F495628
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1764 | 390 | 3528 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10318727|Ga0163163_103187271 |
| Length | 179 |
| Sequence | MMAPADASDRLLPAGLQPQPPANRPAGKELGMTTKAAFSPEEWKTVLQGPPTAGMIVVTAARGGTIRETIALAKAYSEAHAQPGESELLDEIVAARPEVDHSRFHSAEELKEHGLAELRTAVALVESKATAGELDDYRQFVLALASKVAAAHREHGQPVSPAEAAAIQEIRATVGASTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 117 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 119 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 145 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 243 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 276 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 279 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 283 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 284 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 288 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 289 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 376 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.62 |
| Metatranscriptomes | 2.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0 |
| Rhizoplane | 5.33 |
| Rhizosphere | 93.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163163_10318727 | 3300014325 | Bacteria | 1608 |
| 2 | JGI24737J22298_10048834 | 3300001990 | Bacteria | 1288 |
| 3 | JGI24751J29686_10003466 | 3300002459 | Bacteria | 3176 |
| 4 | JGI25404J52841_10015743 | 3300003659 | Bacteria | 1640 |
| 5 | JGI25404J52841_10122746 | 3300003659 | Unclassified | 548 |
| 6 | Ga0058859_11761553 | 3300004798 | Bacteria | 544 |
| 7 | Ga0058863_10863976 | 3300004799 | Bacteria | 679 |
| 8 | Ga0058863_11945211 | 3300004799 | Unclassified | 749 |
| 9 | Ga0058861_11806364 | 3300004800 | Bacteria | 776 |
| 10 | Ga0058861_12027980 | 3300004800 | Unclassified | 886 |
| 11 | Ga0058862_12725586 | 3300004803 | Unclassified | 573 |
| 12 | Ga0058862_12799539 | 3300004803 | Unclassified | 600 |
| 13 | Ga0070658_10013242 | 3300005327 | Bacteria | 6616 |
| 14 | Ga0070658_10022197 | 3300005327 | Bacteria | 5093 |
| 15 | Ga0070683_100331248 | 3300005329 | Bacteria | 1449 |
| 16 | Ga0070683_101935747 | 3300005329 | Unclassified | 567 |
| 17 | Ga0070670_100047936 | 3300005331 | Bacteria | 3677 |
| 18 | Ga0070677_10744136 | 3300005333 | Bacteria | 555 |
| 19 | Ga0068869_100005709 | 3300005334 | Bacteria | 7853 |
| 20 | Ga0068869_100108144 | 3300005334 | Bacteria | 2112 |
| 21 | Ga0068869_100393202 | 3300005334 | Bacteria | 1139 |
| 22 | Ga0068869_101035705 | 3300005334 | Bacteria | 716 |
| 23 | Ga0070666_10113467 | 3300005335 | Bacteria | 1875 |
| 24 | Ga0070666_10407319 | 3300005335 | Unclassified | 978 |
| 25 | Ga0070680_100011453 | 3300005336 | Bacteria | 6862 |
| 26 | Ga0070680_101415576 | 3300005336 | Unclassified | 602 |
| 27 | Ga0070682_100005887 | 3300005337 | Bacteria | 6854 |
| 28 | Ga0070682_100115052 | 3300005337 | Bacteria | 1798 |
| 29 | Ga0070682_100279391 | 3300005337 | Bacteria | 1216 |
| 30 | Ga0070682_100377655 | 3300005337 | Unclassified | 1065 |
| 31 | Ga0070682_100532683 | 3300005337 | Unclassified | 916 |
| 32 | Ga0070682_101158633 | 3300005337 | Bacteria | 650 |
| 33 | Ga0070682_101631775 | 3300005337 | Bacteria | 558 |
| 34 | Ga0068868_100007699 | 3300005338 | Bacteria | 7683 |
| 35 | Ga0068868_100022775 | 3300005338 | Bacteria | 4734 |
| 36 | Ga0068868_100137865 | 3300005338 | Bacteria | 2001 |
| 37 | Ga0068868_100979543 | 3300005338 | Bacteria | 772 |
| 38 | Ga0068868_101077252 | 3300005338 | Bacteria | 738 |
| 39 | Ga0070660_100040979 | 3300005339 | Bacteria | 3527 |
| 40 | Ga0070660_100183639 | 3300005339 | Bacteria | 1693 |
| 41 | Ga0070660_100255252 | 3300005339 | Bacteria | 1430 |
| 42 | Ga0070689_100328654 | 3300005340 | Bacteria | 1278 |
| 43 | Ga0070689_100366066 | 3300005340 | Bacteria | 1212 |
| 44 | Ga0070689_100385187 | 3300005340 | Unclassified | 1182 |
| 45 | Ga0070691_10127749 | 3300005341 | Bacteria | 1285 |
| 46 | Ga0070691_10227311 | 3300005341 | Unclassified | 992 |
| 47 | Ga0070691_10236913 | 3300005341 | Unclassified | 973 |
| 48 | Ga0070687_100049477 | 3300005343 | Bacteria | 2166 |
| 49 | Ga0070687_100422565 | 3300005343 | Bacteria | 880 |
| 50 | Ga0070687_100437324 | 3300005343 | Unclassified | 867 |
| 51 | Ga0070661_100012300 | 3300005344 | Bacteria | 5985 |
| 52 | Ga0070692_10002327 | 3300005345 | Bacteria | 7331 |
| 53 | Ga0070692_10017091 | 3300005345 | Bacteria | 3462 |
| 54 | Ga0070692_10236109 | 3300005345 | Bacteria | 1088 |
| 55 | Ga0070692_10426667 | 3300005345 | Bacteria | 843 |
| 56 | Ga0070668_100142063 | 3300005347 | Bacteria | 1935 |
| 57 | Ga0070668_101359363 | 3300005347 | Bacteria | 647 |
| 58 | Ga0070669_100179537 | 3300005353 | Bacteria | 1655 |
| 59 | Ga0070675_100005056 | 3300005354 | Bacteria | 10070 |
| 60 | Ga0070675_100013842 | 3300005354 | Bacteria | 6350 |
| 61 | Ga0070675_100883745 | 3300005354 | Bacteria | 819 |
| 62 | Ga0070671_100011302 | 3300005355 | Bacteria | 7174 |
| 63 | Ga0070671_100159317 | 3300005355 | Bacteria | 1908 |
| 64 | Ga0070671_100634399 | 3300005355 | Bacteria | 924 |
| 65 | Ga0070674_100160540 | 3300005356 | Bacteria | 1705 |
| 66 | Ga0070674_102065845 | 3300005356 | Unclassified | 519 |
| 67 | Ga0070673_100055617 | 3300005364 | Bacteria | 3118 |
| 68 | Ga0070673_100166133 | 3300005364 | Bacteria | 1880 |
| 69 | Ga0070673_100837679 | 3300005364 | Unclassified | 851 |
| 70 | Ga0070688_100270345 | 3300005365 | Unclassified | 1217 |
| 71 | Ga0070659_100008993 | 3300005366 | Bacteria | 7324 |
| 72 | Ga0070659_100032143 | 3300005366 | Bacteria | 4068 |
| 73 | Ga0070659_100598180 | 3300005366 | Bacteria | 947 |
| 74 | Ga0070703_10009847 | 3300005406 | Unclassified | 2695 |
| 75 | Ga0070703_10178025 | 3300005406 | Unclassified | 819 |
| 76 | Ga0070703_10417537 | 3300005406 | Unclassified | 587 |
| 77 | Ga0070709_10010150 | 3300005434 | Bacteria | 5206 |
| 78 | Ga0070709_10024217 | 3300005434 | Bacteria | 3572 |
| 79 | Ga0070709_10033342 | 3300005434 | Bacteria | 3113 |
| 80 | Ga0070709_10130683 | 3300005434 | Bacteria | 1714 |
| 81 | Ga0070709_10178205 | 3300005434 | Bacteria | 1490 |
| 82 | Ga0070709_10303590 | 3300005434 | Bacteria | 1166 |
| 83 | Ga0070709_10521302 | 3300005434 | Bacteria | 906 |
| 84 | Ga0070709_10531241 | 3300005434 | Bacteria | 897 |
| 85 | Ga0070709_10561563 | 3300005434 | Unclassified | 874 |
| 86 | Ga0070714_100001782 | 3300005435 | Bacteria | 15681 |
| 87 | Ga0070714_100005462 | 3300005435 | Bacteria | 9707 |
| 88 | Ga0070714_100014506 | 3300005435 | Bacteria | 6331 |
| 89 | Ga0070714_100016824 | 3300005435 | Bacteria | 5914 |
| 90 | Ga0070714_100043249 | 3300005435 | Bacteria | 3809 |
| 91 | Ga0070714_100048641 | 3300005435 | Bacteria | 3607 |
| 92 | Ga0070714_100063241 | 3300005435 | Bacteria | 3182 |
| 93 | Ga0070714_100081303 | 3300005435 | Bacteria | 2820 |
| 94 | Ga0070714_100107667 | 3300005435 | Bacteria | 2464 |
| 95 | Ga0070714_100145393 | 3300005435 | Bacteria | 2132 |
| 96 | Ga0070714_100341632 | 3300005435 | Bacteria | 1404 |
| 97 | Ga0070714_100422658 | 3300005435 | Bacteria | 1263 |
| 98 | Ga0070714_100844833 | 3300005435 | Bacteria | 888 |
| 99 | Ga0070714_100862154 | 3300005435 | Bacteria | 878 |
| 100 | Ga0070714_101049828 | 3300005435 | Unclassified | 793 |
| 101 | Ga0070713_100002466 | 3300005436 | Bacteria | 12073 |
| 102 | Ga0070713_100010817 | 3300005436 | Bacteria | 6612 |
| 103 | Ga0070713_100010914 | 3300005436 | Bacteria | 6586 |
| 104 | Ga0070713_100013244 | 3300005436 | Bacteria | 6081 |
| 105 | Ga0070713_100016564 | 3300005436 | Bacteria | 5544 |
| 106 | Ga0070713_100020352 | 3300005436 | Bacteria | 5086 |
| 107 | Ga0070713_100046937 | 3300005436 | Bacteria | 3547 |
| 108 | Ga0070713_100074544 | 3300005436 | Bacteria | 2875 |
| 109 | Ga0070713_100098438 | 3300005436 | Bacteria | 2529 |
| 110 | Ga0070713_100127147 | 3300005436 | Bacteria | 2243 |
| 111 | Ga0070713_100153422 | 3300005436 | Bacteria | 2051 |
| 112 | Ga0070713_100303044 | 3300005436 | Bacteria | 1471 |
| 113 | Ga0070713_100353648 | 3300005436 | Unclassified | 1363 |
| 114 | Ga0070713_100383151 | 3300005436 | Unclassified | 1310 |
| 115 | Ga0070713_100884862 | 3300005436 | Unclassified | 858 |
| 116 | Ga0070713_100928769 | 3300005436 | Bacteria | 837 |
| 117 | Ga0070713_101557069 | 3300005436 | Bacteria | 641 |
| 118 | Ga0070710_10002186 | 3300005437 | Bacteria | 9234 |
| 119 | Ga0070710_10003232 | 3300005437 | Bacteria | 7717 |
| 120 | Ga0070710_10026286 | 3300005437 | Bacteria | 3091 |
| 121 | Ga0070710_10069495 | 3300005437 | Bacteria | 2026 |
| 122 | Ga0070710_10128625 | 3300005437 | Bacteria | 1541 |
| 123 | Ga0070710_10135280 | 3300005437 | Bacteria | 1506 |
| 124 | Ga0070710_10146747 | 3300005437 | Unclassified | 1452 |
| 125 | Ga0070710_10232187 | 3300005437 | Bacteria | 1178 |
| 126 | Ga0070710_10266914 | 3300005437 | Bacteria | 1105 |
| 127 | Ga0070710_10272911 | 3300005437 | Bacteria | 1094 |
| 128 | Ga0070710_10294791 | 3300005437 | Bacteria | 1057 |
| 129 | Ga0070710_11386341 | 3300005437 | Bacteria | 525 |
| 130 | Ga0070711_100009327 | 3300005439 | Bacteria | 6039 |
| 131 | Ga0070711_100010966 | 3300005439 | Bacteria | 5617 |
| 132 | Ga0070711_100017065 | 3300005439 | Bacteria | 4618 |
| 133 | Ga0070711_100019269 | 3300005439 | Bacteria | 4376 |
| 134 | Ga0070711_100057333 | 3300005439 | Bacteria | 2697 |
| 135 | Ga0070711_100117781 | 3300005439 | Bacteria | 1959 |
| 136 | Ga0070711_100140960 | 3300005439 | Bacteria | 1808 |
| 137 | Ga0070711_100229625 | 3300005439 | Bacteria | 1446 |
| 138 | Ga0070711_100256564 | 3300005439 | Unclassified | 1374 |
| 139 | Ga0070711_100350328 | 3300005439 | Bacteria | 1187 |
| 140 | Ga0070711_100619474 | 3300005439 | Unclassified | 904 |
| 141 | Ga0070711_100728634 | 3300005439 | Unclassified | 836 |
| 142 | Ga0070711_100846385 | 3300005439 | Unclassified | 778 |
| 143 | Ga0070711_101576170 | 3300005439 | Bacteria | 574 |
| 144 | Ga0070711_101828452 | 3300005439 | Bacteria | 533 |
| 145 | Ga0070705_100042306 | 3300005440 | Bacteria | 2604 |
| 146 | Ga0070705_100053930 | 3300005440 | Bacteria | 2356 |
| 147 | Ga0070705_100182225 | 3300005440 | Bacteria | 1424 |
| 148 | Ga0070705_100660111 | 3300005440 | Bacteria | 817 |
| 149 | Ga0070705_101217671 | 3300005440 | Bacteria | 621 |
| 150 | Ga0070700_100013534 | 3300005441 | Bacteria | 4583 |
| 151 | Ga0070700_100063331 | 3300005441 | Unclassified | 2339 |
| 152 | Ga0070700_100081369 | 3300005441 | Bacteria | 2092 |
| 153 | Ga0070700_100343350 | 3300005441 | Bacteria | 1104 |
| 154 | Ga0070694_100029171 | 3300005444 | Bacteria | 3599 |
| 155 | Ga0070694_100117259 | 3300005444 | Bacteria | 1906 |
| 156 | Ga0070708_100161848 | 3300005445 | Bacteria | 2086 |
| 157 | Ga0070708_100229508 | 3300005445 | Bacteria | 1742 |
| 158 | Ga0070708_100259477 | 3300005445 | Bacteria | 1633 |
| 159 | Ga0070708_100468533 | 3300005445 | Bacteria | 1188 |
| 160 | Ga0070708_100745116 | 3300005445 | Bacteria | 921 |
| 161 | Ga0070708_100799236 | 3300005445 | Bacteria | 887 |
| 162 | Ga0070708_101157604 | 3300005445 | Bacteria | 724 |
| 163 | Ga0070663_100011604 | 3300005455 | Bacteria | 5538 |
| 164 | Ga0070663_100014065 | 3300005455 | Bacteria | 5127 |
| 165 | Ga0070663_100457016 | 3300005455 | Unclassified | 1054 |
| 166 | Ga0070678_100002952 | 3300005456 | Bacteria | 9428 |
| 167 | Ga0070678_100490789 | 3300005456 | Unclassified | 1082 |
| 168 | Ga0070678_100958821 | 3300005456 | Bacteria | 784 |
| 169 | Ga0070662_100005844 | 3300005457 | Bacteria | 7896 |
| 170 | Ga0070662_100358135 | 3300005457 | Bacteria | 1197 |
| 171 | Ga0070662_100842272 | 3300005457 | Bacteria | 781 |
| 172 | Ga0070681_10025226 | 3300005458 | Bacteria | 5979 |
| 173 | Ga0070681_10403536 | 3300005458 | Unclassified | 1278 |
| 174 | Ga0070681_10537408 | 3300005458 | Unclassified | 1082 |
| 175 | Ga0070681_11066418 | 3300005458 | Bacteria | 728 |
| 176 | Ga0070681_11490316 | 3300005458 | Unclassified | 601 |
| 177 | Ga0070681_11555670 | 3300005458 | Unclassified | 586 |
| 178 | Ga0070685_10065843 | 3300005466 | Bacteria | 2133 |
| 179 | Ga0070685_10066797 | 3300005466 | Bacteria | 2120 |
| 180 | Ga0070685_10757204 | 3300005466 | Unclassified | 713 |
| 181 | Ga0070685_10795467 | 3300005466 | Bacteria | 697 |
| 182 | Ga0070706_100007069 | 3300005467 | Bacteria | 10569 |
| 183 | Ga0070706_100051626 | 3300005467 | Bacteria | 3795 |
| 184 | Ga0070706_100220625 | 3300005467 | Unclassified | 1770 |
| 185 | Ga0070706_100304365 | 3300005467 | Bacteria | 1487 |
| 186 | Ga0070706_100387094 | 3300005467 | Bacteria | 1302 |
| 187 | Ga0070706_100431792 | 3300005467 | Bacteria | 1226 |
| 188 | Ga0070706_100470249 | 3300005467 | Bacteria | 1170 |
| 189 | Ga0070706_100663340 | 3300005467 | Unclassified | 968 |
| 190 | Ga0070706_101210475 | 3300005467 | Bacteria | 694 |
| 191 | Ga0070707_100248267 | 3300005468 | Unclassified | 1732 |
| 192 | Ga0070707_100537758 | 3300005468 | Bacteria | 1131 |
| 193 | Ga0070707_100554360 | 3300005468 | Bacteria | 1112 |
| 194 | Ga0070707_100670160 | 3300005468 | Bacteria | 1000 |
| 195 | Ga0070707_100962570 | 3300005468 | Bacteria | 819 |
| 196 | Ga0070707_101497343 | 3300005468 | Unclassified | 642 |
| 197 | Ga0070698_100006532 | 3300005471 | Bacteria | 12644 |
| 198 | Ga0070698_100012141 | 3300005471 | Bacteria | 9128 |
| 199 | Ga0070698_100035173 | 3300005471 | Bacteria | 5180 |
| 200 | Ga0070698_100086786 | 3300005471 | Bacteria | 3115 |
| 201 | Ga0070698_100171037 | 3300005471 | Bacteria | 2114 |
| 202 | Ga0070698_100330758 | 3300005471 | Bacteria | 1455 |
| 203 | Ga0070698_100743364 | 3300005471 | Bacteria | 924 |
| 204 | Ga0070698_100978814 | 3300005471 | Unclassified | 793 |
| 205 | Ga0070699_100014964 | 3300005518 | Bacteria | 6667 |
| 206 | Ga0070699_100081537 | 3300005518 | Bacteria | 2820 |
| 207 | Ga0070699_101376775 | 3300005518 | Unclassified | 647 |
| 208 | Ga0070699_101506262 | 3300005518 | Bacteria | 617 |
| 209 | Ga0070679_100009959 | 3300005530 | Bacteria | 8996 |
| 210 | Ga0070679_100366858 | 3300005530 | Bacteria | 1387 |
| 211 | Ga0070679_101678028 | 3300005530 | Archaea | 583 |
| 212 | Ga0070684_100023630 | 3300005535 | Bacteria | 5146 |
| 213 | Ga0070684_100108307 | 3300005535 | Bacteria | 2489 |
| 214 | Ga0070684_100227648 | 3300005535 | Bacteria | 1702 |
| 215 | Ga0070684_100436552 | 3300005535 | Unclassified | 1209 |
| 216 | Ga0070684_100634201 | 3300005535 | Unclassified | 994 |
| 217 | Ga0070697_100051291 | 3300005536 | Bacteria | 3352 |
| 218 | Ga0070697_100153053 | 3300005536 | Bacteria | 1945 |
| 219 | Ga0070697_100200586 | 3300005536 | Bacteria | 1696 |
| 220 | Ga0070697_100233017 | 3300005536 | Bacteria | 1571 |
| 221 | Ga0070697_101027074 | 3300005536 | Bacteria | 733 |
| 222 | Ga0068853_100071107 | 3300005539 | Bacteria | 3029 |
| 223 | Ga0070672_100152249 | 3300005543 | Bacteria | 1914 |
| 224 | Ga0070672_100286650 | 3300005543 | Bacteria | 1393 |
| 225 | Ga0070686_100120300 | 3300005544 | Bacteria | 1802 |
| 226 | Ga0070686_100794195 | 3300005544 | Unclassified | 762 |
| 227 | Ga0070695_100094119 | 3300005545 | Bacteria | 2006 |
| 228 | Ga0070695_100128025 | 3300005545 | Bacteria | 1746 |
| 229 | Ga0070696_100010729 | 3300005546 | Bacteria | 6137 |
| 230 | Ga0070696_100265708 | 3300005546 | Bacteria | 1303 |
| 231 | Ga0070696_100426790 | 3300005546 | Bacteria | 1042 |
| 232 | Ga0070696_101923313 | 3300005546 | Bacteria | 513 |
| 233 | Ga0070693_100009979 | 3300005547 | Bacteria | 4740 |
| 234 | Ga0070693_100056614 | 3300005547 | Bacteria | 2263 |
| 235 | Ga0070693_100190523 | 3300005547 | Bacteria | 1326 |
| 236 | Ga0070693_101265155 | 3300005547 | Bacteria | 569 |
| 237 | Ga0070693_101334762 | 3300005547 | Unclassified | 555 |
| 238 | Ga0070665_100044963 | 3300005548 | Bacteria | 4432 |
| 239 | Ga0070665_100390981 | 3300005548 | Bacteria | 1398 |
| 240 | Ga0070665_101705720 | 3300005548 | Unclassified | 637 |
| 241 | Ga0070665_102468634 | 3300005548 | Bacteria | 521 |
| 242 | Ga0070704_100937873 | 3300005549 | Bacteria | 780 |
| 243 | Ga0068855_100041202 | 3300005563 | Bacteria | 5474 |
| 244 | Ga0068855_100215844 | 3300005563 | Bacteria | 2153 |
| 245 | Ga0070664_100004428 | 3300005564 | Bacteria | 11284 |
| 246 | Ga0070664_100150382 | 3300005564 | Unclassified | 2055 |
| 247 | Ga0070664_100474787 | 3300005564 | Bacteria | 1150 |
| 248 | Ga0070664_101055129 | 3300005564 | Unclassified | 765 |
| 249 | Ga0068857_100079839 | 3300005577 | Bacteria | 2921 |
| 250 | Ga0068857_100112081 | 3300005577 | Bacteria | 2453 |
| 251 | Ga0068857_100678969 | 3300005577 | Bacteria | 977 |
| 252 | Ga0068857_101696385 | 3300005577 | Bacteria | 617 |
| 253 | Ga0068854_100075280 | 3300005578 | Bacteria | 2478 |
| 254 | Ga0068854_100228365 | 3300005578 | Bacteria | 1476 |
| 255 | Ga0068854_100247688 | 3300005578 | Bacteria | 1421 |
| 256 | Ga0068856_100012369 | 3300005614 | Bacteria | 8267 |
| 257 | Ga0068856_100023480 | 3300005614 | Bacteria | 5996 |
| 258 | Ga0068856_100029778 | 3300005614 | Bacteria | 5334 |
| 259 | Ga0068856_100047243 | 3300005614 | Bacteria | 4241 |
| 260 | Ga0068856_100078319 | 3300005614 | Bacteria | 3277 |
| 261 | Ga0068856_100101668 | 3300005614 | Bacteria | 2867 |
| 262 | Ga0068856_100119354 | 3300005614 | Bacteria | 2638 |
| 263 | Ga0068856_100777229 | 3300005614 | Bacteria | 977 |
| 264 | Ga0068856_101316920 | 3300005614 | Unclassified | 737 |
| 265 | Ga0068856_101394552 | 3300005614 | Bacteria | 715 |
| 266 | Ga0070702_100005256 | 3300005615 | Bacteria | 6007 |
| 267 | Ga0070702_100053012 | 3300005615 | Bacteria | 2328 |
| 268 | Ga0070702_100109299 | 3300005615 | Bacteria | 1711 |
| 269 | Ga0070702_100725855 | 3300005615 | Unclassified | 760 |
| 270 | Ga0068852_100074918 | 3300005616 | Bacteria | 2983 |
| 271 | Ga0068852_100082574 | 3300005616 | Bacteria | 2856 |
| 272 | Ga0068852_100150961 | 3300005616 | Bacteria | 2160 |
| 273 | Ga0068852_100160595 | 3300005616 | Bacteria | 2098 |
| 274 | Ga0068852_100239202 | 3300005616 | Bacteria | 1734 |
| 275 | Ga0068859_100094507 | 3300005617 | Bacteria | 3042 |
| 276 | Ga0068859_100556351 | 3300005617 | Bacteria | 1241 |
| 277 | Ga0068859_101284859 | 3300005617 | Bacteria | 806 |
| 278 | Ga0068864_100252602 | 3300005618 | Bacteria | 1637 |
| 279 | Ga0068864_100527028 | 3300005618 | Bacteria | 1140 |
| 280 | Ga0068864_100758132 | 3300005618 | Unclassified | 951 |
| 281 | Ga0068866_10045697 | 3300005718 | Unclassified | 2198 |
| 282 | Ga0068866_10414156 | 3300005718 | Bacteria | 872 |
| 283 | Ga0068861_100050540 | 3300005719 | Bacteria | 3153 |
| 284 | Ga0068861_100068075 | 3300005719 | Bacteria | 2750 |
| 285 | Ga0068861_100268666 | 3300005719 | Bacteria | 1464 |
| 286 | Ga0068861_100366174 | 3300005719 | Bacteria | 1269 |
| 287 | Ga0068851_10130227 | 3300005834 | Bacteria | 1360 |
| 288 | Ga0068851_10807208 | 3300005834 | Bacteria | 583 |
| 289 | Ga0068870_10024554 | 3300005840 | Bacteria | 2983 |
| 290 | Ga0068870_10428750 | 3300005840 | Unclassified | 867 |
| 291 | Ga0068863_100015437 | 3300005841 | Bacteria | 7342 |
| 292 | Ga0068863_100147909 | 3300005841 | Bacteria | 2247 |
| 293 | Ga0068863_100326583 | 3300005841 | Bacteria | 1491 |
| 294 | Ga0068863_101580532 | 3300005841 | Bacteria | 665 |
| 295 | Ga0068863_101993372 | 3300005841 | Unclassified | 590 |
| 296 | Ga0068858_100030337 | 3300005842 | Bacteria | 5020 |
| 297 | Ga0068858_100122867 | 3300005842 | Bacteria | 2429 |
| 298 | Ga0068858_100212549 | 3300005842 | Bacteria | 1830 |
| 299 | Ga0068858_100582309 | 3300005842 | Bacteria | 1085 |
| 300 | Ga0068858_100822571 | 3300005842 | Bacteria | 906 |
| 301 | Ga0068858_101039385 | 3300005842 | Bacteria | 803 |
| 302 | Ga0068860_100107786 | 3300005843 | Bacteria | 2662 |
| 303 | Ga0068860_100173307 | 3300005843 | Bacteria | 2084 |
| 304 | Ga0068860_100177043 | 3300005843 | Bacteria | 2061 |
| 305 | Ga0068860_100361236 | 3300005843 | Bacteria | 1431 |
| 306 | Ga0068860_100384438 | 3300005843 | Bacteria | 1386 |
| 307 | Ga0068860_101098703 | 3300005843 | Bacteria | 814 |
| 308 | Ga0068860_101391162 | 3300005843 | Unclassified | 723 |
| 309 | Ga0068862_100016710 | 3300005844 | Bacteria | 6110 |
| 310 | Ga0068862_100338935 | 3300005844 | Unclassified | 1392 |
| 311 | Ga0068862_101302387 | 3300005844 | Bacteria | 728 |
| 312 | Ga0068862_101645609 | 3300005844 | Bacteria | 649 |
| 313 | Ga0081455_10069071 | 3300005937 | Bacteria | 2939 |
| 314 | Ga0081455_10106215 | 3300005937 | Bacteria | 2241 |
| 315 | Ga0081540_1000104 | 3300005983 | Bacteria | 90590 |
| 316 | Ga0081540_1000407 | 3300005983 | Bacteria | 42401 |
| 317 | Ga0081540_1012627 | 3300005983 | Bacteria | 5543 |
| 318 | Ga0070717_10003754 | 3300006028 | Bacteria | 10904 |
| 319 | Ga0070717_10017574 | 3300006028 | Bacteria | 5569 |
| 320 | Ga0070717_10017727 | 3300006028 | Bacteria | 5546 |
| 321 | Ga0070717_10034347 | 3300006028 | Bacteria | 4099 |
| 322 | Ga0070717_10044436 | 3300006028 | Bacteria | 3627 |
| 323 | Ga0070717_10046989 | 3300006028 | Bacteria | 3535 |
| 324 | Ga0070717_10071397 | 3300006028 | Bacteria | 2896 |
| 325 | Ga0070717_10098167 | 3300006028 | Bacteria | 2483 |
| 326 | Ga0070717_10261008 | 3300006028 | Bacteria | 1533 |
| 327 | Ga0070717_10354422 | 3300006028 | Bacteria | 1312 |
| 328 | Ga0070717_10405952 | 3300006028 | Bacteria | 1224 |
