006821 | 3300048916 | Bacteria | 7282 |
| 1648 | Ga0496113_0009476 | 3300048916 | Bacteria | 6388 |
| 1649 | Ga0496113_0016822 | 3300048916 | Bacteria | 5060 |
| 1650 | Ga0496113_0039442 | 3300048916 | Bacteria | 3476 |
| 1651 | Ga0496113_0240448 | 3300048916 | Bacteria | 1444 |
| 1652 | Ga0496113_0277014 | 3300048916 | Unclassified | 1341 |
| 1653 | Ga0496113_0344004 | 3300048916 | Bacteria | 1196 |
| 1654 | Ga0496113_0811179 | 3300048916 | Unclassified | 743 |
| 1655 | Ga0496113_0988100 | 3300048916 | Bacteria | 663 |
| 1656 | Ga0496114_0000356 | 3300048917 | Bacteria | 33554 |
| 1657 | Ga0496114_0000404 | 3300048917 | Bacteria | 31906 |
| 1658 | Ga0496114_0004656 | 3300048917 | Bacteria | 10664 |
| 1659 | Ga0496114_0028777 | 3300048917 | Bacteria | 4562 |
| 1660 | Ga0496114_0033507 | 3300048917 | Bacteria | 4233 |
| 1661 | Ga0496114_0044665 | 3300048917 | Bacteria | 3677 |
| 1662 | Ga0496114_0048157 | 3300048917 | Bacteria | 3545 |
| 1663 | Ga0496114_0062878 | 3300048917 | Bacteria | 3107 |
| 1664 | Ga0496114_0065058 | 3300048917 | Bacteria | 3054 |
| 1665 | Ga0496114_0087340 | 3300048917 | Bacteria | 2644 |
| 1666 | Ga0496114_0173874 | 3300048917 | Bacteria | 1878 |
| 1667 | Ga0496114_0240853 | 3300048917 | Bacteria | 1591 |
| 1668 | Ga0496114_0242968 | 3300048917 | Bacteria | 1584 |
| 1669 | Ga0496114_0392905 | 3300048917 | Bacteria | 1228 |
| 1670 | Ga0496114_0437931 | 3300048917 | Unclassified | 1158 |
| 1671 | Ga0496114_0737164 | 3300048917 | Bacteria | 862 |
| 1672 | Ga0496115_0003585 | 3300048918 | Bacteria | 11163 |
| 1673 | Ga0496115_0011507 | 3300048918 | Bacteria | 6634 |
| 1674 | Ga0496115_0016253 | 3300048918 | Bacteria | 5662 |
| 1675 | Ga0496115_0022227 | 3300048918 | Bacteria | 4912 |
| 1676 | Ga0496115_0027626 | 3300048918 | Bacteria | 4441 |
| 1677 | Ga0496115_0112837 | 3300048918 | Bacteria | 2233 |
| 1678 | Ga0496115_0533639 | 3300048918 | Bacteria | 939 |
| 1679 | Ga0496115_0923301 | 3300048918 | Bacteria | 672 |
| 1680 | Ga0501034_0012275 | 3300049571 | Bacteria | 8854 |
| 1681 | Ga0501036_0478541 | 3300049572 | Bacteria | 1037 |
| 1682 | Ga0501047_0045260 | 3300049581 | Bacteria | 4255 |
| 1683 | Ga0501067_0001025 | 3300049583 | Bacteria | 15041 |
| 1684 | Ga0501067_0020731 | 3300049583 | Bacteria | 3636 |
| 1685 | Ga0501067_0041661 | 3300049583 | Bacteria | 2550 |
| 1686 | Ga0501067_0059394 | 3300049583 | Bacteria | 2117 |
| 1687 | Ga0501067_0062089 | 3300049583 | Bacteria | 2068 |
| 1688 | Ga0501068_0257082 | 3300049584 | Bacteria | 1114 |
| 1689 | Ga0501069_0003321 | 3300049585 | Bacteria | 8255 |
| 1690 | Ga0501069_0011862 | 3300049585 | Bacteria | 4621 |
| 1691 | Ga0501069_0027503 | 3300049585 | Bacteria | 3116 |
| 1692 | Ga0501069_0880311 | 3300049585 | Bacteria | 544 |
| 1693 | Ga0501070_0007998 | 3300049586 | Bacteria | 8954 |
| 1694 | Ga0501070_0026505 | 3300049586 | Bacteria | 4861 |
| 1695 | Ga0501071_1003366 | 3300049587 | Bacteria | 645 |
| 1696 | Ga0501072_0013409 | 3300049588 | Bacteria | 6273 |
| 1697 | Ga0501073_0011431 | 3300049589 | Bacteria | 6496 |
| 1698 | Ga0501074_0020920 | 3300049590 | Bacteria | 4751 |
| 1699 | Ga0501074_0106178 | 3300049590 | Bacteria | 2010 |
| 1700 | Ga0501075_0337341 | 3300049591 | Bacteria | 1149 |
| 1701 | Ga0501076_0378553 | 3300049592 | Unclassified | 1163 |
| 1702 | Ga0501079_0045168 | 3300049741 | Bacteria | 3400 |
| 1703 | Ga0501079_0464571 | 3300049741 | Unclassified | 994 |
| 1704 | Ga0501080_0003102 | 3300049742 | Bacteria | 14670 |
| 1705 | Ga0501080_0105085 | 3300049742 | Bacteria | 2618 |
| 1706 | Ga0501081_0731540 | 3300049743 | Unclassified | 743 |
| 1707 | Ga0501081_0795377 | 3300049743 | Unclassified | 712 |
| 1708 | Ga0501083_0001195 | 3300049744 | Bacteria | 17537 |
| 1709 | Ga0501083_0275891 | 3300049744 | Bacteria | 1094 |
| 1710 | Ga0501044_0311762 | 3300049823 | Bacteria | 1500 |
| 1711 | nmdc:mga0yw44_591563_c1 | 3300050492 | Bacteria | 754 |
| 1712 | nmdc:mga0yw44_93626_c1 | 3300050492 | Bacteria | 1903 |
| 1713 | nmdc:mga05p37_1121769_c1 | 3300050507 | Unclassified | 821 |
| 1714 | nmdc:mga05p37_1670778_c1 | 3300050507 | Bacteria | 623 |
| 1715 | nmdc:mga05p37_172288_c1 | 3300050507 | Bacteria | 2639 |
| 1716 | nmdc:mga05p37_246105_c1 | 3300050507 | Bacteria | 2147 |
| 1717 | nmdc:mga05p37_38372_c1 | 3300050507 | Bacteria | 5875 |
| 1718 | nmdc:mga05p37_523266_c1 | 3300050507 | Bacteria | 1356 |
| 1719 | nmdc:mga06r32_101267_c1 | 3300050510 | Bacteria | 2827 |
| 1720 | nmdc:mga06r32_183981_c1 | 3300050510 | Bacteria | 2076 |
| 1721 | nmdc:mga06r32_538271_c1 | 3300050510 | Bacteria | 1143 |
| 1722 | nmdc:mga08y16_1260446_c1 | 3300050511 | Bacteria | 708 |
| 1723 | nmdc:mga08y16_1357471_c1 | 3300050511 | Bacteria | 676 |
| 1724 | nmdc:mga08y16_348330_c1 | 3300050511 | Unclassified | 1522 |
| 1725 | nmdc:mga0n895_11341_c1 | 3300050512 | Bacteria | 7943 |
| 1726 | nmdc:mga0n895_121568_c1 | 3300050512 | Bacteria | 2632 |
| 1727 | nmdc:mga0n895_128934_c1 | 3300050512 | Bacteria | 2554 |
| 1728 | nmdc:mga0n895_15149_c1 | 3300050512 | Bacteria | 7026 |
| 1729 | nmdc:mga0n895_19850_c1 | 3300050512 | Bacteria | 6255 |
| 1730 | nmdc:mga0n895_276457_c1 | 3300050512 | Unclassified | 1703 |
| 1731 | nmdc:mga0n895_31090_c1 | 3300050512 | Bacteria | 5109 |
| 1732 | nmdc:mga0n895_335957_c1 | 3300050512 | Bacteria | 1531 |
| 1733 | nmdc:mga0n895_491604_c1 | 3300050512 | Bacteria | 1237 |
| 1734 | nmdc:mga0n895_612970_c1 | 3300050512 | Bacteria | 1090 |
| 1735 | nmdc:mga0n895_714580_c1 | 3300050512 | Bacteria | 997 |
| 1736 | nmdc:mga0n895_82756_c1 | 3300050512 | Bacteria | 3200 |
| 1737 | nmdc:mga0n895_877627_c1 | 3300050512 | Bacteria | 883 |
| 1738 | nmdc:mga0rr50_11505_c1 | 3300050513 | Bacteria | 5670 |
| 1739 | nmdc:mga0rr50_143246_c1 | 3300050513 | Bacteria | 1925 |
| 1740 | nmdc:mga0rr50_221492_c1 | 3300050513 | Bacteria | 1562 |
| 1741 | nmdc:mga0rr50_2615_c1 | 3300050513 | Bacteria | 10202 |
| 1742 | nmdc:mga0rr50_51388_c1 | 3300050513 | Bacteria | 3058 |
| 1743 | nmdc:mga0rr50_54468_c1 | 3300050513 | Bacteria | 2980 |
| 1744 | nmdc:mga0rr50_7814_c1 | 3300050513 | Bacteria | 6629 |
| 1745 | nmdc:mga0rr50_8473_c1 | 3300050513 | Bacteria | 6405 |
| 1746 | nmdc:mga08x19_179801_c1 | 3300050514 | Bacteria | 1444 |
| 1747 | nmdc:mga08x19_40310_c1 | 3300050514 | Bacteria | 2972 |
| 1748 | nmdc:mga08x19_8684_c1 | 3300050514 | Bacteria | 6058 |
| 1749 | nmdc:mga0a205_2017_c1 | 3300050515 | Bacteria | 17726 |
| 1750 | nmdc:mga0a205_34318_c1 | 3300050515 | Bacteria | 4869 |
| 1751 | nmdc:mga0a205_344728_c1 | 3300050515 | Bacteria | 1358 |
| 1752 | nmdc:mga0a205_36789_c1 | 3300050515 | Bacteria | 4706 |
| 1753 | nmdc:mga0a205_409831_c1 | 3300050515 | Bacteria | 1218 |
| 1754 | nmdc:mga0a205_533992_c1 | 3300050515 | Bacteria | 1029 |
| 1755 | nmdc:mga0a205_585298_c1 | 3300050515 | Bacteria | 970 |
| 1756 | nmdc:mga0a205_58757_c1 | 3300050515 | Bacteria | 3714 |
| 1757 | nmdc:mga0a205_796988_c1 | 3300050515 | Bacteria | 793 |
| 1758 | Ga0495601_0000273 | 3300053077 | Bacteria | 28075 |
| 1759 | Ga0495601_0078078 | 3300053077 | Bacteria | 2121 |
| 1760 | Ga0495601_0422177 | 3300053077 | Bacteria | 864 |
| 1761 | Ga0495601_0567442 | 3300053077 | Bacteria | 729 |
| 1762 | Ga0495601_0669435 | 3300053077 | Bacteria | 663 |
| 1763 | Ga0495601_0942941 | 3300053077 | Bacteria | 544 |
| 1764 | Ga0495612_0030276 | 3300053078 | Bacteria | 2180 |
| 1765 | Ga0495612_0143348 | 3300053078 | Bacteria | 1037 |
| 1766 | Ga0495655_0249351 | 3300053083 | Bacteria | 596 |
| 1767 | Ga0495655_0325428 | 3300053083 | Bacteria | 533 |
| 1768 | Ga0495595_0016538 | 3300053084 | Bacteria | 3158 |
| 1769 | Ga0495595_0026793 | 3300053084 | Bacteria | 2563 |
| 1770 | Ga0495595_0143183 | 3300053084 | Bacteria | 1174 |
| 1771 | Ga0495595_0385175 | 3300053084 | Bacteria | 710 |
| 1772 | Ga0495619_0000123 | 3300053085 | Bacteria | 57052 |
| 1773 | Ga0495619_0003756 | 3300053085 | Bacteria | 9779 |
| 1774 | Ga0495619_0010339 | 3300053085 | Bacteria | 5872 |
| 1775 | Ga0495619_0062364 | 3300053085 | Bacteria | 2481 |
| 1776 | Ga0495619_0091000 | 3300053085 | Bacteria | 2065 |
| 1777 | Ga0495619_0103711 | 3300053085 | Bacteria | 1938 |
| 1778 | Ga0495619_0137416 | 3300053085 | Bacteria | 1681 |
| 1779 | Ga0495619_0195299 | 3300053085 | Bacteria | 1401 |
| 1780 | Ga0495619_0347332 | 3300053085 | Bacteria | 1026 |
| 1781 | Ga0500566_0405083 | 3300053094 | Bacteria | 609 |
| 1782 | Ga0587066_003474 | 3300059490 | Bacteria | 1854 |
| 1783 | Ga0587066_008475 | 3300059490 | Bacteria | 1428 |
| 1784 | Ga0587066_026050 | 3300059490 | Bacteria | 1008 |
| 1785 | Ga0587066_034361 | 3300059490 | Bacteria | 923 |
| 1786 | Ga0587070_022572 | 3300059491 | Unclassified | 1073 |
| 1787 | Ga0587073_0024496 | 3300059492 | Bacteria | 1192 |
| 1788 | Ga0587077_015938 | 3300059493 | Unclassified | 1259 |
| 1789 | Ga0587082_043305 | 3300059504 | Bacteria | 834 |
| 1790 | Ga0587082_098357 | 3300059504 | Bacteria | 634 |
| 1791 | Ga0587082_166337 | 3300059504 | Bacteria | 532 |
| 1792 | Ga0587083_0042144 | 3300059505 | Bacteria | 961 |
| 1793 | Ga0587083_0043679 | 3300059505 | Bacteria | 949 |
| 1794 | Ga0587088_025102 | 3300059508 | Bacteria | 1026 |
| 1795 | Ga0587090_055994 | 3300059510 | Bacteria | 735 |
| 1796 | Ga0587091_022009 | 3300059511 | Bacteria | 1122 |
| 1797 | Ga0587098_055762 | 3300059604 | Bacteria | 610 |
