F495628

General Info

Members Datasets Scaffolds Average Seq Length
1764 390 3528 149

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10318727|Ga0163163_103187271
Length 179
Sequence MMAPADASDRLLPAGLQPQPPANRPAGKELGMTTKAAFSPEEWKTVLQGPPTAGMIVVTAARGGTIRETIALAKAYSEAHAQPGESELLDEIVAARPEVDHSRFHSAEELKEHGLAELRTAVALVESKATAGELDDYRQFVLALASKVAAAHREHGQPVSPAEAAAIQEIRATVGASTA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
117 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
118 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
119 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
239 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
240 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
243 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
244 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
279 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
283 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
288 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
289 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
300 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
311 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
312 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
329 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
333 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
361 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
376 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 2.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 5.33
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 16.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10318727 3300014325 Bacteria 1608
2 JGI24737J22298_10048834 3300001990 Bacteria 1288
3 JGI24751J29686_10003466 3300002459 Bacteria 3176
4 JGI25404J52841_10015743 3300003659 Bacteria 1640
5 JGI25404J52841_10122746 3300003659 Unclassified 548
6 Ga0058859_11761553 3300004798 Bacteria 544
7 Ga0058863_10863976 3300004799 Bacteria 679
8 Ga0058863_11945211 3300004799 Unclassified 749
9 Ga0058861_11806364 3300004800 Bacteria 776
10 Ga0058861_12027980 3300004800 Unclassified 886
11 Ga0058862_12725586 3300004803 Unclassified 573
12 Ga0058862_12799539 3300004803 Unclassified 600
13 Ga0070658_10013242 3300005327 Bacteria 6616
14 Ga0070658_10022197 3300005327 Bacteria 5093
15 Ga0070683_100331248 3300005329 Bacteria 1449
16 Ga0070683_101935747 3300005329 Unclassified 567
17 Ga0070670_100047936 3300005331 Bacteria 3677
18 Ga0070677_10744136 3300005333 Bacteria 555
19 Ga0068869_100005709 3300005334 Bacteria 7853
20 Ga0068869_100108144 3300005334 Bacteria 2112
21 Ga0068869_100393202 3300005334 Bacteria 1139
22 Ga0068869_101035705 3300005334 Bacteria 716
23 Ga0070666_10113467 3300005335 Bacteria 1875
24 Ga0070666_10407319 3300005335 Unclassified 978
25 Ga0070680_100011453 3300005336 Bacteria 6862
26 Ga0070680_101415576 3300005336 Unclassified 602
27 Ga0070682_100005887 3300005337 Bacteria 6854
28 Ga0070682_100115052 3300005337 Bacteria 1798
29 Ga0070682_100279391 3300005337 Bacteria 1216
30 Ga0070682_100377655 3300005337 Unclassified 1065
31 Ga0070682_100532683 3300005337 Unclassified 916
32 Ga0070682_101158633 3300005337 Bacteria 650
33 Ga0070682_101631775 3300005337 Bacteria 558
34 Ga0068868_100007699 3300005338 Bacteria 7683
35 Ga0068868_100022775 3300005338 Bacteria 4734
36 Ga0068868_100137865 3300005338 Bacteria 2001
37 Ga0068868_100979543 3300005338 Bacteria 772
38 Ga0068868_101077252 3300005338 Bacteria 738
39 Ga0070660_100040979 3300005339 Bacteria 3527
40 Ga0070660_100183639 3300005339 Bacteria 1693
41 Ga0070660_100255252 3300005339 Bacteria 1430
42 Ga0070689_100328654 3300005340 Bacteria 1278
43 Ga0070689_100366066 3300005340 Bacteria 1212
44 Ga0070689_100385187 3300005340 Unclassified 1182
45 Ga0070691_10127749 3300005341 Bacteria 1285
46 Ga0070691_10227311 3300005341 Unclassified 992
47 Ga0070691_10236913 3300005341 Unclassified 973
48 Ga0070687_100049477 3300005343 Bacteria 2166
49 Ga0070687_100422565 3300005343 Bacteria 880
50 Ga0070687_100437324 3300005343 Unclassified 867
51 Ga0070661_100012300 3300005344 Bacteria 5985
52 Ga0070692_10002327 3300005345 Bacteria 7331
53 Ga0070692_10017091 3300005345 Bacteria 3462
54 Ga0070692_10236109 3300005345 Bacteria 1088
55 Ga0070692_10426667 3300005345 Bacteria 843
56 Ga0070668_100142063 3300005347 Bacteria 1935
57 Ga0070668_101359363 3300005347 Bacteria 647
58 Ga0070669_100179537 3300005353 Bacteria 1655
59 Ga0070675_100005056 3300005354 Bacteria 10070
60 Ga0070675_100013842 3300005354 Bacteria 6350
61 Ga0070675_100883745 3300005354 Bacteria 819
62 Ga0070671_100011302 3300005355 Bacteria 7174
63 Ga0070671_100159317 3300005355 Bacteria 1908
64 Ga0070671_100634399 3300005355 Bacteria 924
65 Ga0070674_100160540 3300005356 Bacteria 1705
66 Ga0070674_102065845 3300005356 Unclassified 519
67 Ga0070673_100055617 3300005364 Bacteria 3118
68 Ga0070673_100166133 3300005364 Bacteria 1880
69 Ga0070673_100837679 3300005364 Unclassified 851
70 Ga0070688_100270345 3300005365 Unclassified 1217
71 Ga0070659_100008993 3300005366 Bacteria 7324
72 Ga0070659_100032143 3300005366 Bacteria 4068
73 Ga0070659_100598180 3300005366 Bacteria 947
74 Ga0070703_10009847 3300005406 Unclassified 2695
75 Ga0070703_10178025 3300005406 Unclassified 819
76 Ga0070703_10417537 3300005406 Unclassified 587
77 Ga0070709_10010150 3300005434 Bacteria 5206
78 Ga0070709_10024217 3300005434 Bacteria 3572
79 Ga0070709_10033342 3300005434 Bacteria 3113
80 Ga0070709_10130683 3300005434 Bacteria 1714
81 Ga0070709_10178205 3300005434 Bacteria 1490
82 Ga0070709_10303590 3300005434 Bacteria 1166
83 Ga0070709_10521302 3300005434 Bacteria 906
84 Ga0070709_10531241 3300005434 Bacteria 897
85 Ga0070709_10561563 3300005434 Unclassified 874
86 Ga0070714_100001782 3300005435 Bacteria 15681
87 Ga0070714_100005462 3300005435 Bacteria 9707
88 Ga0070714_100014506 3300005435 Bacteria 6331
89 Ga0070714_100016824 3300005435 Bacteria 5914
90 Ga0070714_100043249 3300005435 Bacteria 3809
91 Ga0070714_100048641 3300005435 Bacteria 3607
92 Ga0070714_100063241 3300005435 Bacteria 3182
93 Ga0070714_100081303 3300005435 Bacteria 2820
94 Ga0070714_100107667 3300005435 Bacteria 2464
95 Ga0070714_100145393 3300005435 Bacteria 2132
96 Ga0070714_100341632 3300005435 Bacteria 1404
97 Ga0070714_100422658 3300005435 Bacteria 1263
98 Ga0070714_100844833 3300005435 Bacteria 888
99 Ga0070714_100862154 3300005435 Bacteria 878
100 Ga0070714_101049828 3300005435 Unclassified 793
101 Ga0070713_100002466 3300005436 Bacteria 12073
102 Ga0070713_100010817 3300005436 Bacteria 6612
103 Ga0070713_100010914 3300005436 Bacteria 6586
104 Ga0070713_100013244 3300005436 Bacteria 6081
105 Ga0070713_100016564 3300005436 Bacteria 5544
106 Ga0070713_100020352 3300005436 Bacteria 5086
107 Ga0070713_100046937 3300005436 Bacteria 3547
108 Ga0070713_100074544 3300005436 Bacteria 2875
109 Ga0070713_100098438 3300005436 Bacteria 2529
110 Ga0070713_100127147 3300005436 Bacteria 2243
111 Ga0070713_100153422 3300005436 Bacteria 2051
112 Ga0070713_100303044 3300005436 Bacteria 1471
113 Ga0070713_100353648 3300005436 Unclassified 1363
114 Ga0070713_100383151 3300005436 Unclassified 1310
115 Ga0070713_100884862 3300005436 Unclassified 858
116 Ga0070713_100928769 3300005436 Bacteria 837
117 Ga0070713_101557069 3300005436 Bacteria 641
118 Ga0070710_10002186 3300005437 Bacteria 9234
119 Ga0070710_10003232 3300005437 Bacteria 7717
120 Ga0070710_10026286 3300005437 Bacteria 3091
121 Ga0070710_10069495 3300005437 Bacteria 2026
122 Ga0070710_10128625 3300005437 Bacteria 1541
123 Ga0070710_10135280 3300005437 Bacteria 1506
124 Ga0070710_10146747 3300005437 Unclassified 1452
125 Ga0070710_10232187 3300005437 Bacteria 1178
126 Ga0070710_10266914 3300005437 Bacteria 1105
127 Ga0070710_10272911 3300005437 Bacteria 1094
128 Ga0070710_10294791 3300005437 Bacteria 1057
129 Ga0070710_11386341 3300005437 Bacteria 525
130 Ga0070711_100009327 3300005439 Bacteria 6039
131 Ga0070711_100010966 3300005439 Bacteria 5617
132 Ga0070711_100017065 3300005439 Bacteria 4618
133 Ga0070711_100019269 3300005439 Bacteria 4376
134 Ga0070711_100057333 3300005439 Bacteria 2697
135 Ga0070711_100117781 3300005439 Bacteria 1959
136 Ga0070711_100140960 3300005439 Bacteria 1808
137 Ga0070711_100229625 3300005439 Bacteria 1446
138 Ga0070711_100256564 3300005439 Unclassified 1374
139 Ga0070711_100350328 3300005439 Bacteria 1187