| 329 | Ga0070717_10409148 | 3300006028 | Bacteria | 1219 |
| 330 | Ga0070717_10496758 | 3300006028 | Bacteria | 1102 |
| 331 | Ga0070717_10797414 | 3300006028 | Bacteria | 859 |
| 332 | Ga0070717_11350236 | 3300006028 | Bacteria | 648 |
| 333 | Ga0075365_10009485 | 3300006038 | Bacteria | 5598 |
| 334 | Ga0075365_10018158 | 3300006038 | Unclassified | 4319 |
| 335 | Ga0075365_10330506 | 3300006038 | Bacteria | 1074 |
| 336 | Ga0075364_10202935 | 3300006051 | Unclassified | 1344 |
| 337 | Ga0075364_10479967 | 3300006051 | Bacteria | 850 |
| 338 | Ga0075432_10044836 | 3300006058 | Bacteria | 1551 |
| 339 | Ga0070715_10006081 | 3300006163 | Bacteria | 4078 |
| 340 | Ga0070715_10023396 | 3300006163 | Bacteria | 2420 |
| 341 | Ga0070715_10041772 | 3300006163 | Bacteria | 1923 |
| 342 | Ga0070715_10053107 | 3300006163 | Bacteria | 1750 |
| 343 | Ga0070715_10473368 | 3300006163 | Unclassified | 712 |
| 344 | Ga0070716_100007446 | 3300006173 | Bacteria | 5393 |
| 345 | Ga0070716_100016324 | 3300006173 | Bacteria | 3829 |
| 346 | Ga0070716_100018119 | 3300006173 | Bacteria | 3664 |
| 347 | Ga0070716_100040797 | 3300006173 | Bacteria | 2584 |
| 348 | Ga0070716_100062447 | 3300006173 | Bacteria | 2160 |
| 349 | Ga0070716_100109143 | 3300006173 | Bacteria | 1711 |
| 350 | Ga0070716_100115814 | 3300006173 | Unclassified | 1669 |
| 351 | Ga0070716_100187595 | 3300006173 | Bacteria | 1363 |
| 352 | Ga0070716_100309992 | 3300006173 | Bacteria | 1101 |
| 353 | Ga0070716_100460198 | 3300006173 | Unclassified | 929 |
| 354 | Ga0070716_100782992 | 3300006173 | Bacteria | 737 |
| 355 | Ga0070716_101002155 | 3300006173 | Bacteria | 660 |
| 356 | Ga0070716_101050077 | 3300006173 | Unclassified | 647 |
| 357 | Ga0070716_101163781 | 3300006173 | Bacteria | 618 |
| 358 | Ga0070712_100017733 | 3300006175 | Bacteria | 4611 |
| 359 | Ga0070712_100022086 | 3300006175 | Bacteria | 4187 |
| 360 | Ga0070712_100023859 | 3300006175 | Bacteria | 4045 |
| 361 | Ga0070712_100026399 | 3300006175 | Bacteria | 3868 |
| 362 | Ga0070712_100037188 | 3300006175 | Bacteria | 3316 |
| 363 | Ga0070712_100041079 | 3300006175 | Unclassified | 3174 |
| 364 | Ga0070712_100043229 | 3300006175 | Bacteria | 3101 |
| 365 | Ga0070712_100049911 | 3300006175 | Bacteria | 2908 |
| 366 | Ga0070712_100062953 | 3300006175 | Bacteria | 2624 |
| 367 | Ga0070712_100108982 | 3300006175 | Unclassified | 2063 |
| 368 | Ga0070712_100114035 | 3300006175 | Bacteria | 2022 |
| 369 | Ga0070712_100136347 | 3300006175 | Unclassified | 1866 |
| 370 | Ga0070712_100175645 | 3300006175 | Bacteria | 1665 |
| 371 | Ga0070712_100241222 | 3300006175 | Bacteria | 1440 |
| 372 | Ga0070712_100278841 | 3300006175 | Bacteria | 1345 |
| 373 | Ga0070712_100488612 | 3300006175 | Bacteria | 1030 |
| 374 | Ga0070712_101245468 | 3300006175 | Unclassified | 648 |
| 375 | Ga0070712_101650423 | 3300006175 | Unclassified | 561 |
| 376 | Ga0097621_100007234 | 3300006237 | Bacteria | 7924 |
| 377 | Ga0097621_100089473 | 3300006237 | Bacteria | 2574 |
| 378 | Ga0097621_100168724 | 3300006237 | Bacteria | 1885 |
| 379 | Ga0097621_101184688 | 3300006237 | Bacteria | 719 |
| 380 | Ga0068871_100026210 | 3300006358 | Bacteria | 4546 |
| 381 | Ga0068871_100076034 | 3300006358 | Bacteria | 2773 |
| 382 | Ga0068871_100738797 | 3300006358 | Bacteria | 904 |
| 383 | Ga0068871_101080999 | 3300006358 | Bacteria | 749 |
| 384 | Ga0068871_101204619 | 3300006358 | Bacteria | 710 |
| 385 | Ga0068871_101914574 | 3300006358 | Unclassified | 564 |
| 386 | Ga0075428_100178551 | 3300006844 | Bacteria | 2299 |
| 387 | Ga0075428_100278491 | 3300006844 | Bacteria | 1800 |
| 388 | Ga0075428_101385565 | 3300006844 | Archaea | 738 |
| 389 | Ga0075430_100232570 | 3300006846 | Bacteria | 1528 |
| 390 | Ga0075430_100413637 | 3300006846 | Bacteria | 1113 |
| 391 | Ga0075431_100006776 | 3300006847 | Bacteria | 11373 |
| 392 | Ga0075433_10018103 | 3300006852 | Bacteria | 5849 |
| 393 | Ga0075433_10019630 | 3300006852 | Bacteria | 5636 |
| 394 | Ga0075433_10027468 | 3300006852 | Bacteria | 4828 |
| 395 | Ga0075433_10104447 | 3300006852 | Bacteria | 2510 |
| 396 | Ga0075433_10154025 | 3300006852 | Bacteria | 2045 |
| 397 | Ga0075433_10716918 | 3300006852 | Bacteria | 876 |
| 398 | Ga0075434_100004695 | 3300006871 | Bacteria | 12345 |
| 399 | Ga0075434_100007730 | 3300006871 | Bacteria | 9954 |
| 400 | Ga0075434_100071965 | 3300006871 | Bacteria | 3449 |
| 401 | Ga0075434_100112471 | 3300006871 | Bacteria | 2734 |
| 402 | Ga0075434_101305058 | 3300006871 | Bacteria | 737 |
| 403 | Ga0075429_100361982 | 3300006880 | Bacteria | 1270 |
| 404 | Ga0068865_100033373 | 3300006881 | Bacteria | 3446 |
| 405 | Ga0068865_100037607 | 3300006881 | Bacteria | 3269 |
| 406 | Ga0068865_100133593 | 3300006881 | Bacteria | 1862 |
| 407 | Ga0068865_100628633 | 3300006881 | Bacteria | 910 |
| 408 | Ga0075436_100004471 | 3300006914 | Bacteria | 9590 |
| 409 | Ga0075436_100008644 | 3300006914 | Bacteria | 6961 |
| 410 | Ga0075436_100208571 | 3300006914 | Bacteria | 1385 |
| 411 | Ga0075436_100363350 | 3300006914 | Bacteria | 1045 |
| 412 | Ga0075436_101151888 | 3300006914 | Bacteria | 584 |
| 413 | Ga0097620_100094509 | 3300006931 | Bacteria | 3042 |
| 414 | Ga0097620_100556342 | 3300006931 | Bacteria | 1241 |
| 415 | Ga0097620_101284819 | 3300006931 | Bacteria | 806 |
| 416 | Ga0075435_100004634 | 3300007076 | Bacteria | 9470 |
| 417 | Ga0075435_100016766 | 3300007076 | Bacteria | 5527 |
| 418 | Ga0075435_100023872 | 3300007076 | Bacteria | 4737 |
| 419 | Ga0075435_100046118 | 3300007076 | Bacteria | 3495 |
| 420 | Ga0075435_100070273 | 3300007076 | Bacteria | 2857 |
| 421 | Ga0075435_100073543 | 3300007076 | Bacteria | 2794 |
| 422 | Ga0075435_100401754 | 3300007076 | Bacteria | 1178 |
| 423 | Ga0075435_100456828 | 3300007076 | Unclassified | 1102 |
| 424 | Ga0075435_100791147 | 3300007076 | Bacteria | 826 |
| 425 | Ga0099795_10163173 | 3300007788 | Unclassified | 921 |
| 426 | Ga0105240_10144999 | 3300009093 | Bacteria | 2834 |
| 427 | Ga0105240_10373511 | 3300009093 | Bacteria | 1612 |
| 428 | Ga0111539_10012913 | 3300009094 | Bacteria | 10451 |
| 429 | Ga0111539_10018741 | 3300009094 | Bacteria | 8567 |
| 430 | Ga0111539_10180844 | 3300009094 | Bacteria | 2463 |
| 431 | Ga0111539_10194349 | 3300009094 | Unclassified | 2367 |
| 432 | Ga0105245_10011721 | 3300009098 | Bacteria | 7628 |
| 433 | Ga0105245_10017175 | 3300009098 | Bacteria | 6312 |
| 434 | Ga0105245_10019479 | 3300009098 | Bacteria | 5945 |
| 435 | Ga0105245_10043032 | 3300009098 | Bacteria | 4029 |
| 436 | Ga0105245_10626082 | 3300009098 | Bacteria | 1105 |
| 437 | Ga0105245_10776567 | 3300009098 | Bacteria | 995 |
| 438 | Ga0105245_11445754 | 3300009098 | Bacteria | 738 |
| 439 | Ga0105247_10009226 | 3300009101 | Bacteria | 5998 |
| 440 | Ga0105247_10055335 | 3300009101 | Bacteria | 2448 |
| 441 | Ga0105247_10060652 | 3300009101 | Bacteria | 2344 |
| 442 | Ga0105247_10092348 | 3300009101 | Unclassified | 1923 |
| 443 | Ga0105247_10110257 | 3300009101 | Bacteria | 1770 |
| 444 | Ga0105247_10746219 | 3300009101 | Unclassified | 741 |
| 445 | Ga0105247_11164788 | 3300009101 | Bacteria | 612 |
| 446 | Ga0105247_11832378 | 3300009101 | Unclassified | 506 |
| 447 | Ga0114129_10319057 | 3300009147 | Bacteria | 2066 |
| 448 | Ga0114129_10320804 | 3300009147 | Bacteria | 2059 |
| 449 | Ga0114129_10425534 | 3300009147 | Bacteria | 1746 |
| 450 | Ga0114129_10481836 | 3300009147 | Bacteria | 1623 |
| 451 | Ga0114129_10797926 | 3300009147 | Bacteria | 1205 |
| 452 | Ga0114129_11848543 | 3300009147 | Bacteria | 733 |
| 453 | Ga0105243_10186551 | 3300009148 | Bacteria | 1808 |
| 454 | Ga0105243_10235737 | 3300009148 | Bacteria | 1626 |
| 455 | Ga0105241_10003397 | 3300009174 | Bacteria | 11848 |
| 456 | Ga0105241_10154797 | 3300009174 | Bacteria | 1879 |
| 457 | Ga0105241_10259734 | 3300009174 | Bacteria | 1476 |
| 458 | Ga0105241_10379678 | 3300009174 | Unclassified | 1234 |
| 459 | Ga0105241_10696150 | 3300009174 | Bacteria | 927 |
| 460 | Ga0105241_11108327 | 3300009174 | Unclassified | 746 |
| 461 | Ga0105241_12413606 | 3300009174 | Unclassified | 525 |
| 462 | Ga0105242_10181606 | 3300009176 | Bacteria | 1857 |
| 463 | Ga0105242_10301929 | 3300009176 | Bacteria | 1462 |
| 464 | Ga0105242_10520947 | 3300009176 | Bacteria | 1134 |
| 465 | Ga0105242_11060357 | 3300009176 | Bacteria | 822 |
| 466 | Ga0105248_10044768 | 3300009177 | Bacteria | 4964 |
| 467 | Ga0105248_10249885 | 3300009177 | Bacteria | 1996 |
| 468 | Ga0105248_10440794 | 3300009177 | Unclassified | 1467 |
| 469 | Ga0105248_11798426 | 3300009177 | Bacteria | 695 |
| 470 | Ga0105237_10396873 | 3300009545 | Bacteria | 1384 |
| 471 | Ga0105237_10953618 | 3300009545 | Bacteria | 865 |
| 472 | Ga0105237_12665792 | 3300009545 | Bacteria | 511 |
| 473 | Ga0105238_10081070 | 3300009551 | Bacteria | 3234 |
| 474 | Ga0105238_10683832 | 3300009551 | Bacteria | 1038 |
| 475 | Ga0105238_10870749 | 3300009551 | Bacteria | 918 |
| 476 | Ga0105249_10202075 | 3300009553 | Bacteria | 1945 |
| 477 | Ga0105249_10299234 | 3300009553 | Bacteria | 1613 |
| 478 | Ga0105249_11092202 | 3300009553 | Bacteria | 868 |
| 479 | Ga0105249_11765475 | 3300009553 | Bacteria | 691 |
| 480 | Ga0105249_12855915 | 3300009553 | Bacteria | 554 |
| 481 | Ga0099796_10003244 | 3300010159 | Bacteria | 3738 |
| 482 | Ga0105239_10086880 | 3300010375 | Bacteria | 3447 |
| 483 | Ga0105239_10203853 | 3300010375 | Bacteria | 2216 |
| 484 | Ga0105239_10239976 | 3300010375 | Unclassified | 2034 |
| 485 | Ga0105239_10657603 | 3300010375 | Bacteria | 1197 |
| 486 | Ga0105246_10004636 | 3300011119 | Bacteria | 8364 |
| 487 | Ga0105246_10246838 | 3300011119 | Bacteria | 1414 |
| 488 | Ga0105246_10334068 | 3300011119 | Unclassified | 1236 |
| 489 | Ga0105246_11397550 | 3300011119 | Unclassified | 653 |
| 490 | Ga0157340_1019153 | 3300012473 | Bacteria | 563 |
| 491 | Ga0157346_1008823 | 3300012480 | Bacteria | 702 |
| 492 | Ga0157343_1012339 | 3300012488 | Bacteria | 675 |
| 493 | Ga0154012_109650 | 3300013059 | Unclassified | 558 |
| 494 | Ga0157373_10058229 | 3300013100 | Bacteria | 2740 |
| 495 | Ga0157373_10073191 | 3300013100 | Bacteria | 2418 |
| 496 | Ga0157371_10066452 | 3300013102 | Bacteria | 2553 |
| 497 | Ga0157371_10212903 | 3300013102 | Bacteria | 1387 |
| 498 | Ga0157371_10517304 | 3300013102 | Bacteria | 882 |
| 499 | Ga0157371_10612433 | 3300013102 | Bacteria | 811 |
| 500 | Ga0157370_10020387 | 3300013104 | Bacteria | 6622 |
| 501 | Ga0157370_10107173 | 3300013104 | Bacteria | 2614 |
| 502 | Ga0157370_11203259 | 3300013104 | Bacteria | 683 |
| 503 | Ga0157369_10053400 | 3300013105 | Bacteria | 4369 |
| 504 | Ga0157369_10802442 | 3300013105 | Unclassified | 967 |
| 505 | Ga0157369_11057129 | 3300013105 | Unclassified | 830 |
| 506 | Ga0157369_11069493 | 3300013105 | Bacteria | 825 |
| 507 | Ga0157369_11265449 | 3300013105 | Bacteria | 752 |
| 508 | Ga0157374_10003370 | 3300013296 | Bacteria | 13422 |
| 509 | Ga0157374_10566076 | 3300013296 | Bacteria | 1145 |
| 510 | Ga0163162_10125876 | 3300013306 | Bacteria | 2668 |
| 511 | Ga0163162_10216040 | 3300013306 | Bacteria | 2048 |
| 512 | Ga0163162_10552114 | 3300013306 | Bacteria | 1280 |
| 513 | Ga0163162_11830778 | 3300013306 | Unclassified | 694 |
| 514 | Ga0157372_10031567 | 3300013307 | Bacteria | 5800 |
| 515 | Ga0157372_10184675 | 3300013307 | Unclassified | 2415 |
| 516 | Ga0157372_10338065 | 3300013307 | Bacteria | 1754 |
| 517 | Ga0157372_10419262 | 3300013307 | Bacteria | 1560 |
| 518 | Ga0157372_10626520 | 3300013307 | Unclassified | 1253 |
| 519 | Ga0157372_10628438 | 3300013307 | Unclassified | 1251 |
| 520 | Ga0157372_11067061 | 3300013307 | Bacteria | 935 |
| 521 | Ga0157372_11310973 | 3300013307 | Bacteria | 835 |
| 522 | Ga0157372_11411541 | 3300013307 | Unclassified | 803 |
| 523 | Ga0157372_11783205 | 3300013307 | Bacteria | 708 |
| 524 | Ga0157375_10234748 | 3300013308 | Bacteria | 1993 |
| 525 | Ga0157375_10387373 | 3300013308 | Bacteria | 1564 |
| 526 | Ga0157375_11074882 | 3300013308 | Unclassified | 941 |
| 527 | Ga0157375_11117211 | 3300013308 | Bacteria | 923 |
| 528 | Ga0157375_12580062 | 3300013308 | Bacteria | 607 |
| 529 | Ga0163163_10116651 | 3300014325 | Bacteria | 2701 |
| 530 | Ga0163163_10151441 | 3300014325 | Bacteria | 2363 |
| 531 | Ga0163163_10233622 | 3300014325 | Bacteria | 1888 |
| 532 | Ga0163163_10469917 | 3300014325 | Unclassified | 1318 |
| 533 | Ga0163163_10944767 | 3300014325 | Bacteria | 925 |
| 534 | Ga0163163_11451896 | 3300014325 | Bacteria | 747 |
| 535 | Ga0157380_10269619 | 3300014326 | Bacteria | 1551 |
| 536 | Ga0157380_10624806 | 3300014326 | Bacteria | 1070 |
| 537 | Ga0182008_10370965 | 3300014497 | Unclassified | 763 |
| 538 | Ga0157377_10002762 | 3300014745 | Bacteria | 7817 |
| 539 | Ga0157377_10046848 | 3300014745 | Bacteria | 2420 |
| 540 | Ga0157377_10173808 | 3300014745 | Bacteria | 1349 |
| 541 | Ga0157379_10012062 | 3300014968 | Bacteria | 7551 |
| 542 | Ga0157379_10187511 | 3300014968 | Bacteria | 1869 |
| 543 | Ga0157379_10251809 | 3300014968 | Bacteria | 1603 |
| 544 | Ga0157379_10483919 | 3300014968 | Unclassified | 1146 |
| 545 | Ga0157376_10251799 | 3300014969 | Bacteria | 1650 |
| 546 | Ga0157376_10443643 | 3300014969 | Unclassified | 1264 |
| 547 | Ga0157376_10531030 | 3300014969 | Bacteria | 1161 |
| 548 | Ga0157376_10731319 | 3300014969 | Unclassified | 997 |
| 549 | Ga0157376_11238749 | 3300014969 | Bacteria | 775 |
| 550 | Ga0157376_12054895 | 3300014969 | Bacteria | 609 |
| 551 | Ga0163161_10613258 | 3300017792 | Bacteria | 898 |
| 552 | Ga0197907_10046920 | 3300020069 | Bacteria | 985 |
| 553 | Ga0197907_10460177 | 3300020069 | Bacteria | 1010 |
| 554 | Ga0197907_10775795 | 3300020069 | Unclassified | 572 |
| 555 | Ga0206356_10036912 | 3300020070 | Unclassified | 934 |
| 556 | Ga0206349_1901982 | 3300020075 | Bacteria | 2744 |
| 557 | Ga0206351_10347265 | 3300020077 | Unclassified | 687 |
| 558 | Ga0206350_10854846 | 3300020080 | Bacteria | 2114 |
| 559 | Ga0206350_11587344 | 3300020080 | Bacteria | 668 |
| 560 | Ga0206354_10697934 | 3300020081 | Unclassified | 1118 |
| 561 | Ga0206354_10734318 | 3300020081 | Bacteria | 1590 |
| 562 | Ga0206353_10041774 | 3300020082 | Bacteria | 2702 |
| 563 | Ga0154015_1109481 | 3300020610 | Bacteria | 632 |
| 564 | Ga0213876_10695116 | 3300021384 | Bacteria | 541 |
| 565 | Ga0224712_10071118 | 3300022467 | Bacteria | 1413 |
| 566 | Ga0224712_10150220 | 3300022467 | Bacteria | 1032 |
| 567 | Ga0224712_10206935 | 3300022467 | Bacteria | 894 |
| 568 | Ga0224569_110831 | 3300022732 | Bacteria | 642 |
| 569 | Ga0228598_1071943 | 3300024227 | Unclassified | 692 |
| 570 | Ga0228598_1078221 | 3300024227 | Bacteria | 663 |
| 571 | Ga0207656_10144846 | 3300025321 | Bacteria | 1122 |
| 572 | Ga0207656_10163946 | 3300025321 | Bacteria | 1059 |
| 573 | Ga0207653_10001186 | 3300025885 | Bacteria | 8509 |
| 574 | Ga0207653_10064887 | 3300025885 | Unclassified | 1239 |
| 575 | Ga0207653_10096166 | 3300025885 | Bacteria | 1042 |
| 576 | Ga0207653_10226501 | 3300025885 | Bacteria | 711 |
| 577 | Ga0207692_10000949 | 3300025898 | Bacteria | 10525 |
| 578 | Ga0207692_10001835 | 3300025898 | Bacteria | 8067 |
| 579 | Ga0207692_10012234 | 3300025898 | Bacteria | 3680 |
| 580 | Ga0207692_10056246 | 3300025898 | Bacteria | 2017 |
| 581 | Ga0207692_10073885 | 3300025898 | Bacteria | 1805 |
| 582 | Ga0207692_10083361 | 3300025898 | Bacteria | 1715 |
| 583 | Ga0207692_10149007 | 3300025898 | Bacteria | 1338 |
| 584 | Ga0207692_10234060 | 3300025898 | Unclassified | 1094 |
| 585 | Ga0207692_10258215 | 3300025898 | Bacteria | 1046 |
| 586 | Ga0207692_10309035 | 3300025898 | Bacteria | 964 |
| 587 | Ga0207692_10338420 | 3300025898 | Bacteria | 925 |
| 588 | Ga0207642_10179843 | 3300025899 | Unclassified | 1151 |
| 589 | Ga0207642_10648519 | 3300025899 | Bacteria | 661 |
| 590 | Ga0207642_10731704 | 3300025899 | Bacteria | 625 |
| 591 | Ga0207710_10188835 | 3300025900 | Bacteria | 1014 |
| 592 | Ga0207710_10388059 | 3300025900 | Unclassified | 715 |
| 593 | Ga0207710_10487294 | 3300025900 | Bacteria | 639 |
| 594 | Ga0207688_10010890 | 3300025901 | Bacteria | 4947 |
| 595 | Ga0207688_10011318 | 3300025901 | Bacteria | 4857 |
| 596 | Ga0207688_10063565 | 3300025901 | Bacteria | 2082 |
| 597 | Ga0207688_10076341 | 3300025901 | Bacteria | 1908 |
| 598 | Ga0207647_10092435 | 3300025904 | Bacteria | 1804 |
| 599 | Ga0207685_10035667 | 3300025905 | Bacteria | 1817 |
| 600 | Ga0207685_10048434 | 3300025905 | Unclassified | 1628 |
| 601 | Ga0207685_10093219 | 3300025905 | Bacteria | 1273 |
| 602 | Ga0207685_10405012 | 3300025905 | Unclassified | 700 |
| 603 | Ga0207699_10000382 | 3300025906 | Bacteria | 23317 |
| 604 | Ga0207699_10001986 | 3300025906 | Bacteria | 9668 |
| 605 | Ga0207699_10002721 | 3300025906 | Bacteria | 8359 |
| 606 | Ga0207699_10009488 | 3300025906 | Bacteria | 4849 |
| 607 | Ga0207699_10010279 | 3300025906 | Bacteria | 4690 |
| 608 | Ga0207699_10021331 | 3300025906 | Bacteria | 3489 |
| 609 | Ga0207699_10033749 | 3300025906 | Bacteria | 2895 |
| 610 | Ga0207699_10037506 | 3300025906 | Bacteria | 2771 |
| 611 | Ga0207699_10060539 | 3300025906 | Bacteria | 2274 |
| 612 | Ga0207699_10186713 | 3300025906 | Bacteria | 1397 |
| 613 | Ga0207699_10346396 | 3300025906 | Bacteria | 1048 |
| 614 | Ga0207699_10400705 | 3300025906 | Bacteria | 977 |
| 615 | Ga0207699_10475487 | 3300025906 | Unclassified | 899 |
| 616 | Ga0207699_10645687 | 3300025906 | Bacteria | 773 |
| 617 | Ga0207643_10001477 | 3300025908 | Bacteria | 13481 |
| 618 | Ga0207705_10016324 | 3300025909 | Bacteria | 5325 |
| 619 | Ga0207705_10291033 | 3300025909 | Bacteria | 1251 |
| 620 | Ga0207684_10001155 | 3300025910 | Bacteria | 29461 |
| 621 | Ga0207684_10250746 | 3300025910 | Bacteria | 1527 |
| 622 | Ga0207684_10346268 | 3300025910 | Bacteria | 1279 |
| 623 | Ga0207684_10414758 | 3300025910 | Unclassified | 1157 |
| 624 | Ga0207684_10485570 | 3300025910 | Bacteria | 1059 |
| 625 | Ga0207654_10003244 | 3300025911 | Bacteria | 8214 |
| 626 | Ga0207654_10116632 | 3300025911 | Unclassified | 1670 |
| 627 | Ga0207654_10207874 | 3300025911 | Bacteria | 1292 |
| 628 | Ga0207654_10548960 | 3300025911 | Unclassified | 820 |
| 629 | Ga0207654_10700433 | 3300025911 | Bacteria | 728 |
| 630 | Ga0207707_10008747 | 3300025912 | Bacteria | 8788 |
| 631 | Ga0207707_10659819 | 3300025912 | Bacteria | 881 |
| 632 | Ga0207707_11109670 | 3300025912 | Bacteria | 644 |
| 633 | Ga0207671_10214451 | 3300025914 | Unclassified | 1507 |
| 634 | Ga0207693_10003685 | 3300025915 | Bacteria | 13076 |
| 635 | Ga0207693_10003865 | 3300025915 | Bacteria | 12764 |
| 636 | Ga0207693_10004300 | 3300025915 | Bacteria | 12058 |
| 637 | Ga0207693_10006202 | 3300025915 | Bacteria | 9916 |
| 638 | Ga0207693_10009637 | 3300025915 | Bacteria | 7865 |
| 639 | Ga0207693_10012756 | 3300025915 | Bacteria | 6783 |
| 640 | Ga0207693_10039072 | 3300025915 | Bacteria | 3736 |
| 641 | Ga0207693_10070244 | 3300025915 | Bacteria | 2740 |
| 642 | Ga0207693_10081592 | 3300025915 | Bacteria | 2532 |
| 643 | Ga0207693_10082011 | 3300025915 | Bacteria | 2525 |
| 644 | Ga0207693_10121785 | 3300025915 | Bacteria | 2049 |
| 645 | Ga0207693_10124351 | 3300025915 | Bacteria | 2027 |
| 646 | Ga0207693_10189014 | 3300025915 | Bacteria | 1621 |
| 647 | Ga0207693_10207654 | 3300025915 | Bacteria | 1540 |
| 648 | Ga0207693_10239957 | 3300025915 | Bacteria | 1423 |
| 649 | Ga0207693_10804861 | 3300025915 | Unclassified | 724 |
| 650 | Ga0207693_10923304 | 3300025915 | Unclassified | 669 |
| 651 | Ga0207693_11460966 | 3300025915 | Unclassified | 506 |
| 652 | Ga0207663_10007794 | 3300025916 | Bacteria | 5577 |
| 653 | Ga0207663_10012086 | 3300025916 | Bacteria | 4656 |
| 654 | Ga0207663_10019857 | 3300025916 | Bacteria | 3795 |
| 655 | Ga0207663_10022173 | 3300025916 | Bacteria | 3627 |
| 656 | Ga0207663_10022747 | 3300025916 | Bacteria | 3587 |
| 657 | Ga0207663_10110204 | 3300025916 | Bacteria | 1867 |
| 658 | Ga0207663_10232298 | 3300025916 | Bacteria | 1348 |
| 659 | Ga0207663_10250060 | 3300025916 | Bacteria | 1304 |
| 660 | Ga0207663_10268621 | 3300025916 | Bacteria | 1262 |
| 661 | Ga0207663_10396446 | 3300025916 | Bacteria | 1055 |
| 662 | Ga0207663_10751023 | 3300025916 | Unclassified | 775 |
| 663 | Ga0207660_10172425 | 3300025917 | Bacteria | 1675 |
| 664 | Ga0207660_10457936 | 3300025917 | Unclassified | 1032 |
| 665 | Ga0207660_11131482 | 3300025917 | Unclassified | 638 |
| 666 | Ga0207662_10005270 | 3300025918 | Bacteria | 6870 |
| 667 | Ga0207657_10032467 | 3300025919 | Bacteria | 4717 |
| 668 | Ga0207657_10091678 | 3300025919 | Bacteria | 2533 |
| 669 | Ga0207657_10175833 | 3300025919 | Bacteria | 1732 |
| 670 | Ga0207657_10971833 | 3300025919 | Unclassified | 652 |
| 671 | Ga0207652_10255614 | 3300025921 | Bacteria | 1580 |
| 672 | Ga0207652_10376589 | 3300025921 | Bacteria | 1281 |
| 673 | Ga0207652_10421464 | 3300025921 | Bacteria | 1204 |
| 674 | Ga0207652_10427032 | 3300025921 | Unclassified | 1195 |
| 675 | Ga0207646_10089570 | 3300025922 | Unclassified | 2754 |
| 676 | Ga0207646_10108213 | 3300025922 | Bacteria | 2494 |
| 677 | Ga0207646_10231966 | 3300025922 | Bacteria | 1668 |
| 678 | Ga0207646_10298782 | 3300025922 | Bacteria | 1455 |