| 1798 | Ga0587106_001318 | 3300059605 | Bacteria | 2159 |
| 1799 | Ga0587106_014613 | 3300059605 | Bacteria | 1084 |
| 1800 | Ga0587121_13633 | 3300059606 | Bacteria | 530 |
| 1801 | Ga0587113_046809 | 3300059625 | Bacteria | 531 |
| 1802 | Ga0587115_007228 | 3300059626 | Bacteria | 1306 |
| 1803 | Ga0587128_125207 | 3300059630 | Bacteria | 563 |
| 1804 | Ga0587128_134054 | 3300059630 | Bacteria | 551 |
| 1805 | Ga0587067_013278 | 3300059640 | Unclassified | 1301 |
| 1806 | Ga0587067_157212 | 3300059640 | Bacteria | 575 |
| 1807 | Ga0587068_020750 | 3300059641 | Bacteria | 1076 |
| 1808 | Ga0587078_051183 | 3300059646 | Bacteria | 606 |
| 1809 | Ga0587079_000834 | 3300059647 | Bacteria | 3099 |
| 1810 | Ga0587079_007273 | 3300059647 | Bacteria | 1650 |
| 1811 | Ga0587107_016428 | 3300059652 | Bacteria | 978 |
| 1812 | Ga0587110_025690 | 3300059654 | Bacteria | 693 |
| 1813 | Ga0587071_051674 | 3300060344 | Bacteria | 852 |
| 1814 | Ga0587111_0240484 | 3300060346 | Bacteria | 531 |
| 1815 | Ga0466962_0000618 | 3300061719 | Bacteria | 15773 |
| 1816 | Ga0466962_0002035 | 3300061719 | Bacteria | 9553 |
| 1817 | Ga0466962_0009674 | 3300061719 | Bacteria | 4624 |
| 1818 | Ga0466962_0014258 | 3300061719 | Bacteria | 3829 |
| 1819 | Ga0466962_0059781 | 3300061719 | Bacteria | 1819 |
| 1820 | Ga0466962_0079819 | 3300061719 | Bacteria | 1564 |
| 1821 | Ga0466962_0119436 | 3300061719 | Bacteria | 1271 |
| 1822 | Ga0530510_0009967 | 3300061734 | Bacteria | 6666 |
| 1823 | Ga0530510_0159471 | 3300061734 | Bacteria | 1668 |
| 1824 | Ga0530510_0177060 | 3300061734 | Bacteria | 1581 |
| 1825 | Ga0530510_1452382 | 3300061734 | Bacteria | 526 |
| 1826 | Ga0207681_11330880 | |||
| 1827 | Ga0058863_11731045 | |||
| 1828 | Ga0058862_12807872 | |||
| 1829 | Ga0070658_10013364 | |||
| 1830 | Ga0070676_11053314 | |||
| 1831 | Ga0070683_100001708 | |||
| 1832 | Ga0070683_100006172 | |||
| 1833 | Ga0070683_100015515 | |||
| 1834 | Ga0070683_100044248 | |||
| 1835 | Ga0070683_100057488 | |||
| 1836 | Ga0070683_100100167 | |||
| 1837 | Ga0070683_100165156 | |||
| 1838 | Ga0070683_100219000 | |||
| 1839 | Ga0070683_102369656 | |||
| 1840 | Ga0070690_100072267 | |||
| 1841 | Ga0070690_100103547 | |||
| 1842 | Ga0070690_100572717 | |||
| 1843 | Ga0070690_100928842 | |||
| 1844 | Ga0068869_100854770 | |||
| 1845 | Ga0070666_10061309 | |||
| 1846 | Ga0070666_11327921 | |||
| 1847 | Ga0070680_100037505 | |||
| 1848 | Ga0070680_100039529 | |||
| 1849 | Ga0070680_100103365 | |||
| 1850 | Ga0070680_100118799 | |||
| 1851 | Ga0070680_100218396 | |||
| 1852 | Ga0070680_100258182 | |||
| 1853 | Ga0070680_100387139 | |||
| 1854 | Ga0070680_100387419 | |||
| 1855 | Ga0070680_100460417 | |||
| 1856 | Ga0070680_100621589 | |||
| 1857 | Ga0070680_101813531 | |||
| 1858 | Ga0070682_100002331 | |||
| 1859 | Ga0070682_100019799 | |||
| 1860 | Ga0070682_100072527 | |||
| 1861 | Ga0070682_100078787 | |||
| 1862 | Ga0070682_100109769 | |||
| 1863 | Ga0070682_100167241 | |||
| 1864 | Ga0070682_100214342 | |||
| 1865 | Ga0070682_100611904 | |||
| 1866 | Ga0068868_100166940 | |||
| 1867 | Ga0068868_100201178 | |||
| 1868 | Ga0068868_100342626 | |||
| 1869 | Ga0068868_100429331 | |||
| 1870 | Ga0068868_101192438 | |||
| 1871 | Ga0068868_101533074 | |||
| 1872 | Ga0068868_101914221 | |||
| 1873 | Ga0068868_102145999 | |||
| 1874 | Ga0070660_100004253 | |||
| 1875 | Ga0070660_100012338 | |||
| 1876 | Ga0070660_100024290 | |||
| 1877 | Ga0070660_100036325 | |||
| 1878 | Ga0070660_100038938 | |||
| 1879 | Ga0070660_100047344 | |||
| 1880 | Ga0070660_100074301 | |||
| 1881 | Ga0070660_100112457 | |||
| 1882 | Ga0070660_100315231 | |||
| 1883 | Ga0070660_100710743 | |||
| 1884 | Ga0070660_101089372 | |||
| 1885 | Ga0070660_101301634 | |||
| 1886 | Ga0070689_100474441 | |||
| 1887 | Ga0070689_102137612 | |||
| 1888 | Ga0070691_10331966 | |||
| 1889 | Ga0070691_10434298 | |||
| 1890 | Ga0070687_100341763 | |||
| 1891 | Ga0070661_100060435 | |||
| 1892 | Ga0070661_100086785 | |||
| 1893 | Ga0070661_100088452 | |||
| 1894 | Ga0070661_100806084 | |||
| 1895 | Ga0070661_101203562 | |||
| 1896 | Ga0070692_10003563 | |||
| 1897 | Ga0070692_10127680 | |||
| 1898 | Ga0070668_100013432 | |||
| 1899 | Ga0070669_100879021 | |||
| 1900 | Ga0070669_101664512 | |||
| 1901 | Ga0070675_100966101 | |||
| 1902 | Ga0070671_100043036 | |||
| 1903 | Ga0070671_100046873 | |||
| 1904 | Ga0070671_100352536 | |||
| 1905 | Ga0070674_100020000 | |||
| 1906 | Ga0070674_100290390 | |||
| 1907 | Ga0070674_100608806 | |||
| 1908 | Ga0070673_100451084 | |||
| 1909 | Ga0070688_100040381 | |||
| 1910 | Ga0070659_100019066 | |||
| 1911 | Ga0070659_100047606 | |||
| 1912 | Ga0070659_100490970 | |||
| 1913 | Ga0070659_100703158 | |||
| 1914 | Ga0070659_100713563 | |||
| 1915 | Ga0070703_10004706 | |||
| 1916 | Ga0070703_10140157 | |||
| 1917 | Ga0070703_10212949 | |||
| 1918 | Ga0070709_10017895 | |||
| 1919 | Ga0070709_10023373 | |||
| 1920 | Ga0070709_10123336 | |||
| 1921 | Ga0070709_10127106 | |||
| 1922 | Ga0070709_10182249 | |||
| 1923 | Ga0070709_10531003 | |||
| 1924 | Ga0070709_10702835 | |||
| 1925 | Ga0070714_100028835 | |||
| 1926 | Ga0070714_100046168 | |||
| 1927 | Ga0070714_100056564 | |||
| 1928 | Ga0070714_100084933 | |||
| 1929 | Ga0070714_100092072 | |||
| 1930 | Ga0070714_100170924 | |||
| 1931 | Ga0070714_100223446 | |||
| 1932 | Ga0070714_100236558 | |||
| 1933 | Ga0070714_100240876 | |||
| 1934 | Ga0070714_100285364 | |||
| 1935 | Ga0070714_100292885 | |||
| 1936 | Ga0070714_100400961 | |||
| 1937 | Ga0070714_100488233 | |||
| 1938 | Ga0070714_100714312 | |||
| 1939 | Ga0070714_101067530 | |||
| 1940 | Ga0070713_100001385 | |||
| 1941 | Ga0070713_100049209 | |||
| 1942 | Ga0070713_100106240 | |||
| 1943 | Ga0070713_100275311 | |||
| 1944 | Ga0070713_100287937 | |||
| 1945 | Ga0070713_100359453 | |||
| 1946 | Ga0070713_101408739 | |||
| 1947 | Ga0070713_101720823 | |||
| 1948 | Ga0070713_102203499 | |||
| 1949 | Ga0070710_10004423 | |||
| 1950 | Ga0070710_10026574 | |||
| 1951 | Ga0070710_10033117 | |||
| 1952 | Ga0070710_10049662 | |||
| 1953 | Ga0070710_10056845 | |||
| 1954 | Ga0070710_10400848 | |||
| 1955 | Ga0070710_10498263 | |||
| 1956 | Ga0070701_10040106 | |||
| 1957 | Ga0070701_10521768 | |||
| 1958 | Ga0070701_10524942 | |||
| 1959 | Ga0070711_100011720 | |||
| 1960 | Ga0070711_100012459 | |||
| 1961 | Ga0070711_100040909 | |||
| 1962 | Ga0070711_100071933 | |||
| 1963 | Ga0070711_100095375 | |||
| 1964 | Ga0070711_100259062 | |||
| 1965 | Ga0070711_100358015 | |||
| 1966 | Ga0070711_100425544 | |||
| 1967 | Ga0070711_100575308 | |||
| 1968 | Ga0070705_100027122 | |||
| 1969 | Ga0070705_100042434 | |||
| 1970 | Ga0070705_100161460 | |||
| 1971 | Ga0070705_100210125 | |||
| 1972 | Ga0070705_100229931 | |||
| 1973 | Ga0070705_100284812 | |||
| 1974 | Ga0070700_100060803 | |||
| 1975 | Ga0070694_100013842 | |||
| 1976 | Ga0070694_100090601 | |||
| 1977 | Ga0070694_100106381 | |||
| 1978 | Ga0070694_100259555 | |||
| 1979 | Ga0070694_100464265 | |||
| 1980 | Ga0070708_100021151 | |||
| 1981 | Ga0070708_100121492 | |||
| 1982 | Ga0070708_100165815 | |||
| 1983 | Ga0070708_100181039 | |||
| 1984 | Ga0070708_100196478 | |||
| 1985 | Ga0070708_100430108 | |||
| 1986 | Ga0070708_100892397 | |||
| 1987 | Ga0070663_100225578 | |||
| 1988 | Ga0070663_100425281 | |||
| 1989 | Ga0070663_101319931 | |||
| 1990 | Ga0070678_100010155 | |||
| 1991 | Ga0070678_100045649 | |||
| 1992 | Ga0070678_100094242 | |||
| 1993 | Ga0070678_100728215 | |||
| 1994 | Ga0070678_101449407 | |||
| 1995 | Ga0070678_101552219 | |||
| 1996 | Ga0070678_101908759 | |||
| 1997 | Ga0070678_101966689 | |||
| 1998 | Ga0070681_10001242 | |||
| 1999 | Ga0070681_10013046 | |||
| 2000 | Ga0070681_10019025 | |||
| 2001 | Ga0070681_10023346 | |||
| 2002 | Ga0070681_10028889 | |||
| 2003 | Ga0070681_10042573 | |||
| 2004 | Ga0070681_10051422 | |||
| 2005 | Ga0070681_10065624 | |||
| 2006 | Ga0070681_10077379 | |||
| 2007 | Ga0070681_10096415 | |||
| 2008 | Ga0070681_10108064 | |||
| 2009 | Ga0070681_10187899 | |||
| 2010 | Ga0070681_10213474 | |||
| 2011 | Ga0070681_10359317 | |||
| 2012 | Ga0070681_10608961 | |||
| 2013 | Ga0068867_100028830 | |||
| 2014 | Ga0068867_100081773 | |||
| 2015 | Ga0068867_100253810 | |||
| 2016 | Ga0068867_100880084 | |||
| 2017 | Ga0070706_100043493 | |||
| 2018 | Ga0070706_100137266 | |||
| 2019 | Ga0070706_100201402 | |||
| 2020 | Ga0070706_100235755 | |||
| 2021 | Ga0070706_100284698 | |||
| 2022 | Ga0070707_100009757 | |||
| 2023 | Ga0070707_100023210 | |||
| 2024 | Ga0070707_100069548 | |||
| 2025 | Ga0070707_100290385 | |||
| 2026 | Ga0070707_101702177 | |||
| 2027 | Ga0070707_101882547 | |||
| 2028 | Ga0070698_100010227 | |||
| 2029 | Ga0070698_100025668 | |||
| 2030 | Ga0070698_100055291 | |||
| 2031 | Ga0070698_100305002 | |||
| 2032 | Ga0070698_101201140 | |||
| 2033 | Ga0070698_101429049 | |||
| 2034 | Ga0070698_101683858 | |||
| 2035 | Ga0070699_100029838 | |||
| 2036 | Ga0070699_100078981 | |||
| 2037 | Ga0070699_100160571 | |||
| 2038 | Ga0070699_100211051 | |||
| 2039 | Ga0070699_100653334 | |||
| 2040 | Ga0070699_100696827 | |||
| 2041 | Ga0070679_100002714 | |||
| 2042 | Ga0070679_100003063 | |||
| 2043 | Ga0070679_100004177 | |||
| 2044 | Ga0070679_100008713 | |||
| 2045 | Ga0070679_100025308 | |||