140 Ga0070711_100619474 3300005439 Unclassified 904
141 Ga0070711_100728634 3300005439 Unclassified 836
142 Ga0070711_100846385 3300005439 Unclassified 778
143 Ga0070711_101576170 3300005439 Bacteria 574
144 Ga0070711_101828452 3300005439 Bacteria 533
145 Ga0070705_100042306 3300005440 Bacteria 2604
146 Ga0070705_100053930 3300005440 Bacteria 2356
147 Ga0070705_100182225 3300005440 Bacteria 1424
148 Ga0070705_100660111 3300005440 Bacteria 817
149 Ga0070705_101217671 3300005440 Bacteria 621
150 Ga0070700_100013534 3300005441 Bacteria 4583
151 Ga0070700_100063331 3300005441 Unclassified 2339
152 Ga0070700_100081369 3300005441 Bacteria 2092
153 Ga0070700_100343350 3300005441 Bacteria 1104
154 Ga0070694_100029171 3300005444 Bacteria 3599
155 Ga0070694_100117259 3300005444 Bacteria 1906
156 Ga0070708_100161848 3300005445 Bacteria 2086
157 Ga0070708_100229508 3300005445 Bacteria 1742
158 Ga0070708_100259477 3300005445 Bacteria 1633
159 Ga0070708_100468533 3300005445 Bacteria 1188
160 Ga0070708_100745116 3300005445 Bacteria 921
161 Ga0070708_100799236 3300005445 Bacteria 887
162 Ga0070708_101157604 3300005445 Bacteria 724
163 Ga0070663_100011604 3300005455 Bacteria 5538
164 Ga0070663_100014065 3300005455 Bacteria 5127
165 Ga0070663_100457016 3300005455 Unclassified 1054
166 Ga0070678_100002952 3300005456 Bacteria 9428
167 Ga0070678_100490789 3300005456 Unclassified 1082
168 Ga0070678_100958821 3300005456 Bacteria 784
169 Ga0070662_100005844 3300005457 Bacteria 7896
170 Ga0070662_100358135 3300005457 Bacteria 1197
171 Ga0070662_100842272 3300005457 Bacteria 781
172 Ga0070681_10025226 3300005458 Bacteria 5979
173 Ga0070681_10403536 3300005458 Unclassified 1278
174 Ga0070681_10537408 3300005458 Unclassified 1082
175 Ga0070681_11066418 3300005458 Bacteria 728
176 Ga0070681_11490316 3300005458 Unclassified 601
177 Ga0070681_11555670 3300005458 Unclassified 586
178 Ga0070685_10065843 3300005466 Bacteria 2133
179 Ga0070685_10066797 3300005466 Bacteria 2120
180 Ga0070685_10757204 3300005466 Unclassified 713
181 Ga0070685_10795467 3300005466 Bacteria 697
182 Ga0070706_100007069 3300005467 Bacteria 10569
183 Ga0070706_100051626 3300005467 Bacteria 3795
184 Ga0070706_100220625 3300005467 Unclassified 1770
185 Ga0070706_100304365 3300005467 Bacteria 1487
186 Ga0070706_100387094 3300005467 Bacteria 1302
187 Ga0070706_100431792 3300005467 Bacteria 1226
188 Ga0070706_100470249 3300005467 Bacteria 1170
189 Ga0070706_100663340 3300005467 Unclassified 968
190 Ga0070706_101210475 3300005467 Bacteria 694
191 Ga0070707_100248267 3300005468 Unclassified 1732
192 Ga0070707_100537758 3300005468 Bacteria 1131
193 Ga0070707_100554360 3300005468 Bacteria 1112
194 Ga0070707_100670160 3300005468 Bacteria 1000
195 Ga0070707_100962570 3300005468 Bacteria 819
196 Ga0070707_101497343 3300005468 Unclassified 642
197 Ga0070698_100006532 3300005471 Bacteria 12644
198 Ga0070698_100012141 3300005471 Bacteria 9128
199 Ga0070698_100035173 3300005471 Bacteria 5180
200 Ga0070698_100086786 3300005471 Bacteria 3115
201 Ga0070698_100171037 3300005471 Bacteria 2114
202 Ga0070698_100330758 3300005471 Bacteria 1455
203 Ga0070698_100743364 3300005471 Bacteria 924
204 Ga0070698_100978814 3300005471 Unclassified 793
205 Ga0070699_100014964 3300005518 Bacteria 6667
206 Ga0070699_100081537 3300005518 Bacteria 2820
207 Ga0070699_101376775 3300005518 Unclassified 647
208 Ga0070699_101506262 3300005518 Bacteria 617
209 Ga0070679_100009959 3300005530 Bacteria 8996
210 Ga0070679_100366858 3300005530 Bacteria 1387
211 Ga0070679_101678028 3300005530 Archaea 583
212 Ga0070684_100023630 3300005535 Bacteria 5146
213 Ga0070684_100108307 3300005535 Bacteria 2489
214 Ga0070684_100227648 3300005535 Bacteria 1702
215 Ga0070684_100436552 3300005535 Unclassified 1209
216 Ga0070684_100634201 3300005535 Unclassified 994
217 Ga0070697_100051291 3300005536 Bacteria 3352
218 Ga0070697_100153053 3300005536 Bacteria 1945
219 Ga0070697_100200586 3300005536 Bacteria 1696
220 Ga0070697_100233017 3300005536 Bacteria 1571
221 Ga0070697_101027074 3300005536 Bacteria 733
222 Ga0068853_100071107 3300005539 Bacteria 3029
223 Ga0070672_100152249 3300005543 Bacteria 1914
224 Ga0070672_100286650 3300005543 Bacteria 1393
225 Ga0070686_100120300 3300005544 Bacteria 1802
226 Ga0070686_100794195 3300005544 Unclassified 762
227 Ga0070695_100094119 3300005545 Bacteria 2006
228 Ga0070695_100128025 3300005545 Bacteria 1746
229 Ga0070696_100010729 3300005546 Bacteria 6137
230 Ga0070696_100265708 3300005546 Bacteria 1303
231 Ga0070696_100426790 3300005546 Bacteria 1042
232 Ga0070696_101923313 3300005546 Bacteria 513
233 Ga0070693_100009979 3300005547 Bacteria 4740
234 Ga0070693_100056614 3300005547 Bacteria 2263
235 Ga0070693_100190523 3300005547 Bacteria 1326
236 Ga0070693_101265155 3300005547 Bacteria 569
237 Ga0070693_101334762 3300005547 Unclassified 555
238 Ga0070665_100044963 3300005548 Bacteria 4432
239 Ga0070665_100390981 3300005548 Bacteria 1398
240 Ga0070665_101705720 3300005548 Unclassified 637
241 Ga0070665_102468634 3300005548 Bacteria 521
242 Ga0070704_100937873 3300005549 Bacteria 780
243 Ga0068855_100041202 3300005563 Bacteria 5474
244 Ga0068855_100215844 3300005563 Bacteria 2153
245 Ga0070664_100004428 3300005564 Bacteria 11284
246 Ga0070664_100150382 3300005564 Unclassified 2055
247 Ga0070664_100474787 3300005564 Bacteria 1150
248 Ga0070664_101055129 3300005564 Unclassified 765
249 Ga0068857_100079839 3300005577 Bacteria 2921
250 Ga0068857_100112081 3300005577 Bacteria 2453
251 Ga0068857_100678969 3300005577 Bacteria 977
252 Ga0068857_101696385 3300005577 Bacteria 617
253 Ga0068854_100075280 3300005578 Bacteria 2478
254 Ga0068854_100228365 3300005578 Bacteria 1476
255 Ga0068854_100247688 3300005578 Bacteria 1421
256 Ga0068856_100012369 3300005614 Bacteria 8267
257 Ga0068856_100023480 3300005614 Bacteria 5996
258 Ga0068856_100029778 3300005614 Bacteria 5334
259 Ga0068856_100047243 3300005614 Bacteria 4241
260 Ga0068856_100078319 3300005614 Bacteria 3277
261 Ga0068856_100101668 3300005614 Bacteria 2867
262 Ga0068856_100119354 3300005614 Bacteria 2638
263 Ga0068856_100777229 3300005614 Bacteria 977
264 Ga0068856_101316920 3300005614 Unclassified 737
265 Ga0068856_101394552 3300005614 Bacteria 715
266 Ga0070702_100005256 3300005615 Bacteria 6007
267 Ga0070702_100053012 3300005615 Bacteria 2328
268 Ga0070702_100109299 3300005615 Bacteria 1711
269 Ga0070702_100725855 3300005615 Unclassified 760
270 Ga0068852_100074918 3300005616 Bacteria 2983
271 Ga0068852_100082574 3300005616 Bacteria 2856
272 Ga0068852_100150961 3300005616 Bacteria 2160
273 Ga0068852_100160595 3300005616 Bacteria 2098
274 Ga0068852_100239202 3300005616 Bacteria 1734
275 Ga0068859_100094507 3300005617 Bacteria 3042
276 Ga0068859_100556351 3300005617 Bacteria 1241
277 Ga0068859_101284859 3300005617 Bacteria 806
278 Ga0068864_100252602 3300005618 Bacteria 1637
279 Ga0068864_100527028 3300005618 Bacteria 1140
280 Ga0068864_100758132 3300005618 Unclassified 951
281 Ga0068866_10045697 3300005718 Unclassified 2198
282 Ga0068866_10414156 3300005718 Bacteria 872
283 Ga0068861_100050540 3300005719 Bacteria 3153
284 Ga0068861_100068075 3300005719 Bacteria 2750
285 Ga0068861_100268666 3300005719 Bacteria 1464
286 Ga0068861_100366174 3300005719 Bacteria 1269
287 Ga0068851_10130227 3300005834 Bacteria 1360
288 Ga0068851_10807208 3300005834 Bacteria 583
289 Ga0068870_10024554 3300005840 Bacteria 2983
290 Ga0068870_10428750 3300005840 Unclassified 867
291 Ga0068863_100015437 3300005841 Bacteria 7342
292 Ga0068863_100147909 3300005841 Bacteria 2247
293 Ga0068863_100326583 3300005841 Bacteria 1491
294 Ga0068863_101580532 3300005841 Bacteria 665
295 Ga0068863_101993372 3300005841 Unclassified 590
296 Ga0068858_100030337 3300005842 Bacteria 5020
297 Ga0068858_100122867 3300005842 Bacteria 2429
298 Ga0068858_100212549 3300005842 Bacteria 1830
299 Ga0068858_100582309 3300005842 Bacteria 1085
300 Ga0068858_100822571 3300005842 Bacteria 906
301 Ga0068858_101039385 3300005842 Bacteria 803
302 Ga0068860_100107786 3300005843 Bacteria 2662
303 Ga0068860_100173307 3300005843 Bacteria 2084
304 Ga0068860_100177043 3300005843 Bacteria 2061
305 Ga0068860_100361236 3300005843 Bacteria 1431
306 Ga0068860_100384438 3300005843 Bacteria 1386
307 Ga0068860_101098703 3300005843 Bacteria 814
308 Ga0068860_101391162 3300005843 Unclassified 723
309 Ga0068862_100016710 3300005844 Bacteria 6110