| 679 | Ga0207646_10316335 | 3300025922 | Bacteria | 1410 |
| 680 | Ga0207646_10453755 | 3300025922 | Bacteria | 1157 |
| 681 | Ga0207646_11565446 | 3300025922 | Unclassified | 569 |
| 682 | Ga0207681_10120837 | 3300025923 | Bacteria | 1921 |
| 683 | Ga0207694_10010228 | 3300025924 | Bacteria | 7073 |
| 684 | Ga0207694_10140574 | 3300025924 | Bacteria | 1941 |
| 685 | Ga0207650_10017816 | 3300025925 | Bacteria | 4975 |
| 686 | Ga0207659_10005481 | 3300025926 | Bacteria | 7697 |
| 687 | Ga0207659_10017248 | 3300025926 | Bacteria | 4713 |
| 688 | Ga0207659_10082174 | 3300025926 | Bacteria | 2384 |
| 689 | Ga0207659_10785257 | 3300025926 | Bacteria | 818 |
| 690 | Ga0207687_10013941 | 3300025927 | Bacteria | 5254 |
| 691 | Ga0207687_10016714 | 3300025927 | Bacteria | 4823 |
| 692 | Ga0207687_10375366 | 3300025927 | Bacteria | 1164 |
| 693 | Ga0207687_10529573 | 3300025927 | Bacteria | 986 |
| 694 | Ga0207700_10000156 | 3300025928 | Bacteria | 40692 |
| 695 | Ga0207700_10002756 | 3300025928 | Bacteria | 10129 |
| 696 | Ga0207700_10003388 | 3300025928 | Bacteria | 9254 |
| 697 | Ga0207700_10009717 | 3300025928 | Bacteria | 6027 |
| 698 | Ga0207700_10010541 | 3300025928 | Bacteria | 5840 |
| 699 | Ga0207700_10011236 | 3300025928 | Bacteria | 5700 |
| 700 | Ga0207700_10038665 | 3300025928 | Bacteria | 3465 |
| 701 | Ga0207700_10053061 | 3300025928 | Bacteria | 3035 |
| 702 | Ga0207700_10069650 | 3300025928 | Bacteria | 2701 |
| 703 | Ga0207700_10085433 | 3300025928 | Bacteria | 2477 |
| 704 | Ga0207700_10145950 | 3300025928 | Bacteria | 1950 |
| 705 | Ga0207700_10281330 | 3300025928 | Bacteria | 1431 |
| 706 | Ga0207700_10303814 | 3300025928 | Bacteria | 1379 |
| 707 | Ga0207700_10339012 | 3300025928 | Bacteria | 1307 |
| 708 | Ga0207700_10476688 | 3300025928 | Bacteria | 1102 |
| 709 | Ga0207700_10572086 | 3300025928 | Unclassified | 1004 |
| 710 | Ga0207700_10913690 | 3300025928 | Unclassified | 786 |
| 711 | Ga0207664_10001396 | 3300025929 | Bacteria | 15869 |
| 712 | Ga0207664_10002012 | 3300025929 | Bacteria | 13393 |
| 713 | Ga0207664_10005805 | 3300025929 | Bacteria | 8440 |
| 714 | Ga0207664_10014718 | 3300025929 | Bacteria | 5660 |
| 715 | Ga0207664_10027872 | 3300025929 | Bacteria | 4288 |
| 716 | Ga0207664_10039052 | 3300025929 | Bacteria | 3683 |
| 717 | Ga0207664_10043034 | 3300025929 | Bacteria | 3529 |
| 718 | Ga0207664_10047685 | 3300025929 | Bacteria | 3366 |
| 719 | Ga0207664_10056491 | 3300025929 | Bacteria | 3117 |
| 720 | Ga0207664_10096719 | 3300025929 | Unclassified | 2431 |
| 721 | Ga0207664_10161145 | 3300025929 | Unclassified | 1913 |
| 722 | Ga0207664_10166919 | 3300025929 | Bacteria | 1881 |
| 723 | Ga0207664_10294306 | 3300025929 | Unclassified | 1427 |
| 724 | Ga0207664_10305615 | 3300025929 | Bacteria | 1400 |
| 725 | Ga0207664_10335389 | 3300025929 | Bacteria | 1336 |
| 726 | Ga0207664_10341840 | 3300025929 | Bacteria | 1323 |
| 727 | Ga0207664_10354322 | 3300025929 | Bacteria | 1299 |
| 728 | Ga0207664_10354995 | 3300025929 | Bacteria | 1298 |
| 729 | Ga0207664_10418463 | 3300025929 | Bacteria | 1193 |
| 730 | Ga0207664_10471755 | 3300025929 | Bacteria | 1122 |
| 731 | Ga0207664_10489533 | 3300025929 | Unclassified | 1101 |
| 732 | Ga0207664_10500341 | 3300025929 | Bacteria | 1088 |
| 733 | Ga0207664_10610991 | 3300025929 | Bacteria | 979 |
| 734 | Ga0207644_10054045 | 3300025931 | Bacteria | 2892 |
| 735 | Ga0207644_10062316 | 3300025931 | Bacteria | 2704 |
| 736 | Ga0207644_11104131 | 3300025931 | Unclassified | 666 |
| 737 | Ga0207690_10262663 | 3300025932 | Bacteria | 1338 |
| 738 | Ga0207690_10455275 | 3300025932 | Unclassified | 1029 |
| 739 | Ga0207690_10924431 | 3300025932 | Unclassified | 724 |
| 740 | Ga0207706_10041381 | 3300025933 | Bacteria | 4084 |
| 741 | Ga0207706_10098551 | 3300025933 | Bacteria | 2571 |
| 742 | Ga0207706_10100307 | 3300025933 | Bacteria | 2547 |
| 743 | Ga0207706_10307429 | 3300025933 | Bacteria | 1381 |
| 744 | Ga0207686_10075435 | 3300025934 | Bacteria | 2183 |
| 745 | Ga0207686_10135207 | 3300025934 | Bacteria | 1696 |
| 746 | Ga0207686_10237623 | 3300025934 | Bacteria | 1324 |
| 747 | Ga0207686_10754462 | 3300025934 | Unclassified | 777 |
| 748 | Ga0207709_10161436 | 3300025935 | Bacteria | 1563 |
| 749 | Ga0207709_10623243 | 3300025935 | Unclassified | 856 |
| 750 | Ga0207670_10305975 | 3300025936 | Bacteria | 1246 |
| 751 | Ga0207670_10674004 | 3300025936 | Bacteria | 854 |
| 752 | Ga0207669_10335256 | 3300025937 | Bacteria | 1163 |
| 753 | Ga0207704_10041969 | 3300025938 | Bacteria | 2688 |
| 754 | Ga0207704_10076906 | 3300025938 | Bacteria | 2140 |
| 755 | Ga0207665_10000827 | 3300025939 | Bacteria | 20934 |
| 756 | Ga0207665_10013492 | 3300025939 | Bacteria | 5373 |
| 757 | Ga0207665_10016808 | 3300025939 | Bacteria | 4805 |
| 758 | Ga0207665_10018832 | 3300025939 | Bacteria | 4537 |
| 759 | Ga0207665_10025313 | 3300025939 | Bacteria | 3915 |
| 760 | Ga0207665_10057490 | 3300025939 | Bacteria | 2627 |
| 761 | Ga0207665_10100639 | 3300025939 | Bacteria | 2017 |
| 762 | Ga0207665_10599103 | 3300025939 | Bacteria | 860 |
| 763 | Ga0207665_10665675 | 3300025939 | Bacteria | 817 |
| 764 | Ga0207665_11139314 | 3300025939 | Bacteria | 622 |
| 765 | Ga0207691_10130392 | 3300025940 | Bacteria | 2221 |
| 766 | Ga0207691_10269671 | 3300025940 | Bacteria | 1466 |
| 767 | Ga0207691_10476040 | 3300025940 | Bacteria | 1061 |
| 768 | Ga0207691_10563433 | 3300025940 | Bacteria | 966 |
| 769 | Ga0207711_10198419 | 3300025941 | Bacteria | 1830 |
| 770 | Ga0207711_10243529 | 3300025941 | Bacteria | 1649 |
| 771 | Ga0207689_10004314 | 3300025942 | Bacteria | 12948 |
| 772 | Ga0207689_10040223 | 3300025942 | Bacteria | 3870 |
| 773 | Ga0207689_10099849 | 3300025942 | Bacteria | 2385 |
| 774 | Ga0207689_10136090 | 3300025942 | Bacteria | 2023 |
| 775 | Ga0207689_10608264 | 3300025942 | Bacteria | 920 |
| 776 | Ga0207689_11171369 | 3300025942 | Unclassified | 647 |
| 777 | Ga0207661_10008039 | 3300025944 | Bacteria | 7518 |
| 778 | Ga0207661_10273228 | 3300025944 | Bacteria | 1509 |
| 779 | Ga0207661_10533555 | 3300025944 | Bacteria | 1074 |
| 780 | Ga0207679_10003876 | 3300025945 | Bacteria | 9276 |
| 781 | Ga0207679_10012038 | 3300025945 | Bacteria | 5625 |
| 782 | Ga0207679_10119630 | 3300025945 | Bacteria | 2094 |
| 783 | Ga0207679_10277278 | 3300025945 | Bacteria | 1436 |
| 784 | Ga0207679_10434964 | 3300025945 | Unclassified | 1161 |
| 785 | Ga0207679_10608002 | 3300025945 | Bacteria | 986 |
| 786 | Ga0207667_10222997 | 3300025949 | Unclassified | 1931 |
| 787 | Ga0207667_10517086 | 3300025949 | Bacteria | 1209 |
| 788 | Ga0207667_10836891 | 3300025949 | Bacteria | 915 |
| 789 | Ga0207667_11394251 | 3300025949 | Bacteria | 674 |
| 790 | Ga0207651_10013540 | 3300025960 | Bacteria | 4672 |
| 791 | Ga0207651_10065036 | 3300025960 | Bacteria | 2556 |
| 792 | Ga0207651_10366428 | 3300025960 | Bacteria | 1218 |
| 793 | Ga0207712_10205255 | 3300025961 | Bacteria | 1566 |
| 794 | Ga0207712_10355985 | 3300025961 | Bacteria | 1218 |
| 795 | Ga0207712_10362079 | 3300025961 | Bacteria | 1209 |
| 796 | Ga0207712_10761102 | 3300025961 | Bacteria | 849 |
| 797 | Ga0207712_10892872 | 3300025961 | Bacteria | 785 |
| 798 | Ga0207668_10026299 | 3300025972 | Bacteria | 3777 |
| 799 | Ga0207640_10047791 | 3300025981 | Bacteria | 2762 |
| 800 | Ga0207640_10063926 | 3300025981 | Bacteria | 2448 |
| 801 | Ga0207640_10083607 | 3300025981 | Bacteria | 2189 |
| 802 | Ga0207640_10447977 | 3300025981 | Unclassified | 1063 |
| 803 | Ga0207677_10008292 | 3300026023 | Bacteria | 5793 |
| 804 | Ga0207677_10013105 | 3300026023 | Bacteria | 4792 |
| 805 | Ga0207677_10111282 | 3300026023 | Bacteria | 2040 |
| 806 | Ga0207677_10260269 | 3300026023 | Bacteria | 1414 |
| 807 | Ga0207677_11054440 | 3300026023 | Unclassified | 739 |
| 808 | Ga0207677_11368968 | 3300026023 | Unclassified | 651 |
| 809 | Ga0207677_11610072 | 3300026023 | Bacteria | 601 |
| 810 | Ga0207703_10018287 | 3300026035 | Bacteria | 5473 |
| 811 | Ga0207703_10065521 | 3300026035 | Bacteria | 2986 |
| 812 | Ga0207703_10460870 | 3300026035 | Bacteria | 1189 |
| 813 | Ga0207703_10733653 | 3300026035 | Unclassified | 941 |
| 814 | Ga0207639_10148398 | 3300026041 | Bacteria | 1961 |
| 815 | Ga0207639_10936882 | 3300026041 | Bacteria | 810 |
| 816 | Ga0207639_11683215 | 3300026041 | Bacteria | 595 |
| 817 | Ga0207678_10000571 | 3300026067 | Bacteria | 33712 |
| 818 | Ga0207678_10008530 | 3300026067 | Bacteria | 9030 |
| 819 | Ga0207678_10039266 | 3300026067 | Bacteria | 4109 |
| 820 | Ga0207678_10520902 | 3300026067 | Unclassified | 1038 |
| 821 | Ga0207708_10025598 | 3300026075 | Bacteria | 4466 |
| 822 | Ga0207708_10079452 | 3300026075 | Bacteria | 2520 |
| 823 | Ga0207708_10103125 | 3300026075 | Bacteria | 2209 |
| 824 | Ga0207708_10509670 | 3300026075 | Unclassified | 1009 |
| 825 | Ga0207702_10011510 | 3300026078 | Bacteria | 7371 |
| 826 | Ga0207702_10011865 | 3300026078 | Bacteria | 7253 |
| 827 | Ga0207702_10020025 | 3300026078 | Bacteria | 5544 |
| 828 | Ga0207702_10057124 | 3300026078 | Bacteria | 3316 |
| 829 | Ga0207702_10060038 | 3300026078 | Bacteria | 3241 |
| 830 | Ga0207702_10108584 | 3300026078 | Bacteria | 2462 |
| 831 | Ga0207702_10130621 | 3300026078 | Bacteria | 2260 |
| 832 | Ga0207702_10319159 | 3300026078 | Bacteria | 1479 |
| 833 | Ga0207641_10007274 | 3300026088 | Bacteria | 9222 |
| 834 | Ga0207641_10277293 | 3300026088 | Bacteria | 1575 |
| 835 | Ga0207641_10692648 | 3300026088 | Bacteria | 1003 |
| 836 | Ga0207641_10853770 | 3300026088 | Bacteria | 902 |
| 837 | Ga0207641_11135330 | 3300026088 | Bacteria | 780 |
| 838 | Ga0207641_11289191 | 3300026088 | Bacteria | 731 |
| 839 | Ga0207648_10121425 | 3300026089 | Bacteria | 2297 |
| 840 | Ga0207676_10014581 | 3300026095 | Bacteria | 5658 |
| 841 | Ga0207676_10137180 | 3300026095 | Unclassified | 2089 |
| 842 | Ga0207676_10930036 | 3300026095 | Bacteria | 854 |
| 843 | Ga0207676_11572071 | 3300026095 | Unclassified | 655 |
| 844 | Ga0207676_11961666 | 3300026095 | Bacteria | 584 |
| 845 | Ga0207674_10017738 | 3300026116 | Bacteria | 7758 |
| 846 | Ga0207674_10103809 | 3300026116 | Bacteria | 2821 |
| 847 | Ga0207674_10149401 | 3300026116 | Bacteria | 2294 |
| 848 | Ga0207674_11064517 | 3300026116 | Unclassified | 778 |
| 849 | Ga0207675_100045236 | 3300026118 | Bacteria | 4112 |
| 850 | Ga0207675_100358107 | 3300026118 | Bacteria | 1431 |
| 851 | Ga0207675_100736754 | 3300026118 | Archaea | 996 |
| 852 | Ga0207675_101173437 | 3300026118 | Bacteria | 788 |
| 853 | Ga0207683_10003351 | 3300026121 | Bacteria | 13966 |
| 854 | Ga0207683_10011951 | 3300026121 | Bacteria | 7410 |
| 855 | Ga0207683_10023507 | 3300026121 | Bacteria | 5302 |
| 856 | Ga0207683_10031230 | 3300026121 | Bacteria | 4622 |
| 857 | Ga0207683_10134204 | 3300026121 | Bacteria | 2228 |
| 858 | Ga0207683_11125649 | 3300026121 | Bacteria | 728 |
| 859 | Ga0207698_10011480 | 3300026142 | Bacteria | 5748 |
| 860 | Ga0207698_10202021 | 3300026142 | Bacteria | 1780 |
| 861 | Ga0207698_10211044 | 3300026142 | Bacteria | 1747 |
| 862 | Ga0207698_10251524 | 3300026142 | Bacteria | 1617 |
| 863 | Ga0207698_10370663 | 3300026142 | Unclassified | 1359 |
| 864 | Ga0207698_10720269 | 3300026142 | Unclassified | 994 |
| 865 | Ga0207698_11176151 | 3300026142 | Bacteria | 781 |
| 866 | Ga0207428_10022119 | 3300027907 | Bacteria | 5368 |
| 867 | Ga0207428_10037031 | 3300027907 | Bacteria | 3972 |
| 868 | Ga0207428_10038618 | 3300027907 | Bacteria | 3881 |
| 869 | Ga0207428_10101678 | 3300027907 | Unclassified | 2221 |
| 870 | Ga0268266_10148679 | 3300028379 | Bacteria | 2109 |
| 871 | Ga0268266_10223698 | 3300028379 | Bacteria | 1731 |
| 872 | Ga0268266_10877141 | 3300028379 | Bacteria | 867 |
| 873 | Ga0268266_11633618 | 3300028379 | Unclassified | 620 |
| 874 | Ga0268265_10310227 | 3300028380 | Bacteria | 1424 |
| 875 | Ga0268265_10992821 | 3300028380 | Unclassified | 829 |
| 876 | Ga0268265_12372267 | 3300028380 | Bacteria | 537 |
| 877 | Ga0268264_11511417 | 3300028381 | Bacteria | 682 |
| 878 | Ga0265326_10007839 | 3300028558 | Bacteria | 3251 |
| 879 | Ga0265319_1010112 | 3300028563 | Bacteria | 3955 |
| 880 | Ga0265334_10000580 | 3300028573 | Bacteria | 18616 |
| 881 | Ga0265318_10000194 | 3300028577 | Bacteria | 53339 |
| 882 | Ga0265322_10007374 | 3300028654 | Bacteria | 3212 |
| 883 | Ga0265338_10005413 | 3300028800 | Bacteria | 16666 |
| 884 | Ga0265338_10707315 | 3300028800 | Bacteria | 695 |
| 885 | Ga0265760_10065404 | 3300031090 | Bacteria | 1110 |
| 886 | Ga0265330_10000730 | 3300031235 | Bacteria | 20693 |
| 887 | Ga0265332_10000843 | 3300031238 | Bacteria | 18612 |
| 888 | Ga0265328_10011532 | 3300031239 | Bacteria | 3527 |
| 889 | Ga0265320_10018276 | 3300031240 | Bacteria | 3866 |
| 890 | Ga0265320_10033110 | 3300031240 | Bacteria | 2641 |
| 891 | Ga0265325_10000203 | 3300031241 | Bacteria | 42252 |
| 892 | Ga0265329_10004054 | 3300031242 | Bacteria | 6223 |
| 893 | Ga0265340_10000614 | 3300031247 | Bacteria | 19974 |
| 894 | Ga0265339_10038764 | 3300031249 | Bacteria | 2655 |
| 895 | Ga0265331_10002005 | 3300031250 | Bacteria | 14166 |
| 896 | Ga0265327_10025146 | 3300031251 | Bacteria | 3478 |
| 897 | Ga0265316_10000977 | 3300031344 | Bacteria | 31051 |
| 898 | Ga0307408_102301429 | 3300031548 | Unclassified | 522 |
| 899 | Ga0265313_10001583 | 3300031595 | Bacteria | 21101 |
| 900 | Ga0265314_10032259 | 3300031711 | Bacteria | 3854 |
| 901 | Ga0265342_10001105 | 3300031712 | Bacteria | 25873 |
| 902 | Ga0307406_10407727 | 3300031901 | Unclassified | 1079 |
| 903 | Ga0307409_100033772 | 3300031995 | Bacteria | 3727 |
| 904 | Ga0307409_100804628 | 3300031995 | Unclassified | 948 |
| 905 | Ga0307411_10773345 | 3300032005 | Unclassified | 843 |
| 906 | Ga0307415_100028205 | 3300032126 | Bacteria | 3568 |
| 907 | Ga0307415_100844022 | 3300032126 | Unclassified | 840 |
| 908 | Ga0373930_0034201 | 3300034816 | Bacteria | 1058 |
| 909 | Ga0373930_0039097 | 3300034816 | Unclassified | 1005 |
| 910 | Ga0373930_0119338 | 3300034816 | Unclassified | 641 |
| 911 | Ga0373948_0002617 | 3300034817 | Bacteria | 2682 |
| 912 | Ga0373948_0034373 | 3300034817 | Bacteria | 1036 |
| 913 | Ga0373958_0056031 | 3300034819 | Bacteria | 843 |
| 914 | Ga0373958_0073225 | 3300034819 | Bacteria | 764 |
| 915 | Ga0373959_0103596 | 3300034820 | Bacteria | 680 |
| 916 | Ga0373938_0000786 | 3300034957 | Bacteria | 5158 |
| 917 | Ga0373938_0050188 | 3300034957 | Bacteria | 951 |
| 918 | Ga0373926_0001583 | 3300035083 | Bacteria | 6997 |
| 919 | Ga0373926_0040371 | 3300035083 | Bacteria | 1665 |
| 920 | Ga0373926_0178754 | 3300035083 | Bacteria | 813 |
| 921 | Ga0373928_0015051 | 3300035084 | Bacteria | 1570 |
| 922 | Ga0373929_0086236 | 3300035085 | Bacteria | 773 |
| 923 | Ga0373934_0004946 | 3300035086 | Bacteria | 4937 |
| 924 | Ga0373934_0088436 | 3300035086 | Bacteria | 1247 |
| 925 | Ga0373934_0096311 | 3300035086 | Bacteria | 1195 |
| 926 | Ga0373934_0157898 | 3300035086 | Bacteria | 930 |
| 927 | Ga0373940_0043795 | 3300035088 | Unclassified | 1238 |
| 928 | Ga0373940_0113999 | 3300035088 | Bacteria | 832 |
| 929 | Ga0373944_0001507 | 3300035089 | Bacteria | 5891 |
| 930 | Ga0373944_0002613 | 3300035089 | Bacteria | 4590 |
| 931 | Ga0373944_0063558 | 3300035089 | Bacteria | 1189 |
| 932 | Ga0373944_0068111 | 3300035089 | Bacteria | 1154 |
| 933 | Ga0373944_0135814 | 3300035089 | Unclassified | 858 |
| 934 | Ga0373951_0009620 | 3300035091 | Bacteria | 2173 |
| 935 | Ga0373952_0008357 | 3300035092 | Bacteria | 1962 |
| 936 | Ga0373952_0104235 | 3300035092 | Bacteria | 752 |
| 937 | Ga0373923_0000360 | 3300035111 | Bacteria | 10308 |
| 938 | Ga0373923_0017774 | 3300035111 | Bacteria | 2725 |
| 939 | Ga0373923_0022734 | 3300035111 | Bacteria | 2461 |
| 940 | Ga0373923_0034967 | 3300035111 | Bacteria | 2042 |
| 941 | Ga0373923_0071364 | 3300035111 | Bacteria | 1491 |
| 942 | Ga0373923_0078204 | 3300035111 | Bacteria | 1431 |
| 943 | Ga0373923_0094825 | 3300035111 | Unclassified | 1310 |
| 944 | Ga0373932_0001030 | 3300035112 | Bacteria | 8065 |
| 945 | Ga0373932_0011323 | 3300035112 | Bacteria | 2177 |
| 946 | Ga0373932_0022573 | 3300035112 | Bacteria | 1673 |
| 947 | Ga0373932_0086528 | 3300035112 | Bacteria | 999 |
| 948 | Ga0373936_0000848 | 3300035113 | Bacteria | 10882 |
| 949 | Ga0373936_0005713 | 3300035113 | Bacteria | 4693 |
| 950 | Ga0373936_0047631 | 3300035113 | Bacteria | 1729 |
| 951 | Ga0373936_0054534 | 3300035113 | Unclassified | 1622 |
| 952 | Ga0373936_0167373 | 3300035113 | Bacteria | 960 |
| 953 | Ga0373939_0026006 | 3300035114 | Bacteria | 1646 |
| 954 | Ga0373939_0031214 | 3300035114 | Bacteria | 1538 |
| 955 | Ga0373939_0280245 | 3300035114 | Bacteria | 658 |
| 956 | Ga0373941_0002052 | 3300035115 | Bacteria | 4367 |
| 957 | Ga0373941_0012468 | 3300035115 | Bacteria | 2223 |
| 958 | Ga0373941_0049370 | 3300035115 | Bacteria | 1332 |
| 959 | Ga0373945_0000180 | 3300035116 | Bacteria | 16902 |
| 960 | Ga0373945_0000330 | 3300035116 | Bacteria | 13469 |
| 961 | Ga0373945_0232190 | 3300035116 | Bacteria | 774 |
| 962 | Ga0373945_0354775 | 3300035116 | Bacteria | 636 |
| 963 | Ga0373953_0000061 | 3300035117 | Bacteria | 27457 |
| 964 | Ga0373953_0002146 | 3300035117 | Bacteria | 5900 |
| 965 | Ga0373953_0013441 | 3300035117 | Bacteria | 2924 |
| 966 | Ga0373953_0048468 | 3300035117 | Bacteria | 1711 |
| 967 | Ga0373953_0085932 | 3300035117 | Unclassified | 1313 |
| 968 | Ga0373953_0212492 | 3300035117 | Unclassified | 837 |
| 969 | Ga0373954_0001600 | 3300035118 | Bacteria | 9236 |
| 970 | Ga0373954_0025111 | 3300035118 | Bacteria | 2722 |
| 971 | Ga0373954_0039472 | 3300035118 | Bacteria | 2197 |
| 972 | Ga0373954_0051972 | 3300035118 | Bacteria | 1925 |
| 973 | Ga0373954_0087546 | 3300035118 | Bacteria | 1493 |
| 974 | Ga0373954_0417522 | 3300035118 | Unclassified | 664 |
| 975 | Ga0373956_0000860 | 3300035119 | Bacteria | 12644 |
| 976 | Ga0373956_0003968 | 3300035119 | Bacteria | 5944 |
| 977 | Ga0373956_0011717 | 3300035119 | Bacteria | 3617 |
| 978 | Ga0373956_0020518 | 3300035119 | Bacteria | 2812 |
| 979 | Ga0373956_0105013 | 3300035119 | Bacteria | 1312 |
| 980 | Ga0373956_0169805 | 3300035119 | Bacteria | 1029 |
| 981 | Ga0373956_0428437 | 3300035119 | Unclassified | 631 |
| 982 | Ga0373957_0000360 | 3300035120 | Bacteria | 11609 |
| 983 | Ga0373957_0000832 | 3300035120 | Bacteria | 8066 |
| 984 | Ga0373957_0002259 | 3300035120 | Bacteria | 5457 |
| 985 | Ga0373957_0002760 | 3300035120 | Bacteria | 5052 |
| 986 | Ga0373957_0008572 | 3300035120 | Bacteria | 3318 |
| 987 | Ga0373957_0104108 | 3300035120 | Unclassified | 1138 |
| 988 | Ga0373957_0237507 | 3300035120 | Unclassified | 765 |
| 989 | Ga0373960_0106917 | 3300035121 | Unclassified | 913 |
| 990 | Ga0373943_0001628 | 3300035170 | Bacteria | 10184 |
| 991 | Ga0373943_0002968 | 3300035170 | Bacteria | 7699 |
| 992 | Ga0373943_0012078 | 3300035170 | Bacteria | 3889 |
| 993 | Ga0373943_0019860 | 3300035170 | Unclassified | 3094 |
| 994 | Ga0373943_0066574 | 3300035170 | Bacteria | 1815 |
| 995 | Ga0373943_0193271 | 3300035170 | Bacteria | 1123 |
| 996 | Ga0373943_0345500 | 3300035170 | Unclassified | 852 |
| 997 | Ga0373946_0001056 | 3300035171 | Bacteria | 9482 |
| 998 | Ga0373946_0001301 | 3300035171 | Bacteria | 8634 |
| 999 | Ga0373946_0003253 | 3300035171 | Bacteria | 5768 |
| 1000 | Ga0373946_0048787 | 3300035171 | Unclassified | 1764 |
| 1001 | Ga0373946_0082131 | 3300035171 | Bacteria | 1413 |
| 1002 | Ga0373946_0215369 | 3300035171 | Bacteria | 925 |
| 1003 | Ga0373946_0222662 | 3300035171 | Bacteria | 911 |
| 1004 | Ga0373946_0261093 | 3300035171 | Bacteria | 847 |
| 1005 | Ga0373955_0000018 | 3300035172 | Bacteria | 68313 |
| 1006 | Ga0373955_0004186 | 3300035172 | Bacteria | 6368 |
| 1007 | Ga0373955_0031583 | 3300035172 | Bacteria | 2775 |
| 1008 | Ga0373955_0076092 | 3300035172 | Bacteria | 1887 |
| 1009 | Ga0373955_0091183 | 3300035172 | Bacteria | 1737 |
| 1010 | Ga0373955_0109963 | 3300035172 | Bacteria | 1592 |
| 1011 | Ga0373955_0257882 | 3300035172 | Unclassified | 1046 |
| 1012 | Ga0373955_0312582 | 3300035172 | Unclassified | 948 |
| 1013 | Ga0373955_0443969 | 3300035172 | Bacteria | 790 |
| 1014 | Ga0373955_0618705 | 3300035172 | Unclassified | 663 |
| 1015 | Ga0373955_0747636 | 3300035172 | Unclassified | 601 |
| 1016 | Ga0373942_0050192 | 3300035207 | Unclassified | 1167 |
| 1017 | Ga0373961_0023559 | 3300035241 | Bacteria | 1658 |
| 1018 | Ga0373961_0207514 | 3300035241 | Bacteria | 694 |
| 1019 | Ga0373962_0038690 | 3300035242 | Bacteria | 1336 |
| 1020 | Ga0373924_0000135 | 3300035410 | Bacteria | 21359 |
| 1021 | Ga0373924_0002433 | 3300035410 | Bacteria | 6264 |
| 1022 | Ga0373924_0009284 | 3300035410 | Bacteria | 3601 |
| 1023 | Ga0373924_0010395 | 3300035410 | Bacteria | 3429 |
| 1024 | Ga0373924_0011342 | 3300035410 | Bacteria | 3308 |
| 1025 | Ga0373924_0019412 | 3300035410 | Bacteria | 2634 |
| 1026 | Ga0373924_0067883 | 3300035410 | Bacteria | 1500 |
| 1027 | Ga0373924_0090116 | 3300035410 | Bacteria | 1311 |
| 1028 | Ga0373924_0174516 | 3300035410 | Unclassified | 945 |
| 1029 | Ga0373924_0342837 | 3300035410 | Unclassified | 665 |
| 1030 | Ga0373931_0006527 | 3300035691 | Bacteria | 5453 |