| 2046 | Ga0070679_100033799 | |||
| 2047 | Ga0070679_100040623 | |||
| 2048 | Ga0070679_100097900 | |||
| 2049 | Ga0070679_100100501 | |||
| 2050 | Ga0070679_100107428 | |||
| 2051 | Ga0070679_100149742 | |||
| 2052 | Ga0070679_100209394 | |||
| 2053 | Ga0070679_100254456 | |||
| 2054 | Ga0070679_100254828 | |||
| 2055 | Ga0070679_100261912 | |||
| 2056 | Ga0070679_100269761 | |||
| 2057 | Ga0070679_100326036 | |||
| 2058 | Ga0070679_101307909 | |||
| 2059 | Ga0070684_100000634 | |||
| 2060 | Ga0070684_100001095 | |||
| 2061 | Ga0070684_100009770 | |||
| 2062 | Ga0070684_100012986 | |||
| 2063 | Ga0070684_100017852 | |||
| 2064 | Ga0070684_100035568 | |||
| 2065 | Ga0070684_100041689 | |||
| 2066 | Ga0070684_100115181 | |||
| 2067 | Ga0070684_100172679 | |||
| 2068 | Ga0070684_100256642 | |||
| 2069 | Ga0070684_100275496 | |||
| 2070 | Ga0070684_101480245 | |||
| 2071 | Ga0070684_102246469 | |||
| 2072 | Ga0070697_100136942 | |||
| 2073 | Ga0070697_100352380 | |||
| 2074 | Ga0070697_100793715 | |||
| 2075 | Ga0068853_100069721 | |||
| 2076 | Ga0068853_100353736 | |||
| 2077 | Ga0068853_100675639 | |||
| 2078 | Ga0068853_101183623 | |||
| 2079 | Ga0068853_101637044 | |||
| 2080 | Ga0070686_100053085 | |||
| 2081 | Ga0070686_100092266 | |||
| 2082 | Ga0070686_100092533 | |||
| 2083 | Ga0070686_100799943 | |||
| 2084 | Ga0070695_100000149 | |||
| 2085 | Ga0070695_100105738 | |||
| 2086 | Ga0070695_100484809 | |||
| 2087 | Ga0070695_100932749 | |||
| 2088 | Ga0070695_101004550 | |||
| 2089 | Ga0070696_100013480 | |||
| 2090 | Ga0070696_100075151 | |||
| 2091 | Ga0070696_100085664 | |||
| 2092 | Ga0070696_100124018 | |||
| 2093 | Ga0070696_100355183 | |||
| 2094 | Ga0070696_100386439 | |||
| 2095 | Ga0070696_100517404 | |||
| 2096 | Ga0070696_101106618 | |||
| 2097 | Ga0070696_101107165 | |||
| 2098 | Ga0070696_101656264 | |||
| 2099 | Ga0070696_101884421 | |||
| 2100 | Ga0070693_100024148 | |||
| 2101 | Ga0070693_100219174 | |||
| 2102 | Ga0070693_100222624 | |||
| 2103 | Ga0070693_100276086 | |||
| 2104 | Ga0070693_100491704 | |||
| 2105 | Ga0070665_100015545 | |||
| 2106 | Ga0070704_100024006 | |||
| 2107 | Ga0070704_100191457 | |||
| 2108 | Ga0070704_100209814 | |||
| 2109 | Ga0070704_100428818 | |||
| 2110 | Ga0070704_100496955 | |||
| 2111 | Ga0070704_101232193 | |||
| 2112 | Ga0068855_100007584 | |||
| 2113 | Ga0068855_100032107 | |||
| 2114 | Ga0068855_100043181 | |||
| 2115 | Ga0068855_100106284 | |||
| 2116 | Ga0068855_100216726 | |||
| 2117 | Ga0068855_100506102 | |||
| 2118 | Ga0068855_100513656 | |||
| 2119 | Ga0068855_100586154 | |||
| 2120 | Ga0068855_100601229 | |||
| 2121 | Ga0068855_100838960 | |||
| 2122 | Ga0068855_100843166 | |||
| 2123 | Ga0068855_101498589 | |||
| 2124 | Ga0070664_100491758 | |||
| 2125 | Ga0070664_100601216 | |||
| 2126 | Ga0070664_100611796 | |||
| 2127 | Ga0070664_101096333 | |||
| 2128 | Ga0068857_100052206 | |||
| 2129 | Ga0068857_100128207 | |||
| 2130 | Ga0068857_100148013 | |||
| 2131 | Ga0068857_100721695 | |||
| 2132 | Ga0068857_101626126 | |||
| 2133 | Ga0068854_100168208 | |||
| 2134 | Ga0068854_100328269 | |||
| 2135 | Ga0068854_100945290 | |||
| 2136 | Ga0068854_101805155 | |||
| 2137 | Ga0068856_100005850 | |||
| 2138 | Ga0068856_100029736 | |||
| 2139 | Ga0068856_100059390 | |||
| 2140 | Ga0068856_100067378 | |||
| 2141 | Ga0068856_100073506 | |||
| 2142 | Ga0068856_100084897 | |||
| 2143 | Ga0068856_100106040 | |||
| 2144 | Ga0068856_100108111 | |||
| 2145 | Ga0068856_100184179 | |||
| 2146 | Ga0068856_100193144 | |||
| 2147 | Ga0068856_100280290 | |||
| 2148 | Ga0068856_100285395 | |||
| 2149 | Ga0068856_100633706 | |||
| 2150 | Ga0068856_100651260 | |||
| 2151 | Ga0068856_100936609 | |||
| 2152 | Ga0070702_100030227 | |||
| 2153 | Ga0070702_100059691 | |||
| 2154 | Ga0070702_100133455 | |||
| 2155 | Ga0070702_100137437 | |||
| 2156 | Ga0070702_100203691 | |||
| 2157 | Ga0070702_100368934 | |||
| 2158 | Ga0070702_100396548 | |||
| 2159 | Ga0070702_101480695 | |||
| 2160 | Ga0068852_100026148 | |||
| 2161 | Ga0068852_100040177 | |||
| 2162 | Ga0068852_100070992 | |||
| 2163 | Ga0068852_100269603 | |||
| 2164 | Ga0068852_100790557 | |||
| 2165 | Ga0068852_100934740 | |||
| 2166 | Ga0068852_101610983 | |||
| 2167 | Ga0068852_101857816 | |||
| 2168 | Ga0068859_100159693 | |||
| 2169 | Ga0068859_100507915 | |||
| 2170 | Ga0068864_100883778 | |||
| 2171 | Ga0068864_101839956 | |||
| 2172 | Ga0068866_10013281 | |||
| 2173 | Ga0068861_100136643 | |||
| 2174 | Ga0068861_100327242 | |||
| 2175 | Ga0068861_100607123 | |||
| 2176 | Ga0068861_100780972 | |||
| 2177 | Ga0068870_10248381 | |||
| 2178 | Ga0068863_100779696 | |||
| 2179 | Ga0068863_101416066 | |||
| 2180 | Ga0068858_100629348 | |||
| 2181 | Ga0068860_100045868 | |||
| 2182 | Ga0068860_102076824 | |||
| 2183 | Ga0068862_100067203 | |||
| 2184 | Ga0068862_100117096 | |||
| 2185 | Ga0081455_10124410 | |||
| 2186 | Ga0081455_10518823 | |||
| 2187 | Ga0081538_10034811 | |||
| 2188 | Ga0081540_1002235 | |||
| 2189 | Ga0081540_1026664 | |||
| 2190 | Ga0070717_10003333 | |||
| 2191 | Ga0070717_10041814 | |||
| 2192 | Ga0070717_10083984 | |||
| 2193 | Ga0070717_10093381 | |||
| 2194 | Ga0070717_10116255 | |||
| 2195 | Ga0070717_10168699 | |||
| 2196 | Ga0070717_10242891 | |||
| 2197 | Ga0070717_10453528 | |||
| 2198 | Ga0070717_10845184 | |||
| 2199 | Ga0075365_10075561 | |||
| 2200 | Ga0075365_10179228 | |||
| 2201 | Ga0075432_10036241 | |||
| 2202 | Ga0075432_10126901 | |||
| 2203 | Ga0070715_10002066 | |||
| 2204 | Ga0070715_10005055 | |||
| 2205 | Ga0070715_10057194 | |||
| 2206 | Ga0070715_10074650 | |||
| 2207 | Ga0070715_10406901 | |||
| 2208 | Ga0070716_100010488 | |||
| 2209 | Ga0070716_100071624 | |||
| 2210 | Ga0070716_100092788 | |||
| 2211 | Ga0070716_100385000 | |||
| 2212 | Ga0070712_100009318 | |||
| 2213 | Ga0070712_100015768 | |||
| 2214 | Ga0070712_100015819 | |||
| 2215 | Ga0070712_100040377 | |||
| 2216 | Ga0070712_100063298 | |||
| 2217 | Ga0070712_100122379 | |||
| 2218 | Ga0070712_100139598 | |||
| 2219 | Ga0070712_100154799 | |||
| 2220 | Ga0070712_100340568 | |||
| 2221 | Ga0070712_100436683 | |||
| 2222 | Ga0070712_100585071 | |||
| 2223 | Ga0070712_100649023 | |||
| 2224 | Ga0070712_100662329 | |||
| 2225 | Ga0070712_101410614 | |||
| 2226 | Ga0097621_100308869 | |||
| 2227 | Ga0068871_100004038 | |||
| 2228 | Ga0068871_100122770 | |||
| 2229 | Ga0068871_100191377 | |||
| 2230 | Ga0068871_100408102 | |||
| 2231 | Ga0068871_100491063 | |||
| 2232 | Ga0068871_100608126 | |||
| 2233 | Ga0075428_101108153 | |||
| 2234 | Ga0075431_100028374 | |||
| 2235 | Ga0075431_100143449 | |||
| 2236 | Ga0075431_100384711 | |||
| 2237 | Ga0075431_101049626 | |||
| 2238 | Ga0075431_101852658 | |||
| 2239 | Ga0075433_10000234 | |||
| 2240 | Ga0075433_10010777 | |||
| 2241 | Ga0075433_10036141 | |||
| 2242 | Ga0075433_10066498 | |||
| 2243 | Ga0075433_10093461 | |||
| 2244 | Ga0075433_10179930 | |||
| 2245 | Ga0075433_10204458 | |||
| 2246 | Ga0075433_10321968 | |||
| 2247 | Ga0075433_10388230 | |||
| 2248 | Ga0075433_10567591 | |||
| 2249 | Ga0075433_11421051 | |||
| 2250 | Ga0075433_11483405 | |||
| 2251 | Ga0075434_100004422 | |||
| 2252 | Ga0075434_100071055 | |||
| 2253 | Ga0075434_100140704 | |||
| 2254 | Ga0075434_100373976 | |||
| 2255 | Ga0075434_100384317 | |||
| 2256 | Ga0075434_100499372 | |||
| 2257 | Ga0075434_100650344 | |||
| 2258 | Ga0075434_100668418 | |||
| 2259 | Ga0075434_100788371 | |||
| 2260 | Ga0075434_100908203 | |||
| 2261 | Ga0068865_100002544 | |||
| 2262 | Ga0068865_100113633 | |||
| 2263 | Ga0068865_100223836 | |||
| 2264 | Ga0075436_100007169 | |||
| 2265 | Ga0075436_100014405 | |||
| 2266 | Ga0075436_100052256 | |||
| 2267 | Ga0075436_100139650 | |||
| 2268 | Ga0097620_100159695 | |||
| 2269 | Ga0097620_100507915 | |||
| 2270 | Ga0075435_100004443 | |||
| 2271 | Ga0075435_100005187 | |||
| 2272 | Ga0075435_100030814 | |||
| 2273 | Ga0075435_100036941 | |||
| 2274 | Ga0075435_100050817 | |||
| 2275 | Ga0075435_100289067 | |||
| 2276 | Ga0075435_101547354 | |||
| 2277 | Ga0099795_10312983 | |||
| 2278 | Ga0105244_10393381 | |||
| 2279 | Ga0105240_10020003 | |||
| 2280 | Ga0105240_10092626 | |||
| 2281 | Ga0105240_10133761 | |||
| 2282 | Ga0105240_10141561 | |||
| 2283 | Ga0105240_10182685 | |||
| 2284 | Ga0105240_10272459 | |||
| 2285 | Ga0105240_10425326 | |||
| 2286 | Ga0105240_10435580 | |||
| 2287 | Ga0105240_10640305 | |||
| 2288 | Ga0105240_11382467 | |||
| 2289 | Ga0111539_10201203 | |||
| 2290 | Ga0111539_10293607 | |||
| 2291 | Ga0111539_11950381 | |||
| 2292 | Ga0111539_12010099 | |||
| 2293 | Ga0105245_10038631 | |||
| 2294 | Ga0105245_10039040 | |||
| 2295 | Ga0105245_10133867 | |||
| 2296 | Ga0105245_10196137 | |||
| 2297 | Ga0105245_10408868 | |||
| 2298 | Ga0105245_10556325 | |||
| 2299 | Ga0105245_10583528 | |||
| 2300 | Ga0105245_10610048 | |||
| 2301 | Ga0105245_10690795 | |||
| 2302 | Ga0105245_11185071 | |||
| 2303 | Ga0105245_11496094 | |||
| 2304 | Ga0105245_11762534 | |||
| 2305 | Ga0105247_10225374 | |||
| 2306 | Ga0105247_11670328 | |||
| 2307 | Ga0114129_10010266 | |||
| 2308 | Ga0114129_10033703 | |||
| 2309 | Ga0114129_10124835 | |||
| 2310 | Ga0114129_10485830 | |||
| 2311 | Ga0114129_10598034 | |||
| 2312 | Ga0114129_10888454 | |||
| 2313 | Ga0114129_11055888 | |||