310 Ga0068862_100338935 3300005844 Unclassified 1392
311 Ga0068862_101302387 3300005844 Bacteria 728
312 Ga0068862_101645609 3300005844 Bacteria 649
313 Ga0081455_10069071 3300005937 Bacteria 2939
314 Ga0081455_10106215 3300005937 Bacteria 2241
315 Ga0081540_1000104 3300005983 Bacteria 90590
316 Ga0081540_1000407 3300005983 Bacteria 42401
317 Ga0081540_1012627 3300005983 Bacteria 5543
318 Ga0070717_10003754 3300006028 Bacteria 10904
319 Ga0070717_10017574 3300006028 Bacteria 5569
320 Ga0070717_10017727 3300006028 Bacteria 5546
321 Ga0070717_10034347 3300006028 Bacteria 4099
322 Ga0070717_10044436 3300006028 Bacteria 3627
323 Ga0070717_10046989 3300006028 Bacteria 3535
324 Ga0070717_10071397 3300006028 Bacteria 2896
325 Ga0070717_10098167 3300006028 Bacteria 2483
326 Ga0070717_10261008 3300006028 Bacteria 1533
327 Ga0070717_10354422 3300006028 Bacteria 1312
328 Ga0070717_10405952 3300006028 Bacteria 1224
329 Ga0070717_10409148 3300006028 Bacteria 1219
330 Ga0070717_10496758 3300006028 Bacteria 1102
331 Ga0070717_10797414 3300006028 Bacteria 859
332 Ga0070717_11350236 3300006028 Bacteria 648
333 Ga0075365_10009485 3300006038 Bacteria 5598
334 Ga0075365_10018158 3300006038 Unclassified 4319
335 Ga0075365_10330506 3300006038 Bacteria 1074
336 Ga0075364_10202935 3300006051 Unclassified 1344
337 Ga0075364_10479967 3300006051 Bacteria 850
338 Ga0075432_10044836 3300006058 Bacteria 1551
339 Ga0070715_10006081 3300006163 Bacteria 4078
340 Ga0070715_10023396 3300006163 Bacteria 2420
341 Ga0070715_10041772 3300006163 Bacteria 1923
342 Ga0070715_10053107 3300006163 Bacteria 1750
343 Ga0070715_10473368 3300006163 Unclassified 712
344 Ga0070716_100007446 3300006173 Bacteria 5393
345 Ga0070716_100016324 3300006173 Bacteria 3829
346 Ga0070716_100018119 3300006173 Bacteria 3664
347 Ga0070716_100040797 3300006173 Bacteria 2584
348 Ga0070716_100062447 3300006173 Bacteria 2160
349 Ga0070716_100109143 3300006173 Bacteria 1711
350 Ga0070716_100115814 3300006173 Unclassified 1669
351 Ga0070716_100187595 3300006173 Bacteria 1363
352 Ga0070716_100309992 3300006173 Bacteria 1101
353 Ga0070716_100460198 3300006173 Unclassified 929
354 Ga0070716_100782992 3300006173 Bacteria 737
355 Ga0070716_101002155 3300006173 Bacteria 660
356 Ga0070716_101050077 3300006173 Unclassified 647
357 Ga0070716_101163781 3300006173 Bacteria 618
358 Ga0070712_100017733 3300006175 Bacteria 4611
359 Ga0070712_100022086 3300006175 Bacteria 4187
360 Ga0070712_100023859 3300006175 Bacteria 4045
361 Ga0070712_100026399 3300006175 Bacteria 3868
362 Ga0070712_100037188 3300006175 Bacteria 3316
363 Ga0070712_100041079 3300006175 Unclassified 3174
364 Ga0070712_100043229 3300006175 Bacteria 3101
365 Ga0070712_100049911 3300006175 Bacteria 2908
366 Ga0070712_100062953 3300006175 Bacteria 2624
367 Ga0070712_100108982 3300006175 Unclassified 2063
368 Ga0070712_100114035 3300006175 Bacteria 2022
369 Ga0070712_100136347 3300006175 Unclassified 1866
370 Ga0070712_100175645 3300006175 Bacteria 1665
371 Ga0070712_100241222 3300006175 Bacteria 1440
372 Ga0070712_100278841 3300006175 Bacteria 1345
373 Ga0070712_100488612 3300006175 Bacteria 1030
374 Ga0070712_101245468 3300006175 Unclassified 648
375 Ga0070712_101650423 3300006175 Unclassified 561
376 Ga0097621_100007234 3300006237 Bacteria 7924
377 Ga0097621_100089473 3300006237 Bacteria 2574
378 Ga0097621_100168724 3300006237 Bacteria 1885
379 Ga0097621_101184688 3300006237 Bacteria 719
380 Ga0068871_100026210 3300006358 Bacteria 4546
381 Ga0068871_100076034 3300006358 Bacteria 2773
382 Ga0068871_100738797 3300006358 Bacteria 904
383 Ga0068871_101080999 3300006358 Bacteria 749
384 Ga0068871_101204619 3300006358 Bacteria 710
385 Ga0068871_101914574 3300006358 Unclassified 564
386 Ga0075428_100178551 3300006844 Bacteria 2299
387 Ga0075428_100278491 3300006844 Bacteria 1800
388 Ga0075428_101385565 3300006844 Archaea 738
389 Ga0075430_100232570 3300006846 Bacteria 1528
390 Ga0075430_100413637 3300006846 Bacteria 1113
391 Ga0075431_100006776 3300006847 Bacteria 11373
392 Ga0075433_10018103 3300006852 Bacteria 5849
393 Ga0075433_10019630 3300006852 Bacteria 5636
394 Ga0075433_10027468 3300006852 Bacteria 4828
395 Ga0075433_10104447 3300006852 Bacteria 2510
396 Ga0075433_10154025 3300006852 Bacteria 2045
397 Ga0075433_10716918 3300006852 Bacteria 876
398 Ga0075434_100004695 3300006871 Bacteria 12345
399 Ga0075434_100007730 3300006871 Bacteria 9954
400 Ga0075434_100071965 3300006871 Bacteria 3449
401 Ga0075434_100112471 3300006871 Bacteria 2734
402 Ga0075434_101305058 3300006871 Bacteria 737
403 Ga0075429_100361982 3300006880 Bacteria 1270
404 Ga0068865_100033373 3300006881 Bacteria 3446
405 Ga0068865_100037607 3300006881 Bacteria 3269
406 Ga0068865_100133593 3300006881 Bacteria 1862
407 Ga0068865_100628633 3300006881 Bacteria 910
408 Ga0075436_100004471 3300006914 Bacteria 9590
409 Ga0075436_100008644 3300006914 Bacteria 6961
410 Ga0075436_100208571 3300006914 Bacteria 1385
411 Ga0075436_100363350 3300006914 Bacteria 1045
412 Ga0075436_101151888 3300006914 Bacteria 584
413 Ga0097620_100094509 3300006931 Bacteria 3042
414 Ga0097620_100556342 3300006931 Bacteria 1241
415 Ga0097620_101284819 3300006931 Bacteria 806
416 Ga0075435_100004634 3300007076 Bacteria 9470
417 Ga0075435_100016766 3300007076 Bacteria 5527
418 Ga0075435_100023872 3300007076 Bacteria 4737
419 Ga0075435_100046118 3300007076 Bacteria 3495
420 Ga0075435_100070273 3300007076 Bacteria 2857
421 Ga0075435_100073543 3300007076 Bacteria 2794
422 Ga0075435_100401754 3300007076 Bacteria 1178
423 Ga0075435_100456828 3300007076 Unclassified 1102
424 Ga0075435_100791147 3300007076 Bacteria 826
425 Ga0099795_10163173 3300007788 Unclassified 921
426 Ga0105240_10144999 3300009093 Bacteria 2834
427 Ga0105240_10373511 3300009093 Bacteria 1612
428 Ga0111539_10012913 3300009094 Bacteria 10451
429 Ga0111539_10018741 3300009094 Bacteria 8567
430 Ga0111539_10180844 3300009094 Bacteria 2463
431 Ga0111539_10194349 3300009094 Unclassified 2367
432 Ga0105245_10011721 3300009098 Bacteria 7628
433 Ga0105245_10017175 3300009098 Bacteria 6312
434 Ga0105245_10019479 3300009098 Bacteria 5945
435 Ga0105245_10043032 3300009098 Bacteria 4029
436 Ga0105245_10626082 3300009098 Bacteria 1105
437 Ga0105245_10776567 3300009098 Bacteria 995
438 Ga0105245_11445754 3300009098 Bacteria 738
439 Ga0105247_10009226 3300009101 Bacteria 5998
440 Ga0105247_10055335 3300009101 Bacteria 2448
441 Ga0105247_10060652 3300009101 Bacteria 2344
442 Ga0105247_10092348 3300009101 Unclassified 1923
443 Ga0105247_10110257 3300009101 Bacteria 1770
444 Ga0105247_10746219 3300009101 Unclassified 741
445 Ga0105247_11164788 3300009101 Bacteria 612
446 Ga0105247_11832378 3300009101 Unclassified 506
447 Ga0114129_10319057 3300009147 Bacteria 2066
448 Ga0114129_10320804 3300009147 Bacteria 2059
449 Ga0114129_10425534 3300009147 Bacteria 1746
450 Ga0114129_10481836 3300009147 Bacteria 1623
451 Ga0114129_10797926 3300009147 Bacteria 1205
452 Ga0114129_11848543 3300009147 Bacteria 733
453 Ga0105243_10186551 3300009148 Bacteria 1808
454 Ga0105243_10235737 3300009148 Bacteria 1626
455 Ga0105241_10003397 3300009174 Bacteria 11848
456 Ga0105241_10154797 3300009174 Bacteria 1879
457 Ga0105241_10259734 3300009174 Bacteria 1476
458 Ga0105241_10379678 3300009174 Unclassified 1234
459 Ga0105241_10696150 3300009174 Bacteria 927
460 Ga0105241_11108327 3300009174 Unclassified 746
461 Ga0105241_12413606 3300009174 Unclassified 525
462 Ga0105242_10181606 3300009176 Bacteria 1857
463 Ga0105242_10301929 3300009176 Bacteria 1462
464 Ga0105242_10520947 3300009176 Bacteria 1134
465 Ga0105242_11060357 3300009176 Bacteria 822
466 Ga0105248_10044768 3300009177 Bacteria 4964
467 Ga0105248_10249885 3300009177 Bacteria 1996
468 Ga0105248_10440794 3300009177 Unclassified 1467
469 Ga0105248_11798426 3300009177 Bacteria 695
470 Ga0105237_10396873 3300009545 Bacteria 1384
471 Ga0105237_10953618 3300009545 Bacteria 865
472 Ga0105237_12665792 3300009545 Bacteria 511
473 Ga0105238_10081070 3300009551 Bacteria 3234
474 Ga0105238_10683832 3300009551 Bacteria 1038
475 Ga0105238_10870749 3300009551 Bacteria 918
476 Ga0105249_10202075 3300009553 Bacteria 1945
477 Ga0105249_10299234 3300009553 Bacteria 1613
478 Ga0105249_11092202 3300009553 Bacteria 868
479 Ga0105249_11765475 3300009553 Bacteria 691
480 Ga0105249_12855915 3300009553 Bacteria 554
481 Ga0099796_10003244 3300010159 Bacteria 3738