| 1031 | Ga0373931_0019910 | 3300035691 | Bacteria | 3353 |
| 1032 | Ga0373931_0084098 | 3300035691 | Bacteria | 1761 |
| 1033 | Ga0373931_0263352 | 3300035691 | Bacteria | 1053 |
| 1034 | Ga0373931_0896155 | 3300035691 | Bacteria | 596 |
| 1035 | Ga0373931_0967021 | 3300035691 | Bacteria | 575 |
| 1036 | Ga0373935_0000268 | 3300035692 | Bacteria | 25733 |
| 1037 | Ga0373935_0009010 | 3300035692 | Bacteria | 5970 |
| 1038 | Ga0373935_0016166 | 3300035692 | Bacteria | 4516 |
| 1039 | Ga0373935_0022407 | 3300035692 | Bacteria | 3873 |
| 1040 | Ga0373935_0133967 | 3300035692 | Bacteria | 1667 |
| 1041 | Ga0373935_0220173 | 3300035692 | Unclassified | 1318 |
| 1042 | Ga0373935_0306024 | 3300035692 | Bacteria | 1124 |
| 1043 | Ga0373935_0452116 | 3300035692 | Unclassified | 928 |
| 1044 | Ga0373935_0593266 | 3300035692 | Unclassified | 810 |
| 1045 | Ga0373935_0683809 | 3300035692 | Bacteria | 754 |
| 1046 | Ga0373935_0947499 | 3300035692 | Bacteria | 638 |
| 1047 | Ga0373935_1232597 | 3300035692 | Unclassified | 558 |
| 1048 | Ga0373935_1269727 | 3300035692 | Unclassified | 549 |
| 1049 | Ga0373927_0008506 | 3300035695 | Bacteria | 6903 |
| 1050 | Ga0373927_0010147 | 3300035695 | Bacteria | 6297 |
| 1051 | Ga0373927_0014979 | 3300035695 | Bacteria | 5130 |
| 1052 | Ga0373927_0174847 | 3300035695 | Bacteria | 1408 |
| 1053 | Ga0373927_0184794 | 3300035695 | Bacteria | 1367 |
| 1054 | Ga0373933_0000003 | 3300035724 | Bacteria | 150420 |
| 1055 | Ga0373933_0005672 | 3300035724 | Bacteria | 6797 |
| 1056 | Ga0373933_0014841 | 3300035724 | Bacteria | 4335 |
| 1057 | Ga0373933_0017241 | 3300035724 | Bacteria | 4050 |
| 1058 | Ga0373933_0020085 | 3300035724 | Bacteria | 3783 |
| 1059 | Ga0373933_0022806 | 3300035724 | Bacteria | 3569 |
| 1060 | Ga0373933_0023349 | 3300035724 | Bacteria | 3532 |
| 1061 | Ga0373933_0045946 | 3300035724 | Bacteria | 2591 |
| 1062 | Ga0373933_0167934 | 3300035724 | Bacteria | 1395 |
| 1063 | Ga0373933_0231717 | 3300035724 | Bacteria | 1186 |
| 1064 | Ga0373933_0235238 | 3300035724 | Bacteria | 1177 |
| 1065 | Ga0373933_0436035 | 3300035724 | Bacteria | 856 |
| 1066 | Ga0373933_0495742 | 3300035724 | Unclassified | 800 |
| 1067 | Ga0373933_1056539 | 3300035724 | Bacteria | 535 |
| 1068 | Ga0373947_0000374 | 3300035725 | Bacteria | 25329 |
| 1069 | Ga0373947_0020201 | 3300035725 | Bacteria | 3844 |
| 1070 | Ga0373947_0034022 | 3300035725 | Bacteria | 3013 |
| 1071 | Ga0373947_0035392 | 3300035725 | Bacteria | 2956 |
| 1072 | Ga0373947_0328048 | 3300035725 | Bacteria | 1024 |
| 1073 | Ga0373947_0404216 | 3300035725 | Bacteria | 921 |
| 1074 | Ga0373947_0417756 | 3300035725 | Bacteria | 906 |
| 1075 | Ga0373947_0595298 | 3300035725 | Bacteria | 753 |
| 1076 | Ga0373947_0637709 | 3300035725 | Unclassified | 726 |
| 1077 | Ga0373937_0000016 | 3300036401 | Bacteria | 145523 |
| 1078 | Ga0373937_0005352 | 3300036401 | Bacteria | 10976 |
| 1079 | Ga0373937_0012476 | 3300036401 | Bacteria | 7476 |
| 1080 | Ga0373937_0102857 | 3300036401 | Bacteria | 2652 |
| 1081 | Ga0373937_0105413 | 3300036401 | Bacteria | 2619 |
| 1082 | Ga0373937_0114133 | 3300036401 | Bacteria | 2514 |
| 1083 | Ga0373937_0141769 | 3300036401 | Bacteria | 2249 |
| 1084 | Ga0373937_0181821 | 3300036401 | Bacteria | 1974 |
| 1085 | Ga0373937_0242772 | 3300036401 | Bacteria | 1697 |
| 1086 | Ga0373937_0246563 | 3300036401 | Bacteria | 1683 |
| 1087 | Ga0373937_2019151 | 3300036401 | Unclassified | 523 |
| 1088 | Ga0373925_0001174 | 3300037068 | Bacteria | 23167 |
| 1089 | Ga0373925_0010255 | 3300037068 | Bacteria | 6796 |
| 1090 | Ga0373925_0020229 | 3300037068 | Bacteria | 4843 |
| 1091 | Ga0373925_0032585 | 3300037068 | Bacteria | 3836 |
| 1092 | Ga0373925_0035606 | 3300037068 | Bacteria | 3673 |
| 1093 | Ga0373925_0038415 | 3300037068 | Bacteria | 3539 |
| 1094 | Ga0373925_0058021 | 3300037068 | Bacteria | 2901 |
| 1095 | Ga0373925_0072731 | 3300037068 | Bacteria | 2601 |
| 1096 | Ga0373925_0256974 | 3300037068 | Bacteria | 1402 |
| 1097 | Ga0373925_0295006 | 3300037068 | Bacteria | 1308 |
| 1098 | Ga0373925_0407793 | 3300037068 | Bacteria | 1109 |
| 1099 | Ga0373925_0436164 | 3300037068 | Bacteria | 1071 |
| 1100 | Ga0373925_0544266 | 3300037068 | Unclassified | 954 |
| 1101 | Ga0373925_0602044 | 3300037068 | Bacteria | 905 |
| 1102 | Ga0373925_0936220 | 3300037068 | Unclassified | 714 |
| 1103 | Ga0373925_1494568 | 3300037068 | Unclassified | 553 |
| 1104 | Ga0373925_1576613 | 3300037068 | Bacteria | 537 |
| 1105 | Ga0395899_0003362 | 3300037312 | Bacteria | 12693 |
| 1106 | Ga0395900_0002558 | 3300037418 | Bacteria | 19945 |
| 1107 | Ga0395900_0181538 | 3300037418 | Bacteria | 2138 |
| 1108 | Ga0395900_0932135 | 3300037418 | Bacteria | 791 |
| 1109 | Ga0395898_0043181 | 3300037466 | Bacteria | 4443 |
| 1110 | Ga0395898_0117792 | 3300037466 | Unclassified | 2544 |
| 1111 | Ga0395898_0312056 | 3300037466 | Bacteria | 1500 |
| 1112 | Ga0395898_0449208 | 3300037466 | Bacteria | 1228 |
| 1113 | Ga0395905_0002554 | 3300037471 | Bacteria | 20070 |
| 1114 | Ga0395905_0156420 | 3300037471 | Bacteria | 2144 |
| 1115 | Ga0436364_0441041 | 3300037853 | Bacteria | 6930 |
| 1116 | Ga0436364_0844683 | 3300037853 | Bacteria | 1027 |
| 1117 | Ga0395901_0002375 | 3300038443 | Bacteria | 19144 |
| 1118 | Ga0395901_0222606 | 3300038443 | Bacteria | 1972 |
| 1119 | Ga0436365_0255797 | 3300039437 | Bacteria | 1354 |
| 1120 | Ga0436365_0426892 | 3300039437 | Bacteria | 1611 |
| 1121 | Ga0436365_0464844 | 3300039437 | Bacteria | 8549 |
| 1122 | Ga0436360_0189120 | 3300039438 | Bacteria | 1743 |
| 1123 | Ga0436363_0280449 | 3300039450 | Bacteria | 2745 |
| 1124 | Ga0436363_0349492 | 3300039450 | Unclassified | 859 |
| 1125 | Ga0436363_1620924 | 3300039450 | Bacteria | 1385 |
| 1126 | Ga0436362_0478452 | 3300039453 | Bacteria | 1421 |
| 1127 | Ga0436362_0558682 | 3300039453 | Bacteria | 1324 |
| 1128 | Ga0451853_3176466 | 3300041512 | Bacteria | 947 |
| 1129 | Ga0439448_0071681 | 3300042005 | Bacteria | 1154 |
| 1130 | Ga0439463_021757 | 3300042016 | Bacteria | 1602 |
| 1131 | Ga0450902_028456 | 3300042137 | Bacteria | 938 |
| 1132 | Ga0439459_0059592 | 3300042438 | Unclassified | 859 |
| 1133 | Ga0439464_0042218 | 3300042439 | Bacteria | 1302 |
| 1134 | Ga0439440_0028544 | 3300042993 | Bacteria | 1303 |
| 1135 | Ga0439440_0107102 | 3300042993 | Unclassified | 766 |
| 1136 | Ga0466963_0104496 | 3300044694 | Bacteria | 1941 |
| 1137 | Ga0466964_0652663 | 3300044706 | Bacteria | 582 |
| 1138 | Ga0466959_0167529 | 3300045049 | Bacteria | 1542 |
| 1139 | Ga0466967_0090419 | 3300045976 | Bacteria | 2781 |
| 1140 | Ga0466967_0100033 | 3300045976 | Bacteria | 2649 |
| 1141 | Ga0495592_0000116 | 3300046454 | Bacteria | 70091 |
| 1142 | Ga0495592_0006999 | 3300046454 | Bacteria | 8429 |
| 1143 | Ga0495592_0017920 | 3300046454 | Bacteria | 5381 |
| 1144 | Ga0495592_0019499 | 3300046454 | Bacteria | 5157 |
| 1145 | Ga0495592_0076016 | 3300046454 | Bacteria | 2437 |
| 1146 | Ga0495592_0114071 | 3300046454 | Bacteria | 1909 |
| 1147 | Ga0495592_0167062 | 3300046454 | Bacteria | 1509 |
| 1148 | Ga0495592_0288556 | 3300046454 | Bacteria | 1070 |
| 1149 | Ga0495592_0298778 | 3300046454 | Bacteria | 1047 |
| 1150 | Ga0495592_0300116 | 3300046454 | Bacteria | 1044 |
| 1151 | Ga0495592_0327487 | 3300046454 | Bacteria | 988 |
| 1152 | Ga0495592_0418739 | 3300046454 | Bacteria | 845 |
| 1153 | Ga0495603_0039544 | 3300046455 | Bacteria | 2825 |
| 1154 | Ga0495603_0043628 | 3300046455 | Bacteria | 2677 |
| 1155 | Ga0495603_0395187 | 3300046455 | Unclassified | 792 |
| 1156 | Ga0495629_0003179 | 3300046459 | Bacteria | 12433 |
| 1157 | Ga0495629_0049067 | 3300046459 | Bacteria | 2960 |
| 1158 | Ga0495629_0059086 | 3300046459 | Bacteria | 2680 |
| 1159 | Ga0495629_0077735 | 3300046459 | Bacteria | 2316 |
| 1160 | Ga0495629_0650742 | 3300046459 | Unclassified | 702 |
| 1161 | Ga0495629_0760598 | 3300046459 | Unclassified | 641 |
| 1162 | Ga0495641_0001952 | 3300046461 | Bacteria | 16770 |
| 1163 | Ga0495641_0019077 | 3300046461 | Bacteria | 3521 |
| 1164 | Ga0495641_0022429 | 3300046461 | Bacteria | 3159 |
| 1165 | Ga0495641_0041441 | 3300046461 | Bacteria | 2139 |
| 1166 | Ga0495641_0058480 | 3300046461 | Bacteria | 1744 |
| 1167 | Ga0495641_0095454 | 3300046461 | Bacteria | 1328 |
| 1168 | Ga0495641_0411834 | 3300046461 | Unclassified | 614 |
| 1169 | Ga0495641_0528390 | 3300046461 | Unclassified | 538 |
| 1170 | Ga0495651_0000009 | 3300046462 | Bacteria | 150455 |
| 1171 | Ga0495651_0006098 | 3300046462 | Bacteria | 9202 |
| 1172 | Ga0495651_0012073 | 3300046462 | Bacteria | 6648 |
| 1173 | Ga0495651_0014354 | 3300046462 | Bacteria | 6124 |
| 1174 | Ga0495651_0025318 | 3300046462 | Bacteria | 4618 |
| 1175 | Ga0495651_0030794 | 3300046462 | Bacteria | 4184 |
| 1176 | Ga0495651_0032117 | 3300046462 | Bacteria | 4096 |
| 1177 | Ga0495651_0038319 | 3300046462 | Bacteria | 3733 |
| 1178 | Ga0495651_0158059 | 3300046462 | Bacteria | 1627 |
| 1179 | Ga0495651_0163956 | 3300046462 | Bacteria | 1589 |
| 1180 | Ga0495651_0165889 | 3300046462 | Unclassified | 1577 |
| 1181 | Ga0495651_0180396 | 3300046462 | Bacteria | 1495 |
| 1182 | Ga0495651_0199508 | 3300046462 | Bacteria | 1401 |
| 1183 | Ga0495651_0199745 | 3300046462 | Unclassified | 1400 |
| 1184 | Ga0495651_0295023 | 3300046462 | Unclassified | 1090 |
| 1185 | Ga0495653_0001057 | 3300046463 | Bacteria | 21196 |
| 1186 | Ga0495653_0011491 | 3300046463 | Bacteria | 7234 |
| 1187 | Ga0495653_0018727 | 3300046463 | Bacteria | 5621 |
| 1188 | Ga0495653_0025298 | 3300046463 | Bacteria | 4773 |
| 1189 | Ga0495653_0025742 | 3300046463 | Bacteria | 4720 |
| 1190 | Ga0495653_0025926 | 3300046463 | Bacteria | 4704 |
| 1191 | Ga0495653_0029010 | 3300046463 | Bacteria | 4422 |
| 1192 | Ga0495653_0046335 | 3300046463 | Bacteria | 3367 |
| 1193 | Ga0495653_0076811 | 3300046463 | Bacteria | 2481 |
| 1194 | Ga0495653_0081376 | 3300046463 | Bacteria | 2393 |
| 1195 | Ga0495653_0093855 | 3300046463 | Bacteria | 2187 |
| 1196 | Ga0495653_0124807 | 3300046463 | Bacteria | 1829 |
| 1197 | Ga0495653_0170506 | 3300046463 | Bacteria | 1502 |
| 1198 | Ga0495653_0297210 | 3300046463 | Bacteria | 1054 |
| 1199 | Ga0495653_0601169 | 3300046463 | Bacteria | 676 |
| 1200 | Ga0495653_0602003 | 3300046463 | Unclassified | 675 |
| 1201 | Ga0495580_0000900 | 3300046472 | Bacteria | 25880 |
| 1202 | Ga0495580_0036534 | 3300046472 | Bacteria | 3526 |
| 1203 | Ga0495580_0110406 | 3300046472 | Unclassified | 1910 |
| 1204 | Ga0495580_0566721 | 3300046472 | Unclassified | 753 |
| 1205 | Ga0495582_0001399 | 3300046473 | Bacteria | 13590 |
| 1206 | Ga0495582_0025720 | 3300046473 | Bacteria | 3224 |
| 1207 | Ga0495582_0032243 | 3300046473 | Bacteria | 2882 |
| 1208 | Ga0495582_0036144 | 3300046473 | Unclassified | 2717 |
| 1209 | Ga0495582_0267110 | 3300046473 | Bacteria | 981 |
| 1210 | Ga0495639_0002222 | 3300046475 | Bacteria | 8537 |
| 1211 | Ga0495639_0020728 | 3300046475 | Bacteria | 2873 |
| 1212 | Ga0495639_0026940 | 3300046475 | Bacteria | 2543 |
| 1213 | Ga0495639_0099918 | 3300046475 | Unclassified | 1369 |
| 1214 | Ga0495639_0117264 | 3300046475 | Bacteria | 1268 |
| 1215 | Ga0495639_0214240 | 3300046475 | Bacteria | 945 |
| 1216 | Ga0495639_0279751 | 3300046475 | Bacteria | 829 |
| 1217 | Ga0495662_0008680 | 3300046476 | Bacteria | 4996 |
| 1218 | Ga0495662_0023663 | 3300046476 | Bacteria | 2966 |
| 1219 | Ga0495662_0029676 | 3300046476 | Bacteria | 2639 |
| 1220 | Ga0495662_0031440 | 3300046476 | Bacteria | 2564 |
| 1221 | Ga0495662_0033704 | 3300046476 | Unclassified | 2474 |
| 1222 | Ga0495662_0069691 | 3300046476 | Bacteria | 1704 |
| 1223 | Ga0495662_0082193 | 3300046476 | Unclassified | 1567 |
| 1224 | Ga0495662_0213777 | 3300046476 | Bacteria | 950 |
| 1225 | Ga0495662_0250492 | 3300046476 | Unclassified | 872 |
| 1226 | Ga0495664_0019681 | 3300046477 | Bacteria | 3884 |
| 1227 | Ga0495664_0026889 | 3300046477 | Bacteria | 3352 |
| 1228 | Ga0495664_0030255 | 3300046477 | Bacteria | 3171 |
| 1229 | Ga0495664_0044510 | 3300046477 | Bacteria | 2630 |
| 1230 | Ga0495664_0047929 | 3300046477 | Bacteria | 2536 |
| 1231 | Ga0495664_0072516 | 3300046477 | Bacteria | 2058 |
| 1232 | Ga0495664_0095125 | 3300046477 | Bacteria | 1793 |
| 1233 | Ga0495664_0225396 | 3300046477 | Bacteria | 1135 |
| 1234 | Ga0495664_0314091 | 3300046477 | Unclassified | 945 |
| 1235 | Ga0495664_0353267 | 3300046477 | Bacteria | 885 |
| 1236 | Ga0495664_0401150 | 3300046477 | Unclassified | 823 |
| 1237 | Ga0495664_0569882 | 3300046477 | Bacteria | 674 |
| 1238 | Ga0495664_0930599 | 3300046477 | Unclassified | 507 |
| 1239 | Ga0495594_0005006 | 3300046499 | Bacteria | 6819 |
| 1240 | Ga0495608_0000019 | 3300046511 | Bacteria | 180119 |
| 1241 | Ga0495608_0004481 | 3300046511 | Bacteria | 9980 |
| 1242 | Ga0495608_0011269 | 3300046511 | Bacteria | 6225 |
| 1243 | Ga0495608_0011645 | 3300046511 | Bacteria | 6117 |
| 1244 | Ga0495608_0012752 | 3300046511 | Bacteria | 5832 |
| 1245 | Ga0495608_0017826 | 3300046511 | Bacteria | 4908 |
| 1246 | Ga0495608_0044919 | 3300046511 | Bacteria | 2946 |
| 1247 | Ga0495608_0054997 | 3300046511 | Bacteria | 2630 |
| 1248 | Ga0495608_0074761 | 3300046511 | Bacteria | 2208 |
| 1249 | Ga0495608_0112328 | 3300046511 | Bacteria | 1751 |
| 1250 | Ga0495608_0241099 | 3300046511 | Bacteria | 1130 |
| 1251 | Ga0495608_0343605 | 3300046511 | Bacteria | 919 |
| 1252 | Ga0495618_0006736 | 3300046514 | Bacteria | 6961 |
| 1253 | Ga0495618_0014710 | 3300046514 | Bacteria | 4771 |
| 1254 | Ga0495618_0017092 | 3300046514 | Bacteria | 4446 |
| 1255 | Ga0495618_0033991 | 3300046514 | Bacteria | 3196 |
| 1256 | Ga0495618_0045378 | 3300046514 | Bacteria | 2772 |
| 1257 | Ga0495618_0066823 | 3300046514 | Bacteria | 2285 |
| 1258 | Ga0495618_0098447 | 3300046514 | Bacteria | 1871 |
| 1259 | Ga0495618_0156310 | 3300046514 | Bacteria | 1455 |
| 1260 | Ga0495618_0166001 | 3300046514 | Bacteria | 1406 |
| 1261 | Ga0495618_0299964 | 3300046514 | Unclassified | 998 |
| 1262 | Ga0495618_0326188 | 3300046514 | Unclassified | 950 |
| 1263 | Ga0495620_0370176 | 3300046515 | Unclassified | 543 |
| 1264 | Ga0495628_0000487 | 3300046516 | Bacteria | 36399 |
| 1265 | Ga0495628_0028198 | 3300046516 | Bacteria | 4563 |
| 1266 | Ga0495628_0056091 | 3300046516 | Bacteria | 3102 |
| 1267 | Ga0495628_0071001 | 3300046516 | Bacteria | 2715 |
| 1268 | Ga0495628_0078610 | 3300046516 | Bacteria | 2565 |
| 1269 | Ga0495628_0079322 | 3300046516 | Bacteria | 2552 |
| 1270 | Ga0495628_0096624 | 3300046516 | Bacteria | 2282 |
| 1271 | Ga0495628_0170790 | 3300046516 | Bacteria | 1649 |
| 1272 | Ga0495628_0222459 | 3300046516 | Bacteria | 1417 |
| 1273 | Ga0495628_0282064 | 3300046516 | Unclassified | 1233 |
| 1274 | Ga0495628_0291187 | 3300046516 | Unclassified | 1210 |
| 1275 | Ga0495628_0300312 | 3300046516 | Bacteria | 1188 |
| 1276 | Ga0495628_0413996 | 3300046516 | Unclassified | 983 |
| 1277 | Ga0495628_0616721 | 3300046516 | Unclassified | 773 |
| 1278 | Ga0495628_0731997 | 3300046516 | Bacteria | 696 |
| 1279 | Ga0495630_0009386 | 3300046517 | Bacteria | 7031 |
| 1280 | Ga0495630_0014713 | 3300046517 | Bacteria | 5705 |
| 1281 | Ga0495630_0018848 | 3300046517 | Bacteria | 5072 |
| 1282 | Ga0495630_0026862 | 3300046517 | Bacteria | 4265 |
| 1283 | Ga0495630_0027228 | 3300046517 | Bacteria | 4238 |
| 1284 | Ga0495630_0087173 | 3300046517 | Bacteria | 2357 |
| 1285 | Ga0495630_0087772 | 3300046517 | Bacteria | 2349 |
| 1286 | Ga0495630_0106606 | 3300046517 | Bacteria | 2122 |
| 1287 | Ga0495630_0155776 | 3300046517 | Unclassified | 1739 |
| 1288 | Ga0495630_1003100 | 3300046517 | Unclassified | 634 |
| 1289 | Ga0495666_0008314 | 3300046526 | Bacteria | 5200 |
| 1290 | Ga0495666_0094884 | 3300046526 | Bacteria | 1407 |
| 1291 | Ga0495652_0000082 | 3300046529 | Bacteria | 102163 |
| 1292 | Ga0495652_0001084 | 3300046529 | Bacteria | 30802 |
| 1293 | Ga0495652_0014619 | 3300046529 | Bacteria | 7037 |
| 1294 | Ga0495652_0016263 | 3300046529 | Bacteria | 6655 |
| 1295 | Ga0495652_0067816 | 3300046529 | Bacteria | 2990 |
| 1296 | Ga0495652_0073538 | 3300046529 | Bacteria | 2845 |
| 1297 | Ga0495652_0074971 | 3300046529 | Unclassified | 2812 |
| 1298 | Ga0495652_0085318 | 3300046529 | Bacteria | 2595 |
| 1299 | Ga0495652_0086326 | 3300046529 | Bacteria | 2577 |
| 1300 | Ga0495652_0185471 | 3300046529 | Unclassified | 1592 |
| 1301 | Ga0495652_0249961 | 3300046529 | Bacteria | 1314 |
| 1302 | Ga0495652_0311528 | 3300046529 | Bacteria | 1140 |
| 1303 | Ga0495652_0321084 | 3300046529 | Bacteria | 1119 |
| 1304 | Ga0495652_0645350 | 3300046529 | Bacteria | 717 |
| 1305 | Ga0495665_0008673 | 3300046531 | Bacteria | 5518 |
| 1306 | Ga0495665_0049185 | 3300046531 | Bacteria | 2235 |
| 1307 | Ga0495665_0082628 | 3300046531 | Bacteria | 1689 |
| 1308 | Ga0495665_0088407 | 3300046531 | Bacteria | 1628 |
| 1309 | Ga0495665_0111653 | 3300046531 | Unclassified | 1433 |
| 1310 | Ga0495665_0146193 | 3300046531 | Unclassified | 1235 |
| 1311 | Ga0495665_0211031 | 3300046531 | Bacteria | 1005 |
| 1312 | Ga0495640_0015109 | 3300046533 | Bacteria | 5816 |
| 1313 | Ga0495640_0017597 | 3300046533 | Bacteria | 5321 |
| 1314 | Ga0495640_0020301 | 3300046533 | Bacteria | 4893 |
| 1315 | Ga0495640_0033180 | 3300046533 | Bacteria | 3670 |
| 1316 | Ga0495640_0049760 | 3300046533 | Bacteria | 2888 |
| 1317 | Ga0495640_0059001 | 3300046533 | Bacteria | 2615 |
| 1318 | Ga0495640_0075262 | 3300046533 | Bacteria | 2255 |
| 1319 | Ga0495640_0084767 | 3300046533 | Bacteria | 2101 |
| 1320 | Ga0495640_0148536 | 3300046533 | Bacteria | 1507 |
| 1321 | Ga0495640_0181958 | 3300046533 | Unclassified | 1339 |
| 1322 | Ga0495640_0319389 | 3300046533 | Bacteria | 962 |
| 1323 | Ga0495586_0038174 | 3300046535 | Bacteria | 2578 |
| 1324 | Ga0495586_0077563 | 3300046535 | Bacteria | 1821 |
| 1325 | Ga0495586_0129586 | 3300046535 | Unclassified | 1412 |
| 1326 | Ga0495586_0159291 | 3300046535 | Bacteria | 1273 |
| 1327 | Ga0495586_0324389 | 3300046535 | Unclassified | 883 |
| 1328 | Ga0495586_0406291 | 3300046535 | Bacteria | 784 |
| 1329 | Ga0495586_0485292 | 3300046535 | Bacteria | 713 |
| 1330 | Ga0495587_0000041 | 3300046536 | Bacteria | 110168 |
| 1331 | Ga0495587_0002545 | 3300046536 | Bacteria | 12192 |
| 1332 | Ga0495587_0003164 | 3300046536 | Bacteria | 11002 |
| 1333 | Ga0495587_0006468 | 3300046536 | Bacteria | 7632 |
| 1334 | Ga0495587_0020245 | 3300046536 | Bacteria | 4107 |
| 1335 | Ga0495587_0077639 | 3300046536 | Bacteria | 1927 |
| 1336 | Ga0495587_0082492 | 3300046536 | Bacteria | 1863 |
| 1337 | Ga0495587_0085962 | 3300046536 | Bacteria | 1820 |
| 1338 | Ga0495587_0108321 | 3300046536 | Bacteria | 1597 |
| 1339 | Ga0495645_0030131 | 3300046543 | Bacteria | 3951 |
| 1340 | Ga0495645_0035787 | 3300046543 | Bacteria | 3619 |
| 1341 | Ga0495645_0040681 | 3300046543 | Bacteria | 3390 |
| 1342 | Ga0495645_0052142 | 3300046543 | Bacteria | 2977 |
| 1343 | Ga0495645_0062859 | 3300046543 | Bacteria | 2688 |
| 1344 | Ga0495645_0072059 | 3300046543 | Bacteria | 2490 |
| 1345 | Ga0495645_0114655 | 3300046543 | Bacteria | 1904 |
| 1346 | Ga0495645_0117802 | 3300046543 | Bacteria | 1873 |
| 1347 | Ga0495645_0190744 | 3300046543 | Bacteria | 1397 |
| 1348 | Ga0495645_0260561 | 3300046543 | Bacteria | 1148 |
| 1349 | Ga0495645_0267992 | 3300046543 | Bacteria | 1128 |
| 1350 | Ga0495645_0364684 | 3300046543 | Bacteria | 928 |
| 1351 | Ga0495645_0433029 | 3300046543 | Bacteria | 832 |
| 1352 | Ga0495645_0461707 | 3300046543 | Unclassified | 799 |
| 1353 | Ga0495667_0000037 | 3300046559 | Bacteria | 133780 |
| 1354 | Ga0495667_0000421 | 3300046559 | Bacteria | 27190 |
| 1355 | Ga0495667_0000800 | 3300046559 | Bacteria | 20253 |
| 1356 | Ga0495667_0004264 | 3300046559 | Bacteria | 9639 |
| 1357 | Ga0495667_0009183 | 3300046559 | Bacteria | 6715 |
| 1358 | Ga0495667_0011013 | 3300046559 | Bacteria | 6113 |
| 1359 | Ga0495667_0019326 | 3300046559 | Bacteria | 4597 |
| 1360 | Ga0495667_0027470 | 3300046559 | Bacteria | 3834 |
| 1361 | Ga0495667_0034240 | 3300046559 | Bacteria | 3396 |
| 1362 | Ga0495667_0043787 | 3300046559 | Bacteria | 2965 |
| 1363 | Ga0495667_0056052 | 3300046559 | Bacteria | 2592 |
| 1364 | Ga0495667_0066308 | 3300046559 | Bacteria | 2360 |
| 1365 | Ga0495667_0090587 | 3300046559 | Bacteria | 1981 |
| 1366 | Ga0495667_0157246 | 3300046559 | Bacteria | 1462 |
| 1367 | Ga0495667_0411843 | 3300046559 | Bacteria | 851 |
| 1368 | Ga0495667_0435459 | 3300046559 | Unclassified | 824 |
| 1369 | Ga0495667_0544238 | 3300046559 | Unclassified | 725 |
| 1370 | Ga0495634_0010433 | 3300046642 | Bacteria | 6805 |
| 1371 | Ga0495634_0011439 | 3300046642 | Bacteria | 6462 |
| 1372 | Ga0495634_0053227 | 3300046642 | Bacteria | 2712 |
| 1373 | Ga0495634_0092595 | 3300046642 | Bacteria | 1961 |
| 1374 | Ga0495634_0319851 | 3300046642 | Bacteria | 934 |
| 1375 | Ga0495634_0500040 | 3300046642 | Unclassified | 713 |
| 1376 | Ga0495634_0600131 | 3300046642 | Bacteria | 639 |
| 1377 | Ga0495635_0002898 | 3300046663 | Bacteria | 11780 |
| 1378 | Ga0495635_0007111 | 3300046663 | Bacteria | 7826 |
| 1379 | Ga0495635_0032303 | 3300046663 | Bacteria | 3631 |
| 1380 | Ga0495635_0040020 | 3300046663 | Bacteria | 3241 |