| 2314 | Ga0105243_10028603 | |||
| 2315 | Ga0105243_10251139 | |||
| 2316 | Ga0105243_10311261 | |||
| 2317 | Ga0105243_10542943 | |||
| 2318 | Ga0105243_10688683 | |||
| 2319 | Ga0105243_10840728 | |||
| 2320 | Ga0105243_10880820 | |||
| 2321 | Ga0105243_10972234 | |||
| 2322 | Ga0105243_11080792 | |||
| 2323 | Ga0105243_11189443 | |||
| 2324 | Ga0105243_11318962 | |||
| 2325 | Ga0105241_10031940 | |||
| 2326 | Ga0105241_10046297 | |||
| 2327 | Ga0105241_10079452 | |||
| 2328 | Ga0105241_10104276 | |||
| 2329 | Ga0105241_10287181 | |||
| 2330 | Ga0105241_10402576 | |||
| 2331 | Ga0105241_10490765 | |||
| 2332 | Ga0105241_12195476 | |||
| 2333 | Ga0105242_10006583 | |||
| 2334 | Ga0105242_10033342 | |||
| 2335 | Ga0105242_10128870 | |||
| 2336 | Ga0105242_10207246 | |||
| 2337 | Ga0105242_10229933 | |||
| 2338 | Ga0105242_10355360 | |||
| 2339 | Ga0105242_10418824 | |||
| 2340 | Ga0105242_10501721 | |||
| 2341 | Ga0105242_10557638 | |||
| 2342 | Ga0105248_10015477 | |||
| 2343 | Ga0105248_10381449 | |||
| 2344 | Ga0105248_10777088 | |||
| 2345 | Ga0105248_11034067 | |||
| 2346 | Ga0105248_11225327 | |||
| 2347 | Ga0105248_11752982 | |||
| 2348 | Ga0105248_12182794 | |||
| 2349 | Ga0105237_10021997 | |||
| 2350 | Ga0105237_10053974 | |||
| 2351 | Ga0105237_10064887 | |||
| 2352 | Ga0105237_10207702 | |||
| 2353 | Ga0105237_10208430 | |||
| 2354 | Ga0105237_10989364 | |||
| 2355 | Ga0105237_11147742 | |||
| 2356 | Ga0105238_10042846 | |||
| 2357 | Ga0105238_10085418 | |||
| 2358 | Ga0105238_10715963 | |||
| 2359 | Ga0105238_10933842 | |||
| 2360 | Ga0105249_10053947 | |||
| 2361 | Ga0105249_10144561 | |||
| 2362 | Ga0105249_10161606 | |||
| 2363 | Ga0105249_10289899 | |||
| 2364 | Ga0105239_10021863 | |||
| 2365 | Ga0105239_10095199 | |||
| 2366 | Ga0105239_10551159 | |||
| 2367 | Ga0105239_10555505 | |||
| 2368 | Ga0105239_11816970 | |||
| 2369 | Ga0105239_11818473 | |||
| 2370 | Ga0105239_12187089 | |||
| 2371 | Ga0105239_12196874 | |||
| 2372 | Ga0105239_12787022 | |||
| 2373 | Ga0105246_10153466 | |||
| 2374 | Ga0105246_10215989 | |||
| 2375 | Ga0157340_1009891 | |||
| 2376 | Ga0157340_1019491 | |||
| 2377 | Ga0157329_1035890 | |||
| 2378 | Ga0157338_1001489 | |||
| 2379 | Ga0157373_10139196 | |||
| 2380 | Ga0157373_10140835 | |||
| 2381 | Ga0157373_10210799 | |||
| 2382 | Ga0157373_10858979 | |||
| 2383 | Ga0157373_11264629 | |||
| 2384 | Ga0157371_10221787 | |||
| 2385 | Ga0157371_10270943 | |||
| 2386 | Ga0157371_10398773 | |||
| 2387 | Ga0157371_10490224 | |||
| 2388 | Ga0157371_10492456 | |||
| 2389 | Ga0157371_10799652 | |||
| 2390 | Ga0157371_10840313 | |||
| 2391 | Ga0157370_10004179 | |||
| 2392 | Ga0157370_10030932 | |||
| 2393 | Ga0157370_10075505 | |||
| 2394 | Ga0157370_10235463 | |||
| 2395 | Ga0157370_10277534 | |||
| 2396 | Ga0157370_10288527 | |||
| 2397 | Ga0157370_10353586 | |||
| 2398 | Ga0157369_10005342 | |||
| 2399 | Ga0157369_10037155 | |||
| 2400 | Ga0157369_10037291 | |||
| 2401 | Ga0157369_10176788 | |||
| 2402 | Ga0157369_10205525 | |||
| 2403 | Ga0157369_10358034 | |||
| 2404 | Ga0157369_10409315 | |||
| 2405 | Ga0157369_10536911 | |||
| 2406 | Ga0157369_10561378 | |||
| 2407 | Ga0157369_10610589 | |||
| 2408 | Ga0157369_10846707 | |||
| 2409 | Ga0157369_10851924 | |||
| 2410 | Ga0157369_11343692 | |||
| 2411 | Ga0157374_10058576 | |||
| 2412 | Ga0157374_10069343 | |||
| 2413 | Ga0157374_10097387 | |||
| 2414 | Ga0157374_10198977 | |||
| 2415 | Ga0157374_10522726 | |||
| 2416 | Ga0157374_10624159 | |||
| 2417 | Ga0157374_11497534 | |||
| 2418 | Ga0157378_10244342 | |||
| 2419 | Ga0157378_10268584 | |||
| 2420 | Ga0157378_11240292 | |||
| 2421 | Ga0163162_10195359 | |||
| 2422 | Ga0163162_10284009 | |||
| 2423 | Ga0163162_10504085 | |||
| 2424 | Ga0157372_10012713 | |||
| 2425 | Ga0157372_10022568 | |||
| 2426 | Ga0157372_10106332 | |||
| 2427 | Ga0157372_10110209 | |||
| 2428 | Ga0157372_10113951 | |||
| 2429 | Ga0157372_10128688 | |||
| 2430 | Ga0157372_10149835 | |||
| 2431 | Ga0157372_10303254 | |||
| 2432 | Ga0157372_10580179 | |||
| 2433 | Ga0157372_10771748 | |||
| 2434 | Ga0157372_11994921 | |||
| 2435 | Ga0157372_12156146 | |||
| 2436 | Ga0157375_10188691 | |||
| 2437 | Ga0157375_10580016 | |||
| 2438 | Ga0157375_11224460 | |||
| 2439 | Ga0157375_11696372 | |||
| 2440 | Ga0157375_12660126 | |||
| 2441 | Ga0163163_10103660 | |||
| 2442 | Ga0163163_10177306 | |||
| 2443 | Ga0163163_10317257 | |||
| 2444 | Ga0163163_10693821 | |||
| 2445 | Ga0163163_11326689 | |||
| 2446 | Ga0163163_11890387 | |||
| 2447 | Ga0157380_10075326 | |||
| 2448 | Ga0157380_10106664 | |||
| 2449 | Ga0157380_11671359 | |||
| 2450 | Ga0157380_12400617 | |||
| 2451 | Ga0182008_10112521 | |||
| 2452 | Ga0182008_10129261 | |||
| 2453 | Ga0182008_10264600 | |||
| 2454 | Ga0157377_10309440 | |||
| 2455 | Ga0157377_10407634 | |||
| 2456 | Ga0157379_10436783 | |||
| 2457 | Ga0157379_10811926 | |||
| 2458 | Ga0157376_10087743 | |||
| 2459 | Ga0157376_10116016 | |||
| 2460 | Ga0157376_10388378 | |||
| 2461 | Ga0157376_10765546 | |||
| 2462 | Ga0157376_11189195 | |||
| 2463 | Ga0182006_1006904 | |||
| 2464 | Ga0182007_10015269 | |||
| 2465 | Ga0197907_10686216 | |||
| 2466 | Ga0197907_10795793 | |||
| 2467 | Ga0197907_10998639 | |||
| 2468 | Ga0197907_11173570 | |||
| 2469 | Ga0197907_11290110 | |||
| 2470 | Ga0206356_10326962 | |||
| 2471 | Ga0206356_10433530 | |||
| 2472 | Ga0206356_10685410 | |||
| 2473 | Ga0206356_10963825 | |||
| 2474 | Ga0206356_11112730 | |||
| 2475 | Ga0206356_11210167 | |||
| 2476 | Ga0206356_11728640 | |||
| 2477 | Ga0206356_11892795 | |||
| 2478 | Ga0206349_1921883 | |||
| 2479 | Ga0206355_1000829 | |||
| 2480 | Ga0206355_1512630 | |||
| 2481 | Ga0206351_10325921 | |||
| 2482 | Ga0206352_10022792 | |||
| 2483 | Ga0206352_10134720 | |||
| 2484 | Ga0206352_10607688 | |||
| 2485 | Ga0206350_10539958 | |||
| 2486 | Ga0206350_11204617 | |||
| 2487 | Ga0206354_10112960 | |||
| 2488 | Ga0206354_10297273 | |||
| 2489 | Ga0206354_10928523 | |||
| 2490 | Ga0206354_11376546 | |||
| 2491 | Ga0206354_11427068 | |||
| 2492 | Ga0206354_11480520 | |||
| 2493 | Ga0206354_11650294 | |||
| 2494 | Ga0206353_10517639 | |||
| 2495 | Ga0206353_10654202 | |||
| 2496 | Ga0206353_10824057 | |||
| 2497 | Ga0206353_10898624 | |||
| 2498 | Ga0206353_11970468 | |||
| 2499 | Ga0224712_10172386 | |||
| 2500 | Ga0224712_10288465 | |||
| 2501 | Ga0224712_10313845 | |||
| 2502 | Ga0224712_10410822 | |||
| 2503 | Ga0207653_10000411 | |||
| 2504 | Ga0207692_10013727 | |||
| 2505 | Ga0207692_10018366 | |||
| 2506 | Ga0207692_10031200 | |||
| 2507 | Ga0207692_10035221 | |||
| 2508 | Ga0207692_10061987 | |||
| 2509 | Ga0207692_10147586 | |||
| 2510 | Ga0207692_10495575 | |||
| 2511 | Ga0207642_10041691 | |||
| 2512 | Ga0207642_11107642 | |||
| 2513 | Ga0207688_10093184 | |||
| 2514 | Ga0207688_10189542 | |||
| 2515 | Ga0207647_10333181 | |||
| 2516 | Ga0207685_10020128 | |||
| 2517 | Ga0207685_10035688 | |||
| 2518 | Ga0207685_10101330 | |||
| 2519 | Ga0207685_10516853 | |||
| 2520 | Ga0207699_10047880 | |||
| 2521 | Ga0207699_10095147 | |||
| 2522 | Ga0207699_10552390 | |||
| 2523 | Ga0207645_10633696 | |||
| 2524 | Ga0207643_10072386 | |||
| 2525 | Ga0207705_10033277 | |||
| 2526 | Ga0207705_10118060 | |||
| 2527 | Ga0207705_10165165 | |||
| 2528 | Ga0207705_10610449 | |||
| 2529 | Ga0207684_10046933 | |||
| 2530 | Ga0207684_10101301 | |||
| 2531 | Ga0207684_10188568 | |||
| 2532 | Ga0207684_10377929 | |||
| 2533 | Ga0207684_10758650 | |||
| 2534 | Ga0207684_11388694 | |||
| 2535 | Ga0207654_10030702 | |||
| 2536 | Ga0207654_10041780 | |||
| 2537 | Ga0207654_11174171 | |||
| 2538 | Ga0207707_10003875 | |||
| 2539 | Ga0207707_10007128 | |||
| 2540 | Ga0207707_10040791 | |||
| 2541 | Ga0207707_10049450 | |||
| 2542 | Ga0207707_10064843 | |||
| 2543 | Ga0207707_10065998 | |||
| 2544 | Ga0207707_10067978 | |||
| 2545 | Ga0207707_10081465 | |||
| 2546 | Ga0207707_11329946 | |||
| 2547 | Ga0207695_10066551 | |||
| 2548 | Ga0207695_10133411 | |||
| 2549 | Ga0207695_10419355 | |||
| 2550 | Ga0207671_10595512 | |||
| 2551 | Ga0207693_10002010 | |||
| 2552 | Ga0207693_10002850 | |||
| 2553 | Ga0207693_10004399 | |||
| 2554 | Ga0207693_10010709 | |||
| 2555 | Ga0207693_10012106 | |||
| 2556 | Ga0207693_10039628 | |||
| 2557 | Ga0207693_10064591 | |||
| 2558 | Ga0207693_10065933 | |||
| 2559 | Ga0207693_10066160 | |||
| 2560 | Ga0207693_10095453 | |||
| 2561 | Ga0207693_10133403 | |||
| 2562 | Ga0207693_10199885 | |||
| 2563 | Ga0207693_10328877 | |||
| 2564 | Ga0207663_10016159 | |||
| 2565 | Ga0207663_10027714 | |||
| 2566 | Ga0207663_10049700 | |||
| 2567 | Ga0207663_10191969 | |||
| 2568 | Ga0207663_10812354 | |||
| 2569 | Ga0207663_11172132 | |||
| 2570 | Ga0207660_10001253 | |||
| 2571 | Ga0207660_10015474 | |||
| 2572 | Ga0207660_10332189 | |||
| 2573 | Ga0207660_10660773 | |||
| 2574 | Ga0207660_10750244 | |||
| 2575 | Ga0207662_10183702 | |||
| 2576 | Ga0207662_10208417 | |||
| 2577 | Ga0207657_10001344 | |||
| 2578 | Ga0207657_10003362 | |||
| 2579 | Ga0207657_10005637 | |||
| 2580 | Ga0207657_10011355 | |||
| 2581 | Ga0207657_10042200 | |||
| 2582 | Ga0207657_10047842 | |||
| 2583 | Ga0207657_10127884 | |||
| 2584 | Ga0207657_10396786 | |||
| 2585 | Ga0207657_10623685 | |||
| 2586 | Ga0207657_10740604 | |||