482 Ga0105239_10086880 3300010375 Bacteria 3447
483 Ga0105239_10203853 3300010375 Bacteria 2216
484 Ga0105239_10239976 3300010375 Unclassified 2034
485 Ga0105239_10657603 3300010375 Bacteria 1197
486 Ga0105246_10004636 3300011119 Bacteria 8364
487 Ga0105246_10246838 3300011119 Bacteria 1414
488 Ga0105246_10334068 3300011119 Unclassified 1236
489 Ga0105246_11397550 3300011119 Unclassified 653
490 Ga0157340_1019153 3300012473 Bacteria 563
491 Ga0157346_1008823 3300012480 Bacteria 702
492 Ga0157343_1012339 3300012488 Bacteria 675
493 Ga0154012_109650 3300013059 Unclassified 558
494 Ga0157373_10058229 3300013100 Bacteria 2740
495 Ga0157373_10073191 3300013100 Bacteria 2418
496 Ga0157371_10066452 3300013102 Bacteria 2553
497 Ga0157371_10212903 3300013102 Bacteria 1387
498 Ga0157371_10517304 3300013102 Bacteria 882
499 Ga0157371_10612433 3300013102 Bacteria 811
500 Ga0157370_10020387 3300013104 Bacteria 6622
501 Ga0157370_10107173 3300013104 Bacteria 2614
502 Ga0157370_11203259 3300013104 Bacteria 683
503 Ga0157369_10053400 3300013105 Bacteria 4369
504 Ga0157369_10802442 3300013105 Unclassified 967
505 Ga0157369_11057129 3300013105 Unclassified 830
506 Ga0157369_11069493 3300013105 Bacteria 825
507 Ga0157369_11265449 3300013105 Bacteria 752
508 Ga0157374_10003370 3300013296 Bacteria 13422
509 Ga0157374_10566076 3300013296 Bacteria 1145
510 Ga0163162_10125876 3300013306 Bacteria 2668
511 Ga0163162_10216040 3300013306 Bacteria 2048
512 Ga0163162_10552114 3300013306 Bacteria 1280
513 Ga0163162_11830778 3300013306 Unclassified 694
514 Ga0157372_10031567 3300013307 Bacteria 5800
515 Ga0157372_10184675 3300013307 Unclassified 2415
516 Ga0157372_10338065 3300013307 Bacteria 1754
517 Ga0157372_10419262 3300013307 Bacteria 1560
518 Ga0157372_10626520 3300013307 Unclassified 1253
519 Ga0157372_10628438 3300013307 Unclassified 1251
520 Ga0157372_11067061 3300013307 Bacteria 935
521 Ga0157372_11310973 3300013307 Bacteria 835
522 Ga0157372_11411541 3300013307 Unclassified 803
523 Ga0157372_11783205 3300013307 Bacteria 708
524 Ga0157375_10234748 3300013308 Bacteria 1993
525 Ga0157375_10387373 3300013308 Bacteria 1564
526 Ga0157375_11074882 3300013308 Unclassified 941
527 Ga0157375_11117211 3300013308 Bacteria 923
528 Ga0157375_12580062 3300013308 Bacteria 607
529 Ga0163163_10116651 3300014325 Bacteria 2701
530 Ga0163163_10151441 3300014325 Bacteria 2363
531 Ga0163163_10233622 3300014325 Bacteria 1888
532 Ga0163163_10469917 3300014325 Unclassified 1318
533 Ga0163163_10944767 3300014325 Bacteria 925
534 Ga0163163_11451896 3300014325 Bacteria 747
535 Ga0157380_10269619 3300014326 Bacteria 1551
536 Ga0157380_10624806 3300014326 Bacteria 1070
537 Ga0182008_10370965 3300014497 Unclassified 763
538 Ga0157377_10002762 3300014745 Bacteria 7817
539 Ga0157377_10046848 3300014745 Bacteria 2420
540 Ga0157377_10173808 3300014745 Bacteria 1349
541 Ga0157379_10012062 3300014968 Bacteria 7551
542 Ga0157379_10187511 3300014968 Bacteria 1869
543 Ga0157379_10251809 3300014968 Bacteria 1603
544 Ga0157379_10483919 3300014968 Unclassified 1146
545 Ga0157376_10251799 3300014969 Bacteria 1650
546 Ga0157376_10443643 3300014969 Unclassified 1264
547 Ga0157376_10531030 3300014969 Bacteria 1161
548 Ga0157376_10731319 3300014969 Unclassified 997
549 Ga0157376_11238749 3300014969 Bacteria 775
550 Ga0157376_12054895 3300014969 Bacteria 609
551 Ga0163161_10613258 3300017792 Bacteria 898
552 Ga0197907_10046920 3300020069 Bacteria 985
553 Ga0197907_10460177 3300020069 Bacteria 1010
554 Ga0197907_10775795 3300020069 Unclassified 572
555 Ga0206356_10036912 3300020070 Unclassified 934
556 Ga0206349_1901982 3300020075 Bacteria 2744
557 Ga0206351_10347265 3300020077 Unclassified 687
558 Ga0206350_10854846 3300020080 Bacteria 2114
559 Ga0206350_11587344 3300020080 Bacteria 668
560 Ga0206354_10697934 3300020081 Unclassified 1118
561 Ga0206354_10734318 3300020081 Bacteria 1590
562 Ga0206353_10041774 3300020082 Bacteria 2702
563 Ga0154015_1109481 3300020610 Bacteria 632
564 Ga0213876_10695116 3300021384 Bacteria 541
565 Ga0224712_10071118 3300022467 Bacteria 1413
566 Ga0224712_10150220 3300022467 Bacteria 1032
567 Ga0224712_10206935 3300022467 Bacteria 894
568 Ga0224569_110831 3300022732 Bacteria 642
569 Ga0228598_1071943 3300024227 Unclassified 692
570 Ga0228598_1078221 3300024227 Bacteria 663
571 Ga0207656_10144846 3300025321 Bacteria 1122
572 Ga0207656_10163946 3300025321 Bacteria 1059
573 Ga0207653_10001186 3300025885 Bacteria 8509
574 Ga0207653_10064887 3300025885 Unclassified 1239
575 Ga0207653_10096166 3300025885 Bacteria 1042
576 Ga0207653_10226501 3300025885 Bacteria 711
577 Ga0207692_10000949 3300025898 Bacteria 10525
578 Ga0207692_10001835 3300025898 Bacteria 8067
579 Ga0207692_10012234 3300025898 Bacteria 3680
580 Ga0207692_10056246 3300025898 Bacteria 2017
581 Ga0207692_10073885 3300025898 Bacteria 1805
582 Ga0207692_10083361 3300025898 Bacteria 1715
583 Ga0207692_10149007 3300025898 Bacteria 1338
584 Ga0207692_10234060 3300025898 Unclassified 1094
585 Ga0207692_10258215 3300025898 Bacteria 1046
586 Ga0207692_10309035 3300025898 Bacteria 964
587 Ga0207692_10338420 3300025898 Bacteria 925
588 Ga0207642_10179843 3300025899 Unclassified 1151
589 Ga0207642_10648519 3300025899 Bacteria 661
590 Ga0207642_10731704 3300025899 Bacteria 625
591 Ga0207710_10188835 3300025900 Bacteria 1014
592 Ga0207710_10388059 3300025900 Unclassified 715
593 Ga0207710_10487294 3300025900 Bacteria 639
594 Ga0207688_10010890 3300025901 Bacteria 4947
595 Ga0207688_10011318 3300025901 Bacteria 4857
596 Ga0207688_10063565 3300025901 Bacteria 2082
597 Ga0207688_10076341 3300025901 Bacteria 1908
598 Ga0207647_10092435 3300025904 Bacteria 1804
599 Ga0207685_10035667 3300025905 Bacteria 1817
600 Ga0207685_10048434 3300025905 Unclassified 1628
601 Ga0207685_10093219 3300025905 Bacteria 1273
602 Ga0207685_10405012 3300025905 Unclassified 700
603 Ga0207699_10000382 3300025906 Bacteria 23317
604 Ga0207699_10001986 3300025906 Bacteria 9668
605 Ga0207699_10002721 3300025906 Bacteria 8359
606 Ga0207699_10009488 3300025906 Bacteria 4849
607 Ga0207699_10010279 3300025906 Bacteria 4690
608 Ga0207699_10021331 3300025906 Bacteria 3489
609 Ga0207699_10033749 3300025906 Bacteria 2895
610 Ga0207699_10037506 3300025906 Bacteria 2771
611 Ga0207699_10060539 3300025906 Bacteria 2274
612 Ga0207699_10186713 3300025906 Bacteria 1397
613 Ga0207699_10346396 3300025906 Bacteria 1048
614 Ga0207699_10400705 3300025906 Bacteria 977
615 Ga0207699_10475487 3300025906 Unclassified 899
616 Ga0207699_10645687 3300025906 Bacteria 773
617 Ga0207643_10001477 3300025908 Bacteria 13481
618 Ga0207705_10016324 3300025909 Bacteria 5325
619 Ga0207705_10291033 3300025909 Bacteria 1251
620 Ga0207684_10001155 3300025910 Bacteria 29461
621 Ga0207684_10250746 3300025910 Bacteria 1527
622 Ga0207684_10346268 3300025910 Bacteria 1279
623 Ga0207684_10414758 3300025910 Unclassified 1157
624 Ga0207684_10485570 3300025910 Bacteria 1059
625 Ga0207654_10003244 3300025911 Bacteria 8214
626 Ga0207654_10116632 3300025911 Unclassified 1670
627 Ga0207654_10207874 3300025911 Bacteria 1292
628 Ga0207654_10548960 3300025911 Unclassified 820
629 Ga0207654_10700433 3300025911 Bacteria 728
630 Ga0207707_10008747 3300025912 Bacteria 8788
631 Ga0207707_10659819 3300025912 Bacteria 881
632 Ga0207707_11109670 3300025912 Bacteria 644
633 Ga0207671_10214451 3300025914 Unclassified 1507
634 Ga0207693_10003685 3300025915 Bacteria 13076
635 Ga0207693_10003865 3300025915 Bacteria 12764
636 Ga0207693_10004300 3300025915 Bacteria 12058
637 Ga0207693_10006202 3300025915 Bacteria 9916
638 Ga0207693_10009637 3300025915 Bacteria 7865
639 Ga0207693_10012756 3300025915 Bacteria 6783
640 Ga0207693_10039072 3300025915 Bacteria 3736
641 Ga0207693_10070244 3300025915 Bacteria 2740
642 Ga0207693_10081592 3300025915 Bacteria 2532
643 Ga0207693_10082011 3300025915 Bacteria 2525
644 Ga0207693_10121785 3300025915 Bacteria 2049
645 Ga0207693_10124351 3300025915 Bacteria 2027
646 Ga0207693_10189014 3300025915 Bacteria 1621
647 Ga0207693_10207654 3300025915 Bacteria 1540
648 Ga0207693_10239957 3300025915 Bacteria 1423
649 Ga0207693_10804861 3300025915 Unclassified 724
650 Ga0207693_10923304 3300025915 Unclassified 669
651 Ga0207693_11460966 3300025915 Unclassified 506
652 Ga0207663_10007794 3300025916 Bacteria 5577
653 Ga0207663_10012086 3300025916 Bacteria 4656
654 Ga0207663_10019857 3300025916 Bacteria 3795