| 1381 | Ga0495635_0042984 | 3300046663 | Bacteria | 3119 |
| 1382 | Ga0495635_0059737 | 3300046663 | Bacteria | 2621 |
| 1383 | Ga0495635_0064133 | 3300046663 | Bacteria | 2522 |
| 1384 | Ga0495635_0122135 | 3300046663 | Bacteria | 1776 |
| 1385 | Ga0495635_0144754 | 3300046663 | Bacteria | 1618 |
| 1386 | Ga0495635_0214678 | 3300046663 | Bacteria | 1302 |
| 1387 | Ga0495635_0655376 | 3300046663 | Bacteria | 683 |
| 1388 | Ga0495635_0667590 | 3300046663 | Unclassified | 675 |
| 1389 | Ga0495588_0165662 | 3300046674 | Bacteria | 1169 |
| 1390 | Ga0495588_0248622 | 3300046674 | Bacteria | 938 |
| 1391 | Ga0495657_0000094 | 3300046675 | Bacteria | 78779 |
| 1392 | Ga0495657_0003003 | 3300046675 | Bacteria | 13956 |
| 1393 | Ga0495657_0021904 | 3300046675 | Bacteria | 4582 |
| 1394 | Ga0495657_0030345 | 3300046675 | Bacteria | 3787 |
| 1395 | Ga0495657_0040493 | 3300046675 | Bacteria | 3195 |
| 1396 | Ga0495657_0043467 | 3300046675 | Bacteria | 3064 |
| 1397 | Ga0495657_0047804 | 3300046675 | Bacteria | 2890 |
| 1398 | Ga0495657_0052593 | 3300046675 | Bacteria | 2729 |
| 1399 | Ga0495657_0066023 | 3300046675 | Bacteria | 2378 |
| 1400 | Ga0495657_0097164 | 3300046675 | Bacteria | 1881 |
| 1401 | Ga0495657_0103176 | 3300046675 | Bacteria | 1814 |
| 1402 | Ga0495657_0120284 | 3300046675 | Bacteria | 1654 |
| 1403 | Ga0495657_0127573 | 3300046675 | Unclassified | 1597 |
| 1404 | Ga0495657_0142898 | 3300046675 | Bacteria | 1490 |
| 1405 | Ga0495599_0000040 | 3300046678 | Bacteria | 97423 |
| 1406 | Ga0495599_0002900 | 3300046678 | Bacteria | 9976 |
| 1407 | Ga0495599_0005848 | 3300046678 | Bacteria | 7385 |
| 1408 | Ga0495599_0009981 | 3300046678 | Bacteria | 5813 |
| 1409 | Ga0495599_0010351 | 3300046678 | Bacteria | 5703 |
| 1410 | Ga0495599_0032221 | 3300046678 | Bacteria | 3290 |
| 1411 | Ga0495599_0038601 | 3300046678 | Bacteria | 3001 |
| 1412 | Ga0495599_0193223 | 3300046678 | Bacteria | 1251 |
| 1413 | Ga0495599_0278142 | 3300046678 | Bacteria | 1014 |
| 1414 | Ga0495599_0359470 | 3300046678 | Unclassified | 872 |
| 1415 | Ga0495599_0384877 | 3300046678 | Unclassified | 837 |
| 1416 | Ga0495599_0401143 | 3300046678 | Bacteria | 817 |
| 1417 | Ga0495599_0408841 | 3300046678 | Bacteria | 807 |
| 1418 | Ga0495623_0000284 | 3300046679 | Bacteria | 32990 |
| 1419 | Ga0495623_0025339 | 3300046679 | Bacteria | 3820 |
| 1420 | Ga0495623_0027339 | 3300046679 | Bacteria | 3669 |
| 1421 | Ga0495623_0060472 | 3300046679 | Unclassified | 2377 |
| 1422 | Ga0495623_0066130 | 3300046679 | Bacteria | 2259 |
| 1423 | Ga0495623_0074365 | 3300046679 | Bacteria | 2111 |
| 1424 | Ga0495623_0168398 | 3300046679 | Bacteria | 1282 |
| 1425 | Ga0495623_0348223 | 3300046679 | Bacteria | 808 |
| 1426 | Ga0495646_0010148 | 3300046680 | Bacteria | 5988 |
| 1427 | Ga0495646_0020355 | 3300046680 | Bacteria | 4198 |
| 1428 | Ga0495646_0033771 | 3300046680 | Unclassified | 3180 |
| 1429 | Ga0495646_0053908 | 3300046680 | Bacteria | 2421 |
| 1430 | Ga0495646_0098108 | 3300046680 | Bacteria | 1683 |
| 1431 | Ga0495646_0148879 | 3300046680 | Bacteria | 1303 |
| 1432 | Ga0495646_0472108 | 3300046680 | Bacteria | 646 |
| 1433 | Ga0495647_0033564 | 3300046681 | Bacteria | 1918 |
| 1434 | Ga0495647_0045938 | 3300046681 | Bacteria | 1680 |
| 1435 | Ga0495647_0190530 | 3300046681 | Bacteria | 896 |
| 1436 | Ga0495647_0215784 | 3300046681 | Bacteria | 845 |
| 1437 | Ga0495647_0315318 | 3300046681 | Unclassified | 707 |
| 1438 | Ga0495658_0000946 | 3300046683 | Bacteria | 15487 |
| 1439 | Ga0495658_0035064 | 3300046683 | Bacteria | 2757 |
| 1440 | Ga0495658_0085296 | 3300046683 | Unclassified | 1861 |
| 1441 | Ga0495658_0092352 | 3300046683 | Bacteria | 1794 |
| 1442 | Ga0495658_0831232 | 3300046683 | Bacteria | 591 |
| 1443 | Ga0495658_0846115 | 3300046683 | Unclassified | 585 |
| 1444 | Ga0495613_0004518 | 3300046689 | Bacteria | 10433 |
| 1445 | Ga0495613_0011485 | 3300046689 | Bacteria | 6588 |
| 1446 | Ga0495613_0063652 | 3300046689 | Bacteria | 2698 |
| 1447 | Ga0495613_0072554 | 3300046689 | Bacteria | 2509 |
| 1448 | Ga0495613_0078390 | 3300046689 | Bacteria | 2403 |
| 1449 | Ga0495613_0085475 | 3300046689 | Bacteria | 2289 |
| 1450 | Ga0495624_0002604 | 3300046690 | Bacteria | 13611 |
| 1451 | Ga0495624_0006330 | 3300046690 | Bacteria | 8413 |
| 1452 | Ga0495624_0017938 | 3300046690 | Bacteria | 4742 |
| 1453 | Ga0495624_0032175 | 3300046690 | Bacteria | 3402 |
| 1454 | Ga0495624_0048265 | 3300046690 | Bacteria | 2703 |
| 1455 | Ga0495624_0197000 | 3300046690 | Unclassified | 1224 |
| 1456 | Ga0495624_0326890 | 3300046690 | Bacteria | 923 |
| 1457 | Ga0495624_0455125 | 3300046690 | Bacteria | 767 |
| 1458 | Ga0495600_0000803 | 3300046809 | Bacteria | 16646 |
| 1459 | Ga0495600_0003966 | 3300046809 | Bacteria | 8796 |
| 1460 | Ga0495600_0008834 | 3300046809 | Bacteria | 6204 |
| 1461 | Ga0495600_0015047 | 3300046809 | Bacteria | 4885 |
| 1462 | Ga0495600_0046491 | 3300046809 | Bacteria | 2831 |
| 1463 | Ga0495600_0062743 | 3300046809 | Bacteria | 2428 |
| 1464 | Ga0495600_0068838 | 3300046809 | Bacteria | 2313 |
| 1465 | Ga0495600_0078023 | 3300046809 | Bacteria | 2163 |
| 1466 | Ga0495600_0079409 | 3300046809 | Unclassified | 2142 |
| 1467 | Ga0495600_0154704 | 3300046809 | Bacteria | 1483 |
| 1468 | Ga0495600_0403190 | 3300046809 | Bacteria | 851 |
| 1469 | Ga0495581_0004483 | 3300047315 | Bacteria | 8074 |
| 1470 | Ga0495581_0015778 | 3300047315 | Bacteria | 4386 |
| 1471 | Ga0495581_0028979 | 3300047315 | Bacteria | 3210 |
| 1472 | Ga0495581_0037596 | 3300047315 | Bacteria | 2802 |
| 1473 | Ga0495581_0037870 | 3300047315 | Bacteria | 2791 |
| 1474 | Ga0495604_0000040 | 3300047317 | Bacteria | 120837 |
| 1475 | Ga0495604_0014873 | 3300047317 | Bacteria | 6207 |
| 1476 | Ga0495604_0022068 | 3300047317 | Bacteria | 5081 |
| 1477 | Ga0495604_0024377 | 3300047317 | Bacteria | 4826 |
| 1478 | Ga0495604_0074084 | 3300047317 | Bacteria | 2567 |
| 1479 | Ga0495604_0131783 | 3300047317 | Bacteria | 1796 |
| 1480 | Ga0495604_0163256 | 3300047317 | Bacteria | 1572 |
| 1481 | Ga0495604_0182639 | 3300047317 | Bacteria | 1466 |
| 1482 | Ga0495604_0187379 | 3300047317 | Unclassified | 1444 |
| 1483 | Ga0495674_0000257 | 3300047319 | Bacteria | 45119 |
| 1484 | Ga0495674_0045612 | 3300047319 | Bacteria | 3892 |
| 1485 | Ga0495674_0053795 | 3300047319 | Bacteria | 3537 |
| 1486 | Ga0495674_0054363 | 3300047319 | Bacteria | 3516 |
| 1487 | Ga0495674_0064729 | 3300047319 | Bacteria | 3177 |
| 1488 | Ga0495674_0082232 | 3300047319 | Bacteria | 2761 |
| 1489 | Ga0495674_0094041 | 3300047319 | Bacteria | 2557 |
| 1490 | Ga0495674_0120504 | 3300047319 | Bacteria | 2216 |
| 1491 | Ga0495674_0221591 | 3300047319 | Bacteria | 1563 |
| 1492 | Ga0495674_0335528 | 3300047319 | Bacteria | 1229 |
| 1493 | Ga0495674_0398343 | 3300047319 | Unclassified | 1111 |
| 1494 | Ga0495674_0424028 | 3300047319 | Bacteria | 1071 |
| 1495 | Ga0495674_0668777 | 3300047319 | Bacteria | 817 |
| 1496 | Ga0495674_0740959 | 3300047319 | Unclassified | 768 |
| 1497 | Ga0495674_0928457 | 3300047319 | Unclassified | 670 |
| 1498 | Ga0495674_1019563 | 3300047319 | Bacteria | 633 |
| 1499 | Ga0495674_1104308 | 3300047319 | Unclassified | 603 |
| 1500 | Ga0495676_0000700 | 3300047321 | Bacteria | 27875 |
| 1501 | Ga0495676_0020351 | 3300047321 | Bacteria | 5822 |
| 1502 | Ga0495676_0047635 | 3300047321 | Bacteria | 3463 |
| 1503 | Ga0495676_0150426 | 3300047321 | Bacteria | 1657 |
| 1504 | Ga0495676_0435237 | 3300047321 | Bacteria | 866 |
| 1505 | Ga0495680_0000010 | 3300047322 | Bacteria | 142931 |
| 1506 | Ga0495680_0010497 | 3300047322 | Bacteria | 8264 |
| 1507 | Ga0495680_0010698 | 3300047322 | Bacteria | 8182 |
| 1508 | Ga0495680_0013172 | 3300047322 | Bacteria | 7226 |
| 1509 | Ga0495680_0013767 | 3300047322 | Bacteria | 7038 |
| 1510 | Ga0495680_0014838 | 3300047322 | Bacteria | 6735 |
| 1511 | Ga0495680_0016768 | 3300047322 | Bacteria | 6280 |
| 1512 | Ga0495680_0029749 | 3300047322 | Bacteria | 4469 |
| 1513 | Ga0495680_0038010 | 3300047322 | Bacteria | 3851 |
| 1514 | Ga0495680_0049590 | 3300047322 | Bacteria | 3288 |
| 1515 | Ga0495680_0059578 | 3300047322 | Bacteria | 2946 |
| 1516 | Ga0495680_0068511 | 3300047322 | Bacteria | 2710 |
| 1517 | Ga0495680_0087590 | 3300047322 | Bacteria | 2341 |
| 1518 | Ga0495680_0096053 | 3300047322 | Unclassified | 2214 |
| 1519 | Ga0495680_0276036 | 3300047322 | Unclassified | 1185 |
| 1520 | Ga0495680_0291630 | 3300047322 | Unclassified | 1147 |
| 1521 | Ga0495680_0452998 | 3300047322 | Bacteria | 878 |
| 1522 | Ga0495680_0510352 | 3300047322 | Bacteria | 815 |
| 1523 | Ga0495680_0559823 | 3300047322 | Bacteria | 769 |
| 1524 | Ga0495680_0573177 | 3300047322 | Bacteria | 758 |
| 1525 | Ga0495675_0000111 | 3300047444 | Bacteria | 58822 |
| 1526 | Ga0495675_0006911 | 3300047444 | Bacteria | 6968 |
| 1527 | Ga0495675_0150205 | 3300047444 | Unclassified | 1440 |
| 1528 | Ga0495675_0180580 | 3300047444 | Bacteria | 1292 |
| 1529 | Ga0495675_0305886 | 3300047444 | Bacteria | 943 |
| 1530 | Ga0495684_0000641 | 3300047471 | Bacteria | 28128 |
| 1531 | Ga0495684_0009245 | 3300047471 | Bacteria | 7610 |
| 1532 | Ga0495684_0009309 | 3300047471 | Bacteria | 7581 |
| 1533 | Ga0495684_0018560 | 3300047471 | Bacteria | 5357 |
| 1534 | Ga0495684_0020458 | 3300047471 | Bacteria | 5100 |
| 1535 | Ga0495684_0031019 | 3300047471 | Bacteria | 4103 |
| 1536 | Ga0495684_0034267 | 3300047471 | Bacteria | 3896 |
| 1537 | Ga0495684_0079617 | 3300047471 | Unclassified | 2487 |
| 1538 | Ga0495684_0083078 | 3300047471 | Bacteria | 2429 |
| 1539 | Ga0495684_0125520 | 3300047471 | Bacteria | 1931 |
| 1540 | Ga0495684_0129501 | 3300047471 | Bacteria | 1896 |
| 1541 | Ga0495684_0198864 | 3300047471 | Bacteria | 1478 |
| 1542 | Ga0495684_0217398 | 3300047471 | Bacteria | 1402 |
| 1543 | Ga0495684_0375752 | 3300047471 | Bacteria | 1003 |
| 1544 | Ga0495684_0416822 | 3300047471 | Unclassified | 939 |
| 1545 | Ga0495684_0644354 | 3300047471 | Bacteria | 709 |
| 1546 | Ga0495593_0009511 | 3300047673 | Bacteria | 5639 |
| 1547 | Ga0495593_0018083 | 3300047673 | Bacteria | 3963 |
| 1548 | Ga0495593_0043192 | 3300047673 | Bacteria | 2416 |
| 1549 | Ga0495593_0157171 | 3300047673 | Bacteria | 1149 |
| 1550 | Ga0495593_0500001 | 3300047673 | Unclassified | 609 |
| 1551 | Ga0495602_0000130 | 3300048088 | Bacteria | 71178 |
| 1552 | Ga0495602_0002822 | 3300048088 | Bacteria | 17774 |
| 1553 | Ga0495602_0008980 | 3300048088 | Bacteria | 10415 |
| 1554 | Ga0495602_0025415 | 3300048088 | Bacteria | 5731 |
| 1555 | Ga0495602_0026049 | 3300048088 | Bacteria | 5648 |
| 1556 | Ga0495602_0057636 | 3300048088 | Bacteria | 3406 |
| 1557 | Ga0495602_0063939 | 3300048088 | Bacteria | 3185 |
| 1558 | Ga0495602_0075199 | 3300048088 | Bacteria | 2867 |
| 1559 | Ga0495602_0083382 | 3300048088 | Bacteria | 2678 |
| 1560 | Ga0495602_0184792 | 3300048088 | Unclassified | 1604 |
| 1561 | Ga0495602_0185362 | 3300048088 | Bacteria | 1601 |
| 1562 | Ga0495602_0292628 | 3300048088 | Bacteria | 1195 |
| 1563 | Ga0495602_0369990 | 3300048088 | Unclassified | 1029 |
| 1564 | Ga0495602_0712107 | 3300048088 | Unclassified | 680 |
| 1565 | Ga0495614_0005861 | 3300048089 | Bacteria | 5535 |
| 1566 | Ga0495614_0026653 | 3300048089 | Bacteria | 2492 |
| 1567 | Ga0495614_0030574 | 3300048089 | Bacteria | 2318 |
| 1568 | Ga0495614_0325448 | 3300048089 | Bacteria | 713 |
| 1569 | Ga0496100_0009329 | 3300048903 | Bacteria | 5514 |
| 1570 | Ga0496100_0073862 | 3300048903 | Unclassified | 2283 |
| 1571 | Ga0496100_0226749 | 3300048903 | Bacteria | 1373 |
| 1572 | Ga0496100_0339081 | 3300048903 | Bacteria | 1133 |
| 1573 | Ga0496100_0490707 | 3300048903 | Unclassified | 945 |
| 1574 | Ga0496101_0065686 | 3300048904 | Bacteria | 2645 |
| 1575 | Ga0496101_0240698 | 3300048904 | Unclassified | 1408 |
| 1576 | Ga0496101_0292110 | 3300048904 | Unclassified | 1275 |
| 1577 | Ga0496101_0457172 | 3300048904 | Bacteria | 1007 |
| 1578 | Ga0496101_0901869 | 3300048904 | Unclassified | 696 |
| 1579 | Ga0496101_0936434 | 3300048904 | Bacteria | 682 |
| 1580 | Ga0496102_0021857 | 3300048905 | Bacteria | 5663 |
| 1581 | Ga0496102_0047254 | 3300048905 | Bacteria | 3910 |
| 1582 | Ga0496102_0065897 | 3300048905 | Bacteria | 3320 |
| 1583 | Ga0496102_0119431 | 3300048905 | Bacteria | 2461 |
| 1584 | Ga0496102_0264690 | 3300048905 | Unclassified | 1621 |
| 1585 | Ga0496102_0439573 | 3300048905 | Bacteria | 1224 |
| 1586 | Ga0496102_0471923 | 3300048905 | Bacteria | 1176 |
| 1587 | Ga0496102_0539972 | 3300048905 | Unclassified | 1088 |
| 1588 | Ga0496103_0019954 | 3300048906 | Unclassified | 4025 |
| 1589 | Ga0496103_0129345 | 3300048906 | Bacteria | 1612 |
| 1590 | Ga0496103_0591173 | 3300048906 | Unclassified | 707 |
| 1591 | Ga0496103_0674244 | 3300048906 | Unclassified | 656 |
| 1592 | Ga0496104_0001728 | 3300048907 | Bacteria | 18862 |
| 1593 | Ga0496104_0005984 | 3300048907 | Bacteria | 10656 |
| 1594 | Ga0496104_0013896 | 3300048907 | Bacteria | 7263 |
| 1595 | Ga0496104_0096280 | 3300048907 | Bacteria | 2831 |
| 1596 | Ga0496104_0213677 | 3300048907 | Bacteria | 1840 |
| 1597 | Ga0496104_0394181 | 3300048907 | Bacteria | 1297 |
| 1598 | Ga0496104_0537481 | 3300048907 | Bacteria | 1080 |
| 1599 | Ga0496105_0005569 | 3300048908 | Bacteria | 9562 |
| 1600 | Ga0496105_0009713 | 3300048908 | Bacteria | 7536 |
| 1601 | Ga0496105_0024538 | 3300048908 | Bacteria | 4899 |
| 1602 | Ga0496105_0047663 | 3300048908 | Bacteria | 3536 |
| 1603 | Ga0496105_0497826 | 3300048908 | Bacteria | 957 |
| 1604 | Ga0496106_0016858 | 3300048909 | Bacteria | 5406 |
| 1605 | Ga0496106_0019946 | 3300048909 | Bacteria | 4972 |
| 1606 | Ga0496106_0137287 | 3300048909 | Bacteria | 1921 |
| 1607 | Ga0496106_0203804 | 3300048909 | Bacteria | 1575 |
| 1608 | Ga0496107_0107452 | 3300048910 | Bacteria | 2049 |
| 1609 | Ga0496107_0430193 | 3300048910 | Bacteria | 981 |
| 1610 | Ga0496108_0003239 | 3300048911 | Bacteria | 13091 |
| 1611 | Ga0496108_0027260 | 3300048911 | Bacteria | 4716 |
| 1612 | Ga0496108_0031025 | 3300048911 | Bacteria | 4431 |
| 1613 | Ga0496108_0046864 | 3300048911 | Bacteria | 3612 |
| 1614 | Ga0496108_0054206 | 3300048911 | Bacteria | 3365 |
| 1615 | Ga0496108_0069275 | 3300048911 | Bacteria | 2976 |
| 1616 | Ga0496108_0121284 | 3300048911 | Bacteria | 2242 |
| 1617 | Ga0496108_1197694 | 3300048911 | Unclassified | 642 |
| 1618 | Ga0496109_0035177 | 3300048912 | Bacteria | 4516 |
| 1619 | Ga0496109_0042748 | 3300048912 | Bacteria | 4106 |
| 1620 | Ga0496109_0065907 | 3300048912 | Bacteria | 3315 |
| 1621 | Ga0496109_0097059 | 3300048912 | Bacteria | 2731 |
| 1622 | Ga0496109_0132392 | 3300048912 | Bacteria | 2328 |
| 1623 | Ga0496109_0156639 | 3300048912 | Bacteria | 2134 |
| 1624 | Ga0496109_0181416 | 3300048912 | Bacteria | 1977 |
| 1625 | Ga0496109_0203472 | 3300048912 | Bacteria | 1862 |
| 1626 | Ga0496109_0811560 | 3300048912 | Bacteria | 873 |
| 1627 | Ga0496109_1118975 | 3300048912 | Bacteria | 724 |
| 1628 | Ga0496109_1163527 | 3300048912 | Bacteria | 708 |
| 1629 | Ga0496110_0009668 | 3300048913 | Bacteria | 7809 |
| 1630 | Ga0496110_0018783 | 3300048913 | Bacteria | 5803 |
| 1631 | Ga0496110_0036569 | 3300048913 | Bacteria | 4264 |
| 1632 | Ga0496110_0385973 | 3300048913 | Bacteria | 1276 |
| 1633 | Ga0496110_0425521 | 3300048913 | Bacteria | 1210 |
| 1634 | Ga0496110_1087753 | 3300048913 | Unclassified | 707 |
| 1635 | Ga0496110_1686624 | 3300048913 | Unclassified | 544 |
| 1636 | Ga0496110_1887134 | 3300048913 | Bacteria | 507 |
| 1637 | Ga0496111_0016631 | 3300048914 | Bacteria | 5072 |
| 1638 | Ga0496111_0017434 | 3300048914 | Bacteria | 4965 |
| 1639 | Ga0496111_0036631 | 3300048914 | Bacteria | 3508 |
| 1640 | Ga0496111_0334317 | 3300048914 | Unclassified | 1121 |
| 1641 | Ga0496111_0712600 | 3300048914 | Bacteria | 729 |
| 1642 | Ga0496112_0041837 | 3300048915 | Bacteria | 4483 |
| 1643 | Ga0496112_0059748 | 3300048915 | Bacteria | 3756 |
| 1644 | Ga0496112_0105794 | 3300048915 | Bacteria | 2783 |
| 1645 | Ga0496112_0129818 | 3300048915 | Bacteria | 2491 |
| 1646 | Ga0496112_0202951 | 3300048915 | Bacteria | 1941 |
| 1647 | Ga0496112_0230762 | 3300048915 | Bacteria | 1805 |
| 1648 | Ga0496112_0247940 | 3300048915 | Bacteria | 1733 |
| 1649 | Ga0496112_0464343 | 3300048915 | Bacteria | 1203 |
| 1650 | Ga0496113_0011035 | 3300048916 | Bacteria | 6005 |
| 1651 | Ga0496113_0215690 | 3300048916 | Bacteria | 1528 |
| 1652 | Ga0496113_0408343 | 3300048916 | Unclassified | 1090 |
| 1653 | Ga0496113_0537845 | 3300048916 | Unclassified | 937 |
| 1654 | Ga0496114_0023617 | 3300048917 | Bacteria | 5018 |
| 1655 | Ga0496114_0123980 | 3300048917 | Bacteria | 2225 |
| 1656 | Ga0496114_0164480 | 3300048917 | Bacteria | 1931 |
| 1657 | Ga0496114_0169086 | 3300048917 | Bacteria | 1904 |
| 1658 | Ga0496114_0277953 | 3300048917 | Bacteria | 1476 |
| 1659 | Ga0496114_1635398 | 3300048917 | Unclassified | 532 |
| 1660 | Ga0496115_0011631 | 3300048918 | Bacteria | 6602 |
| 1661 | Ga0496115_0099596 | 3300048918 | Bacteria | 2382 |
| 1662 | Ga0496115_0260350 | 3300048918 | Bacteria | 1426 |
| 1663 | Ga0496126_0020236 | 3300048929 | Bacteria | 6531 |
| 1664 | Ga0496126_0052999 | 3300048929 | Bacteria | 3683 |
| 1665 | nmdc:mga00v17_361463_c1 | 3300050491 | Unclassified | 944 |
| 1666 | nmdc:mga00v17_994478_c1 | 3300050491 | Bacteria | 528 |
| 1667 | nmdc:mga0yw44_12527_c1 | 3300050492 | Bacteria | 4426 |
| 1668 | nmdc:mga0yw44_6553_c1 | 3300050492 | Bacteria | 5637 |
| 1669 | nmdc:mga05p37_1049985_c1 | 3300050507 | Bacteria | 859 |
| 1670 | nmdc:mga05p37_139868_c1 | 3300050507 | Bacteria | 2966 |
| 1671 | nmdc:mga05p37_264060_c1 | 3300050507 | Bacteria | 2059 |
| 1672 | nmdc:mga05p37_269737_c1 | 3300050507 | Bacteria | 2034 |
| 1673 | nmdc:mga05p37_78117_c1 | 3300050507 | Bacteria | 4075 |
| 1674 | nmdc:mga05p37_98037_c1 | 3300050507 | Bacteria | 3611 |
| 1675 | nmdc:mga09592_487827_c1 | 3300050508 | Bacteria | 1061 |
| 1676 | nmdc:mga0qj67_286715_c1 | 3300050509 | Bacteria | 1334 |
| 1677 | nmdc:mga0qj67_597220_c1 | 3300050509 | Bacteria | 883 |
| 1678 | nmdc:mga06r32_1586_c1 | 3300050510 | Bacteria | 20490 |
| 1679 | nmdc:mga06r32_485283_c1 | 3300050510 | Bacteria | 1213 |
| 1680 | nmdc:mga08y16_146281_c1 | 3300050511 | Bacteria | 2457 |
| 1681 | nmdc:mga08y16_182705_c1 | 3300050511 | Bacteria | 2177 |
| 1682 | nmdc:mga08y16_27538_c1 | 3300050511 | Bacteria | 5988 |
| 1683 | nmdc:mga08y16_30083_c1 | 3300050511 | Bacteria | 5717 |
| 1684 | nmdc:mga0n895_1147983_c1 | 3300050512 | Bacteria | 753 |
| 1685 | nmdc:mga0n895_1722097_c1 | 3300050512 | Unclassified | 589 |
| 1686 | nmdc:mga0n895_205608_c1 | 3300050512 | Bacteria | 1999 |
| 1687 | nmdc:mga0n895_28072_c1 | 3300050512 | Bacteria | 5351 |
| 1688 | nmdc:mga0n895_4006_c1 | 3300050512 | Bacteria | 11980 |
| 1689 | nmdc:mga0n895_47170_c1 | 3300050512 | Bacteria | 4212 |
| 1690 | nmdc:mga0n895_474028_c1 | 3300050512 | Bacteria | 1263 |
| 1691 | nmdc:mga0n895_475446_c1 | 3300050512 | Unclassified | 1261 |
| 1692 | nmdc:mga0n895_633187_c1 | 3300050512 | Bacteria | 1069 |
| 1693 | nmdc:mga0rr50_114849_c1 | 3300050513 | Bacteria | 2136 |
| 1694 | nmdc:mga0rr50_13459_c1 | 3300050513 | Bacteria | 5327 |
| 1695 | nmdc:mga0rr50_225611_c1 | 3300050513 | Unclassified | 1549 |
| 1696 | nmdc:mga0rr50_226123_c1 | 3300050513 | Bacteria | 1547 |
| 1697 | nmdc:mga0rr50_289822_c1 | 3300050513 | Bacteria | 1367 |
| 1698 | nmdc:mga0rr50_50055_c1 | 3300050513 | Bacteria | 3095 |
| 1699 | nmdc:mga0rr50_510610_c1 | 3300050513 | Unclassified | 1022 |
| 1700 | nmdc:mga0rr50_5547_c1 | 3300050513 | Bacteria | 7543 |
| 1701 | nmdc:mga0rr50_915273_c1 | 3300050513 | Bacteria | 748 |
| 1702 | nmdc:mga08x19_111689_c1 | 3300050514 | Bacteria | 1824 |
| 1703 | nmdc:mga08x19_219966_c1 | 3300050514 | Bacteria | 1305 |
| 1704 | nmdc:mga08x19_481230_c1 | 3300050514 | Bacteria | 875 |
| 1705 | nmdc:mga08x19_491163_c1 | 3300050514 | Unclassified | 866 |
| 1706 | nmdc:mga08x19_51308_c1 | 3300050514 | Bacteria | 2650 |
| 1707 | nmdc:mga0a205_1568058_c1 | 3300050515 | Bacteria | 507 |
| 1708 | nmdc:mga0a205_20148_c1 | 3300050515 | Bacteria | 6292 |
| 1709 | nmdc:mga0a205_43005_c1 | 3300050515 | Bacteria | 4355 |
| 1710 | nmdc:mga0a205_45094_c1 | 3300050515 | Bacteria | 4251 |
| 1711 | nmdc:mga0a205_497045_c1 | 3300050515 | Unclassified | 1077 |
| 1712 | nmdc:mga0a205_57492_c1 | 3300050515 | Bacteria | 3756 |
| 1713 | Ga0495601_0007905 | 3300053077 | Bacteria | 6263 |
| 1714 | Ga0495601_0019038 | 3300053077 | Bacteria | 4183 |
| 1715 | Ga0495601_0040024 | 3300053077 | Bacteria | 2935 |
| 1716 | Ga0495601_0053164 | 3300053077 | Unclassified | 2559 |
| 1717 | Ga0495601_0088130 | 3300053077 | Bacteria | 1996 |
| 1718 | Ga0495601_0093801 | 3300053077 | Bacteria | 1934 |
| 1719 | Ga0495601_0158429 | 3300053077 | Bacteria | 1479 |
| 1720 | Ga0495601_0159689 | 3300053077 | Unclassified | 1473 |
| 1721 | Ga0495601_0230971 | 3300053077 | Bacteria | 1208 |
| 1722 | Ga0495601_0320700 | 3300053077 | Bacteria | 1009 |
| 1723 | Ga0495601_0325432 | 3300053077 | Bacteria | 1001 |
| 1724 | Ga0495601_0431746 | 3300053077 | Bacteria | 853 |
| 1725 | Ga0495612_0006041 | 3300053078 | Bacteria | 4988 |
| 1726 | Ga0495612_0024731 | 3300053078 | Bacteria | 2411 |
| 1727 | Ga0495612_0032374 | 3300053078 | Bacteria | 2112 |