| 2587 | Ga0207657_11011119 | |||
| 2588 | Ga0207649_10037277 | |||
| 2589 | Ga0207652_10002068 | |||
| 2590 | Ga0207652_10008528 | |||
| 2591 | Ga0207652_10019536 | |||
| 2592 | Ga0207652_10068716 | |||
| 2593 | Ga0207652_10075250 | |||
| 2594 | Ga0207652_10131356 | |||
| 2595 | Ga0207652_10139498 | |||
| 2596 | Ga0207652_10176415 | |||
| 2597 | Ga0207652_10183796 | |||
| 2598 | Ga0207652_10342097 | |||
| 2599 | Ga0207652_11523155 | |||
| 2600 | Ga0207646_10013145 | |||
| 2601 | Ga0207646_10016422 | |||
| 2602 | Ga0207646_10114968 | |||
| 2603 | Ga0207646_10290026 | |||
| 2604 | Ga0207646_10358206 | |||
| 2605 | Ga0207646_10394056 | |||
| 2606 | Ga0207646_10536157 | |||
| 2607 | Ga0207646_10859406 | |||
| 2608 | Ga0207681_10364496 | |||
| 2609 | Ga0207694_10464342 | |||
| 2610 | Ga0207694_10523109 | |||
| 2611 | Ga0207659_10046872 | |||
| 2612 | Ga0207659_10394930 | |||
| 2613 | Ga0207687_10004309 | |||
| 2614 | Ga0207687_10109369 | |||
| 2615 | Ga0207687_10250943 | |||
| 2616 | Ga0207687_10402386 | |||
| 2617 | Ga0207687_10484761 | |||
| 2618 | Ga0207687_10722705 | |||
| 2619 | Ga0207687_10839431 | |||
| 2620 | Ga0207687_11300613 | |||
| 2621 | Ga0207700_10000024 | |||
| 2622 | Ga0207700_10046031 | |||
| 2623 | Ga0207700_10270783 | |||
| 2624 | Ga0207700_10307360 | |||
| 2625 | Ga0207700_10506741 | |||
| 2626 | Ga0207700_10565430 | |||
| 2627 | Ga0207664_10002612 | |||
| 2628 | Ga0207664_10025419 | |||
| 2629 | Ga0207664_10060905 | |||
| 2630 | Ga0207664_10073858 | |||
| 2631 | Ga0207664_10139485 | |||
| 2632 | Ga0207664_10187236 | |||
| 2633 | Ga0207664_10216177 | |||
| 2634 | Ga0207664_10237450 | |||
| 2635 | Ga0207664_10240931 | |||
| 2636 | Ga0207664_10271937 | |||
| 2637 | Ga0207664_10293062 | |||
| 2638 | Ga0207664_10309140 | |||
| 2639 | Ga0207664_10414337 | |||
| 2640 | Ga0207664_10462033 | |||
| 2641 | Ga0207644_10100055 | |||
| 2642 | Ga0207644_10324060 | |||
| 2643 | Ga0207690_10872026 | |||
| 2644 | Ga0207690_10997686 | |||
| 2645 | Ga0207690_11329689 | |||
| 2646 | Ga0207686_10007885 | |||
| 2647 | Ga0207686_10291524 | |||
| 2648 | Ga0207686_10521124 | |||
| 2649 | Ga0207686_10901075 | |||
| 2650 | Ga0207686_11463251 | |||
| 2651 | Ga0207709_10009766 | |||
| 2652 | Ga0207709_10023343 | |||
| 2653 | Ga0207709_10287721 | |||
| 2654 | Ga0207709_10533976 | |||
| 2655 | Ga0207709_11358009 | |||
| 2656 | Ga0207669_10203990 | |||
| 2657 | Ga0207704_10233568 | |||
| 2658 | Ga0207704_10241856 | |||
| 2659 | Ga0207704_10439320 | |||
| 2660 | Ga0207665_10001313 | |||
| 2661 | Ga0207665_10001721 | |||
| 2662 | Ga0207665_10007331 | |||
| 2663 | Ga0207665_10009738 | |||
| 2664 | Ga0207665_10010704 | |||
| 2665 | Ga0207665_10182922 | |||
| 2666 | Ga0207665_10553468 | |||
| 2667 | Ga0207711_10051394 | |||
| 2668 | Ga0207711_11052394 | |||
| 2669 | Ga0207689_10795007 | |||
| 2670 | Ga0207689_10927952 | |||
| 2671 | Ga0207661_10001504 | |||
| 2672 | Ga0207661_10009335 | |||
| 2673 | Ga0207661_10045306 | |||
| 2674 | Ga0207661_10086948 | |||
| 2675 | Ga0207661_11292534 | |||
| 2676 | Ga0207661_11953729 | |||
| 2677 | Ga0207679_10730514 | |||
| 2678 | Ga0207679_11039416 | |||
| 2679 | Ga0207667_10083557 | |||
| 2680 | Ga0207667_10231048 | |||
| 2681 | Ga0207667_10466697 | |||
| 2682 | Ga0207667_11171198 | |||
| 2683 | Ga0207667_11223828 | |||
| 2684 | Ga0207651_10352362 | |||
| 2685 | Ga0207651_10504655 | |||
| 2686 | Ga0207712_10383739 | |||
| 2687 | Ga0207712_10390720 | |||
| 2688 | Ga0207668_10356053 | |||
| 2689 | Ga0207668_10797453 | |||
| 2690 | Ga0207640_10124217 | |||
| 2691 | Ga0207658_10526110 | |||
| 2692 | Ga0207658_11127935 | |||
| 2693 | Ga0207677_10193379 | |||
| 2694 | Ga0207677_10375312 | |||
| 2695 | Ga0207677_12073956 | |||
| 2696 | Ga0207703_11476638 | |||
| 2697 | Ga0207639_10216173 | |||
| 2698 | Ga0207639_10623525 | |||
| 2699 | Ga0207678_10128276 | |||
| 2700 | Ga0207678_10165911 | |||
| 2701 | Ga0207678_10183412 | |||
| 2702 | Ga0207678_10196544 | |||
| 2703 | Ga0207702_10007087 | |||
| 2704 | Ga0207702_10049036 | |||
| 2705 | Ga0207702_10082982 | |||
| 2706 | Ga0207702_10150149 | |||
| 2707 | Ga0207702_10429217 | |||
| 2708 | Ga0207702_10608678 | |||
| 2709 | Ga0207702_10913170 | |||
| 2710 | Ga0207702_11823454 | |||
| 2711 | Ga0207641_10354941 | |||
| 2712 | Ga0207648_10493848 | |||
| 2713 | Ga0207648_10549292 | |||
| 2714 | Ga0207648_11008048 | |||
| 2715 | Ga0207676_11776464 | |||
| 2716 | Ga0207674_10017076 | |||
| 2717 | Ga0207675_100052212 | |||
| 2718 | Ga0207675_100093929 | |||
| 2719 | Ga0207675_100311620 | |||
| 2720 | Ga0207683_10001368 | |||
| 2721 | Ga0207683_10008480 | |||
| 2722 | Ga0207683_10025949 | |||
| 2723 | Ga0207683_10043811 | |||
| 2724 | Ga0207683_10176320 | |||
| 2725 | Ga0207683_10176889 | |||
| 2726 | Ga0207683_11084444 | |||
| 2727 | Ga0207698_10737479 | |||
| 2728 | Ga0207698_10797152 | |||
| 2729 | Ga0209966_1046847 | |||
| 2730 | Ga0209998_10018089 | |||
| 2731 | Ga0207428_10024080 | |||
| 2732 | Ga0207428_10150693 | |||
| 2733 | Ga0207428_10206782 | |||
| 2734 | Ga0207428_10649030 | |||
| 2735 | Ga0207428_10833069 | |||
| 2736 | Ga0268265_10568339 | |||
| 2737 | Ga0268265_10749286 | |||
| 2738 | Ga0268264_10516690 | |||
| 2739 | Ga0268264_11546521 | |||
| 2740 | Ga0265337_1022122 | |||
| 2741 | Ga0265326_10016113 | |||
| 2742 | Ga0265326_10233983 | |||
| 2743 | Ga0265319_1002094 | |||
| 2744 | Ga0265319_1020804 | |||
| 2745 | Ga0265334_10000322 | |||
| 2746 | Ga0265334_10127963 | |||
| 2747 | Ga0265318_10001871 | |||
| 2748 | Ga0265318_10038011 | |||
| 2749 | Ga0265318_10050008 | |||
| 2750 | Ga0265323_10108406 | |||
| 2751 | Ga0265338_10007305 | |||
| 2752 | Ga0265338_10022905 | |||
| 2753 | Ga0265338_10090464 | |||
| 2754 | Ga0265338_10194067 | |||
| 2755 | Ga0265338_10228151 | |||
| 2756 | Ga0265338_10393586 | |||
| 2757 | Ga0265324_10055753 | |||
| 2758 | Ga0265330_10003034 | |||
| 2759 | Ga0265330_10139923 | |||
| 2760 | Ga0265332_10006572 | |||
| 2761 | Ga0265328_10004790 | |||
| 2762 | Ga0265320_10040066 | |||
| 2763 | Ga0265320_10067175 | |||
| 2764 | Ga0265325_10011495 | |||
| 2765 | Ga0265325_10113488 | |||
| 2766 | Ga0265325_10349855 | |||
| 2767 | Ga0265329_10019276 | |||
| 2768 | Ga0265329_10022685 | |||
| 2769 | Ga0265340_10008992 | |||
| 2770 | Ga0265340_10117009 | |||
| 2771 | Ga0265339_10007646 | |||
| 2772 | Ga0265339_10047116 | |||
| 2773 | Ga0265339_10143175 | |||
| 2774 | Ga0265331_10002581 | |||
| 2775 | Ga0265331_10187156 | |||
| 2776 | Ga0265327_10003692 | |||
| 2777 | Ga0265327_10004211 | |||
| 2778 | Ga0265316_10021439 | |||
| 2779 | Ga0265316_10035212 | |||
| 2780 | Ga0265316_10315273 | |||
| 2781 | Ga0265316_10721044 | |||
| 2782 | Ga0265313_10014033 | |||
| 2783 | Ga0265313_10068841 | |||
| 2784 | Ga0265314_10105890 | |||
| 2785 | Ga0265314_10191953 | |||
| 2786 | Ga0265314_10613716 | |||
| 2787 | Ga0265342_10064746 | |||
| 2788 | Ga0265342_10075846 | |||
| 2789 | Ga0265342_10079898 | |||
| 2790 | Ga0265342_10537058 | |||
| 2791 | Ga0307412_12206309 | |||
| 2792 | Ga0307416_100098406 | |||
| 2793 | Ga0307415_100431053 | |||
| 2794 | Ga0316583_10135778 | |||
| 2795 | Ga0373930_0091094 | |||
| 2796 | Ga0373948_0048284 | |||
| 2797 | Ga0373959_0010326 | |||
| 2798 | Ga0373959_0054997 | |||
| 2799 | Ga0373938_0000401 | |||
| 2800 | Ga0373938_0006357 | |||
| 2801 | Ga0373928_0021015 | |||
| 2802 | Ga0373928_0035594 | |||
| 2803 | Ga0373929_0006199 | |||
| 2804 | Ga0373940_0038002 | |||
| 2805 | Ga0373944_0230545 | |||
| 2806 | Ga0373949_0037003 | |||
| 2807 | Ga0373949_0205739 | |||
| 2808 | Ga0373951_0001208 | |||
| 2809 | Ga0373952_0023677 | |||
| 2810 | Ga0373952_0046104 | |||
| 2811 | Ga0373952_0088868 | |||
| 2812 | Ga0373952_0143352 | |||
| 2813 | Ga0373932_0019702 | |||
| 2814 | Ga0373932_0078652 | |||
| 2815 | Ga0373936_0193832 | |||
| 2816 | Ga0373936_0307099 | |||
| 2817 | Ga0373939_0036368 | |||
| 2818 | Ga0373941_0115430 | |||
| 2819 | Ga0373956_0353540 | |||
| 2820 | Ga0373957_0172186 | |||
| 2821 | Ga0373957_0469877 | |||
| 2822 | Ga0373960_0000437 | |||
| 2823 | Ga0373960_0081466 | |||
| 2824 | Ga0373943_0000825 | |||
| 2825 | Ga0373946_0000490 | |||
| 2826 | Ga0373946_0183312 | |||
| 2827 | Ga0373955_0273622 | |||
| 2828 | Ga0373955_0447337 | |||
| 2829 | Ga0373942_0026992 | |||
| 2830 | Ga0373961_0004360 | |||
| 2831 | Ga0373962_0008737 | |||
| 2832 | Ga0373962_0118361 | |||
| 2833 | Ga0373962_0231066 | |||
| 2834 | Ga0373962_0298700 | |||
| 2835 | Ga0373931_0051279 | |||
| 2836 | Ga0373931_0162682 | |||
| 2837 | Ga0373931_0163498 | |||
| 2838 | Ga0373931_0321360 | |||
| 2839 | Ga0373931_0858784 | |||
| 2840 | Ga0373935_0001745 | |||
| 2841 | Ga0373935_0030392 | |||
| 2842 | Ga0373927_0011613 | |||
| 2843 | Ga0373933_0062569 | |||
| 2844 | Ga0373933_0554922 | |||
| 2845 | Ga0373933_1041342 | |||
| 2846 | Ga0373947_0116651 | |||
| 2847 | Ga0373947_0253345 | |||
| 2848 | Ga0373937_0045110 | |||
| 2849 | Ga0373937_0246157 | |||
| 2850 | Ga0373937_0484160 | |||
| 2851 | Ga0373925_0046465 | |||
| 2852 | Ga0373925_1453423 | |||
| 2853 | Ga0395899_0003270 | |||
| 2854 | Ga0395899_0017307 | |||
| 2855 | Ga0395899_0030979 | |||
| 2856 | Ga0395899_0052645 | |||
| 2857 | Ga0395899_0139187 | |||
| 2858 | Ga0395899_0167387 | |||
| 2859 | Ga0395899_0305254 | |||
| 2860 | Ga0395899_0330700 | |||
| 2861 | Ga0395899_0341163 | |||
| 2862 | Ga0395899_0351591 | |||