655 Ga0207663_10022173 3300025916 Bacteria 3627
656 Ga0207663_10022747 3300025916 Bacteria 3587
657 Ga0207663_10110204 3300025916 Bacteria 1867
658 Ga0207663_10232298 3300025916 Bacteria 1348
659 Ga0207663_10250060 3300025916 Bacteria 1304
660 Ga0207663_10268621 3300025916 Bacteria 1262
661 Ga0207663_10396446 3300025916 Bacteria 1055
662 Ga0207663_10751023 3300025916 Unclassified 775
663 Ga0207660_10172425 3300025917 Bacteria 1675
664 Ga0207660_10457936 3300025917 Unclassified 1032
665 Ga0207660_11131482 3300025917 Unclassified 638
666 Ga0207662_10005270 3300025918 Bacteria 6870
667 Ga0207657_10032467 3300025919 Bacteria 4717
668 Ga0207657_10091678 3300025919 Bacteria 2533
669 Ga0207657_10175833 3300025919 Bacteria 1732
670 Ga0207657_10971833 3300025919 Unclassified 652
671 Ga0207652_10255614 3300025921 Bacteria 1580
672 Ga0207652_10376589 3300025921 Bacteria 1281
673 Ga0207652_10421464 3300025921 Bacteria 1204
674 Ga0207652_10427032 3300025921 Unclassified 1195
675 Ga0207646_10089570 3300025922 Unclassified 2754
676 Ga0207646_10108213 3300025922 Bacteria 2494
677 Ga0207646_10231966 3300025922 Bacteria 1668
678 Ga0207646_10298782 3300025922 Bacteria 1455
679 Ga0207646_10316335 3300025922 Bacteria 1410
680 Ga0207646_10453755 3300025922 Bacteria 1157
681 Ga0207646_11565446 3300025922 Unclassified 569
682 Ga0207681_10120837 3300025923 Bacteria 1921
683 Ga0207694_10010228 3300025924 Bacteria 7073
684 Ga0207694_10140574 3300025924 Bacteria 1941
685 Ga0207650_10017816 3300025925 Bacteria 4975
686 Ga0207659_10005481 3300025926 Bacteria 7697
687 Ga0207659_10017248 3300025926 Bacteria 4713
688 Ga0207659_10082174 3300025926 Bacteria 2384
689 Ga0207659_10785257 3300025926 Bacteria 818
690 Ga0207687_10013941 3300025927 Bacteria 5254
691 Ga0207687_10016714 3300025927 Bacteria 4823
692 Ga0207687_10375366 3300025927 Bacteria 1164
693 Ga0207687_10529573 3300025927 Bacteria 986
694 Ga0207700_10000156 3300025928 Bacteria 40692
695 Ga0207700_10002756 3300025928 Bacteria 10129
696 Ga0207700_10003388 3300025928 Bacteria 9254
697 Ga0207700_10009717 3300025928 Bacteria 6027
698 Ga0207700_10010541 3300025928 Bacteria 5840
699 Ga0207700_10011236 3300025928 Bacteria 5700
700 Ga0207700_10038665 3300025928 Bacteria 3465
701 Ga0207700_10053061 3300025928 Bacteria 3035
702 Ga0207700_10069650 3300025928 Bacteria 2701
703 Ga0207700_10085433 3300025928 Bacteria 2477
704 Ga0207700_10145950 3300025928 Bacteria 1950
705 Ga0207700_10281330 3300025928 Bacteria 1431
706 Ga0207700_10303814 3300025928 Bacteria 1379
707 Ga0207700_10339012 3300025928 Bacteria 1307
708 Ga0207700_10476688 3300025928 Bacteria 1102
709 Ga0207700_10572086 3300025928 Unclassified 1004
710 Ga0207700_10913690 3300025928 Unclassified 786
711 Ga0207664_10001396 3300025929 Bacteria 15869
712 Ga0207664_10002012 3300025929 Bacteria 13393
713 Ga0207664_10005805 3300025929 Bacteria 8440
714 Ga0207664_10014718 3300025929 Bacteria 5660
715 Ga0207664_10027872 3300025929 Bacteria 4288
716 Ga0207664_10039052 3300025929 Bacteria 3683
717 Ga0207664_10043034 3300025929 Bacteria 3529
718 Ga0207664_10047685 3300025929 Bacteria 3366
719 Ga0207664_10056491 3300025929 Bacteria 3117
720 Ga0207664_10096719 3300025929 Unclassified 2431
721 Ga0207664_10161145 3300025929 Unclassified 1913
722 Ga0207664_10166919 3300025929 Bacteria 1881
723 Ga0207664_10294306 3300025929 Unclassified 1427
724 Ga0207664_10305615 3300025929 Bacteria 1400
725 Ga0207664_10335389 3300025929 Bacteria 1336
726 Ga0207664_10341840 3300025929 Bacteria 1323
727 Ga0207664_10354322 3300025929 Bacteria 1299
728 Ga0207664_10354995 3300025929 Bacteria 1298
729 Ga0207664_10418463 3300025929 Bacteria 1193
730 Ga0207664_10471755 3300025929 Bacteria 1122
731 Ga0207664_10489533 3300025929 Unclassified 1101
732 Ga0207664_10500341 3300025929 Bacteria 1088
733 Ga0207664_10610991 3300025929 Bacteria 979
734 Ga0207644_10054045 3300025931 Bacteria 2892
735 Ga0207644_10062316 3300025931 Bacteria 2704
736 Ga0207644_11104131 3300025931 Unclassified 666
737 Ga0207690_10262663 3300025932 Bacteria 1338
738 Ga0207690_10455275 3300025932 Unclassified 1029
739 Ga0207690_10924431 3300025932 Unclassified 724
740 Ga0207706_10041381 3300025933 Bacteria 4084
741 Ga0207706_10098551 3300025933 Bacteria 2571
742 Ga0207706_10100307 3300025933 Bacteria 2547
743 Ga0207706_10307429 3300025933 Bacteria 1381
744 Ga0207686_10075435 3300025934 Bacteria 2183
745 Ga0207686_10135207 3300025934 Bacteria 1696
746 Ga0207686_10237623 3300025934 Bacteria 1324
747 Ga0207686_10754462 3300025934 Unclassified 777
748 Ga0207709_10161436 3300025935 Bacteria 1563
749 Ga0207709_10623243 3300025935 Unclassified 856
750 Ga0207670_10305975 3300025936 Bacteria 1246
751 Ga0207670_10674004 3300025936 Bacteria 854
752 Ga0207669_10335256 3300025937 Bacteria 1163
753 Ga0207704_10041969 3300025938 Bacteria 2688
754 Ga0207704_10076906 3300025938 Bacteria 2140
755 Ga0207665_10000827 3300025939 Bacteria 20934
756 Ga0207665_10013492 3300025939 Bacteria 5373
757 Ga0207665_10016808 3300025939 Bacteria 4805
758 Ga0207665_10018832 3300025939 Bacteria 4537
759 Ga0207665_10025313 3300025939 Bacteria 3915
760 Ga0207665_10057490 3300025939 Bacteria 2627
761 Ga0207665_10100639 3300025939 Bacteria 2017
762 Ga0207665_10599103 3300025939 Bacteria 860
763 Ga0207665_10665675 3300025939 Bacteria 817
764 Ga0207665_11139314 3300025939 Bacteria 622
765 Ga0207691_10130392 3300025940 Bacteria 2221
766 Ga0207691_10269671 3300025940 Bacteria 1466
767 Ga0207691_10476040 3300025940 Bacteria 1061
768 Ga0207691_10563433 3300025940 Bacteria 966
769 Ga0207711_10198419 3300025941 Bacteria 1830
770 Ga0207711_10243529 3300025941 Bacteria 1649
771 Ga0207689_10004314 3300025942 Bacteria 12948
772 Ga0207689_10040223 3300025942 Bacteria 3870
773 Ga0207689_10099849 3300025942 Bacteria 2385
774 Ga0207689_10136090 3300025942 Bacteria 2023
775 Ga0207689_10608264 3300025942 Bacteria 920
776 Ga0207689_11171369 3300025942 Unclassified 647
777 Ga0207661_10008039 3300025944 Bacteria 7518
778 Ga0207661_10273228 3300025944 Bacteria 1509
779 Ga0207661_10533555 3300025944 Bacteria 1074
780 Ga0207679_10003876 3300025945 Bacteria 9276
781 Ga0207679_10012038 3300025945 Bacteria 5625
782 Ga0207679_10119630 3300025945 Bacteria 2094
783 Ga0207679_10277278 3300025945 Bacteria 1436
784 Ga0207679_10434964 3300025945 Unclassified 1161
785 Ga0207679_10608002 3300025945 Bacteria 986
786 Ga0207667_10222997 3300025949 Unclassified 1931
787 Ga0207667_10517086 3300025949 Bacteria 1209
788 Ga0207667_10836891 3300025949 Bacteria 915
789 Ga0207667_11394251 3300025949 Bacteria 674
790 Ga0207651_10013540 3300025960 Bacteria 4672
791 Ga0207651_10065036 3300025960 Bacteria 2556
792 Ga0207651_10366428 3300025960 Bacteria 1218
793 Ga0207712_10205255 3300025961 Bacteria 1566
794 Ga0207712_10355985 3300025961 Bacteria 1218
795 Ga0207712_10362079 3300025961 Bacteria 1209
796 Ga0207712_10761102 3300025961 Bacteria 849
797 Ga0207712_10892872 3300025961 Bacteria 785
798 Ga0207668_10026299 3300025972 Bacteria 3777
799 Ga0207640_10047791 3300025981 Bacteria 2762
800 Ga0207640_10063926 3300025981 Bacteria 2448
801 Ga0207640_10083607 3300025981 Bacteria 2189
802 Ga0207640_10447977 3300025981 Unclassified 1063
803 Ga0207677_10008292 3300026023 Bacteria 5793
804 Ga0207677_10013105 3300026023 Bacteria 4792
805 Ga0207677_10111282 3300026023 Bacteria 2040
806 Ga0207677_10260269 3300026023 Bacteria 1414
807 Ga0207677_11054440 3300026023 Unclassified 739
808 Ga0207677_11368968 3300026023 Unclassified 651
809 Ga0207677_11610072 3300026023 Bacteria 601
810 Ga0207703_10018287 3300026035 Bacteria 5473
811 Ga0207703_10065521 3300026035 Bacteria 2986
812 Ga0207703_10460870 3300026035 Bacteria 1189
813 Ga0207703_10733653 3300026035 Unclassified 941
814 Ga0207639_10148398 3300026041 Bacteria 1961
815 Ga0207639_10936882 3300026041 Bacteria 810
816 Ga0207639_11683215 3300026041 Bacteria 595
817 Ga0207678_10000571 3300026067 Bacteria 33712
818 Ga0207678_10008530 3300026067 Bacteria 9030
819 Ga0207678_10039266 3300026067 Bacteria 4109
820 Ga0207678_10520902 3300026067 Unclassified 1038
821 Ga0207708_10025598 3300026075 Bacteria 4466
822 Ga0207708_10079452 3300026075 Bacteria 2520
823 Ga0207708_10103125 3300026075 Bacteria 2209
824 Ga0207708_10509670 3300026075 Unclassified 1009
825 Ga0207702_10011510 3300026078 Bacteria 7371
826 Ga0207702_10011865 3300026078 Bacteria 7253
827 Ga0207702_10020025 3300026078 Bacteria 5544