| 1728 | Ga0495595_0000204 | 3300053084 | Bacteria | 24016 |
| 1729 | Ga0495595_0017370 | 3300053084 | Bacteria | 3095 |
| 1730 | Ga0495595_0021912 | 3300053084 | Bacteria | 2798 |
| 1731 | Ga0495595_0053472 | 3300053084 | Bacteria | 1876 |
| 1732 | Ga0495595_0061234 | 3300053084 | Unclassified | 1762 |
| 1733 | Ga0495595_0062215 | 3300053084 | Bacteria | 1749 |
| 1734 | Ga0495595_0086385 | 3300053084 | Bacteria | 1501 |
| 1735 | Ga0495595_0566120 | 3300053084 | Unclassified | 580 |
| 1736 | Ga0495619_0012940 | 3300053085 | Bacteria | 5255 |
| 1737 | Ga0495619_0018409 | 3300053085 | Bacteria | 4432 |
| 1738 | Ga0495619_0073122 | 3300053085 | Bacteria | 2297 |
| 1739 | Ga0495619_0154585 | 3300053085 | Bacteria | 1583 |
| 1740 | Ga0495619_0180006 | 3300053085 | Bacteria | 1462 |
| 1741 | Ga0495619_0186568 | 3300053085 | Bacteria | 1435 |
| 1742 | Ga0495619_0192053 | 3300053085 | Bacteria | 1413 |
| 1743 | Ga0495619_0320892 | 3300053085 | Unclassified | 1072 |
| 1744 | Ga0495619_0501854 | 3300053085 | Unclassified | 834 |
| 1745 | Ga0495619_0846376 | 3300053085 | Unclassified | 617 |
| 1746 | Ga0500554_027937 | 3300053102 | Bacteria | 1636 |
| 1747 | Ga0587084_027844 | 3300059477 | Bacteria | 891 |
| 1748 | Ga0587084_091673 | 3300059477 | Unclassified | 604 |
| 1749 | Ga0587066_091206 | 3300059490 | Bacteria | 677 |
| 1750 | Ga0587070_131178 | 3300059491 | Bacteria | 610 |
| 1751 | Ga0587070_216049 | 3300059491 | Bacteria | 517 |
| 1752 | Ga0587073_0032714 | 3300059492 | Bacteria | 1085 |
| 1753 | Ga0587073_0085465 | 3300059492 | Bacteria | 792 |
| 1754 | Ga0587077_147919 | 3300059493 | Unclassified | 611 |
| 1755 | Ga0587083_0072319 | 3300059505 | Unclassified | 803 |
| 1756 | Ga0587092_066169 | 3300059512 | Bacteria | 687 |
| 1757 | Ga0587062_073076 | 3300059639 | Bacteria | 624 |
| 1758 | Ga0587067_109788 | 3300059640 | Bacteria | 649 |
| 1759 | Ga0587072_014866 | 3300059643 | Bacteria | 1316 |
| 1760 | Ga0587076_133003 | 3300059645 | Bacteria | 588 |
| 1761 | Ga0587078_050557 | 3300059646 | Unclassified | 608 |
| 1762 | Ga0587079_023847 | 3300059647 | Bacteria | 1123 |
| 1763 | Ga0587071_123395 | 3300060344 | Bacteria | 621 |
| 1764 | Ga0587111_0014553 | 3300060346 | Bacteria | 1424 |
| 1765 | Ga0163163_10318727 | |||
| 1766 | JGI24737J22298_10048834 | |||
| 1767 | JGI24751J29686_10003466 | |||
| 1768 | JGI25404J52841_10015743 | |||
| 1769 | JGI25404J52841_10122746 | |||
| 1770 | Ga0058859_11761553 | |||
| 1771 | Ga0058863_10863976 | |||
| 1772 | Ga0058863_11945211 | |||
| 1773 | Ga0058861_11806364 | |||
| 1774 | Ga0058861_12027980 | |||
| 1775 | Ga0058862_12725586 | |||
| 1776 | Ga0058862_12799539 | |||
| 1777 | Ga0070658_10013242 | |||
| 1778 | Ga0070658_10022197 | |||
| 1779 | Ga0070683_100331248 | |||
| 1780 | Ga0070683_101935747 | |||
| 1781 | Ga0070670_100047936 | |||
| 1782 | Ga0070677_10744136 | |||
| 1783 | Ga0068869_100005709 | |||
| 1784 | Ga0068869_100108144 | |||
| 1785 | Ga0068869_100393202 | |||
| 1786 | Ga0068869_101035705 | |||
| 1787 | Ga0070666_10113467 | |||
| 1788 | Ga0070666_10407319 | |||
| 1789 | Ga0070680_100011453 | |||
| 1790 | Ga0070680_101415576 | |||
| 1791 | Ga0070682_100005887 | |||
| 1792 | Ga0070682_100115052 | |||
| 1793 | Ga0070682_100279391 | |||
| 1794 | Ga0070682_100377655 | |||
| 1795 | Ga0070682_100532683 | |||
| 1796 | Ga0070682_101158633 | |||
| 1797 | Ga0070682_101631775 | |||
| 1798 | Ga0068868_100007699 | |||
| 1799 | Ga0068868_100022775 | |||
| 1800 | Ga0068868_100137865 | |||
| 1801 | Ga0068868_100979543 | |||
| 1802 | Ga0068868_101077252 | |||
| 1803 | Ga0070660_100040979 | |||
| 1804 | Ga0070660_100183639 | |||
| 1805 | Ga0070660_100255252 | |||
| 1806 | Ga0070689_100328654 | |||
| 1807 | Ga0070689_100366066 | |||
| 1808 | Ga0070689_100385187 | |||
| 1809 | Ga0070691_10127749 | |||
| 1810 | Ga0070691_10227311 | |||
| 1811 | Ga0070691_10236913 | |||
| 1812 | Ga0070687_100049477 | |||
| 1813 | Ga0070687_100422565 | |||
| 1814 | Ga0070687_100437324 | |||
| 1815 | Ga0070661_100012300 | |||
| 1816 | Ga0070692_10002327 | |||
| 1817 | Ga0070692_10017091 | |||
| 1818 | Ga0070692_10236109 | |||
| 1819 | Ga0070692_10426667 | |||
| 1820 | Ga0070668_100142063 | |||
| 1821 | Ga0070668_101359363 | |||
| 1822 | Ga0070669_100179537 | |||
| 1823 | Ga0070675_100005056 | |||
| 1824 | Ga0070675_100013842 | |||
| 1825 | Ga0070675_100883745 | |||
| 1826 | Ga0070671_100011302 | |||
| 1827 | Ga0070671_100159317 | |||
| 1828 | Ga0070671_100634399 | |||
| 1829 | Ga0070674_100160540 | |||
| 1830 | Ga0070674_102065845 | |||
| 1831 | Ga0070673_100055617 | |||
| 1832 | Ga0070673_100166133 | |||
| 1833 | Ga0070673_100837679 | |||
| 1834 | Ga0070688_100270345 | |||
| 1835 | Ga0070659_100008993 | |||
| 1836 | Ga0070659_100032143 | |||
| 1837 | Ga0070659_100598180 | |||
| 1838 | Ga0070703_10009847 | |||
| 1839 | Ga0070703_10178025 | |||
| 1840 | Ga0070703_10417537 | |||
| 1841 | Ga0070709_10010150 | |||
| 1842 | Ga0070709_10024217 | |||
| 1843 | Ga0070709_10033342 | |||
| 1844 | Ga0070709_10130683 | |||
| 1845 | Ga0070709_10178205 | |||
| 1846 | Ga0070709_10303590 | |||
| 1847 | Ga0070709_10521302 | |||
| 1848 | Ga0070709_10531241 | |||
| 1849 | Ga0070709_10561563 | |||
| 1850 | Ga0070714_100001782 | |||
| 1851 | Ga0070714_100005462 | |||
| 1852 | Ga0070714_100014506 | |||
| 1853 | Ga0070714_100016824 | |||
| 1854 | Ga0070714_100043249 | |||
| 1855 | Ga0070714_100048641 | |||
| 1856 | Ga0070714_100063241 | |||
| 1857 | Ga0070714_100081303 | |||
| 1858 | Ga0070714_100107667 | |||
| 1859 | Ga0070714_100145393 | |||
| 1860 | Ga0070714_100341632 | |||
| 1861 | Ga0070714_100422658 | |||
| 1862 | Ga0070714_100844833 | |||
| 1863 | Ga0070714_100862154 | |||
| 1864 | Ga0070714_101049828 | |||
| 1865 | Ga0070713_100002466 | |||
| 1866 | Ga0070713_100010817 | |||
| 1867 | Ga0070713_100010914 | |||
| 1868 | Ga0070713_100013244 | |||
| 1869 | Ga0070713_100016564 | |||
| 1870 | Ga0070713_100020352 | |||
| 1871 | Ga0070713_100046937 | |||
| 1872 | Ga0070713_100074544 | |||
| 1873 | Ga0070713_100098438 | |||
| 1874 | Ga0070713_100127147 | |||
| 1875 | Ga0070713_100153422 | |||
| 1876 | Ga0070713_100303044 | |||
| 1877 | Ga0070713_100353648 | |||
| 1878 | Ga0070713_100383151 | |||
| 1879 | Ga0070713_100884862 | |||
| 1880 | Ga0070713_100928769 | |||
| 1881 | Ga0070713_101557069 | |||
| 1882 | Ga0070710_10002186 | |||
| 1883 | Ga0070710_10003232 | |||
| 1884 | Ga0070710_10026286 | |||
| 1885 | Ga0070710_10069495 | |||
| 1886 | Ga0070710_10128625 | |||
| 1887 | Ga0070710_10135280 | |||
| 1888 | Ga0070710_10146747 | |||
| 1889 | Ga0070710_10232187 | |||
| 1890 | Ga0070710_10266914 | |||
| 1891 | Ga0070710_10272911 | |||
| 1892 | Ga0070710_10294791 | |||
| 1893 | Ga0070710_11386341 | |||
| 1894 | Ga0070711_100009327 | |||
| 1895 | Ga0070711_100010966 | |||
| 1896 | Ga0070711_100017065 | |||
| 1897 | Ga0070711_100019269 | |||
| 1898 | Ga0070711_100057333 | |||
| 1899 | Ga0070711_100117781 | |||
| 1900 | Ga0070711_100140960 | |||
| 1901 | Ga0070711_100229625 | |||
| 1902 | Ga0070711_100256564 | |||
| 1903 | Ga0070711_100350328 | |||
| 1904 | Ga0070711_100619474 | |||
| 1905 | Ga0070711_100728634 | |||
| 1906 | Ga0070711_100846385 | |||
| 1907 | Ga0070711_101576170 | |||
| 1908 | Ga0070711_101828452 | |||
| 1909 | Ga0070705_100042306 | |||
| 1910 | Ga0070705_100053930 | |||
| 1911 | Ga0070705_100182225 | |||
| 1912 | Ga0070705_100660111 | |||
| 1913 | Ga0070705_101217671 | |||
| 1914 | Ga0070700_100013534 | |||
| 1915 | Ga0070700_100063331 | |||
| 1916 | Ga0070700_100081369 | |||
| 1917 | Ga0070700_100343350 | |||
| 1918 | Ga0070694_100029171 | |||
| 1919 | Ga0070694_100117259 | |||
| 1920 | Ga0070708_100161848 | |||
| 1921 | Ga0070708_100229508 | |||
| 1922 | Ga0070708_100259477 | |||
| 1923 | Ga0070708_100468533 | |||
| 1924 | Ga0070708_100745116 | |||
| 1925 | Ga0070708_100799236 | |||
| 1926 | Ga0070708_101157604 | |||
| 1927 | Ga0070663_100011604 | |||
| 1928 | Ga0070663_100014065 | |||
| 1929 | Ga0070663_100457016 | |||
| 1930 | Ga0070678_100002952 | |||
| 1931 | Ga0070678_100490789 | |||
| 1932 | Ga0070678_100958821 | |||
| 1933 | Ga0070662_100005844 | |||
| 1934 | Ga0070662_100358135 | |||
| 1935 | Ga0070662_100842272 | |||
| 1936 | Ga0070681_10025226 | |||
| 1937 | Ga0070681_10403536 | |||
| 1938 | Ga0070681_10537408 | |||
| 1939 | Ga0070681_11066418 | |||
| 1940 | Ga0070681_11490316 | |||
| 1941 | Ga0070681_11555670 | |||
| 1942 | Ga0070685_10065843 | |||
| 1943 | Ga0070685_10066797 | |||
| 1944 | Ga0070685_10757204 | |||
| 1945 | Ga0070685_10795467 | |||
| 1946 | Ga0070706_100007069 | |||
| 1947 | Ga0070706_100051626 | |||
| 1948 | Ga0070706_100220625 | |||
| 1949 | Ga0070706_100304365 | |||
| 1950 | Ga0070706_100387094 | |||
| 1951 | Ga0070706_100431792 | |||
| 1952 | Ga0070706_100470249 | |||
| 1953 | Ga0070706_100663340 | |||
| 1954 | Ga0070706_101210475 | |||
| 1955 | Ga0070707_100248267 | |||
| 1956 | Ga0070707_100537758 | |||
| 1957 | Ga0070707_100554360 | |||
| 1958 | Ga0070707_100670160 | |||
| 1959 | Ga0070707_100962570 | |||
| 1960 | Ga0070707_101497343 | |||
| 1961 | Ga0070698_100006532 | |||
| 1962 | Ga0070698_100012141 | |||
| 1963 | Ga0070698_100035173 | |||
| 1964 | Ga0070698_100086786 | |||
| 1965 | Ga0070698_100171037 | |||
| 1966 | Ga0070698_100330758 | |||
| 1967 | Ga0070698_100743364 | |||
| 1968 | Ga0070698_100978814 | |||
| 1969 | Ga0070699_100014964 | |||
| 1970 | Ga0070699_100081537 | |||
| 1971 | Ga0070699_101376775 | |||
| 1972 | Ga0070699_101506262 | |||
| 1973 | Ga0070679_100009959 | |||
| 1974 | Ga0070679_100366858 | |||
| 1975 | Ga0070679_101678028 | |||
| 1976 | Ga0070684_100023630 | |||
| 1977 | Ga0070684_100108307 | |||
| 1978 | Ga0070684_100227648 | |||
| 1979 | Ga0070684_100436552 | |||
| 1980 | Ga0070684_100634201 | |||
| 1981 | Ga0070697_100051291 | |||
| 1982 | Ga0070697_100153053 | |||
| 1983 | Ga0070697_100200586 | |||
| 1984 | Ga0070697_100233017 | |||
| 1985 | Ga0070697_101027074 | |||
| 1986 | Ga0068853_100071107 | |||
| 1987 | Ga0070672_100152249 | |||
| 1988 | Ga0070672_100286650 | |||
| 1989 | Ga0070686_100120300 | |||
| 1990 | Ga0070686_100794195 | |||
| 1991 | Ga0070695_100094119 | |||
| 1992 | Ga0070695_100128025 | |||
| 1993 | Ga0070696_100010729 | |||
| 1994 | Ga0070696_100265708 | |||
| 1995 | Ga0070696_100426790 | |||
| 1996 | Ga0070696_101923313 | |||
| 1997 | Ga0070693_100009979 | |||
| 1998 | Ga0070693_100056614 | |||
| 1999 | Ga0070693_100190523 | |||
| 2000 | Ga0070693_101265155 | |||
| 2001 | Ga0070693_101334762 | |||
| 2002 | Ga0070665_100044963 | |||
| 2003 | Ga0070665_100390981 | |||
| 2004 | Ga0070665_101705720 | |||
| 2005 | Ga0070665_102468634 | |||
| 2006 | Ga0070704_100937873 | |||
| 2007 | Ga0068855_100041202 | |||
| 2008 | Ga0068855_100215844 | |||
| 2009 | Ga0070664_100004428 | |||
| 2010 | Ga0070664_100150382 | |||
| 2011 | Ga0070664_100474787 | |||
| 2012 | Ga0070664_101055129 | |||
| 2013 | Ga0068857_100079839 | |||
| 2014 | Ga0068857_100112081 | |||
| 2015 | Ga0068857_100678969 | |||
| 2016 | Ga0068857_101696385 | |||
| 2017 | Ga0068854_100075280 | |||
| 2018 | Ga0068854_100228365 | |||
| 2019 | Ga0068854_100247688 | |||
| 2020 | Ga0068856_100012369 | |||
| 2021 | Ga0068856_100023480 | |||
| 2022 | Ga0068856_100029778 | |||
| 2023 | Ga0068856_100047243 | |||
| 2024 | Ga0068856_100078319 | |||
| 2025 | Ga0068856_100101668 | |||
| 2026 | Ga0068856_100119354 | |||
| 2027 | Ga0068856_100777229 | |||
| 2028 | Ga0068856_101316920 | |||
| 2029 | Ga0068856_101394552 | |||
| 2030 | Ga0070702_100005256 | |||
| 2031 | Ga0070702_100053012 | |||
| 2032 | Ga0070702_100109299 | |||
| 2033 | Ga0070702_100725855 | |||
| 2034 | Ga0068852_100074918 | |||
| 2035 | Ga0068852_100082574 | |||
| 2036 | Ga0068852_100150961 | |||
| 2037 | Ga0068852_100160595 | |||
| 2038 | Ga0068852_100239202 | |||
| 2039 | Ga0068859_100094507 | |||
| 2040 | Ga0068859_100556351 | |||
| 2041 | Ga0068859_101284859 | |||
| 2042 | Ga0068864_100252602 | |||
| 2043 | Ga0068864_100527028 | |||
| 2044 | Ga0068864_100758132 | |||
| 2045 | Ga0068866_10045697 | |||
| 2046 | Ga0068866_10414156 | |||
| 2047 | Ga0068861_100050540 | |||
| 2048 | Ga0068861_100068075 | |||
| 2049 | Ga0068861_100268666 | |||
| 2050 | Ga0068861_100366174 | |||
| 2051 | Ga0068851_10130227 | |||
| 2052 | Ga0068851_10807208 | |||
| 2053 | Ga0068870_10024554 | |||
| 2054 | Ga0068870_10428750 | |||
| 2055 | Ga0068863_100015437 | |||
| 2056 | Ga0068863_100147909 | |||
| 2057 | Ga0068863_100326583 | |||
| 2058 | Ga0068863_101580532 | |||
| 2059 | Ga0068863_101993372 | |||
| 2060 | Ga0068858_100030337 | |||
| 2061 | Ga0068858_100122867 | |||
| 2062 | Ga0068858_100212549 | |||
| 2063 | Ga0068858_100582309 | |||
| 2064 | Ga0068858_100822571 | |||
| 2065 | Ga0068858_101039385 | |||
| 2066 | Ga0068860_100107786 | |||
| 2067 | Ga0068860_100173307 | |||
| 2068 | Ga0068860_100177043 | |||
| 2069 | Ga0068860_100361236 | |||
| 2070 | Ga0068860_100384438 | |||
| 2071 | Ga0068860_101098703 | |||
| 2072 | Ga0068860_101391162 | |||
| 2073 | Ga0068862_100016710 | |||
| 2074 | Ga0068862_100338935 | |||
| 2075 | Ga0068862_101302387 | |||
| 2076 | Ga0068862_101645609 | |||
| 2077 | Ga0081455_10069071 | |||
| 2078 | Ga0081455_10106215 | |||
| 2079 | Ga0081540_1000104 | |||
| 2080 | Ga0081540_1000407 | |||
| 2081 | Ga0081540_1012627 | |||
| 2082 | Ga0070717_10003754 | |||
| 2083 | Ga0070717_10017574 | |||
| 2084 | Ga0070717_10017727 | |||
| 2085 | Ga0070717_10034347 | |||
| 2086 | Ga0070717_10044436 | |||
| 2087 | Ga0070717_10046989 | |||
| 2088 | Ga0070717_10071397 | |||
| 2089 | Ga0070717_10098167 | |||
| 2090 | Ga0070717_10261008 | |||
| 2091 | Ga0070717_10354422 | |||
| 2092 | Ga0070717_10405952 | |||
| 2093 | Ga0070717_10409148 | |||
| 2094 | Ga0070717_10496758 | |||
| 2095 | Ga0070717_10797414 | |||
| 2096 | Ga0070717_11350236 | |||
| 2097 | Ga0075365_10009485 | |||
| 2098 | Ga0075365_10018158 | |||
| 2099 | Ga0075365_10330506 | |||
| 2100 | Ga0075364_10202935 | |||
| 2101 | Ga0075364_10479967 | |||
| 2102 | Ga0075432_10044836 | |||
| 2103 | Ga0070715_10006081 | |||
| 2104 | Ga0070715_10023396 | |||
| 2105 | Ga0070715_10041772 | |||
| 2106 | Ga0070715_10053107 | |||
| 2107 | Ga0070715_10473368 | |||
| 2108 | Ga0070716_100007446 | |||
| 2109 | Ga0070716_100016324 | |||
| 2110 | Ga0070716_100018119 | |||
| 2111 | Ga0070716_100040797 | |||
| 2112 | Ga0070716_100062447 | |||
| 2113 | Ga0070716_100109143 | |||
| 2114 | Ga0070716_100115814 | |||
| 2115 | Ga0070716_100187595 | |||
| 2116 | Ga0070716_100309992 | |||
| 2117 | Ga0070716_100460198 | |||
| 2118 | Ga0070716_100782992 | |||
| 2119 | Ga0070716_101002155 | |||
| 2120 | Ga0070716_101050077 | |||
| 2121 | Ga0070716_101163781 | |||
| 2122 | Ga0070712_100017733 | |||
| 2123 | Ga0070712_100022086 | |||
| 2124 | Ga0070712_100023859 | |||
| 2125 | Ga0070712_100026399 | |||
| 2126 | Ga0070712_100037188 | |||
| 2127 | Ga0070712_100041079 | |||
| 2128 | Ga0070712_100043229 | |||
| 2129 | Ga0070712_100049911 | |||
| 2130 | Ga0070712_100062953 | |||
| 2131 | Ga0070712_100108982 | |||
| 2132 | Ga0070712_100114035 | |||
| 2133 | Ga0070712_100136347 | |||
| 2134 | Ga0070712_100175645 | |||
| 2135 | Ga0070712_100241222 | |||
| 2136 | Ga0070712_100278841 | |||
| 2137 | Ga0070712_100488612 | |||
| 2138 | Ga0070712_101245468 | |||
| 2139 | Ga0070712_101650423 | |||
| 2140 | Ga0097621_100007234 | |||
| 2141 | Ga0097621_100089473 | |||
| 2142 | Ga0097621_100168724 | |||
| 2143 | Ga0097621_101184688 | |||
| 2144 | Ga0068871_100026210 | |||
| 2145 | Ga0068871_100076034 | |||
| 2146 | Ga0068871_100738797 | |||
| 2147 | Ga0068871_101080999 | |||
| 2148 | Ga0068871_101204619 | |||
| 2149 | Ga0068871_101914574 | |||
| 2150 | Ga0075428_100178551 | |||
| 2151 | Ga0075428_100278491 | |||
| 2152 | Ga0075428_101385565 | |||
| 2153 | Ga0075430_100232570 | |||
| 2154 | Ga0075430_100413637 | |||
| 2155 | Ga0075431_100006776 | |||
| 2156 | Ga0075433_10018103 | |||
| 2157 | Ga0075433_10019630 | |||
| 2158 | Ga0075433_10027468 | |||
| 2159 | Ga0075433_10104447 | |||
| 2160 | Ga0075433_10154025 | |||
| 2161 | Ga0075433_10716918 | |||
| 2162 | Ga0075434_100004695 | |||
| 2163 | Ga0075434_100007730 | |||
| 2164 | Ga0075434_100071965 | |||
| 2165 | Ga0075434_100112471 | |||
| 2166 | Ga0075434_101305058 | |||
| 2167 | Ga0075429_100361982 | |||
| 2168 | Ga0068865_100033373 | |||
| 2169 | Ga0068865_100037607 | |||
| 2170 | Ga0068865_100133593 | |||
| 2171 | Ga0068865_100628633 | |||
| 2172 | Ga0075436_100004471 | |||
| 2173 | Ga0075436_100008644 | |||
| 2174 | Ga0075436_100208571 | |||
| 2175 | Ga0075436_100363350 | |||
| 2176 | Ga0075436_101151888 | |||
| 2177 | Ga0097620_100094509 | |||
| 2178 | Ga0097620_100556342 | |||
| 2179 | Ga0097620_101284819 | |||
| 2180 | Ga0075435_100004634 | |||
| 2181 | Ga0075435_100016766 | |||
| 2182 | Ga0075435_100023872 | |||
| 2183 | Ga0075435_100046118 | |||
| 2184 | Ga0075435_100070273 | |||
| 2185 | Ga0075435_100073543 | |||
| 2186 | Ga0075435_100401754 | |||
| 2187 | Ga0075435_100456828 | |||
| 2188 | Ga0075435_100791147 | |||
| 2189 | Ga0099795_10163173 | |||
| 2190 | Ga0105240_10144999 | |||
| 2191 | Ga0105240_10373511 | |||
| 2192 | Ga0111539_10012913 | |||
| 2193 | Ga0111539_10018741 | |||
| 2194 | Ga0111539_10180844 | |||
| 2195 | Ga0111539_10194349 | |||
| 2196 | Ga0105245_10011721 | |||
| 2197 | Ga0105245_10017175 | |||
| 2198 | Ga0105245_10019479 | |||
| 2199 | Ga0105245_10043032 | |||
| 2200 | Ga0105245_10626082 | |||
| 2201 | Ga0105245_10776567 | |||
| 2202 | Ga0105245_11445754 | |||
| 2203 | Ga0105247_10009226 | |||
| 2204 | Ga0105247_10055335 | |||
| 2205 | Ga0105247_10060652 | |||
| 2206 | Ga0105247_10092348 | |||
| 2207 | Ga0105247_10110257 | |||
| 2208 | Ga0105247_10746219 | |||
| 2209 | Ga0105247_11164788 | |||
| 2210 | Ga0105247_11832378 | |||
| 2211 | Ga0114129_10319057 | |||
| 2212 | Ga0114129_10320804 | |||
| 2213 | Ga0114129_10425534 | |||
| 2214 | Ga0114129_10481836 | |||
| 2215 | Ga0114129_10797926 | |||
| 2216 | Ga0114129_11848543 | |||
| 2217 | Ga0105243_10186551 | |||
| 2218 | Ga0105243_10235737 | |||
| 2219 | Ga0105241_10003397 | |||
| 2220 | Ga0105241_10154797 | |||
| 2221 | Ga0105241_10259734 | |||
| 2222 | Ga0105241_10379678 | |||
| 2223 | Ga0105241_10696150 | |||
| 2224 | Ga0105241_11108327 | |||
| 2225 | Ga0105241_12413606 | |||
| 2226 | Ga0105242_10181606 | |||
| 2227 | Ga0105242_10301929 | |||
| 2228 | Ga0105242_10520947 | |||
| 2229 | Ga0105242_11060357 | |||
| 2230 | Ga0105248_10044768 | |||
| 2231 | Ga0105248_10249885 | |||
| 2232 | Ga0105248_10440794 | |||
| 2233 | Ga0105248_11798426 | |||
| 2234 | Ga0105237_10396873 | |||
| 2235 | Ga0105237_10953618 | |||
| 2236 | Ga0105237_12665792 | |||
| 2237 | Ga0105238_10081070 | |||
| 2238 | Ga0105238_10683832 | |||
| 2239 | Ga0105238_10870749 | |||
| 2240 | Ga0105249_10202075 | |||
| 2241 | Ga0105249_10299234 | |||
| 2242 | Ga0105249_11092202 | |||
| 2243 | Ga0105249_11765475 | |||
| 2244 | Ga0105249_12855915 | |||
| 2245 | Ga0099796_10003244 | |||
| 2246 | Ga0105239_10086880 | |||
| 2247 | Ga0105239_10203853 | |||
| 2248 | Ga0105239_10239976 | |||
| 2249 | Ga0105239_10657603 | |||
| 2250 | Ga0105246_10004636 | |||
| 2251 | Ga0105246_10246838 | |||
| 2252 | Ga0105246_10334068 | |||
| 2253 | Ga0105246_11397550 | |||
| 2254 | Ga0157340_1019153 | |||
| 2255 | Ga0157346_1008823 | |||
| 2256 | Ga0157343_1012339 | |||
| 2257 | Ga0154012_109650 | |||
| 2258 | Ga0157373_10058229 | |||
| 2259 | Ga0157373_10073191 | |||
| 2260 | Ga0157371_10066452 | |||
| 2261 | Ga0157371_10212903 | |||
| 2262 | Ga0157371_10517304 | |||
| 2263 | Ga0157371_10612433 | |||
| 2264 | Ga0157370_10020387 | |||
| 2265 | Ga0157370_10107173 | |||
| 2266 | Ga0157370_11203259 | |||
| 2267 | Ga0157369_10053400 | |||
| 2268 | Ga0157369_10802442 | |||
| 2269 | Ga0157369_11057129 | |||
| 2270 | Ga0157369_11069493 | |||
| 2271 | Ga0157369_11265449 | |||
| 2272 | Ga0157374_10003370 | |||
| 2273 | Ga0157374_10566076 | |||
| 2274 | Ga0163162_10125876 | |||
| 2275 | Ga0163162_10216040 | |||
| 2276 | Ga0163162_10552114 | |||
| 2277 | Ga0163162_11830778 | |||
| 2278 | Ga0157372_10031567 | |||
| 2279 | Ga0157372_10184675 | |||
| 2280 | Ga0157372_10338065 | |||
| 2281 | Ga0157372_10419262 | |||
| 2282 | Ga0157372_10626520 | |||
| 2283 | Ga0157372_10628438 | |||
| 2284 | Ga0157372_11067061 | |||
| 2285 | Ga0157372_11310973 | |||
| 2286 | Ga0157372_11411541 | |||
| 2287 | Ga0157372_11783205 | |||
| 2288 | Ga0157375_10234748 | |||
| 2289 | Ga0157375_10387373 | |||
| 2290 | Ga0157375_11074882 | |||
| 2291 | Ga0157375_11117211 | |||
| 2292 | Ga0157375_12580062 | |||
| 2293 | Ga0163163_10116651 | |||
| 2294 | Ga0163163_10151441 | |||
| 2295 | Ga0163163_10233622 | |||
| 2296 | Ga0163163_10469917 | |||
| 2297 | Ga0163163_10944767 | |||
| 2298 | Ga0163163_11451896 | |||
| 2299 | Ga0157380_10269619 | |||
| 2300 | Ga0157380_10624806 | |||
| 2301 | Ga0182008_10370965 | |||
| 2302 | Ga0157377_10002762 | |||
| 2303 | Ga0157377_10046848 | |||
| 2304 | Ga0157377_10173808 | |||
| 2305 | Ga0157379_10012062 | |||
| 2306 | Ga0157379_10187511 | |||
| 2307 | Ga0157379_10251809 | |||
| 2308 | Ga0157379_10483919 | |||
| 2309 | Ga0157376_10251799 | |||
| 2310 | Ga0157376_10443643 | |||
| 2311 | Ga0157376_10531030 | |||
| 2312 | Ga0157376_10731319 | |||