| 2863 | Ga0395899_0414557 | |||
| 2864 | Ga0395899_0659628 | |||
| 2865 | Ga0395900_0005798 | |||
| 2866 | Ga0395900_0024871 | |||
| 2867 | Ga0395900_0029196 | |||
| 2868 | Ga0395900_0032345 | |||
| 2869 | Ga0395900_0048614 | |||
| 2870 | Ga0395900_0054431 | |||
| 2871 | Ga0395900_0072310 | |||
| 2872 | Ga0395900_0171449 | |||
| 2873 | Ga0395900_0192036 | |||
| 2874 | Ga0395900_0224921 | |||
| 2875 | Ga0395900_0241082 | |||
| 2876 | Ga0395900_0247475 | |||
| 2877 | Ga0395900_0294325 | |||
| 2878 | Ga0395900_0303437 | |||
| 2879 | Ga0395900_0336417 | |||
| 2880 | Ga0395900_0352304 | |||
| 2881 | Ga0395900_0409407 | |||
| 2882 | Ga0395900_0944738 | |||
| 2883 | Ga0395900_1100388 | |||
| 2884 | Ga0395900_1168634 | |||
| 2885 | Ga0395898_0009931 | |||
| 2886 | Ga0395898_0023845 | |||
| 2887 | Ga0395898_0054391 | |||
| 2888 | Ga0395898_0093041 | |||
| 2889 | Ga0395898_0099988 | |||
| 2890 | Ga0395898_0103258 | |||
| 2891 | Ga0395898_0117726 | |||
| 2892 | Ga0395898_0165404 | |||
| 2893 | Ga0395898_0186275 | |||
| 2894 | Ga0395898_0221203 | |||
| 2895 | Ga0395898_0270216 | |||
| 2896 | Ga0395898_0316980 | |||
| 2897 | Ga0395898_0414711 | |||
| 2898 | Ga0395898_0463177 | |||
| 2899 | Ga0395898_0505539 | |||
| 2900 | Ga0395898_0538648 | |||
| 2901 | Ga0395898_0578424 | |||
| 2902 | Ga0395898_0745153 | |||
| 2903 | Ga0395898_0845506 | |||
| 2904 | Ga0395898_1379847 | |||
| 2905 | Ga0395898_1477653 | |||
| 2906 | Ga0395898_1574835 | |||
| 2907 | Ga0395898_1699064 | |||
| 2908 | Ga0395898_1701814 | |||
| 2909 | Ga0395898_1799738 | |||
| 2910 | Ga0395898_1948716 | |||
| 2911 | Ga0395905_0052710 | |||
| 2912 | Ga0395905_0066323 | |||
| 2913 | Ga0395905_0095226 | |||
| 2914 | Ga0395905_0115076 | |||
| 2915 | Ga0395905_0158398 | |||
| 2916 | Ga0395905_0173424 | |||
| 2917 | Ga0395905_0436503 | |||
| 2918 | Ga0395905_0533429 | |||
| 2919 | Ga0395905_0650399 | |||
| 2920 | Ga0395905_0776444 | |||
| 2921 | Ga0395905_0789925 | |||
| 2922 | Ga0395901_0000904 | |||
| 2923 | Ga0395901_0017197 | |||
| 2924 | Ga0395901_0018774 | |||
| 2925 | Ga0395901_0023458 | |||
| 2926 | Ga0395901_0024550 | |||
| 2927 | Ga0395901_0035865 | |||
| 2928 | Ga0395901_0056092 | |||
| 2929 | Ga0395901_0118962 | |||
| 2930 | Ga0395901_0138911 | |||
| 2931 | Ga0395901_0145076 | |||
| 2932 | Ga0395901_0167884 | |||
| 2933 | Ga0395901_0193398 | |||
| 2934 | Ga0395901_0276457 | |||
| 2935 | Ga0395901_0283990 | |||
| 2936 | Ga0395901_0398144 | |||
| 2937 | Ga0395901_0445513 | |||
| 2938 | Ga0395901_0474508 | |||
| 2939 | Ga0395901_0933678 | |||
| 2940 | Ga0395901_1145076 | |||
| 2941 | Ga0395901_1408575 | |||
| 2942 | Ga0395901_1479834 | |||
| 2943 | Ga0439453_0041567 | |||
| 2944 | Ga0439461_0016847 | |||
| 2945 | Ga0451789_0438069 | |||
| 2946 | Ga0451793_0195234 | |||
| 2947 | Ga0451797_0978418 | |||
| 2948 | Ga0451800_0468763 | |||
| 2949 | Ga0451802_0307848 | |||
| 2950 | Ga0451835_0292133 | |||
| 2951 | Ga0451835_1200421 | |||
| 2952 | Ga0451839_1075735 | |||
| 2953 | Ga0451841_1021978 | |||
| 2954 | Ga0451847_0572655 | |||
| 2955 | Ga0451849_0919081 | |||
| 2956 | Ga0451851_1303484 | |||
| 2957 | Ga0451853_0084396 | |||
| 2958 | Ga0451853_0994657 | |||
| 2959 | Ga0451853_2728074 | |||
| 2960 | Ga0439448_0046614 | |||
| 2961 | Ga0439451_055619 | |||
| 2962 | Ga0439462_0052538 | |||
| 2963 | Ga0439446_0001096 | |||
| 2964 | Ga0439434_0011094 | |||
| 2965 | Ga0466969_0009066 | |||
| 2966 | Ga0466969_0016781 | |||
| 2967 | Ga0466972_0034513 | |||
| 2968 | Ga0466965_0009748 | |||
| 2969 | Ga0466965_0030427 | |||
| 2970 | Ga0466965_0389264 | |||
| 2971 | Ga0466965_0775773 | |||
| 2972 | Ga0466966_0070776 | |||
| 2973 | Ga0466966_0080650 | |||
| 2974 | Ga0466966_0231525 | |||
| 2975 | Ga0466966_0326412 | |||
| 2976 | Ga0466961_0003458 | |||
| 2977 | Ga0466961_0005030 | |||
| 2978 | Ga0466961_0007918 | |||
| 2979 | Ga0466961_0008115 | |||
| 2980 | Ga0466961_0020292 | |||
| 2981 | Ga0466961_0056816 | |||
| 2982 | Ga0466963_0000496 | |||
| 2983 | Ga0466963_0000527 | |||
| 2984 | Ga0466963_0000758 | |||
| 2985 | Ga0466963_0000939 | |||
| 2986 | Ga0466963_0001062 | |||
| 2987 | Ga0466963_0001466 | |||
| 2988 | Ga0466963_0003947 | |||
| 2989 | Ga0466963_0007572 | |||
| 2990 | Ga0466963_0009286 | |||
| 2991 | Ga0466963_0011261 | |||
| 2992 | Ga0466963_0023706 | |||
| 2993 | Ga0466963_0029091 | |||
| 2994 | Ga0466963_0039079 | |||
| 2995 | Ga0466963_0043688 | |||
| 2996 | Ga0466963_0047488 | |||
| 2997 | Ga0466963_0062688 | |||
| 2998 | Ga0466963_0086795 | |||
| 2999 | Ga0466963_0108550 | |||
| 3000 | Ga0466963_0120056 | |||
| 3001 | Ga0466963_0129580 | |||
| 3002 | Ga0466963_0290050 | |||
| 3003 | Ga0466963_0375373 | |||
| 3004 | Ga0466963_1102772 | |||
| 3005 | Ga0466963_1162737 | |||
| 3006 | Ga0466964_0010892 | |||
| 3007 | Ga0466964_0011398 | |||
| 3008 | Ga0466964_0037411 | |||
| 3009 | Ga0466964_0048840 | |||
| 3010 | Ga0466964_0074592 | |||
| 3011 | Ga0466964_0085023 | |||
| 3012 | Ga0466964_0112214 | |||
| 3013 | Ga0466964_0229454 | |||
| 3014 | Ga0466964_0316519 | |||
| 3015 | Ga0466971_0000165 | |||
| 3016 | Ga0466971_0000768 | |||
| 3017 | Ga0466971_0033712 | |||
| 3018 | Ga0466971_0043043 | |||
| 3019 | Ga0466971_0073162 | |||
| 3020 | Ga0466971_0137194 | |||
| 3021 | Ga0466971_0178759 | |||
| 3022 | Ga0466971_0260422 | |||
| 3023 | Ga0466971_0400448 | |||
| 3024 | Ga0466968_0016704 | |||
| 3025 | Ga0466968_0018342 | |||
| 3026 | Ga0466968_0022953 | |||
| 3027 | Ga0466968_0023049 | |||
| 3028 | Ga0466968_0047795 | |||
| 3029 | Ga0466968_0058532 | |||
| 3030 | Ga0466968_0176123 | |||
| 3031 | Ga0466968_0262615 | |||
| 3032 | Ga0466968_0297620 | |||
| 3033 | Ga0466970_0044726 | |||
| 3034 | Ga0466970_0142540 | |||
| 3035 | Ga0466970_0519000 | |||
| 3036 | Ga0466957_0001076 | |||
| 3037 | Ga0466957_0008958 | |||
| 3038 | Ga0466957_0010572 | |||
| 3039 | Ga0466957_0013493 | |||
| 3040 | Ga0466957_0021711 | |||
| 3041 | Ga0466957_0031108 | |||
| 3042 | Ga0466957_0037977 | |||
| 3043 | Ga0466957_0044363 | |||
| 3044 | Ga0466957_0053182 | |||
| 3045 | Ga0466957_0107622 | |||
| 3046 | Ga0466957_0146339 | |||
| 3047 | Ga0466957_0158532 | |||
| 3048 | Ga0466957_0243664 | |||
| 3049 | Ga0466960_0002610 | |||
| 3050 | Ga0466960_0006392 | |||
| 3051 | Ga0466960_0032481 | |||
| 3052 | Ga0466960_0034986 | |||
| 3053 | Ga0466960_0080725 | |||
| 3054 | Ga0466960_0155647 | |||
| 3055 | Ga0466960_0492583 | |||
| 3056 | Ga0466960_0734137 | |||
| 3057 | Ga0466960_0985796 | |||
| 3058 | Ga0466959_0003485 | |||
| 3059 | Ga0466959_0004630 | |||
| 3060 | Ga0466959_0017388 | |||
| 3061 | Ga0466959_0095442 | |||
| 3062 | Ga0466959_0238230 | |||
| 3063 | Ga0466959_0313111 | |||
| 3064 | Ga0451576_0334886 | |||
| 3065 | Ga0451576_1941075 | |||
| 3066 | Ga0466958_0000198 | |||
| 3067 | Ga0466958_0003169 | |||
| 3068 | Ga0466958_0006052 | |||
| 3069 | Ga0466958_0015836 | |||
| 3070 | Ga0466958_0035946 | |||
| 3071 | Ga0466958_0179913 | |||
| 3072 | Ga0466958_0189601 | |||
| 3073 | Ga0466958_0239300 | |||
| 3074 | Ga0466958_0332226 | |||
| 3075 | Ga0466958_0520308 | |||
| 3076 | Ga0466967_0006078 | |||
| 3077 | Ga0466967_0006133 | |||
| 3078 | Ga0466967_0012007 | |||
| 3079 | Ga0466967_0016889 | |||
| 3080 | Ga0466967_0017816 | |||
| 3081 | Ga0466967_0026937 | |||
| 3082 | Ga0466967_0027798 | |||
| 3083 | Ga0466967_0029506 | |||
| 3084 | Ga0466967_0041361 | |||
| 3085 | Ga0466967_0061814 | |||
| 3086 | Ga0466967_0079098 | |||
| 3087 | Ga0466967_0085588 | |||
| 3088 | Ga0466967_0095758 | |||
| 3089 | Ga0466967_0104468 | |||
| 3090 | Ga0466967_0124591 | |||
| 3091 | Ga0466967_0134831 | |||
| 3092 | Ga0466967_0139362 | |||
| 3093 | Ga0466967_0143791 | |||
| 3094 | Ga0466967_0175606 | |||
| 3095 | Ga0466967_0181682 | |||
| 3096 | Ga0466967_0196297 | |||
| 3097 | Ga0466967_0212899 | |||
| 3098 | Ga0466967_0301564 | |||
| 3099 | Ga0466967_0471783 | |||
| 3100 | Ga0466967_0505439 | |||
| 3101 | Ga0466967_0520255 | |||
| 3102 | Ga0466967_0609103 | |||
| 3103 | Ga0466967_0740979 | |||
| 3104 | Ga0466967_0915081 | |||
| 3105 | Ga0466967_1463582 | |||
| 3106 | Ga0466967_1497153 | |||
| 3107 | Ga0466967_2308905 | |||
| 3108 | Ga0466967_2359140 | |||
| 3109 | Ga0466967_2474608 | |||
| 3110 | Ga0495592_0000089 | |||
| 3111 | Ga0495592_0028996 | |||
| 3112 | Ga0495592_0098656 | |||
| 3113 | Ga0495592_0464927 | |||
| 3114 | Ga0495603_0018644 | |||
| 3115 | Ga0495629_0004338 | |||
| 3116 | Ga0495629_0034591 | |||
| 3117 | Ga0495629_0053496 | |||
| 3118 | Ga0495629_0302793 | |||
| 3119 | Ga0495629_0621825 | |||
| 3120 | Ga0495641_0000709 | |||
| 3121 | Ga0495641_0008635 | |||
| 3122 | Ga0495641_0026722 | |||
| 3123 | Ga0495641_0127189 | |||
| 3124 | Ga0495641_0210620 | |||
| 3125 | Ga0495641_0223148 | |||
| 3126 | Ga0495651_0000057 | |||
| 3127 | Ga0495651_0122698 | |||
| 3128 | Ga0495651_0513589 | |||
| 3129 | Ga0495653_0009358 | |||
| 3130 | Ga0495653_0010557 | |||
| 3131 | Ga0495653_0075955 | |||
| 3132 | Ga0495653_0325315 | |||
| 3133 | Ga0495653_0506740 | |||
| 3134 | Ga0495582_0000237 | |||
| 3135 | Ga0495582_0009627 | |||
| 3136 | Ga0495582_0285752 | |||
| 3137 | Ga0495605_0226456 | |||
| 3138 | Ga0495639_0005828 | |||
| 3139 | Ga0495639_0273015 | |||
| 3140 | Ga0495639_0504413 | |||
| 3141 | Ga0495662_0000484 | |||
| 3142 | Ga0495662_0104834 | |||
| 3143 | Ga0495662_0117298 | |||
| 3144 | Ga0495662_0637883 | |||