828 Ga0207702_10057124 3300026078 Bacteria 3316
829 Ga0207702_10060038 3300026078 Bacteria 3241
830 Ga0207702_10108584 3300026078 Bacteria 2462
831 Ga0207702_10130621 3300026078 Bacteria 2260
832 Ga0207702_10319159 3300026078 Bacteria 1479
833 Ga0207641_10007274 3300026088 Bacteria 9222
834 Ga0207641_10277293 3300026088 Bacteria 1575
835 Ga0207641_10692648 3300026088 Bacteria 1003
836 Ga0207641_10853770 3300026088 Bacteria 902
837 Ga0207641_11135330 3300026088 Bacteria 780
838 Ga0207641_11289191 3300026088 Bacteria 731
839 Ga0207648_10121425 3300026089 Bacteria 2297
840 Ga0207676_10014581 3300026095 Bacteria 5658
841 Ga0207676_10137180 3300026095 Unclassified 2089
842 Ga0207676_10930036 3300026095 Bacteria 854
843 Ga0207676_11572071 3300026095 Unclassified 655
844 Ga0207676_11961666 3300026095 Bacteria 584
845 Ga0207674_10017738 3300026116 Bacteria 7758
846 Ga0207674_10103809 3300026116 Bacteria 2821
847 Ga0207674_10149401 3300026116 Bacteria 2294
848 Ga0207674_11064517 3300026116 Unclassified 778
849 Ga0207675_100045236 3300026118 Bacteria 4112
850 Ga0207675_100358107 3300026118 Bacteria 1431
851 Ga0207675_100736754 3300026118 Archaea 996
852 Ga0207675_101173437 3300026118 Bacteria 788
853 Ga0207683_10003351 3300026121 Bacteria 13966
854 Ga0207683_10011951 3300026121 Bacteria 7410
855 Ga0207683_10023507 3300026121 Bacteria 5302
856 Ga0207683_10031230 3300026121 Bacteria 4622
857 Ga0207683_10134204 3300026121 Bacteria 2228
858 Ga0207683_11125649 3300026121 Bacteria 728
859 Ga0207698_10011480 3300026142 Bacteria 5748
860 Ga0207698_10202021 3300026142 Bacteria 1780
861 Ga0207698_10211044 3300026142 Bacteria 1747
862 Ga0207698_10251524 3300026142 Bacteria 1617
863 Ga0207698_10370663 3300026142 Unclassified 1359
864 Ga0207698_10720269 3300026142 Unclassified 994
865 Ga0207698_11176151 3300026142 Bacteria 781
866 Ga0207428_10022119 3300027907 Bacteria 5368
867 Ga0207428_10037031 3300027907 Bacteria 3972
868 Ga0207428_10038618 3300027907 Bacteria 3881
869 Ga0207428_10101678 3300027907 Unclassified 2221
870 Ga0268266_10148679 3300028379 Bacteria 2109
871 Ga0268266_10223698 3300028379 Bacteria 1731
872 Ga0268266_10877141 3300028379 Bacteria 867
873 Ga0268266_11633618 3300028379 Unclassified 620
874 Ga0268265_10310227 3300028380 Bacteria 1424
875 Ga0268265_10992821 3300028380 Unclassified 829
876 Ga0268265_12372267 3300028380 Bacteria 537
877 Ga0268264_11511417 3300028381 Bacteria 682
878 Ga0265326_10007839 3300028558 Bacteria 3251
879 Ga0265319_1010112 3300028563 Bacteria 3955
880 Ga0265334_10000580 3300028573 Bacteria 18616
881 Ga0265318_10000194 3300028577 Bacteria 53339
882 Ga0265322_10007374 3300028654 Bacteria 3212
883 Ga0265338_10005413 3300028800 Bacteria 16666
884 Ga0265338_10707315 3300028800 Bacteria 695
885 Ga0265760_10065404 3300031090 Bacteria 1110
886 Ga0265330_10000730 3300031235 Bacteria 20693
887 Ga0265332_10000843 3300031238 Bacteria 18612
888 Ga0265328_10011532 3300031239 Bacteria 3527
889 Ga0265320_10018276 3300031240 Bacteria 3866
890 Ga0265320_10033110 3300031240 Bacteria 2641
891 Ga0265325_10000203 3300031241 Bacteria 42252
892 Ga0265329_10004054 3300031242 Bacteria 6223
893 Ga0265340_10000614 3300031247 Bacteria 19974
894 Ga0265339_10038764 3300031249 Bacteria 2655
895 Ga0265331_10002005 3300031250 Bacteria 14166
896 Ga0265327_10025146 3300031251 Bacteria 3478
897 Ga0265316_10000977 3300031344 Bacteria 31051
898 Ga0307408_102301429 3300031548 Unclassified 522
899 Ga0265313_10001583 3300031595 Bacteria 21101
900 Ga0265314_10032259 3300031711 Bacteria 3854
901 Ga0265342_10001105 3300031712 Bacteria 25873
902 Ga0307406_10407727 3300031901 Unclassified 1079
903 Ga0307409_100033772 3300031995 Bacteria 3727
904 Ga0307409_100804628 3300031995 Unclassified 948
905 Ga0307411_10773345 3300032005 Unclassified 843
906 Ga0307415_100028205 3300032126 Bacteria 3568
907 Ga0307415_100844022 3300032126 Unclassified 840
908 Ga0373930_0034201 3300034816 Bacteria 1058
909 Ga0373930_0039097 3300034816 Unclassified 1005
910 Ga0373930_0119338 3300034816 Unclassified 641
911 Ga0373948_0002617 3300034817 Bacteria 2682
912 Ga0373948_0034373 3300034817 Bacteria 1036
913 Ga0373958_0056031 3300034819 Bacteria 843
914 Ga0373958_0073225 3300034819 Bacteria 764
915 Ga0373959_0103596 3300034820 Bacteria 680
916 Ga0373938_0000786 3300034957 Bacteria 5158
917 Ga0373938_0050188 3300034957 Bacteria 951
918 Ga0373926_0001583 3300035083 Bacteria 6997
919 Ga0373926_0040371 3300035083 Bacteria 1665
920 Ga0373926_0178754 3300035083 Bacteria 813
921 Ga0373928_0015051 3300035084 Bacteria 1570
922 Ga0373929_0086236 3300035085 Bacteria 773
923 Ga0373934_0004946 3300035086 Bacteria 4937
924 Ga0373934_0088436 3300035086 Bacteria 1247
925 Ga0373934_0096311 3300035086 Bacteria 1195
926 Ga0373934_0157898 3300035086 Bacteria 930
927 Ga0373940_0043795 3300035088 Unclassified 1238
928 Ga0373940_0113999 3300035088 Bacteria 832
929 Ga0373944_0001507 3300035089 Bacteria 5891
930 Ga0373944_0002613 3300035089 Bacteria 4590
931 Ga0373944_0063558 3300035089 Bacteria 1189
932 Ga0373944_0068111 3300035089 Bacteria 1154
933 Ga0373944_0135814 3300035089 Unclassified 858
934 Ga0373951_0009620 3300035091 Bacteria 2173
935 Ga0373952_0008357 3300035092 Bacteria 1962
936 Ga0373952_0104235 3300035092 Bacteria 752
937 Ga0373923_0000360 3300035111 Bacteria 10308
938 Ga0373923_0017774 3300035111 Bacteria 2725
939 Ga0373923_0022734 3300035111 Bacteria 2461
940 Ga0373923_0034967 3300035111 Bacteria 2042
941 Ga0373923_0071364 3300035111 Bacteria 1491
942 Ga0373923_0078204 3300035111 Bacteria 1431
943 Ga0373923_0094825 3300035111 Unclassified 1310
944 Ga0373932_0001030 3300035112 Bacteria 8065
945 Ga0373932_0011323 3300035112 Bacteria 2177
946 Ga0373932_0022573 3300035112 Bacteria 1673
947 Ga0373932_0086528 3300035112 Bacteria 999
948 Ga0373936_0000848 3300035113 Bacteria 10882
949 Ga0373936_0005713 3300035113 Bacteria 4693
950 Ga0373936_0047631 3300035113 Bacteria 1729
951 Ga0373936_0054534 3300035113 Unclassified 1622
952 Ga0373936_0167373 3300035113 Bacteria 960
953 Ga0373939_0026006 3300035114 Bacteria 1646
954 Ga0373939_0031214 3300035114 Bacteria 1538
955 Ga0373939_0280245 3300035114 Bacteria 658
956 Ga0373941_0002052 3300035115 Bacteria 4367
957 Ga0373941_0012468 3300035115 Bacteria 2223
958 Ga0373941_0049370 3300035115 Bacteria 1332
959 Ga0373945_0000180 3300035116 Bacteria 16902
960 Ga0373945_0000330 3300035116 Bacteria 13469
961 Ga0373945_0232190 3300035116 Bacteria 774
962 Ga0373945_0354775 3300035116 Bacteria 636
963 Ga0373953_0000061 3300035117 Bacteria 27457
964 Ga0373953_0002146 3300035117 Bacteria 5900
965 Ga0373953_0013441 3300035117 Bacteria 2924
966 Ga0373953_0048468 3300035117 Bacteria 1711
967 Ga0373953_0085932 3300035117 Unclassified 1313
968 Ga0373953_0212492 3300035117 Unclassified 837
969 Ga0373954_0001600 3300035118 Bacteria 9236
970 Ga0373954_0025111 3300035118 Bacteria 2722
971 Ga0373954_0039472 3300035118 Bacteria 2197
972 Ga0373954_0051972 3300035118 Bacteria 1925
973 Ga0373954_0087546 3300035118 Bacteria 1493
974 Ga0373954_0417522 3300035118 Unclassified 664
975 Ga0373956_0000860 3300035119 Bacteria 12644
976 Ga0373956_0003968 3300035119 Bacteria 5944
977 Ga0373956_0011717 3300035119 Bacteria 3617
978 Ga0373956_0020518 3300035119 Bacteria 2812
979 Ga0373956_0105013 3300035119 Bacteria 1312
980 Ga0373956_0169805 3300035119 Bacteria 1029
981 Ga0373956_0428437 3300035119 Unclassified 631
982 Ga0373957_0000360 3300035120 Bacteria 11609
983 Ga0373957_0000832 3300035120 Bacteria 8066
984 Ga0373957_0002259 3300035120 Bacteria 5457
985 Ga0373957_0002760 3300035120 Bacteria 5052
986 Ga0373957_0008572 3300035120 Bacteria 3318
987 Ga0373957_0104108 3300035120 Unclassified 1138
988 Ga0373957_0237507 3300035120 Unclassified 765
989 Ga0373960_0106917 3300035121 Unclassified 913
990 Ga0373943_0001628 3300035170 Bacteria 10184
991 Ga0373943_0002968 3300035170 Bacteria 7699
992 Ga0373943_0012078 3300035170 Bacteria 3889
993 Ga0373943_0019860 3300035170 Unclassified 3094
994 Ga0373943_0066574 3300035170 Bacteria 1815
995 Ga0373943_0193271 3300035170 Bacteria 1123
996 Ga0373943_0345500 3300035170 Unclassified 852
997 Ga0373946_0001056 3300035171 Bacteria 9482
998 Ga0373946_0001301 3300035171 Bacteria 8634
999 Ga0373946_0003253 3300035171 Bacteria 5768
1000 Ga0373946_0048787 3300035171 Unclassified 1764
1001 Ga0373946_0082131 3300035171 Bacteria 1413