| 2313 | Ga0157376_11238749 | |||
| 2314 | Ga0157376_12054895 | |||
| 2315 | Ga0163161_10613258 | |||
| 2316 | Ga0197907_10046920 | |||
| 2317 | Ga0197907_10460177 | |||
| 2318 | Ga0197907_10775795 | |||
| 2319 | Ga0206356_10036912 | |||
| 2320 | Ga0206349_1901982 | |||
| 2321 | Ga0206351_10347265 | |||
| 2322 | Ga0206350_10854846 | |||
| 2323 | Ga0206350_11587344 | |||
| 2324 | Ga0206354_10697934 | |||
| 2325 | Ga0206354_10734318 | |||
| 2326 | Ga0206353_10041774 | |||
| 2327 | Ga0154015_1109481 | |||
| 2328 | Ga0213876_10695116 | |||
| 2329 | Ga0224712_10071118 | |||
| 2330 | Ga0224712_10150220 | |||
| 2331 | Ga0224712_10206935 | |||
| 2332 | Ga0224569_110831 | |||
| 2333 | Ga0228598_1071943 | |||
| 2334 | Ga0228598_1078221 | |||
| 2335 | Ga0207656_10144846 | |||
| 2336 | Ga0207656_10163946 | |||
| 2337 | Ga0207653_10001186 | |||
| 2338 | Ga0207653_10064887 | |||
| 2339 | Ga0207653_10096166 | |||
| 2340 | Ga0207653_10226501 | |||
| 2341 | Ga0207692_10000949 | |||
| 2342 | Ga0207692_10001835 | |||
| 2343 | Ga0207692_10012234 | |||
| 2344 | Ga0207692_10056246 | |||
| 2345 | Ga0207692_10073885 | |||
| 2346 | Ga0207692_10083361 | |||
| 2347 | Ga0207692_10149007 | |||
| 2348 | Ga0207692_10234060 | |||
| 2349 | Ga0207692_10258215 | |||
| 2350 | Ga0207692_10309035 | |||
| 2351 | Ga0207692_10338420 | |||
| 2352 | Ga0207642_10179843 | |||
| 2353 | Ga0207642_10648519 | |||
| 2354 | Ga0207642_10731704 | |||
| 2355 | Ga0207710_10188835 | |||
| 2356 | Ga0207710_10388059 | |||
| 2357 | Ga0207710_10487294 | |||
| 2358 | Ga0207688_10010890 | |||
| 2359 | Ga0207688_10011318 | |||
| 2360 | Ga0207688_10063565 | |||
| 2361 | Ga0207688_10076341 | |||
| 2362 | Ga0207647_10092435 | |||
| 2363 | Ga0207685_10035667 | |||
| 2364 | Ga0207685_10048434 | |||
| 2365 | Ga0207685_10093219 | |||
| 2366 | Ga0207685_10405012 | |||
| 2367 | Ga0207699_10000382 | |||
| 2368 | Ga0207699_10001986 | |||
| 2369 | Ga0207699_10002721 | |||
| 2370 | Ga0207699_10009488 | |||
| 2371 | Ga0207699_10010279 | |||
| 2372 | Ga0207699_10021331 | |||
| 2373 | Ga0207699_10033749 | |||
| 2374 | Ga0207699_10037506 | |||
| 2375 | Ga0207699_10060539 | |||
| 2376 | Ga0207699_10186713 | |||
| 2377 | Ga0207699_10346396 | |||
| 2378 | Ga0207699_10400705 | |||
| 2379 | Ga0207699_10475487 | |||
| 2380 | Ga0207699_10645687 | |||
| 2381 | Ga0207643_10001477 | |||
| 2382 | Ga0207705_10016324 | |||
| 2383 | Ga0207705_10291033 | |||
| 2384 | Ga0207684_10001155 | |||
| 2385 | Ga0207684_10250746 | |||
| 2386 | Ga0207684_10346268 | |||
| 2387 | Ga0207684_10414758 | |||
| 2388 | Ga0207684_10485570 | |||
| 2389 | Ga0207654_10003244 | |||
| 2390 | Ga0207654_10116632 | |||
| 2391 | Ga0207654_10207874 | |||
| 2392 | Ga0207654_10548960 | |||
| 2393 | Ga0207654_10700433 | |||
| 2394 | Ga0207707_10008747 | |||
| 2395 | Ga0207707_10659819 | |||
| 2396 | Ga0207707_11109670 | |||
| 2397 | Ga0207671_10214451 | |||
| 2398 | Ga0207693_10003685 | |||
| 2399 | Ga0207693_10003865 | |||
| 2400 | Ga0207693_10004300 | |||
| 2401 | Ga0207693_10006202 | |||
| 2402 | Ga0207693_10009637 | |||
| 2403 | Ga0207693_10012756 | |||
| 2404 | Ga0207693_10039072 | |||
| 2405 | Ga0207693_10070244 | |||
| 2406 | Ga0207693_10081592 | |||
| 2407 | Ga0207693_10082011 | |||
| 2408 | Ga0207693_10121785 | |||
| 2409 | Ga0207693_10124351 | |||
| 2410 | Ga0207693_10189014 | |||
| 2411 | Ga0207693_10207654 | |||
| 2412 | Ga0207693_10239957 | |||
| 2413 | Ga0207693_10804861 | |||
| 2414 | Ga0207693_10923304 | |||
| 2415 | Ga0207693_11460966 | |||
| 2416 | Ga0207663_10007794 | |||
| 2417 | Ga0207663_10012086 | |||
| 2418 | Ga0207663_10019857 | |||
| 2419 | Ga0207663_10022173 | |||
| 2420 | Ga0207663_10022747 | |||
| 2421 | Ga0207663_10110204 | |||
| 2422 | Ga0207663_10232298 | |||
| 2423 | Ga0207663_10250060 | |||
| 2424 | Ga0207663_10268621 | |||
| 2425 | Ga0207663_10396446 | |||
| 2426 | Ga0207663_10751023 | |||
| 2427 | Ga0207660_10172425 | |||
| 2428 | Ga0207660_10457936 | |||
| 2429 | Ga0207660_11131482 | |||
| 2430 | Ga0207662_10005270 | |||
| 2431 | Ga0207657_10032467 | |||
| 2432 | Ga0207657_10091678 | |||
| 2433 | Ga0207657_10175833 | |||
| 2434 | Ga0207657_10971833 | |||
| 2435 | Ga0207652_10255614 | |||
| 2436 | Ga0207652_10376589 | |||
| 2437 | Ga0207652_10421464 | |||
| 2438 | Ga0207652_10427032 | |||
| 2439 | Ga0207646_10089570 | |||
| 2440 | Ga0207646_10108213 | |||
| 2441 | Ga0207646_10231966 | |||
| 2442 | Ga0207646_10298782 | |||
| 2443 | Ga0207646_10316335 | |||
| 2444 | Ga0207646_10453755 | |||
| 2445 | Ga0207646_11565446 | |||
| 2446 | Ga0207681_10120837 | |||
| 2447 | Ga0207694_10010228 | |||
| 2448 | Ga0207694_10140574 | |||
| 2449 | Ga0207650_10017816 | |||
| 2450 | Ga0207659_10005481 | |||
| 2451 | Ga0207659_10017248 | |||
| 2452 | Ga0207659_10082174 | |||
| 2453 | Ga0207659_10785257 | |||
| 2454 | Ga0207687_10013941 | |||
| 2455 | Ga0207687_10016714 | |||
| 2456 | Ga0207687_10375366 | |||
| 2457 | Ga0207687_10529573 | |||
| 2458 | Ga0207700_10000156 | |||
| 2459 | Ga0207700_10002756 | |||
| 2460 | Ga0207700_10003388 | |||
| 2461 | Ga0207700_10009717 | |||
| 2462 | Ga0207700_10010541 | |||
| 2463 | Ga0207700_10011236 | |||
| 2464 | Ga0207700_10038665 | |||
| 2465 | Ga0207700_10053061 | |||
| 2466 | Ga0207700_10069650 | |||
| 2467 | Ga0207700_10085433 | |||
| 2468 | Ga0207700_10145950 | |||
| 2469 | Ga0207700_10281330 | |||
| 2470 | Ga0207700_10303814 | |||
| 2471 | Ga0207700_10339012 | |||
| 2472 | Ga0207700_10476688 | |||
| 2473 | Ga0207700_10572086 | |||
| 2474 | Ga0207700_10913690 | |||
| 2475 | Ga0207664_10001396 | |||
| 2476 | Ga0207664_10002012 | |||
| 2477 | Ga0207664_10005805 | |||
| 2478 | Ga0207664_10014718 | |||
| 2479 | Ga0207664_10027872 | |||
| 2480 | Ga0207664_10039052 | |||
| 2481 | Ga0207664_10043034 | |||
| 2482 | Ga0207664_10047685 | |||
| 2483 | Ga0207664_10056491 | |||
| 2484 | Ga0207664_10096719 | |||
| 2485 | Ga0207664_10161145 | |||
| 2486 | Ga0207664_10166919 | |||
| 2487 | Ga0207664_10294306 | |||
| 2488 | Ga0207664_10305615 | |||
| 2489 | Ga0207664_10335389 | |||
| 2490 | Ga0207664_10341840 | |||
| 2491 | Ga0207664_10354322 | |||
| 2492 | Ga0207664_10354995 | |||
| 2493 | Ga0207664_10418463 | |||
| 2494 | Ga0207664_10471755 | |||
| 2495 | Ga0207664_10489533 | |||
| 2496 | Ga0207664_10500341 | |||
| 2497 | Ga0207664_10610991 | |||
| 2498 | Ga0207644_10054045 | |||
| 2499 | Ga0207644_10062316 | |||
| 2500 | Ga0207644_11104131 | |||
| 2501 | Ga0207690_10262663 | |||
| 2502 | Ga0207690_10455275 | |||
| 2503 | Ga0207690_10924431 | |||
| 2504 | Ga0207706_10041381 | |||
| 2505 | Ga0207706_10098551 | |||
| 2506 | Ga0207706_10100307 | |||
| 2507 | Ga0207706_10307429 | |||
| 2508 | Ga0207686_10075435 | |||
| 2509 | Ga0207686_10135207 | |||
| 2510 | Ga0207686_10237623 | |||
| 2511 | Ga0207686_10754462 | |||
| 2512 | Ga0207709_10161436 | |||
| 2513 | Ga0207709_10623243 | |||
| 2514 | Ga0207670_10305975 | |||
| 2515 | Ga0207670_10674004 | |||
| 2516 | Ga0207669_10335256 | |||
| 2517 | Ga0207704_10041969 | |||
| 2518 | Ga0207704_10076906 | |||
| 2519 | Ga0207665_10000827 | |||
| 2520 | Ga0207665_10013492 | |||
| 2521 | Ga0207665_10016808 | |||
| 2522 | Ga0207665_10018832 | |||
| 2523 | Ga0207665_10025313 | |||
| 2524 | Ga0207665_10057490 | |||
| 2525 | Ga0207665_10100639 | |||
| 2526 | Ga0207665_10599103 | |||
| 2527 | Ga0207665_10665675 | |||
| 2528 | Ga0207665_11139314 | |||
| 2529 | Ga0207691_10130392 | |||
| 2530 | Ga0207691_10269671 | |||
| 2531 | Ga0207691_10476040 | |||
| 2532 | Ga0207691_10563433 | |||
| 2533 | Ga0207711_10198419 | |||
| 2534 | Ga0207711_10243529 | |||
| 2535 | Ga0207689_10004314 | |||
| 2536 | Ga0207689_10040223 | |||
| 2537 | Ga0207689_10099849 | |||
| 2538 | Ga0207689_10136090 | |||
| 2539 | Ga0207689_10608264 | |||
| 2540 | Ga0207689_11171369 | |||
| 2541 | Ga0207661_10008039 | |||
| 2542 | Ga0207661_10273228 | |||
| 2543 | Ga0207661_10533555 | |||
| 2544 | Ga0207679_10003876 | |||
| 2545 | Ga0207679_10012038 | |||
| 2546 | Ga0207679_10119630 | |||
| 2547 | Ga0207679_10277278 | |||
| 2548 | Ga0207679_10434964 | |||
| 2549 | Ga0207679_10608002 | |||
| 2550 | Ga0207667_10222997 | |||
| 2551 | Ga0207667_10517086 | |||
| 2552 | Ga0207667_10836891 | |||
| 2553 | Ga0207667_11394251 | |||
| 2554 | Ga0207651_10013540 | |||
| 2555 | Ga0207651_10065036 | |||
| 2556 | Ga0207651_10366428 | |||
| 2557 | Ga0207712_10205255 | |||
| 2558 | Ga0207712_10355985 | |||
| 2559 | Ga0207712_10362079 | |||
| 2560 | Ga0207712_10761102 | |||
| 2561 | Ga0207712_10892872 | |||
| 2562 | Ga0207668_10026299 | |||
| 2563 | Ga0207640_10047791 | |||
| 2564 | Ga0207640_10063926 | |||
| 2565 | Ga0207640_10083607 | |||
| 2566 | Ga0207640_10447977 | |||
| 2567 | Ga0207677_10008292 | |||
| 2568 | Ga0207677_10013105 | |||
| 2569 | Ga0207677_10111282 | |||
| 2570 | Ga0207677_10260269 | |||
| 2571 | Ga0207677_11054440 | |||
| 2572 | Ga0207677_11368968 | |||
| 2573 | Ga0207677_11610072 | |||
| 2574 | Ga0207703_10018287 | |||
| 2575 | Ga0207703_10065521 | |||
| 2576 | Ga0207703_10460870 | |||
| 2577 | Ga0207703_10733653 | |||
| 2578 | Ga0207639_10148398 | |||
| 2579 | Ga0207639_10936882 | |||
| 2580 | Ga0207639_11683215 | |||
| 2581 | Ga0207678_10000571 | |||
| 2582 | Ga0207678_10008530 | |||
| 2583 | Ga0207678_10039266 | |||
| 2584 | Ga0207678_10520902 | |||
| 2585 | Ga0207708_10025598 | |||
| 2586 | Ga0207708_10079452 | |||
| 2587 | Ga0207708_10103125 | |||
| 2588 | Ga0207708_10509670 | |||
| 2589 | Ga0207702_10011510 | |||
| 2590 | Ga0207702_10011865 | |||
| 2591 | Ga0207702_10020025 | |||
| 2592 | Ga0207702_10057124 | |||
| 2593 | Ga0207702_10060038 | |||
| 2594 | Ga0207702_10108584 | |||
| 2595 | Ga0207702_10130621 | |||
| 2596 | Ga0207702_10319159 | |||
| 2597 | Ga0207641_10007274 | |||
| 2598 | Ga0207641_10277293 | |||
| 2599 | Ga0207641_10692648 | |||
| 2600 | Ga0207641_10853770 | |||
| 2601 | Ga0207641_11135330 | |||
| 2602 | Ga0207641_11289191 | |||
| 2603 | Ga0207648_10121425 | |||
| 2604 | Ga0207676_10014581 | |||
| 2605 | Ga0207676_10137180 | |||
| 2606 | Ga0207676_10930036 | |||
| 2607 | Ga0207676_11572071 | |||
| 2608 | Ga0207676_11961666 | |||
| 2609 | Ga0207674_10017738 | |||
| 2610 | Ga0207674_10103809 | |||
| 2611 | Ga0207674_10149401 | |||
| 2612 | Ga0207674_11064517 | |||
| 2613 | Ga0207675_100045236 | |||
| 2614 | Ga0207675_100358107 | |||
| 2615 | Ga0207675_100736754 | |||
| 2616 | Ga0207675_101173437 | |||
| 2617 | Ga0207683_10003351 | |||
| 2618 | Ga0207683_10011951 | |||
| 2619 | Ga0207683_10023507 | |||
| 2620 | Ga0207683_10031230 | |||
| 2621 | Ga0207683_10134204 | |||
| 2622 | Ga0207683_11125649 | |||
| 2623 | Ga0207698_10011480 | |||
| 2624 | Ga0207698_10202021 | |||
| 2625 | Ga0207698_10211044 | |||
| 2626 | Ga0207698_10251524 | |||
| 2627 | Ga0207698_10370663 | |||
| 2628 | Ga0207698_10720269 | |||
| 2629 | Ga0207698_11176151 | |||
| 2630 | Ga0207428_10022119 | |||
| 2631 | Ga0207428_10037031 | |||
| 2632 | Ga0207428_10038618 | |||
| 2633 | Ga0207428_10101678 | |||
| 2634 | Ga0268266_10148679 | |||
| 2635 | Ga0268266_10223698 | |||
| 2636 | Ga0268266_10877141 | |||
| 2637 | Ga0268266_11633618 | |||
| 2638 | Ga0268265_10310227 | |||
| 2639 | Ga0268265_10992821 | |||
| 2640 | Ga0268265_12372267 | |||
| 2641 | Ga0268264_11511417 | |||
| 2642 | Ga0265326_10007839 | |||
| 2643 | Ga0265319_1010112 | |||
| 2644 | Ga0265334_10000580 | |||
| 2645 | Ga0265318_10000194 | |||
| 2646 | Ga0265322_10007374 | |||
| 2647 | Ga0265338_10005413 | |||
| 2648 | Ga0265338_10707315 | |||
| 2649 | Ga0265760_10065404 | |||
| 2650 | Ga0265330_10000730 | |||
| 2651 | Ga0265332_10000843 | |||
| 2652 | Ga0265328_10011532 | |||
| 2653 | Ga0265320_10018276 | |||
| 2654 | Ga0265320_10033110 | |||
| 2655 | Ga0265325_10000203 | |||
| 2656 | Ga0265329_10004054 | |||
| 2657 | Ga0265340_10000614 | |||
| 2658 | Ga0265339_10038764 | |||
| 2659 | Ga0265331_10002005 | |||
| 2660 | Ga0265327_10025146 | |||
| 2661 | Ga0265316_10000977 | |||
| 2662 | Ga0307408_102301429 | |||
| 2663 | Ga0265313_10001583 | |||
| 2664 | Ga0265314_10032259 | |||
| 2665 | Ga0265342_10001105 | |||
| 2666 | Ga0307406_10407727 | |||
| 2667 | Ga0307409_100033772 | |||
| 2668 | Ga0307409_100804628 | |||
| 2669 | Ga0307411_10773345 | |||
| 2670 | Ga0307415_100028205 | |||
| 2671 | Ga0307415_100844022 | |||
| 2672 | Ga0373930_0034201 | |||
| 2673 | Ga0373930_0039097 | |||
| 2674 | Ga0373930_0119338 | |||
| 2675 | Ga0373948_0002617 | |||
| 2676 | Ga0373948_0034373 | |||
| 2677 | Ga0373958_0056031 | |||
| 2678 | Ga0373958_0073225 | |||
| 2679 | Ga0373959_0103596 | |||
| 2680 | Ga0373938_0000786 | |||
| 2681 | Ga0373938_0050188 | |||
| 2682 | Ga0373926_0001583 | |||
| 2683 | Ga0373926_0040371 | |||
| 2684 | Ga0373926_0178754 | |||
| 2685 | Ga0373928_0015051 | |||
| 2686 | Ga0373929_0086236 | |||
| 2687 | Ga0373934_0004946 | |||
| 2688 | Ga0373934_0088436 | |||
| 2689 | Ga0373934_0096311 | |||
| 2690 | Ga0373934_0157898 | |||
| 2691 | Ga0373940_0043795 | |||
| 2692 | Ga0373940_0113999 | |||
| 2693 | Ga0373944_0001507 | |||
| 2694 | Ga0373944_0002613 | |||
| 2695 | Ga0373944_0063558 | |||
| 2696 | Ga0373944_0068111 | |||
| 2697 | Ga0373944_0135814 | |||
| 2698 | Ga0373951_0009620 | |||
| 2699 | Ga0373952_0008357 | |||
| 2700 | Ga0373952_0104235 | |||
| 2701 | Ga0373923_0000360 | |||
| 2702 | Ga0373923_0017774 | |||
| 2703 | Ga0373923_0022734 | |||
| 2704 | Ga0373923_0034967 | |||
| 2705 | Ga0373923_0071364 | |||
| 2706 | Ga0373923_0078204 | |||
| 2707 | Ga0373923_0094825 | |||
| 2708 | Ga0373932_0001030 | |||
| 2709 | Ga0373932_0011323 | |||
| 2710 | Ga0373932_0022573 | |||
| 2711 | Ga0373932_0086528 | |||
| 2712 | Ga0373936_0000848 | |||
| 2713 | Ga0373936_0005713 | |||
| 2714 | Ga0373936_0047631 | |||
| 2715 | Ga0373936_0054534 | |||
| 2716 | Ga0373936_0167373 | |||
| 2717 | Ga0373939_0026006 | |||
| 2718 | Ga0373939_0031214 | |||
| 2719 | Ga0373939_0280245 | |||
| 2720 | Ga0373941_0002052 | |||
| 2721 | Ga0373941_0012468 | |||
| 2722 | Ga0373941_0049370 | |||
| 2723 | Ga0373945_0000180 | |||
| 2724 | Ga0373945_0000330 | |||
| 2725 | Ga0373945_0232190 | |||
| 2726 | Ga0373945_0354775 | |||
| 2727 | Ga0373953_0000061 | |||
| 2728 | Ga0373953_0002146 | |||
| 2729 | Ga0373953_0013441 | |||
| 2730 | Ga0373953_0048468 | |||
| 2731 | Ga0373953_0085932 | |||
| 2732 | Ga0373953_0212492 | |||
| 2733 | Ga0373954_0001600 | |||
| 2734 | Ga0373954_0025111 | |||
| 2735 | Ga0373954_0039472 | |||
| 2736 | Ga0373954_0051972 | |||
| 2737 | Ga0373954_0087546 | |||
| 2738 | Ga0373954_0417522 | |||
| 2739 | Ga0373956_0000860 | |||
| 2740 | Ga0373956_0003968 | |||
| 2741 | Ga0373956_0011717 | |||
| 2742 | Ga0373956_0020518 | |||
| 2743 | Ga0373956_0105013 | |||
| 2744 | Ga0373956_0169805 | |||
| 2745 | Ga0373956_0428437 | |||
| 2746 | Ga0373957_0000360 | |||
| 2747 | Ga0373957_0000832 | |||
| 2748 | Ga0373957_0002259 | |||
| 2749 | Ga0373957_0002760 | |||
| 2750 | Ga0373957_0008572 | |||
| 2751 | Ga0373957_0104108 | |||
| 2752 | Ga0373957_0237507 | |||
| 2753 | Ga0373960_0106917 | |||
| 2754 | Ga0373943_0001628 | |||
| 2755 | Ga0373943_0002968 | |||
| 2756 | Ga0373943_0012078 | |||
| 2757 | Ga0373943_0019860 | |||
| 2758 | Ga0373943_0066574 | |||
| 2759 | Ga0373943_0193271 | |||
| 2760 | Ga0373943_0345500 | |||
| 2761 | Ga0373946_0001056 | |||
| 2762 | Ga0373946_0001301 | |||
| 2763 | Ga0373946_0003253 | |||
| 2764 | Ga0373946_0048787 | |||
| 2765 | Ga0373946_0082131 | |||
| 2766 | Ga0373946_0215369 | |||
| 2767 | Ga0373946_0222662 | |||
| 2768 | Ga0373946_0261093 | |||
| 2769 | Ga0373955_0000018 | |||
| 2770 | Ga0373955_0004186 | |||
| 2771 | Ga0373955_0031583 | |||
| 2772 | Ga0373955_0076092 | |||
| 2773 | Ga0373955_0091183 | |||
| 2774 | Ga0373955_0109963 | |||
| 2775 | Ga0373955_0257882 | |||
| 2776 | Ga0373955_0312582 | |||
| 2777 | Ga0373955_0443969 | |||
| 2778 | Ga0373955_0618705 | |||
| 2779 | Ga0373955_0747636 | |||
| 2780 | Ga0373942_0050192 | |||
| 2781 | Ga0373961_0023559 | |||
| 2782 | Ga0373961_0207514 | |||
| 2783 | Ga0373962_0038690 | |||
| 2784 | Ga0373924_0000135 | |||
| 2785 | Ga0373924_0002433 | |||
| 2786 | Ga0373924_0009284 | |||
| 2787 | Ga0373924_0010395 | |||
| 2788 | Ga0373924_0011342 | |||
| 2789 | Ga0373924_0019412 | |||
| 2790 | Ga0373924_0067883 | |||
| 2791 | Ga0373924_0090116 | |||
| 2792 | Ga0373924_0174516 | |||
| 2793 | Ga0373924_0342837 | |||
| 2794 | Ga0373931_0006527 | |||
| 2795 | Ga0373931_0019910 | |||
| 2796 | Ga0373931_0084098 | |||
| 2797 | Ga0373931_0263352 | |||
| 2798 | Ga0373931_0896155 | |||
| 2799 | Ga0373931_0967021 | |||
| 2800 | Ga0373935_0000268 | |||
| 2801 | Ga0373935_0009010 | |||
| 2802 | Ga0373935_0016166 | |||
| 2803 | Ga0373935_0022407 | |||
| 2804 | Ga0373935_0133967 | |||
| 2805 | Ga0373935_0220173 | |||
| 2806 | Ga0373935_0306024 | |||
| 2807 | Ga0373935_0452116 | |||
| 2808 | Ga0373935_0593266 | |||
| 2809 | Ga0373935_0683809 | |||
| 2810 | Ga0373935_0947499 | |||
| 2811 | Ga0373935_1232597 | |||
| 2812 | Ga0373935_1269727 | |||
| 2813 | Ga0373927_0008506 | |||
| 2814 | Ga0373927_0010147 | |||
| 2815 | Ga0373927_0014979 | |||
| 2816 | Ga0373927_0174847 | |||
| 2817 | Ga0373927_0184794 | |||
| 2818 | Ga0373933_0000003 | |||
| 2819 | Ga0373933_0005672 | |||
| 2820 | Ga0373933_0014841 | |||
| 2821 | Ga0373933_0017241 | |||
| 2822 | Ga0373933_0020085 | |||
| 2823 | Ga0373933_0022806 | |||
| 2824 | Ga0373933_0023349 | |||
| 2825 | Ga0373933_0045946 | |||
| 2826 | Ga0373933_0167934 | |||
| 2827 | Ga0373933_0231717 | |||
| 2828 | Ga0373933_0235238 | |||
| 2829 | Ga0373933_0436035 | |||
| 2830 | Ga0373933_0495742 | |||
| 2831 | Ga0373933_1056539 | |||
| 2832 | Ga0373947_0000374 | |||
| 2833 | Ga0373947_0020201 | |||
| 2834 | Ga0373947_0034022 | |||
| 2835 | Ga0373947_0035392 | |||
| 2836 | Ga0373947_0328048 | |||
| 2837 | Ga0373947_0404216 | |||
| 2838 | Ga0373947_0417756 | |||
| 2839 | Ga0373947_0595298 | |||
| 2840 | Ga0373947_0637709 | |||
| 2841 | Ga0373937_0000016 | |||
| 2842 | Ga0373937_0005352 | |||
| 2843 | Ga0373937_0012476 | |||
| 2844 | Ga0373937_0102857 | |||
| 2845 | Ga0373937_0105413 | |||
| 2846 | Ga0373937_0114133 | |||
| 2847 | Ga0373937_0141769 | |||
| 2848 | Ga0373937_0181821 | |||
| 2849 | Ga0373937_0242772 | |||
| 2850 | Ga0373937_0246563 | |||
| 2851 | Ga0373937_2019151 | |||
| 2852 | Ga0373925_0001174 | |||
| 2853 | Ga0373925_0010255 | |||
| 2854 | Ga0373925_0020229 | |||
| 2855 | Ga0373925_0032585 | |||
| 2856 | Ga0373925_0035606 | |||
| 2857 | Ga0373925_0038415 | |||
| 2858 | Ga0373925_0058021 | |||
| 2859 | Ga0373925_0072731 | |||
| 2860 | Ga0373925_0256974 | |||
| 2861 | Ga0373925_0295006 | |||
| 2862 | Ga0373925_0407793 | |||
| 2863 | Ga0373925_0436164 | |||
| 2864 | Ga0373925_0544266 | |||
| 2865 | Ga0373925_0602044 | |||
| 2866 | Ga0373925_0936220 | |||
| 2867 | Ga0373925_1494568 | |||
| 2868 | Ga0373925_1576613 | |||
| 2869 | Ga0395899_0003362 | |||
| 2870 | Ga0395900_0002558 | |||
| 2871 | Ga0395900_0181538 | |||
| 2872 | Ga0395900_0932135 | |||
| 2873 | Ga0395898_0043181 | |||
| 2874 | Ga0395898_0117792 | |||
| 2875 | Ga0395898_0312056 | |||
| 2876 | Ga0395898_0449208 | |||
| 2877 | Ga0395905_0002554 | |||
| 2878 | Ga0395905_0156420 | |||
| 2879 | Ga0436364_0441041 | |||
| 2880 | Ga0436364_0844683 | |||
| 2881 | Ga0395901_0002375 | |||
| 2882 | Ga0395901_0222606 | |||
| 2883 | Ga0436365_0255797 | |||
| 2884 | Ga0436365_0426892 | |||
| 2885 | Ga0436365_0464844 | |||
| 2886 | Ga0436360_0189120 | |||
| 2887 | Ga0436363_0280449 | |||
| 2888 | Ga0436363_0349492 | |||
| 2889 | Ga0436363_1620924 | |||
| 2890 | Ga0436362_0478452 | |||
| 2891 | Ga0436362_0558682 | |||
| 2892 | Ga0451853_3176466 | |||
| 2893 | Ga0439448_0071681 | |||
| 2894 | Ga0439463_021757 | |||
| 2895 | Ga0450902_028456 | |||
| 2896 | Ga0439459_0059592 | |||
| 2897 | Ga0439464_0042218 | |||
| 2898 | Ga0439440_0028544 | |||
| 2899 | Ga0439440_0107102 | |||
| 2900 | Ga0466963_0104496 | |||
| 2901 | Ga0466964_0652663 | |||
| 2902 | Ga0466959_0167529 | |||
| 2903 | Ga0466967_0090419 | |||
| 2904 | Ga0466967_0100033 | |||
| 2905 | Ga0495592_0000116 | |||
| 2906 | Ga0495592_0006999 | |||
| 2907 | Ga0495592_0017920 | |||
| 2908 | Ga0495592_0019499 | |||
| 2909 | Ga0495592_0076016 | |||
| 2910 | Ga0495592_0114071 | |||
| 2911 | Ga0495592_0167062 | |||
| 2912 | Ga0495592_0288556 | |||
| 2913 | Ga0495592_0298778 | |||
| 2914 | Ga0495592_0300116 | |||
| 2915 | Ga0495592_0327487 | |||
| 2916 | Ga0495592_0418739 | |||
| 2917 | Ga0495603_0039544 | |||
| 2918 | Ga0495603_0043628 | |||
| 2919 | Ga0495603_0395187 | |||
| 2920 | Ga0495629_0003179 | |||
| 2921 | Ga0495629_0049067 | |||
| 2922 | Ga0495629_0059086 | |||
| 2923 | Ga0495629_0077735 | |||
| 2924 | Ga0495629_0650742 | |||
| 2925 | Ga0495629_0760598 | |||
| 2926 | Ga0495641_0001952 | |||
| 2927 | Ga0495641_0019077 | |||
| 2928 | Ga0495641_0022429 | |||
| 2929 | Ga0495641_0041441 | |||
| 2930 | Ga0495641_0058480 | |||
| 2931 | Ga0495641_0095454 | |||
| 2932 | Ga0495641_0411834 | |||
| 2933 | Ga0495641_0528390 | |||
| 2934 | Ga0495651_0000009 | |||
| 2935 | Ga0495651_0006098 | |||
| 2936 | Ga0495651_0012073 | |||
| 2937 | Ga0495651_0014354 | |||
| 2938 | Ga0495651_0025318 | |||
| 2939 | Ga0495651_0030794 | |||
| 2940 | Ga0495651_0032117 | |||
| 2941 | Ga0495651_0038319 | |||
| 2942 | Ga0495651_0158059 | |||
| 2943 | Ga0495651_0163956 | |||
| 2944 | Ga0495651_0165889 | |||