| 3145 | Ga0495664_0115589 | |||
| 3146 | Ga0495664_0150755 | |||
| 3147 | Ga0495664_0319139 | |||
| 3148 | Ga0495664_0641340 | |||
| 3149 | Ga0495664_0860754 | |||
| 3150 | Ga0495584_0063028 | |||
| 3151 | Ga0495584_0328131 | |||
| 3152 | Ga0495594_0241792 | |||
| 3153 | Ga0495596_0452774 | |||
| 3154 | Ga0495607_0026370 | |||
| 3155 | Ga0495608_0002880 | |||
| 3156 | Ga0495608_0008254 | |||
| 3157 | Ga0495608_0048333 | |||
| 3158 | Ga0495608_0094899 | |||
| 3159 | Ga0495608_0142843 | |||
| 3160 | Ga0495618_0011414 | |||
| 3161 | Ga0495618_0101505 | |||
| 3162 | Ga0495618_0150230 | |||
| 3163 | Ga0495628_0000066 | |||
| 3164 | Ga0495628_0045716 | |||
| 3165 | Ga0495628_0207794 | |||
| 3166 | Ga0495628_0243995 | |||
| 3167 | Ga0495628_0324054 | |||
| 3168 | Ga0495628_0379390 | |||
| 3169 | Ga0495630_0055324 | |||
| 3170 | Ga0495630_0090331 | |||
| 3171 | Ga0495630_0135396 | |||
| 3172 | Ga0495630_0232175 | |||
| 3173 | Ga0495630_1014408 | |||
| 3174 | Ga0495631_0035672 | |||
| 3175 | Ga0495631_0230514 | |||
| 3176 | Ga0495637_0249762 | |||
| 3177 | Ga0495644_0023749 | |||
| 3178 | Ga0495644_0296041 | |||
| 3179 | Ga0495663_0235328 | |||
| 3180 | Ga0495642_0040762 | |||
| 3181 | Ga0495642_0088740 | |||
| 3182 | Ga0495652_0000118 | |||
| 3183 | Ga0495652_0027906 | |||
| 3184 | Ga0495652_0061355 | |||
| 3185 | Ga0495652_0240341 | |||
| 3186 | Ga0495652_0320341 | |||
| 3187 | Ga0495665_0001276 | |||
| 3188 | Ga0495665_0151752 | |||
| 3189 | Ga0495640_0011148 | |||
| 3190 | Ga0495640_0027749 | |||
| 3191 | Ga0495640_0255831 | |||
| 3192 | Ga0495640_0628717 | |||
| 3193 | Ga0495586_0052557 | |||
| 3194 | Ga0495586_0175388 | |||
| 3195 | Ga0495587_0000096 | |||
| 3196 | Ga0495587_0047693 | |||
| 3197 | Ga0495587_0108139 | |||
| 3198 | Ga0495587_0333721 | |||
| 3199 | Ga0495609_0088539 | |||
| 3200 | Ga0495645_0000052 | |||
| 3201 | Ga0495645_0053773 | |||
| 3202 | Ga0495645_0519607 | |||
| 3203 | Ga0495645_0737307 | |||
| 3204 | Ga0495633_0132186 | |||
| 3205 | Ga0495667_0010006 | |||
| 3206 | Ga0495667_0090735 | |||
| 3207 | Ga0495667_0283497 | |||
| 3208 | Ga0495667_0396192 | |||
| 3209 | Ga0495656_0005086 | |||
| 3210 | Ga0495656_0046893 | |||
| 3211 | Ga0495656_0329591 | |||
| 3212 | Ga0495634_0017218 | |||
| 3213 | Ga0495634_0037586 | |||
| 3214 | Ga0495634_0052232 | |||
| 3215 | Ga0495635_0010241 | |||
| 3216 | Ga0495635_0052437 | |||
| 3217 | Ga0495635_0706270 | |||
| 3218 | Ga0495659_0008068 | |||
| 3219 | Ga0495659_0141202 | |||
| 3220 | Ga0495659_0303203 | |||
| 3221 | Ga0495588_0090691 | |||
| 3222 | Ga0495588_0112405 | |||
| 3223 | Ga0495657_0004760 | |||
| 3224 | Ga0495657_0012143 | |||
| 3225 | Ga0495657_0081250 | |||
| 3226 | Ga0495657_0207378 | |||
| 3227 | Ga0495657_0542524 | |||
| 3228 | Ga0495599_0000046 | |||
| 3229 | Ga0495599_0016285 | |||
| 3230 | Ga0495599_0751531 | |||
| 3231 | Ga0495623_0000061 | |||
| 3232 | Ga0495623_0087137 | |||
| 3233 | Ga0495646_0081327 | |||
| 3234 | Ga0495646_0238702 | |||
| 3235 | Ga0495647_0010802 | |||
| 3236 | Ga0495647_0021233 | |||
| 3237 | Ga0495647_0039368 | |||
| 3238 | Ga0495647_0040462 | |||
| 3239 | Ga0495658_0000690 | |||
| 3240 | Ga0495658_0311028 | |||
| 3241 | Ga0495658_0320485 | |||
| 3242 | Ga0495658_0767741 | |||
| 3243 | Ga0495669_0583933 | |||
| 3244 | Ga0495613_0074518 | |||
| 3245 | Ga0495613_0095494 | |||
| 3246 | Ga0495613_0255313 | |||
| 3247 | Ga0495613_0298169 | |||
| 3248 | Ga0495613_0450315 | |||
| 3249 | Ga0495613_0514260 | |||
| 3250 | Ga0495624_0019594 | |||
| 3251 | Ga0495624_0049223 | |||
| 3252 | Ga0495624_0125350 | |||
| 3253 | Ga0495624_0455793 | |||
| 3254 | Ga0495624_0587498 | |||
| 3255 | Ga0495670_0125502 | |||
| 3256 | Ga0495670_0287962 | |||
| 3257 | Ga0495670_0413608 | |||
| 3258 | Ga0495671_0289877 | |||
| 3259 | Ga0495600_0090023 | |||
| 3260 | Ga0495600_0247630 | |||
| 3261 | Ga0495600_0725031 | |||
| 3262 | Ga0495581_0001253 | |||
| 3263 | Ga0495581_0001600 | |||
| 3264 | Ga0495581_0179822 | |||
| 3265 | Ga0495604_0000075 | |||
| 3266 | Ga0495604_0055376 | |||
| 3267 | Ga0495604_0080405 | |||
| 3268 | Ga0495604_0376981 | |||
| 3269 | Ga0495604_0792616 | |||
| 3270 | Ga0495636_0199483 | |||
| 3271 | Ga0495674_0041297 | |||
| 3272 | Ga0495674_0320691 | |||
| 3273 | Ga0495674_0693720 | |||
| 3274 | Ga0495674_0768415 | |||
| 3275 | Ga0495674_1136872 | |||
| 3276 | Ga0495676_0011861 | |||
| 3277 | Ga0495676_0047337 | |||
| 3278 | Ga0495676_0249982 | |||
| 3279 | Ga0495676_0277111 | |||
| 3280 | Ga0495676_0298462 | |||
| 3281 | Ga0495676_0969544 | |||
| 3282 | Ga0495680_0001905 | |||
| 3283 | Ga0495680_0006191 | |||
| 3284 | Ga0495680_0037232 | |||
| 3285 | Ga0495680_0056729 | |||
| 3286 | Ga0495680_0287801 | |||
| 3287 | Ga0495680_0674159 | |||
| 3288 | Ga0495680_0714312 | |||
| 3289 | Ga0495683_0433346 | |||
| 3290 | Ga0495683_0456273 | |||
| 3291 | Ga0495675_0000089 | |||
| 3292 | Ga0495684_0003909 | |||
| 3293 | Ga0495593_0014087 | |||
| 3294 | Ga0495602_0000140 | |||
| 3295 | Ga0495602_0261263 | |||
| 3296 | Ga0496100_0004732 | |||
| 3297 | Ga0496100_0010338 | |||
| 3298 | Ga0496100_0020599 | |||
| 3299 | Ga0496100_0064483 | |||
| 3300 | Ga0496100_0110162 | |||
| 3301 | Ga0496100_0151612 | |||
| 3302 | Ga0496100_0308610 | |||
| 3303 | Ga0496100_0397149 | |||
| 3304 | Ga0496100_0411232 | |||
| 3305 | Ga0496100_0445117 | |||
| 3306 | Ga0496101_0004530 | |||
| 3307 | Ga0496101_0012096 | |||
| 3308 | Ga0496101_0017691 | |||
| 3309 | Ga0496101_0027136 | |||
| 3310 | Ga0496101_0053116 | |||
| 3311 | Ga0496101_0055464 | |||
| 3312 | Ga0496101_0084510 | |||
| 3313 | Ga0496101_0113050 | |||
| 3314 | Ga0496101_0163593 | |||
| 3315 | Ga0496101_0341321 | |||
| 3316 | Ga0496101_0407874 | |||
| 3317 | Ga0496101_0587011 | |||
| 3318 | Ga0496101_0671515 | |||
| 3319 | Ga0496101_0903107 | |||
| 3320 | Ga0496101_1369153 | |||
| 3321 | Ga0496102_0001619 | |||
| 3322 | Ga0496102_0019419 | |||
| 3323 | Ga0496102_0031138 | |||
| 3324 | Ga0496102_0052127 | |||
| 3325 | Ga0496102_0115683 | |||
| 3326 | Ga0496102_0125287 | |||
| 3327 | Ga0496102_0157860 | |||
| 3328 | Ga0496102_0300191 | |||
| 3329 | Ga0496102_0305497 | |||
| 3330 | Ga0496102_0341605 | |||
| 3331 | Ga0496102_0352560 | |||
| 3332 | Ga0496102_0626905 | |||
| 3333 | Ga0496102_1168181 | |||
| 3334 | Ga0496102_1500844 | |||
| 3335 | Ga0496103_0003260 | |||
| 3336 | Ga0496103_0011323 | |||
| 3337 | Ga0496103_0029954 | |||
| 3338 | Ga0496103_0044530 | |||
| 3339 | Ga0496103_0169078 | |||
| 3340 | Ga0496103_0189656 | |||
| 3341 | Ga0496103_0459737 | |||
| 3342 | Ga0496103_0541414 | |||
| 3343 | Ga0496104_0000698 | |||
| 3344 | Ga0496104_0001046 | |||
| 3345 | Ga0496104_0005959 | |||
| 3346 | Ga0496104_0006253 | |||
| 3347 | Ga0496104_0010896 | |||
| 3348 | Ga0496104_0011416 | |||
| 3349 | Ga0496104_0037752 | |||
| 3350 | Ga0496104_0052023 | |||
| 3351 | Ga0496104_0123420 | |||
| 3352 | Ga0496104_0243349 | |||
| 3353 | Ga0496104_0267593 | |||
| 3354 | Ga0496104_0393914 | |||
| 3355 | Ga0496104_0434813 | |||
| 3356 | Ga0496104_0443285 | |||
| 3357 | Ga0496105_0000377 | |||
| 3358 | Ga0496105_0032083 | |||
| 3359 | Ga0496105_0053178 | |||
| 3360 | Ga0496105_0065374 | |||
| 3361 | Ga0496105_0090952 | |||
| 3362 | Ga0496105_0106665 | |||
| 3363 | Ga0496105_0143228 | |||
| 3364 | Ga0496105_0172719 | |||
| 3365 | Ga0496105_0232354 | |||
| 3366 | Ga0496105_0325512 | |||
| 3367 | Ga0496105_0381444 | |||
| 3368 | Ga0496105_0395622 | |||
| 3369 | Ga0496105_0644661 | |||
| 3370 | Ga0496105_0850135 | |||
| 3371 | Ga0496106_0005023 | |||
| 3372 | Ga0496106_0010051 | |||
| 3373 | Ga0496106_0015786 | |||
| 3374 | Ga0496106_0034593 | |||
| 3375 | Ga0496106_0234914 | |||
| 3376 | Ga0496106_0263059 | |||
| 3377 | Ga0496106_0290547 | |||
| 3378 | Ga0496106_0358212 | |||
| 3379 | Ga0496106_0358915 | |||
| 3380 | Ga0496106_0586223 | |||
| 3381 | Ga0496107_0007323 | |||
| 3382 | Ga0496107_0015370 | |||
| 3383 | Ga0496107_0020725 | |||
| 3384 | Ga0496107_0054065 | |||
| 3385 | Ga0496107_0055332 | |||
| 3386 | Ga0496107_0081995 | |||
| 3387 | Ga0496107_0098586 | |||
| 3388 | Ga0496107_0116854 | |||
| 3389 | Ga0496107_0171207 | |||
| 3390 | Ga0496107_0186511 | |||
| 3391 | Ga0496107_0394265 | |||
| 3392 | Ga0496107_0591326 | |||
| 3393 | Ga0496107_0710546 | |||
| 3394 | Ga0496108_0010471 | |||
| 3395 | Ga0496108_0017267 | |||
| 3396 | Ga0496108_0020646 | |||
| 3397 | Ga0496108_0021100 | |||
| 3398 | Ga0496108_0085622 | |||
| 3399 | Ga0496108_0087262 | |||
| 3400 | Ga0496108_0104019 | |||
| 3401 | Ga0496108_0198216 | |||
| 3402 | Ga0496108_0219645 | |||
| 3403 | Ga0496108_0431573 | |||
| 3404 | Ga0496108_0558838 | |||
| 3405 | Ga0496108_0687574 | |||
| 3406 | Ga0496108_0902702 | |||
| 3407 | Ga0496108_1187795 | |||
| 3408 | Ga0496109_0000283 | |||
| 3409 | Ga0496109_0004017 | |||
| 3410 | Ga0496109_0006743 | |||
| 3411 | Ga0496109_0012833 | |||
| 3412 | Ga0496109_0018246 | |||
| 3413 | Ga0496109_0032576 | |||
| 3414 | Ga0496109_0038118 | |||
| 3415 | Ga0496109_0162906 | |||
| 3416 | Ga0496109_0172234 | |||
| 3417 | Ga0496109_0185355 | |||
| 3418 | Ga0496109_0316614 | |||
| 3419 | Ga0496109_0336530 | |||
| 3420 | Ga0496109_0350998 | |||
| 3421 | Ga0496109_0602839 | |||
| 3422 | Ga0496109_1141414 | |||
| 3423 | Ga0496109_1506322 | |||
| 3424 | Ga0496110_0000421 | |||
| 3425 | Ga0496110_0006569 | |||
| 3426 | Ga0496110_0013754 | |||