1002 Ga0373946_0215369 3300035171 Bacteria 925
1003 Ga0373946_0222662 3300035171 Bacteria 911
1004 Ga0373946_0261093 3300035171 Bacteria 847
1005 Ga0373955_0000018 3300035172 Bacteria 68313
1006 Ga0373955_0004186 3300035172 Bacteria 6368
1007 Ga0373955_0031583 3300035172 Bacteria 2775
1008 Ga0373955_0076092 3300035172 Bacteria 1887
1009 Ga0373955_0091183 3300035172 Bacteria 1737
1010 Ga0373955_0109963 3300035172 Bacteria 1592
1011 Ga0373955_0257882 3300035172 Unclassified 1046
1012 Ga0373955_0312582 3300035172 Unclassified 948
1013 Ga0373955_0443969 3300035172 Bacteria 790
1014 Ga0373955_0618705 3300035172 Unclassified 663
1015 Ga0373955_0747636 3300035172 Unclassified 601
1016 Ga0373942_0050192 3300035207 Unclassified 1167
1017 Ga0373961_0023559 3300035241 Bacteria 1658
1018 Ga0373961_0207514 3300035241 Bacteria 694
1019 Ga0373962_0038690 3300035242 Bacteria 1336
1020 Ga0373924_0000135 3300035410 Bacteria 21359
1021 Ga0373924_0002433 3300035410 Bacteria 6264
1022 Ga0373924_0009284 3300035410 Bacteria 3601
1023 Ga0373924_0010395 3300035410 Bacteria 3429
1024 Ga0373924_0011342 3300035410 Bacteria 3308
1025 Ga0373924_0019412 3300035410 Bacteria 2634
1026 Ga0373924_0067883 3300035410 Bacteria 1500
1027 Ga0373924_0090116 3300035410 Bacteria 1311
1028 Ga0373924_0174516 3300035410 Unclassified 945
1029 Ga0373924_0342837 3300035410 Unclassified 665
1030 Ga0373931_0006527 3300035691 Bacteria 5453
1031 Ga0373931_0019910 3300035691 Bacteria 3353
1032 Ga0373931_0084098 3300035691 Bacteria 1761
1033 Ga0373931_0263352 3300035691 Bacteria 1053
1034 Ga0373931_0896155 3300035691 Bacteria 596
1035 Ga0373931_0967021 3300035691 Bacteria 575
1036 Ga0373935_0000268 3300035692 Bacteria 25733
1037 Ga0373935_0009010 3300035692 Bacteria 5970
1038 Ga0373935_0016166 3300035692 Bacteria 4516
1039 Ga0373935_0022407 3300035692 Bacteria 3873
1040 Ga0373935_0133967 3300035692 Bacteria 1667
1041 Ga0373935_0220173 3300035692 Unclassified 1318
1042 Ga0373935_0306024 3300035692 Bacteria 1124
1043 Ga0373935_0452116 3300035692 Unclassified 928
1044 Ga0373935_0593266 3300035692 Unclassified 810
1045 Ga0373935_0683809 3300035692 Bacteria 754
1046 Ga0373935_0947499 3300035692 Bacteria 638
1047 Ga0373935_1232597 3300035692 Unclassified 558
1048 Ga0373935_1269727 3300035692 Unclassified 549
1049 Ga0373927_0008506 3300035695 Bacteria 6903
1050 Ga0373927_0010147 3300035695 Bacteria 6297
1051 Ga0373927_0014979 3300035695 Bacteria 5130
1052 Ga0373927_0174847 3300035695 Bacteria 1408
1053 Ga0373927_0184794 3300035695 Bacteria 1367
1054 Ga0373933_0000003 3300035724 Bacteria 150420
1055 Ga0373933_0005672 3300035724 Bacteria 6797
1056 Ga0373933_0014841 3300035724 Bacteria 4335
1057 Ga0373933_0017241 3300035724 Bacteria 4050
1058 Ga0373933_0020085 3300035724 Bacteria 3783
1059 Ga0373933_0022806 3300035724 Bacteria 3569
1060 Ga0373933_0023349 3300035724 Bacteria 3532
1061 Ga0373933_0045946 3300035724 Bacteria 2591
1062 Ga0373933_0167934 3300035724 Bacteria 1395
1063 Ga0373933_0231717 3300035724 Bacteria 1186
1064 Ga0373933_0235238 3300035724 Bacteria 1177
1065 Ga0373933_0436035 3300035724 Bacteria 856
1066 Ga0373933_0495742 3300035724 Unclassified 800
1067 Ga0373933_1056539 3300035724 Bacteria 535
1068 Ga0373947_0000374 3300035725 Bacteria 25329
1069 Ga0373947_0020201 3300035725 Bacteria 3844
1070 Ga0373947_0034022 3300035725 Bacteria 3013
1071 Ga0373947_0035392 3300035725 Bacteria 2956
1072 Ga0373947_0328048 3300035725 Bacteria 1024
1073 Ga0373947_0404216 3300035725 Bacteria 921
1074 Ga0373947_0417756 3300035725 Bacteria 906
1075 Ga0373947_0595298 3300035725 Bacteria 753
1076 Ga0373947_0637709 3300035725 Unclassified 726
1077 Ga0373937_0000016 3300036401 Bacteria 145523
1078 Ga0373937_0005352 3300036401 Bacteria 10976
1079 Ga0373937_0012476 3300036401 Bacteria 7476
1080 Ga0373937_0102857 3300036401 Bacteria 2652
1081 Ga0373937_0105413 3300036401 Bacteria 2619
1082 Ga0373937_0114133 3300036401 Bacteria 2514
1083 Ga0373937_0141769 3300036401 Bacteria 2249
1084 Ga0373937_0181821 3300036401 Bacteria 1974
1085 Ga0373937_0242772 3300036401 Bacteria 1697
1086 Ga0373937_0246563 3300036401 Bacteria 1683
1087 Ga0373937_2019151 3300036401 Unclassified 523
1088 Ga0373925_0001174 3300037068 Bacteria 23167
1089 Ga0373925_0010255 3300037068 Bacteria 6796
1090 Ga0373925_0020229 3300037068 Bacteria 4843
1091 Ga0373925_0032585 3300037068 Bacteria 3836
1092 Ga0373925_0035606 3300037068 Bacteria 3673
1093 Ga0373925_0038415 3300037068 Bacteria 3539
1094 Ga0373925_0058021 3300037068 Bacteria 2901
1095 Ga0373925_0072731 3300037068 Bacteria 2601
1096 Ga0373925_0256974 3300037068 Bacteria 1402
1097 Ga0373925_0295006 3300037068 Bacteria 1308
1098 Ga0373925_0407793 3300037068 Bacteria 1109
1099 Ga0373925_0436164 3300037068 Bacteria 1071
1100 Ga0373925_0544266 3300037068 Unclassified 954
1101 Ga0373925_0602044 3300037068 Bacteria 905
1102 Ga0373925_0936220 3300037068 Unclassified 714
1103 Ga0373925_1494568 3300037068 Unclassified 553
1104 Ga0373925_1576613 3300037068 Bacteria 537
1105 Ga0395899_0003362 3300037312 Bacteria 12693
1106 Ga0395900_0002558 3300037418 Bacteria 19945
1107 Ga0395900_0181538 3300037418 Bacteria 2138
1108 Ga0395900_0932135 3300037418 Bacteria 791
1109 Ga0395898_0043181 3300037466 Bacteria 4443
1110 Ga0395898_0117792 3300037466 Unclassified 2544
1111 Ga0395898_0312056 3300037466 Bacteria 1500
1112 Ga0395898_0449208 3300037466 Bacteria 1228
1113 Ga0395905_0002554 3300037471 Bacteria 20070
1114 Ga0395905_0156420 3300037471 Bacteria 2144
1115 Ga0436364_0441041 3300037853 Bacteria 6930
1116 Ga0436364_0844683 3300037853 Bacteria 1027
1117 Ga0395901_0002375 3300038443 Bacteria 19144
1118 Ga0395901_0222606 3300038443 Bacteria 1972
1119 Ga0436365_0255797 3300039437 Bacteria 1354
1120 Ga0436365_0426892 3300039437 Bacteria 1611
1121 Ga0436365_0464844 3300039437 Bacteria 8549
1122 Ga0436360_0189120 3300039438 Bacteria 1743
1123 Ga0436363_0280449 3300039450 Bacteria 2745
1124 Ga0436363_0349492 3300039450 Unclassified 859
1125 Ga0436363_1620924 3300039450 Bacteria 1385
1126 Ga0436362_0478452 3300039453 Bacteria 1421
1127 Ga0436362_0558682 3300039453 Bacteria 1324
1128 Ga0451853_3176466 3300041512 Bacteria 947
1129 Ga0439448_0071681 3300042005 Bacteria 1154
1130 Ga0439463_021757 3300042016 Bacteria 1602
1131 Ga0450902_028456 3300042137 Bacteria 938
1132 Ga0439459_0059592 3300042438 Unclassified 859
1133 Ga0439464_0042218 3300042439 Bacteria 1302
1134 Ga0439440_0028544 3300042993 Bacteria 1303
1135 Ga0439440_0107102 3300042993 Unclassified 766
1136 Ga0466963_0104496 3300044694 Bacteria 1941
1137 Ga0466964_0652663 3300044706 Bacteria 582
1138 Ga0466959_0167529 3300045049 Bacteria 1542
1139 Ga0466967_0090419 3300045976 Bacteria 2781
1140 Ga0466967_0100033 3300045976 Bacteria 2649
1141 Ga0495592_0000116 3300046454 Bacteria 70091
1142 Ga0495592_0006999 3300046454 Bacteria 8429
1143 Ga0495592_0017920 3300046454 Bacteria 5381
1144 Ga0495592_0019499 3300046454 Bacteria 5157
1145 Ga0495592_0076016 3300046454 Bacteria 2437
1146 Ga0495592_0114071 3300046454 Bacteria 1909
1147 Ga0495592_0167062 3300046454 Bacteria 1509
1148 Ga0495592_0288556 3300046454 Bacteria 1070
1149 Ga0495592_0298778 3300046454 Bacteria 1047
1150 Ga0495592_0300116 3300046454 Bacteria 1044
1151 Ga0495592_0327487 3300046454 Bacteria 988
1152 Ga0495592_0418739 3300046454 Bacteria 845
1153 Ga0495603_0039544 3300046455 Bacteria 2825
1154 Ga0495603_0043628 3300046455 Bacteria 2677
1155 Ga0495603_0395187 3300046455 Unclassified 792
1156 Ga0495629_0003179 3300046459 Bacteria 12433
1157 Ga0495629_0049067 3300046459 Bacteria 2960
1158 Ga0495629_0059086 3300046459 Bacteria 2680
1159 Ga0495629_0077735 3300046459 Bacteria 2316
1160 Ga0495629_0650742 3300046459 Unclassified 702
1161 Ga0495629_0760598 3300046459 Unclassified 641
1162 Ga0495641_0001952 3300046461 Bacteria 16770
1163 Ga0495641_0019077 3300046461 Bacteria 3521
1164 Ga0495641_0022429 3300046461 Bacteria 3159
1165 Ga0495641_0041441 3300046461 Bacteria 2139
1166 Ga0495641_0058480 3300046461 Bacteria 1744
1167 Ga0495641_0095454 3300046461 Bacteria 1328
1168 Ga0495641_0411834 3300046461 Unclassified 614
1169 Ga0495641_0528390 3300046461 Unclassified 538
1170 Ga0495651_0000009 3300046462 Bacteria 150455
1171 Ga0495651_0006098 3300046462 Bacteria 9202
1172 Ga0495651_0012073 3300046462 Bacteria 6648
1173 Ga0495651_0014354 3300046462 Bacteria 6124
1174 Ga0495651_0025318 3300046462 Bacteria 4618