| 2945 | Ga0495651_0180396 | |||
| 2946 | Ga0495651_0199508 | |||
| 2947 | Ga0495651_0199745 | |||
| 2948 | Ga0495651_0295023 | |||
| 2949 | Ga0495653_0001057 | |||
| 2950 | Ga0495653_0011491 | |||
| 2951 | Ga0495653_0018727 | |||
| 2952 | Ga0495653_0025298 | |||
| 2953 | Ga0495653_0025742 | |||
| 2954 | Ga0495653_0025926 | |||
| 2955 | Ga0495653_0029010 | |||
| 2956 | Ga0495653_0046335 | |||
| 2957 | Ga0495653_0076811 | |||
| 2958 | Ga0495653_0081376 | |||
| 2959 | Ga0495653_0093855 | |||
| 2960 | Ga0495653_0124807 | |||
| 2961 | Ga0495653_0170506 | |||
| 2962 | Ga0495653_0297210 | |||
| 2963 | Ga0495653_0601169 | |||
| 2964 | Ga0495653_0602003 | |||
| 2965 | Ga0495580_0000900 | |||
| 2966 | Ga0495580_0036534 | |||
| 2967 | Ga0495580_0110406 | |||
| 2968 | Ga0495580_0566721 | |||
| 2969 | Ga0495582_0001399 | |||
| 2970 | Ga0495582_0025720 | |||
| 2971 | Ga0495582_0032243 | |||
| 2972 | Ga0495582_0036144 | |||
| 2973 | Ga0495582_0267110 | |||
| 2974 | Ga0495639_0002222 | |||
| 2975 | Ga0495639_0020728 | |||
| 2976 | Ga0495639_0026940 | |||
| 2977 | Ga0495639_0099918 | |||
| 2978 | Ga0495639_0117264 | |||
| 2979 | Ga0495639_0214240 | |||
| 2980 | Ga0495639_0279751 | |||
| 2981 | Ga0495662_0008680 | |||
| 2982 | Ga0495662_0023663 | |||
| 2983 | Ga0495662_0029676 | |||
| 2984 | Ga0495662_0031440 | |||
| 2985 | Ga0495662_0033704 | |||
| 2986 | Ga0495662_0069691 | |||
| 2987 | Ga0495662_0082193 | |||
| 2988 | Ga0495662_0213777 | |||
| 2989 | Ga0495662_0250492 | |||
| 2990 | Ga0495664_0019681 | |||
| 2991 | Ga0495664_0026889 | |||
| 2992 | Ga0495664_0030255 | |||
| 2993 | Ga0495664_0044510 | |||
| 2994 | Ga0495664_0047929 | |||
| 2995 | Ga0495664_0072516 | |||
| 2996 | Ga0495664_0095125 | |||
| 2997 | Ga0495664_0225396 | |||
| 2998 | Ga0495664_0314091 | |||
| 2999 | Ga0495664_0353267 | |||
| 3000 | Ga0495664_0401150 | |||
| 3001 | Ga0495664_0569882 | |||
| 3002 | Ga0495664_0930599 | |||
| 3003 | Ga0495594_0005006 | |||
| 3004 | Ga0495608_0000019 | |||
| 3005 | Ga0495608_0004481 | |||
| 3006 | Ga0495608_0011269 | |||
| 3007 | Ga0495608_0011645 | |||
| 3008 | Ga0495608_0012752 | |||
| 3009 | Ga0495608_0017826 | |||
| 3010 | Ga0495608_0044919 | |||
| 3011 | Ga0495608_0054997 | |||
| 3012 | Ga0495608_0074761 | |||
| 3013 | Ga0495608_0112328 | |||
| 3014 | Ga0495608_0241099 | |||
| 3015 | Ga0495608_0343605 | |||
| 3016 | Ga0495618_0006736 | |||
| 3017 | Ga0495618_0014710 | |||
| 3018 | Ga0495618_0017092 | |||
| 3019 | Ga0495618_0033991 | |||
| 3020 | Ga0495618_0045378 | |||
| 3021 | Ga0495618_0066823 | |||
| 3022 | Ga0495618_0098447 | |||
| 3023 | Ga0495618_0156310 | |||
| 3024 | Ga0495618_0166001 | |||
| 3025 | Ga0495618_0299964 | |||
| 3026 | Ga0495618_0326188 | |||
| 3027 | Ga0495620_0370176 | |||
| 3028 | Ga0495628_0000487 | |||
| 3029 | Ga0495628_0028198 | |||
| 3030 | Ga0495628_0056091 | |||
| 3031 | Ga0495628_0071001 | |||
| 3032 | Ga0495628_0078610 | |||
| 3033 | Ga0495628_0079322 | |||
| 3034 | Ga0495628_0096624 | |||
| 3035 | Ga0495628_0170790 | |||
| 3036 | Ga0495628_0222459 | |||
| 3037 | Ga0495628_0282064 | |||
| 3038 | Ga0495628_0291187 | |||
| 3039 | Ga0495628_0300312 | |||
| 3040 | Ga0495628_0413996 | |||
| 3041 | Ga0495628_0616721 | |||
| 3042 | Ga0495628_0731997 | |||
| 3043 | Ga0495630_0009386 | |||
| 3044 | Ga0495630_0014713 | |||
| 3045 | Ga0495630_0018848 | |||
| 3046 | Ga0495630_0026862 | |||
| 3047 | Ga0495630_0027228 | |||
| 3048 | Ga0495630_0087173 | |||
| 3049 | Ga0495630_0087772 | |||
| 3050 | Ga0495630_0106606 | |||
| 3051 | Ga0495630_0155776 | |||
| 3052 | Ga0495630_1003100 | |||
| 3053 | Ga0495666_0008314 | |||
| 3054 | Ga0495666_0094884 | |||
| 3055 | Ga0495652_0000082 | |||
| 3056 | Ga0495652_0001084 | |||
| 3057 | Ga0495652_0014619 | |||
| 3058 | Ga0495652_0016263 | |||
| 3059 | Ga0495652_0067816 | |||
| 3060 | Ga0495652_0073538 | |||
| 3061 | Ga0495652_0074971 | |||
| 3062 | Ga0495652_0085318 | |||
| 3063 | Ga0495652_0086326 | |||
| 3064 | Ga0495652_0185471 | |||
| 3065 | Ga0495652_0249961 | |||
| 3066 | Ga0495652_0311528 | |||
| 3067 | Ga0495652_0321084 | |||
| 3068 | Ga0495652_0645350 | |||
| 3069 | Ga0495665_0008673 | |||
| 3070 | Ga0495665_0049185 | |||
| 3071 | Ga0495665_0082628 | |||
| 3072 | Ga0495665_0088407 | |||
| 3073 | Ga0495665_0111653 | |||
| 3074 | Ga0495665_0146193 | |||
| 3075 | Ga0495665_0211031 | |||
| 3076 | Ga0495640_0015109 | |||
| 3077 | Ga0495640_0017597 | |||
| 3078 | Ga0495640_0020301 | |||
| 3079 | Ga0495640_0033180 | |||
| 3080 | Ga0495640_0049760 | |||
| 3081 | Ga0495640_0059001 | |||
| 3082 | Ga0495640_0075262 | |||
| 3083 | Ga0495640_0084767 | |||
| 3084 | Ga0495640_0148536 | |||
| 3085 | Ga0495640_0181958 | |||
| 3086 | Ga0495640_0319389 | |||
| 3087 | Ga0495586_0038174 | |||
| 3088 | Ga0495586_0077563 | |||
| 3089 | Ga0495586_0129586 | |||
| 3090 | Ga0495586_0159291 | |||
| 3091 | Ga0495586_0324389 | |||
| 3092 | Ga0495586_0406291 | |||
| 3093 | Ga0495586_0485292 | |||
| 3094 | Ga0495587_0000041 | |||
| 3095 | Ga0495587_0002545 | |||
| 3096 | Ga0495587_0003164 | |||
| 3097 | Ga0495587_0006468 | |||
| 3098 | Ga0495587_0020245 | |||
| 3099 | Ga0495587_0077639 | |||
| 3100 | Ga0495587_0082492 | |||
| 3101 | Ga0495587_0085962 | |||
| 3102 | Ga0495587_0108321 | |||
| 3103 | Ga0495645_0030131 | |||
| 3104 | Ga0495645_0035787 | |||
| 3105 | Ga0495645_0040681 | |||
| 3106 | Ga0495645_0052142 | |||
| 3107 | Ga0495645_0062859 | |||
| 3108 | Ga0495645_0072059 | |||
| 3109 | Ga0495645_0114655 | |||
| 3110 | Ga0495645_0117802 | |||
| 3111 | Ga0495645_0190744 | |||
| 3112 | Ga0495645_0260561 | |||
| 3113 | Ga0495645_0267992 | |||
| 3114 | Ga0495645_0364684 | |||
| 3115 | Ga0495645_0433029 | |||
| 3116 | Ga0495645_0461707 | |||
| 3117 | Ga0495667_0000037 | |||
| 3118 | Ga0495667_0000421 | |||
| 3119 | Ga0495667_0000800 | |||
| 3120 | Ga0495667_0004264 | |||
| 3121 | Ga0495667_0009183 | |||
| 3122 | Ga0495667_0011013 | |||
| 3123 | Ga0495667_0019326 | |||
| 3124 | Ga0495667_0027470 | |||
| 3125 | Ga0495667_0034240 | |||
| 3126 | Ga0495667_0043787 | |||
| 3127 | Ga0495667_0056052 | |||
| 3128 | Ga0495667_0066308 | |||
| 3129 | Ga0495667_0090587 | |||
| 3130 | Ga0495667_0157246 | |||
| 3131 | Ga0495667_0411843 | |||
| 3132 | Ga0495667_0435459 | |||
| 3133 | Ga0495667_0544238 | |||
| 3134 | Ga0495634_0010433 | |||
| 3135 | Ga0495634_0011439 | |||
| 3136 | Ga0495634_0053227 | |||
| 3137 | Ga0495634_0092595 | |||
| 3138 | Ga0495634_0319851 | |||
| 3139 | Ga0495634_0500040 | |||
| 3140 | Ga0495634_0600131 | |||
| 3141 | Ga0495635_0002898 | |||
| 3142 | Ga0495635_0007111 | |||
| 3143 | Ga0495635_0032303 | |||
| 3144 | Ga0495635_0040020 | |||
| 3145 | Ga0495635_0042984 | |||
| 3146 | Ga0495635_0059737 | |||
| 3147 | Ga0495635_0064133 | |||
| 3148 | Ga0495635_0122135 | |||
| 3149 | Ga0495635_0144754 | |||
| 3150 | Ga0495635_0214678 | |||
| 3151 | Ga0495635_0655376 | |||
| 3152 | Ga0495635_0667590 | |||
| 3153 | Ga0495588_0165662 | |||
| 3154 | Ga0495588_0248622 | |||
| 3155 | Ga0495657_0000094 | |||
| 3156 | Ga0495657_0003003 | |||
| 3157 | Ga0495657_0021904 | |||
| 3158 | Ga0495657_0030345 | |||
| 3159 | Ga0495657_0040493 | |||
| 3160 | Ga0495657_0043467 | |||
| 3161 | Ga0495657_0047804 | |||
| 3162 | Ga0495657_0052593 | |||
| 3163 | Ga0495657_0066023 | |||
| 3164 | Ga0495657_0097164 | |||
| 3165 | Ga0495657_0103176 | |||
| 3166 | Ga0495657_0120284 | |||
| 3167 | Ga0495657_0127573 | |||
| 3168 | Ga0495657_0142898 | |||
| 3169 | Ga0495599_0000040 | |||
| 3170 | Ga0495599_0002900 | |||
| 3171 | Ga0495599_0005848 | |||
| 3172 | Ga0495599_0009981 | |||
| 3173 | Ga0495599_0010351 | |||
| 3174 | Ga0495599_0032221 | |||
| 3175 | Ga0495599_0038601 | |||
| 3176 | Ga0495599_0193223 | |||
| 3177 | Ga0495599_0278142 | |||
| 3178 | Ga0495599_0359470 | |||
| 3179 | Ga0495599_0384877 | |||
| 3180 | Ga0495599_0401143 | |||
| 3181 | Ga0495599_0408841 | |||
| 3182 | Ga0495623_0000284 | |||
| 3183 | Ga0495623_0025339 | |||
| 3184 | Ga0495623_0027339 | |||
| 3185 | Ga0495623_0060472 | |||
| 3186 | Ga0495623_0066130 | |||
| 3187 | Ga0495623_0074365 | |||
| 3188 | Ga0495623_0168398 | |||
| 3189 | Ga0495623_0348223 | |||
| 3190 | Ga0495646_0010148 | |||
| 3191 | Ga0495646_0020355 | |||
| 3192 | Ga0495646_0033771 | |||
| 3193 | Ga0495646_0053908 | |||
| 3194 | Ga0495646_0098108 | |||
| 3195 | Ga0495646_0148879 | |||
| 3196 | Ga0495646_0472108 | |||
| 3197 | Ga0495647_0033564 | |||
| 3198 | Ga0495647_0045938 | |||
| 3199 | Ga0495647_0190530 | |||
| 3200 | Ga0495647_0215784 | |||
| 3201 | Ga0495647_0315318 | |||
| 3202 | Ga0495658_0000946 | |||
| 3203 | Ga0495658_0035064 | |||
| 3204 | Ga0495658_0085296 | |||
| 3205 | Ga0495658_0092352 | |||
| 3206 | Ga0495658_0831232 | |||
| 3207 | Ga0495658_0846115 | |||
| 3208 | Ga0495613_0004518 | |||
| 3209 | Ga0495613_0011485 | |||
| 3210 | Ga0495613_0063652 | |||
| 3211 | Ga0495613_0072554 | |||
| 3212 | Ga0495613_0078390 | |||
| 3213 | Ga0495613_0085475 | |||
| 3214 | Ga0495624_0002604 | |||
| 3215 | Ga0495624_0006330 | |||
| 3216 | Ga0495624_0017938 | |||
| 3217 | Ga0495624_0032175 | |||
| 3218 | Ga0495624_0048265 | |||
| 3219 | Ga0495624_0197000 | |||
| 3220 | Ga0495624_0326890 | |||
| 3221 | Ga0495624_0455125 | |||
| 3222 | Ga0495600_0000803 | |||
| 3223 | Ga0495600_0003966 | |||
| 3224 | Ga0495600_0008834 | |||
| 3225 | Ga0495600_0015047 | |||
| 3226 | Ga0495600_0046491 | |||
| 3227 | Ga0495600_0062743 | |||
| 3228 | Ga0495600_0068838 | |||
| 3229 | Ga0495600_0078023 | |||
| 3230 | Ga0495600_0079409 | |||
| 3231 | Ga0495600_0154704 | |||
| 3232 | Ga0495600_0403190 | |||
| 3233 | Ga0495581_0004483 | |||
| 3234 | Ga0495581_0015778 | |||
| 3235 | Ga0495581_0028979 | |||
| 3236 | Ga0495581_0037596 | |||
| 3237 | Ga0495581_0037870 | |||
| 3238 | Ga0495604_0000040 | |||
| 3239 | Ga0495604_0014873 | |||
| 3240 | Ga0495604_0022068 | |||
| 3241 | Ga0495604_0024377 | |||
| 3242 | Ga0495604_0074084 | |||
| 3243 | Ga0495604_0131783 | |||
| 3244 | Ga0495604_0163256 | |||
| 3245 | Ga0495604_0182639 | |||
| 3246 | Ga0495604_0187379 | |||
| 3247 | Ga0495674_0000257 | |||
| 3248 | Ga0495674_0045612 | |||
| 3249 | Ga0495674_0053795 | |||
| 3250 | Ga0495674_0054363 | |||
| 3251 | Ga0495674_0064729 | |||
| 3252 | Ga0495674_0082232 | |||
| 3253 | Ga0495674_0094041 | |||
| 3254 | Ga0495674_0120504 | |||
| 3255 | Ga0495674_0221591 | |||
| 3256 | Ga0495674_0335528 | |||
| 3257 | Ga0495674_0398343 | |||
| 3258 | Ga0495674_0424028 | |||
| 3259 | Ga0495674_0668777 | |||
| 3260 | Ga0495674_0740959 | |||
| 3261 | Ga0495674_0928457 | |||
| 3262 | Ga0495674_1019563 | |||
| 3263 | Ga0495674_1104308 | |||
| 3264 | Ga0495676_0000700 | |||
| 3265 | Ga0495676_0020351 | |||
| 3266 | Ga0495676_0047635 | |||
| 3267 | Ga0495676_0150426 | |||
| 3268 | Ga0495676_0435237 | |||
| 3269 | Ga0495680_0000010 | |||
| 3270 | Ga0495680_0010497 | |||
| 3271 | Ga0495680_0010698 | |||
| 3272 | Ga0495680_0013172 | |||
| 3273 | Ga0495680_0013767 | |||
| 3274 | Ga0495680_0014838 | |||
| 3275 | Ga0495680_0016768 | |||
| 3276 | Ga0495680_0029749 | |||
| 3277 | Ga0495680_0038010 | |||
| 3278 | Ga0495680_0049590 | |||
| 3279 | Ga0495680_0059578 | |||
| 3280 | Ga0495680_0068511 | |||
| 3281 | Ga0495680_0087590 | |||
| 3282 | Ga0495680_0096053 | |||
| 3283 | Ga0495680_0276036 | |||
| 3284 | Ga0495680_0291630 | |||
| 3285 | Ga0495680_0452998 | |||
| 3286 | Ga0495680_0510352 | |||
| 3287 | Ga0495680_0559823 | |||
| 3288 | Ga0495680_0573177 | |||
| 3289 | Ga0495675_0000111 | |||
| 3290 | Ga0495675_0006911 | |||
| 3291 | Ga0495675_0150205 | |||
| 3292 | Ga0495675_0180580 | |||
| 3293 | Ga0495675_0305886 | |||
| 3294 | Ga0495684_0000641 | |||
| 3295 | Ga0495684_0009245 | |||
| 3296 | Ga0495684_0009309 | |||
| 3297 | Ga0495684_0018560 | |||
| 3298 | Ga0495684_0020458 | |||
| 3299 | Ga0495684_0031019 | |||
| 3300 | Ga0495684_0034267 | |||
| 3301 | Ga0495684_0079617 | |||
| 3302 | Ga0495684_0083078 | |||
| 3303 | Ga0495684_0125520 | |||
| 3304 | Ga0495684_0129501 | |||
| 3305 | Ga0495684_0198864 | |||
| 3306 | Ga0495684_0217398 | |||
| 3307 | Ga0495684_0375752 | |||
| 3308 | Ga0495684_0416822 | |||
| 3309 | Ga0495684_0644354 | |||
| 3310 | Ga0495593_0009511 | |||
| 3311 | Ga0495593_0018083 | |||
| 3312 | Ga0495593_0043192 | |||
| 3313 | Ga0495593_0157171 | |||
| 3314 | Ga0495593_0500001 | |||
| 3315 | Ga0495602_0000130 | |||
| 3316 | Ga0495602_0002822 | |||
| 3317 | Ga0495602_0008980 | |||
| 3318 | Ga0495602_0025415 | |||
| 3319 | Ga0495602_0026049 | |||
| 3320 | Ga0495602_0057636 | |||
| 3321 | Ga0495602_0063939 | |||
| 3322 | Ga0495602_0075199 | |||
| 3323 | Ga0495602_0083382 | |||
| 3324 | Ga0495602_0184792 | |||
| 3325 | Ga0495602_0185362 | |||
| 3326 | Ga0495602_0292628 | |||
| 3327 | Ga0495602_0369990 | |||
| 3328 | Ga0495602_0712107 | |||
| 3329 | Ga0495614_0005861 | |||
| 3330 | Ga0495614_0026653 | |||
| 3331 | Ga0495614_0030574 | |||
| 3332 | Ga0495614_0325448 | |||
| 3333 | Ga0496100_0009329 | |||
| 3334 | Ga0496100_0073862 | |||
| 3335 | Ga0496100_0226749 | |||
| 3336 | Ga0496100_0339081 | |||
| 3337 | Ga0496100_0490707 | |||
| 3338 | Ga0496101_0065686 | |||
| 3339 | Ga0496101_0240698 | |||
| 3340 | Ga0496101_0292110 | |||
| 3341 | Ga0496101_0457172 | |||
| 3342 | Ga0496101_0901869 | |||
| 3343 | Ga0496101_0936434 | |||
| 3344 | Ga0496102_0021857 | |||
| 3345 | Ga0496102_0047254 | |||
| 3346 | Ga0496102_0065897 | |||
| 3347 | Ga0496102_0119431 | |||
| 3348 | Ga0496102_0264690 | |||
| 3349 | Ga0496102_0439573 | |||
| 3350 | Ga0496102_0471923 | |||
| 3351 | Ga0496102_0539972 | |||
| 3352 | Ga0496103_0019954 | |||
| 3353 | Ga0496103_0129345 | |||
| 3354 | Ga0496103_0591173 | |||
| 3355 | Ga0496103_0674244 | |||
| 3356 | Ga0496104_0001728 | |||
| 3357 | Ga0496104_0005984 | |||
| 3358 | Ga0496104_0013896 | |||
| 3359 | Ga0496104_0096280 | |||
| 3360 | Ga0496104_0213677 | |||
| 3361 | Ga0496104_0394181 | |||
| 3362 | Ga0496104_0537481 | |||
| 3363 | Ga0496105_0005569 | |||
| 3364 | Ga0496105_0009713 | |||
| 3365 | Ga0496105_0024538 | |||
| 3366 | Ga0496105_0047663 | |||
| 3367 | Ga0496105_0497826 | |||
| 3368 | Ga0496106_0016858 | |||
| 3369 | Ga0496106_0019946 | |||
| 3370 | Ga0496106_0137287 | |||
| 3371 | Ga0496106_0203804 | |||
| 3372 | Ga0496107_0107452 | |||
| 3373 | Ga0496107_0430193 | |||
| 3374 | Ga0496108_0003239 | |||
| 3375 | Ga0496108_0027260 | |||
| 3376 | Ga0496108_0031025 | |||
| 3377 | Ga0496108_0046864 | |||
| 3378 | Ga0496108_0054206 | |||
| 3379 | Ga0496108_0069275 | |||
| 3380 | Ga0496108_0121284 | |||
| 3381 | Ga0496108_1197694 | |||
| 3382 | Ga0496109_0035177 | |||
| 3383 | Ga0496109_0042748 | |||
| 3384 | Ga0496109_0065907 | |||
| 3385 | Ga0496109_0097059 | |||
| 3386 | Ga0496109_0132392 | |||
| 3387 | Ga0496109_0156639 | |||
| 3388 | Ga0496109_0181416 | |||
| 3389 | Ga0496109_0203472 | |||
| 3390 | Ga0496109_0811560 | |||
| 3391 | Ga0496109_1118975 | |||
| 3392 | Ga0496109_1163527 | |||
| 3393 | Ga0496110_0009668 | |||
| 3394 | Ga0496110_0018783 | |||
| 3395 | Ga0496110_0036569 | |||
| 3396 | Ga0496110_0385973 | |||
| 3397 | Ga0496110_0425521 | |||
| 3398 | Ga0496110_1087753 | |||
| 3399 | Ga0496110_1686624 | |||
| 3400 | Ga0496110_1887134 | |||
| 3401 | Ga0496111_0016631 | |||
| 3402 | Ga0496111_0017434 | |||
| 3403 | Ga0496111_0036631 | |||
| 3404 | Ga0496111_0334317 | |||
| 3405 | Ga0496111_0712600 | |||
| 3406 | Ga0496112_0041837 | |||
| 3407 | Ga0496112_0059748 | |||
| 3408 | Ga0496112_0105794 | |||
| 3409 | Ga0496112_0129818 | |||
| 3410 | Ga0496112_0202951 | |||
| 3411 | Ga0496112_0230762 | |||
| 3412 | Ga0496112_0247940 | |||
| 3413 | Ga0496112_0464343 | |||
| 3414 | Ga0496113_0011035 | |||
| 3415 | Ga0496113_0215690 | |||
| 3416 | Ga0496113_0408343 | |||
| 3417 | Ga0496113_0537845 | |||
| 3418 | Ga0496114_0023617 | |||
| 3419 | Ga0496114_0123980 | |||
| 3420 | Ga0496114_0164480 | |||
| 3421 | Ga0496114_0169086 | |||
| 3422 | Ga0496114_0277953 | |||
| 3423 | Ga0496114_1635398 | |||
| 3424 | Ga0496115_0011631 | |||
| 3425 | Ga0496115_0099596 | |||
| 3426 | Ga0496115_0260350 | |||
| 3427 | Ga0496126_0020236 | |||
| 3428 | Ga0496126_0052999 | |||
| 3429 | nmdc:mga00v17_361463_c1 | |||
| 3430 | nmdc:mga00v17_994478_c1 | |||
| 3431 | nmdc:mga0yw44_12527_c1 | |||
| 3432 | nmdc:mga0yw44_6553_c1 | |||
| 3433 | nmdc:mga05p37_1049985_c1 | |||
| 3434 | nmdc:mga05p37_139868_c1 | |||
| 3435 | nmdc:mga05p37_264060_c1 | |||
| 3436 | nmdc:mga05p37_269737_c1 | |||
| 3437 | nmdc:mga05p37_78117_c1 | |||
| 3438 | nmdc:mga05p37_98037_c1 | |||
| 3439 | nmdc:mga09592_487827_c1 | |||
| 3440 | nmdc:mga0qj67_286715_c1 | |||
| 3441 | nmdc:mga0qj67_597220_c1 | |||
| 3442 | nmdc:mga06r32_1586_c1 | |||
| 3443 | nmdc:mga06r32_485283_c1 | |||
| 3444 | nmdc:mga08y16_146281_c1 | |||
| 3445 | nmdc:mga08y16_182705_c1 | |||
| 3446 | nmdc:mga08y16_27538_c1 | |||
| 3447 | nmdc:mga08y16_30083_c1 | |||
| 3448 | nmdc:mga0n895_1147983_c1 | |||
| 3449 | nmdc:mga0n895_1722097_c1 | |||
| 3450 | nmdc:mga0n895_205608_c1 | |||
| 3451 | nmdc:mga0n895_28072_c1 | |||
| 3452 | nmdc:mga0n895_4006_c1 | |||
| 3453 | nmdc:mga0n895_47170_c1 | |||
| 3454 | nmdc:mga0n895_474028_c1 | |||
| 3455 | nmdc:mga0n895_475446_c1 | |||
| 3456 | nmdc:mga0n895_633187_c1 | |||
| 3457 | nmdc:mga0rr50_114849_c1 | |||
| 3458 | nmdc:mga0rr50_13459_c1 | |||
| 3459 | nmdc:mga0rr50_225611_c1 | |||
| 3460 | nmdc:mga0rr50_226123_c1 | |||
| 3461 | nmdc:mga0rr50_289822_c1 | |||
| 3462 | nmdc:mga0rr50_50055_c1 | |||
| 3463 | nmdc:mga0rr50_510610_c1 | |||
| 3464 | nmdc:mga0rr50_5547_c1 | |||
| 3465 | nmdc:mga0rr50_915273_c1 | |||
| 3466 | nmdc:mga08x19_111689_c1 | |||
| 3467 | nmdc:mga08x19_219966_c1 | |||
| 3468 | nmdc:mga08x19_481230_c1 | |||
| 3469 | nmdc:mga08x19_491163_c1 | |||
| 3470 | nmdc:mga08x19_51308_c1 | |||
| 3471 | nmdc:mga0a205_1568058_c1 | |||
| 3472 | nmdc:mga0a205_20148_c1 | |||
| 3473 | nmdc:mga0a205_43005_c1 | |||
| 3474 | nmdc:mga0a205_45094_c1 | |||
| 3475 | nmdc:mga0a205_497045_c1 | |||
| 3476 | nmdc:mga0a205_57492_c1 | |||
| 3477 | Ga0495601_0007905 | |||
| 3478 | Ga0495601_0019038 | |||
| 3479 | Ga0495601_0040024 | |||
| 3480 | Ga0495601_0053164 | |||
| 3481 | Ga0495601_0088130 | |||
| 3482 | Ga0495601_0093801 | |||
| 3483 | Ga0495601_0158429 | |||
| 3484 | Ga0495601_0159689 | |||
| 3485 | Ga0495601_0230971 | |||
| 3486 | Ga0495601_0320700 | |||
| 3487 | Ga0495601_0325432 | |||
| 3488 | Ga0495601_0431746 | |||
| 3489 | Ga0495612_0006041 | |||
| 3490 | Ga0495612_0024731 | |||
| 3491 | Ga0495612_0032374 | |||
| 3492 | Ga0495595_0000204 | |||
| 3493 | Ga0495595_0017370 | |||
| 3494 | Ga0495595_0021912 | |||
| 3495 | Ga0495595_0053472 | |||
| 3496 | Ga0495595_0061234 | |||
| 3497 | Ga0495595_0062215 | |||
| 3498 | Ga0495595_0086385 | |||
| 3499 | Ga0495595_0566120 | |||
| 3500 | Ga0495619_0012940 | |||
| 3501 | Ga0495619_0018409 | |||
| 3502 | Ga0495619_0073122 | |||
| 3503 | Ga0495619_0154585 | |||
| 3504 | Ga0495619_0180006 | |||
| 3505 | Ga0495619_0186568 | |||
| 3506 | Ga0495619_0192053 | |||
| 3507 | Ga0495619_0320892 | |||
| 3508 | Ga0495619_0501854 | |||
| 3509 | Ga0495619_0846376 | |||
| 3510 | Ga0500554_027937 | |||
| 3511 | Ga0587084_027844 | |||
| 3512 | Ga0587084_091673 | |||
| 3513 | Ga0587066_091206 | |||
| 3514 | Ga0587070_131178 | |||
| 3515 | Ga0587070_216049 | |||
| 3516 | Ga0587073_0032714 | |||
| 3517 | Ga0587073_0085465 | |||
| 3518 | Ga0587077_147919 | |||
| 3519 | Ga0587083_0072319 | |||
| 3520 | Ga0587092_066169 | |||
| 3521 | Ga0587062_073076 | |||
| 3522 | Ga0587067_109788 | |||
| 3523 | Ga0587072_014866 | |||
| 3524 | Ga0587076_133003 | |||
| 3525 | Ga0587078_050557 | |||
| 3526 | Ga0587079_023847 | |||
| 3527 | Ga0587071_123395 | |||
| 3528 | Ga0587111_0014553 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rdr-assembly1.cif.gz_A | circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces | 0.4807 | 38 | 144 |
| 3hf1-assembly1.cif.gz_A | crystal structure of human p53r2 | 0.4334 | 25 | 148 |
| 4djn-assembly1.cif.gz_B | crystal structure of a ribonucleotide reductase m2 b (rnrr2) from homo sapiens at 2.20 a resolution | 0.4306 | 25 | 148 |
| 7eyd-assembly1.cif.gz_19 | cryo-em structure of cyanobacterial phycobilisome from anabaena sp. pcc 7120 | 0.4194 | 12 | 148 |
| 2ou3-assembly1.cif.gz_B | crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution | 0.4178 | 4 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2lyiA01 | Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Spidroin, repetitive domain | 0.4791 | 7 | 147 | 1.10.274.60 |
| af_A1Z9P3_1388_1576_1.10.287.1490 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4775 | 7 | 144 | 1.10.287.1490 |
| af_I1K868_479_658_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.463 | 82 | 143 | 1.25.40.10 |
| af_I1KXX2_1_136_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.4503 | 8 | 139 | 1.20.1410.10 |
| af_Q03001_381_494_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.4478 | 10 | 144 | 1.20.58.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2C682-F1-model_v4 | Uncharacterized protein | 0.9544 | 1 | 148 |
|
| AF-A0A538FQZ1-F1-model_v4 | Uncharacterized protein | 0.9491 | 1 | 120 |
|
| AF-A0A6P2C682-F1-model_v4 | Uncharacterized protein | 0.9482 | 1 | 148 |
|
| AF-A0A538LQB7-F1-model_v4 | FHA domain-containing protein | 0.9455 | 1 | 145 |
GO:0016020
GO:0016491 GO:0051536 |
| AF-A0A3C0XF14-F1-model_v4 | Uncharacterized protein | 0.9265 | 25 | 148 |
|