| 3427 | Ga0496110_0022751 | |||
| 3428 | Ga0496110_0024549 | |||
| 3429 | Ga0496110_0035182 | |||
| 3430 | Ga0496110_0070437 | |||
| 3431 | Ga0496110_0131141 | |||
| 3432 | Ga0496110_0166999 | |||
| 3433 | Ga0496110_0232283 | |||
| 3434 | Ga0496110_0432630 | |||
| 3435 | Ga0496110_0481737 | |||
| 3436 | Ga0496110_0561471 | |||
| 3437 | Ga0496110_0778333 | |||
| 3438 | Ga0496110_1004964 | |||
| 3439 | Ga0496111_0002126 | |||
| 3440 | Ga0496111_0011579 | |||
| 3441 | Ga0496111_0041373 | |||
| 3442 | Ga0496111_0065481 | |||
| 3443 | Ga0496111_0076320 | |||
| 3444 | Ga0496111_0080299 | |||
| 3445 | Ga0496111_0084865 | |||
| 3446 | Ga0496111_0094587 | |||
| 3447 | Ga0496111_0121276 | |||
| 3448 | Ga0496111_0165030 | |||
| 3449 | Ga0496111_0165245 | |||
| 3450 | Ga0496111_0259744 | |||
| 3451 | Ga0496111_0346647 | |||
| 3452 | Ga0496111_0403777 | |||
| 3453 | Ga0496111_0442135 | |||
| 3454 | Ga0496111_0520511 | |||
| 3455 | Ga0496111_1039137 | |||
| 3456 | Ga0496112_0000741 | |||
| 3457 | Ga0496112_0014699 | |||
| 3458 | Ga0496112_0032585 | |||
| 3459 | Ga0496112_0054122 | |||
| 3460 | Ga0496112_0056912 | |||
| 3461 | Ga0496112_0103793 | |||
| 3462 | Ga0496112_0112123 | |||
| 3463 | Ga0496112_0136477 | |||
| 3464 | Ga0496112_0184167 | |||
| 3465 | Ga0496112_0314331 | |||
| 3466 | Ga0496112_0342348 | |||
| 3467 | Ga0496112_0497632 | |||
| 3468 | Ga0496112_0615163 | |||
| 3469 | Ga0496112_0632172 | |||
| 3470 | Ga0496112_1483803 | |||
| 3471 | Ga0496112_1667470 | |||
| 3472 | Ga0496113_0006821 | |||
| 3473 | Ga0496113_0009476 | |||
| 3474 | Ga0496113_0016822 | |||
| 3475 | Ga0496113_0039442 | |||
| 3476 | Ga0496113_0240448 | |||
| 3477 | Ga0496113_0277014 | |||
| 3478 | Ga0496113_0344004 | |||
| 3479 | Ga0496113_0811179 | |||
| 3480 | Ga0496113_0988100 | |||
| 3481 | Ga0496114_0000356 | |||
| 3482 | Ga0496114_0000404 | |||
| 3483 | Ga0496114_0004656 | |||
| 3484 | Ga0496114_0028777 | |||
| 3485 | Ga0496114_0033507 | |||
| 3486 | Ga0496114_0044665 | |||
| 3487 | Ga0496114_0048157 | |||
| 3488 | Ga0496114_0062878 | |||
| 3489 | Ga0496114_0065058 | |||
| 3490 | Ga0496114_0087340 | |||
| 3491 | Ga0496114_0173874 | |||
| 3492 | Ga0496114_0240853 | |||
| 3493 | Ga0496114_0242968 | |||
| 3494 | Ga0496114_0392905 | |||
| 3495 | Ga0496114_0437931 | |||
| 3496 | Ga0496114_0737164 | |||
| 3497 | Ga0496115_0003585 | |||
| 3498 | Ga0496115_0011507 | |||
| 3499 | Ga0496115_0016253 | |||
| 3500 | Ga0496115_0022227 | |||
| 3501 | Ga0496115_0027626 | |||
| 3502 | Ga0496115_0112837 | |||
| 3503 | Ga0496115_0533639 | |||
| 3504 | Ga0496115_0923301 | |||
| 3505 | Ga0501034_0012275 | |||
| 3506 | Ga0501036_0478541 | |||
| 3507 | Ga0501047_0045260 | |||
| 3508 | Ga0501067_0001025 | |||
| 3509 | Ga0501067_0020731 | |||
| 3510 | Ga0501067_0041661 | |||
| 3511 | Ga0501067_0059394 | |||
| 3512 | Ga0501067_0062089 | |||
| 3513 | Ga0501068_0257082 | |||
| 3514 | Ga0501069_0003321 | |||
| 3515 | Ga0501069_0011862 | |||
| 3516 | Ga0501069_0027503 | |||
| 3517 | Ga0501069_0880311 | |||
| 3518 | Ga0501070_0007998 | |||
| 3519 | Ga0501070_0026505 | |||
| 3520 | Ga0501071_1003366 | |||
| 3521 | Ga0501072_0013409 | |||
| 3522 | Ga0501073_0011431 | |||
| 3523 | Ga0501074_0020920 | |||
| 3524 | Ga0501074_0106178 | |||
| 3525 | Ga0501075_0337341 | |||
| 3526 | Ga0501076_0378553 | |||
| 3527 | Ga0501079_0045168 | |||
| 3528 | Ga0501079_0464571 | |||
| 3529 | Ga0501080_0003102 | |||
| 3530 | Ga0501080_0105085 | |||
| 3531 | Ga0501081_0731540 | |||
| 3532 | Ga0501081_0795377 | |||
| 3533 | Ga0501083_0001195 | |||
| 3534 | Ga0501083_0275891 | |||
| 3535 | Ga0501044_0311762 | |||
| 3536 | nmdc:mga0yw44_591563_c1 | |||
| 3537 | nmdc:mga0yw44_93626_c1 | |||
| 3538 | nmdc:mga05p37_1121769_c1 | |||
| 3539 | nmdc:mga05p37_1670778_c1 | |||
| 3540 | nmdc:mga05p37_172288_c1 | |||
| 3541 | nmdc:mga05p37_246105_c1 | |||
| 3542 | nmdc:mga05p37_38372_c1 | |||
| 3543 | nmdc:mga05p37_523266_c1 | |||
| 3544 | nmdc:mga06r32_101267_c1 | |||
| 3545 | nmdc:mga06r32_183981_c1 | |||
| 3546 | nmdc:mga06r32_538271_c1 | |||
| 3547 | nmdc:mga08y16_1260446_c1 | |||
| 3548 | nmdc:mga08y16_1357471_c1 | |||
| 3549 | nmdc:mga08y16_348330_c1 | |||
| 3550 | nmdc:mga0n895_11341_c1 | |||
| 3551 | nmdc:mga0n895_121568_c1 | |||
| 3552 | nmdc:mga0n895_128934_c1 | |||
| 3553 | nmdc:mga0n895_15149_c1 | |||
| 3554 | nmdc:mga0n895_19850_c1 | |||
| 3555 | nmdc:mga0n895_276457_c1 | |||
| 3556 | nmdc:mga0n895_31090_c1 | |||
| 3557 | nmdc:mga0n895_335957_c1 | |||
| 3558 | nmdc:mga0n895_491604_c1 | |||
| 3559 | nmdc:mga0n895_612970_c1 | |||
| 3560 | nmdc:mga0n895_714580_c1 | |||
| 3561 | nmdc:mga0n895_82756_c1 | |||
| 3562 | nmdc:mga0n895_877627_c1 | |||
| 3563 | nmdc:mga0rr50_11505_c1 | |||
| 3564 | nmdc:mga0rr50_143246_c1 | |||
| 3565 | nmdc:mga0rr50_221492_c1 | |||
| 3566 | nmdc:mga0rr50_2615_c1 | |||
| 3567 | nmdc:mga0rr50_51388_c1 | |||
| 3568 | nmdc:mga0rr50_54468_c1 | |||
| 3569 | nmdc:mga0rr50_7814_c1 | |||
| 3570 | nmdc:mga0rr50_8473_c1 | |||
| 3571 | nmdc:mga08x19_179801_c1 | |||
| 3572 | nmdc:mga08x19_40310_c1 | |||
| 3573 | nmdc:mga08x19_8684_c1 | |||
| 3574 | nmdc:mga0a205_2017_c1 | |||
| 3575 | nmdc:mga0a205_34318_c1 | |||
| 3576 | nmdc:mga0a205_344728_c1 | |||
| 3577 | nmdc:mga0a205_36789_c1 | |||
| 3578 | nmdc:mga0a205_409831_c1 | |||
| 3579 | nmdc:mga0a205_533992_c1 | |||
| 3580 | nmdc:mga0a205_585298_c1 | |||
| 3581 | nmdc:mga0a205_58757_c1 | |||
| 3582 | nmdc:mga0a205_796988_c1 | |||
| 3583 | Ga0495601_0000273 | |||
| 3584 | Ga0495601_0078078 | |||
| 3585 | Ga0495601_0422177 | |||
| 3586 | Ga0495601_0567442 | |||
| 3587 | Ga0495601_0669435 | |||
| 3588 | Ga0495601_0942941 | |||
| 3589 | Ga0495612_0030276 | |||
| 3590 | Ga0495612_0143348 | |||
| 3591 | Ga0495655_0249351 | |||
| 3592 | Ga0495655_0325428 | |||
| 3593 | Ga0495595_0016538 | |||
| 3594 | Ga0495595_0026793 | |||
| 3595 | Ga0495595_0143183 | |||
| 3596 | Ga0495595_0385175 | |||
| 3597 | Ga0495619_0000123 | |||
| 3598 | Ga0495619_0003756 | |||
| 3599 | Ga0495619_0010339 | |||
| 3600 | Ga0495619_0062364 | |||
| 3601 | Ga0495619_0091000 | |||
| 3602 | Ga0495619_0103711 | |||
| 3603 | Ga0495619_0137416 | |||
| 3604 | Ga0495619_0195299 | |||
| 3605 | Ga0495619_0347332 | |||
| 3606 | Ga0500566_0405083 | |||
| 3607 | Ga0587066_003474 | |||
| 3608 | Ga0587066_008475 | |||
| 3609 | Ga0587066_026050 | |||
| 3610 | Ga0587066_034361 | |||
| 3611 | Ga0587070_022572 | |||
| 3612 | Ga0587073_0024496 | |||
| 3613 | Ga0587077_015938 | |||
| 3614 | Ga0587082_043305 | |||
| 3615 | Ga0587082_098357 | |||
| 3616 | Ga0587082_166337 | |||
| 3617 | Ga0587083_0042144 | |||
| 3618 | Ga0587083_0043679 | |||
| 3619 | Ga0587088_025102 | |||
| 3620 | Ga0587090_055994 | |||
| 3621 | Ga0587091_022009 | |||
| 3622 | Ga0587098_055762 | |||
| 3623 | Ga0587106_001318 | |||
| 3624 | Ga0587106_014613 | |||
| 3625 | Ga0587121_13633 | |||
| 3626 | Ga0587113_046809 | |||
| 3627 | Ga0587115_007228 | |||
| 3628 | Ga0587128_125207 | |||
| 3629 | Ga0587128_134054 | |||
| 3630 | Ga0587067_013278 | |||
| 3631 | Ga0587067_157212 | |||
| 3632 | Ga0587068_020750 | |||
| 3633 | Ga0587078_051183 | |||
| 3634 | Ga0587079_000834 | |||
| 3635 | Ga0587079_007273 | |||
| 3636 | Ga0587107_016428 | |||
| 3637 | Ga0587110_025690 | |||
| 3638 | Ga0587071_051674 | |||
| 3639 | Ga0587111_0240484 | |||
| 3640 | Ga0466962_0000618 | |||
| 3641 | Ga0466962_0002035 | |||
| 3642 | Ga0466962_0009674 | |||
| 3643 | Ga0466962_0014258 | |||
| 3644 | Ga0466962_0059781 | |||
| 3645 | Ga0466962_0079819 | |||
| 3646 | Ga0466962_0119436 | |||
| 3647 | Ga0530510_0009967 | |||
| 3648 | Ga0530510_0159471 | |||
| 3649 | Ga0530510_0177060 | |||
| 3650 | Ga0530510_1452382 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gx8-assembly1.cif.gz_A | structural and biochemical characterization of yeast monothiol glutaredoxin grx5 | 0.9355 | 3 | 103 |
| 2mma-assembly1.cif.gz_A | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.9309 | 3 | 103 |
| 2wci-assembly1.cif.gz_A | structure of e. coli monothiol glutaredoxin grx4 homodimer | 0.9249 | 1 | 102 |
| 3zyw-assembly1.cif.gz_A | crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) | 0.9168 | 2 | 97 |
| 2wul-assembly1.cif.gz_D | crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster | 0.9088 | 4 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q555C8_40_141_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9715 | 7 | 102 | 3.40.30.10 |
| af_K7UQQ8_80_167_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9671 | 8 | 93 | 3.40.30.10 |
| af_Q8IBZ7_179_272_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9565 | 9 | 97 | 3.40.30.10 |
| 2wemC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9562 | 7 | 101 | 3.40.30.10 |
| af_C6KSR7_119_214_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9544 | 6 | 97 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538JX23-F1-model_v4 | Glutaredoxin | 0.9977 | 3 | 118 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A1F2XR86-F1-model_v4 | Glutaredoxin | 0.9925 | 1 | 117 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A537TUY1-F1-model_v4 | Grx4 family monothiol glutaredoxin | 0.9907 | 1 | 119 |
GO:0046872
GO:0051537 |
| AF-A0A538FHJ8-F1-model_v4 | Glutaredoxin domain-containing protein | 0.9899 | 20 | 119 |
|
| AF-A0A1Q7WX43-F1-model_v4 | Glutaredoxin | 0.9895 | 1 | 119 |
GO:0015036
GO:0046872 GO:0051537 |