1175 Ga0495651_0030794 3300046462 Bacteria 4184
1176 Ga0495651_0032117 3300046462 Bacteria 4096
1177 Ga0495651_0038319 3300046462 Bacteria 3733
1178 Ga0495651_0158059 3300046462 Bacteria 1627
1179 Ga0495651_0163956 3300046462 Bacteria 1589
1180 Ga0495651_0165889 3300046462 Unclassified 1577
1181 Ga0495651_0180396 3300046462 Bacteria 1495
1182 Ga0495651_0199508 3300046462 Bacteria 1401
1183 Ga0495651_0199745 3300046462 Unclassified 1400
1184 Ga0495651_0295023 3300046462 Unclassified 1090
1185 Ga0495653_0001057 3300046463 Bacteria 21196
1186 Ga0495653_0011491 3300046463 Bacteria 7234
1187 Ga0495653_0018727 3300046463 Bacteria 5621
1188 Ga0495653_0025298 3300046463 Bacteria 4773
1189 Ga0495653_0025742 3300046463 Bacteria 4720
1190 Ga0495653_0025926 3300046463 Bacteria 4704
1191 Ga0495653_0029010 3300046463 Bacteria 4422
1192 Ga0495653_0046335 3300046463 Bacteria 3367
1193 Ga0495653_0076811 3300046463 Bacteria 2481
1194 Ga0495653_0081376 3300046463 Bacteria 2393
1195 Ga0495653_0093855 3300046463 Bacteria 2187
1196 Ga0495653_0124807 3300046463 Bacteria 1829
1197 Ga0495653_0170506 3300046463 Bacteria 1502
1198 Ga0495653_0297210 3300046463 Bacteria 1054
1199 Ga0495653_0601169 3300046463 Bacteria 676
1200 Ga0495653_0602003 3300046463 Unclassified 675
1201 Ga0495580_0000900 3300046472 Bacteria 25880
1202 Ga0495580_0036534 3300046472 Bacteria 3526
1203 Ga0495580_0110406 3300046472 Unclassified 1910
1204 Ga0495580_0566721 3300046472 Unclassified 753
1205 Ga0495582_0001399 3300046473 Bacteria 13590
1206 Ga0495582_0025720 3300046473 Bacteria 3224
1207 Ga0495582_0032243 3300046473 Bacteria 2882
1208 Ga0495582_0036144 3300046473 Unclassified 2717
1209 Ga0495582_0267110 3300046473 Bacteria 981
1210 Ga0495639_0002222 3300046475 Bacteria 8537
1211 Ga0495639_0020728 3300046475 Bacteria 2873
1212 Ga0495639_0026940 3300046475 Bacteria 2543
1213 Ga0495639_0099918 3300046475 Unclassified 1369
1214 Ga0495639_0117264 3300046475 Bacteria 1268
1215 Ga0495639_0214240 3300046475 Bacteria 945
1216 Ga0495639_0279751 3300046475 Bacteria 829
1217 Ga0495662_0008680 3300046476 Bacteria 4996
1218 Ga0495662_0023663 3300046476 Bacteria 2966
1219 Ga0495662_0029676 3300046476 Bacteria 2639
1220 Ga0495662_0031440 3300046476 Bacteria 2564
1221 Ga0495662_0033704 3300046476 Unclassified 2474
1222 Ga0495662_0069691 3300046476 Bacteria 1704
1223 Ga0495662_0082193 3300046476 Unclassified 1567
1224 Ga0495662_0213777 3300046476 Bacteria 950
1225 Ga0495662_0250492 3300046476 Unclassified 872
1226 Ga0495664_0019681 3300046477 Bacteria 3884
1227 Ga0495664_0026889 3300046477 Bacteria 3352
1228 Ga0495664_0030255 3300046477 Bacteria 3171
1229 Ga0495664_0044510 3300046477 Bacteria 2630
1230 Ga0495664_0047929 3300046477 Bacteria 2536
1231 Ga0495664_0072516 3300046477 Bacteria 2058
1232 Ga0495664_0095125 3300046477 Bacteria 1793
1233 Ga0495664_0225396 3300046477 Bacteria 1135
1234 Ga0495664_0314091 3300046477 Unclassified 945
1235 Ga0495664_0353267 3300046477 Bacteria 885
1236 Ga0495664_0401150 3300046477 Unclassified 823
1237 Ga0495664_0569882 3300046477 Bacteria 674
1238 Ga0495664_0930599 3300046477 Unclassified 507
1239 Ga0495594_0005006 3300046499 Bacteria 6819
1240 Ga0495608_0000019 3300046511 Bacteria 180119
1241 Ga0495608_0004481 3300046511 Bacteria 9980
1242 Ga0495608_0011269 3300046511 Bacteria 6225
1243 Ga0495608_0011645 3300046511 Bacteria 6117
1244 Ga0495608_0012752 3300046511 Bacteria 5832
1245 Ga0495608_0017826 3300046511 Bacteria 4908
1246 Ga0495608_0044919 3300046511 Bacteria 2946
1247 Ga0495608_0054997 3300046511 Bacteria 2630
1248 Ga0495608_0074761 3300046511 Bacteria 2208
1249 Ga0495608_0112328 3300046511 Bacteria 1751
1250 Ga0495608_0241099 3300046511 Bacteria 1130
1251 Ga0495608_0343605 3300046511 Bacteria 919
1252 Ga0495618_0006736 3300046514 Bacteria 6961
1253 Ga0495618_0014710 3300046514 Bacteria 4771
1254 Ga0495618_0017092 3300046514 Bacteria 4446
1255 Ga0495618_0033991 3300046514 Bacteria 3196
1256 Ga0495618_0045378 3300046514 Bacteria 2772
1257 Ga0495618_0066823 3300046514 Bacteria 2285
1258 Ga0495618_0098447 3300046514 Bacteria 1871
1259 Ga0495618_0156310 3300046514 Bacteria 1455
1260 Ga0495618_0166001 3300046514 Bacteria 1406
1261 Ga0495618_0299964 3300046514 Unclassified 998
1262 Ga0495618_0326188 3300046514 Unclassified 950
1263 Ga0495620_0370176 3300046515 Unclassified 543
1264 Ga0495628_0000487 3300046516 Bacteria 36399
1265 Ga0495628_0028198 3300046516 Bacteria 4563
1266 Ga0495628_0056091 3300046516 Bacteria 3102
1267 Ga0495628_0071001 3300046516 Bacteria 2715
1268 Ga0495628_0078610 3300046516 Bacteria 2565
1269 Ga0495628_0079322 3300046516 Bacteria 2552
1270 Ga0495628_0096624 3300046516 Bacteria 2282
1271 Ga0495628_0170790 3300046516 Bacteria 1649
1272 Ga0495628_0222459 3300046516 Bacteria 1417
1273 Ga0495628_0282064 3300046516 Unclassified 1233
1274 Ga0495628_0291187 3300046516 Unclassified 1210
1275 Ga0495628_0300312 3300046516 Bacteria 1188
1276 Ga0495628_0413996 3300046516 Unclassified 983
1277 Ga0495628_0616721 3300046516 Unclassified 773
1278 Ga0495628_0731997 3300046516 Bacteria 696
1279 Ga0495630_0009386 3300046517 Bacteria 7031
1280 Ga0495630_0014713 3300046517 Bacteria 5705
1281 Ga0495630_0018848 3300046517 Bacteria 5072
1282 Ga0495630_0026862 3300046517 Bacteria 4265
1283 Ga0495630_0027228 3300046517 Bacteria 4238
1284 Ga0495630_0087173 3300046517 Bacteria 2357
1285 Ga0495630_0087772 3300046517 Bacteria 2349
1286 Ga0495630_0106606 3300046517 Bacteria 2122
1287 Ga0495630_0155776 3300046517 Unclassified 1739
1288 Ga0495630_1003100 3300046517 Unclassified 634
1289 Ga0495666_0008314 3300046526 Bacteria 5200
1290 Ga0495666_0094884 3300046526 Bacteria 1407
1291 Ga0495652_0000082 3300046529 Bacteria 102163
1292 Ga0495652_0001084 3300046529 Bacteria 30802
1293 Ga0495652_0014619 3300046529 Bacteria 7037
1294 Ga0495652_0016263 3300046529 Bacteria 6655
1295 Ga0495652_0067816 3300046529 Bacteria 2990
1296 Ga0495652_0073538 3300046529 Bacteria 2845
1297 Ga0495652_0074971 3300046529 Unclassified 2812
1298 Ga0495652_0085318 3300046529 Bacteria 2595
1299 Ga0495652_0086326 3300046529 Bacteria 2577
1300 Ga0495652_0185471 3300046529 Unclassified 1592
1301 Ga0495652_0249961 3300046529 Bacteria 1314
1302 Ga0495652_0311528 3300046529 Bacteria 1140
1303 Ga0495652_0321084 3300046529 Bacteria 1119
1304 Ga0495652_0645350 3300046529 Bacteria 717
1305 Ga0495665_0008673 3300046531 Bacteria 5518
1306 Ga0495665_0049185 3300046531 Bacteria 2235
1307 Ga0495665_0082628 3300046531 Bacteria 1689
1308 Ga0495665_0088407 3300046531 Bacteria 1628
1309 Ga0495665_0111653 3300046531 Unclassified 1433
1310 Ga0495665_0146193 3300046531 Unclassified 1235
1311 Ga0495665_0211031 3300046531 Bacteria 1005
1312 Ga0495640_0015109 3300046533 Bacteria 5816
1313 Ga0495640_0017597 3300046533 Bacteria 5321
1314 Ga0495640_0020301 3300046533 Bacteria 4893
1315 Ga0495640_0033180 3300046533 Bacteria 3670
1316 Ga0495640_0049760 3300046533 Bacteria 2888
1317 Ga0495640_0059001 3300046533 Bacteria 2615
1318 Ga0495640_0075262 3300046533 Bacteria 2255
1319 Ga0495640_0084767 3300046533 Bacteria 2101
1320 Ga0495640_0148536 3300046533 Bacteria 1507
1321 Ga0495640_0181958 3300046533 Unclassified 1339
1322 Ga0495640_0319389 3300046533 Bacteria 962
1323 Ga0495586_0038174 3300046535 Bacteria 2578
1324 Ga0495586_0077563 3300046535 Bacteria 1821
1325 Ga0495586_0129586 3300046535 Unclassified 1412
1326 Ga0495586_0159291 3300046535 Bacteria 1273
1327 Ga0495586_0324389 3300046535 Unclassified 883
1328 Ga0495586_0406291 3300046535 Bacteria 784
1329 Ga0495586_0485292 3300046535 Bacteria 713
1330 Ga0495587_0000041 3300046536 Bacteria 110168
1331 Ga0495587_0002545 3300046536 Bacteria 12192
1332 Ga0495587_0003164 3300046536 Bacteria 11002
1333 Ga0495587_0006468 3300046536 Bacteria 7632
1334 Ga0495587_0020245 3300046536 Bacteria 4107
1335 Ga0495587_0077639 3300046536 Bacteria 1927
1336 Ga0495587_0082492 3300046536 Bacteria 1863
1337 Ga0495587_0085962 3300046536 Bacteria 1820
1338 Ga0495587_0108321 3300046536 Bacteria 1597
1339 Ga0495645_0030131 3300046543 Bacteria 3951
1340 Ga0495645_0035787 3300046543 Bacteria 3619
1341 Ga0495645_0040681 3300046543 Bacteria 3390
1342 Ga0495645_0052142 3300046543 Bacteria 2977
1343 Ga0495645_0062859 3300046543 Bacteria 2688
1344 Ga0495645_0072059 3300046543 Bacteria 2490
1345 Ga0495645_0114655 3300046543 Bacteria 1904
1346 Ga0495645_0117802 3300046543 Bacteria 1873
1347 Ga0495645_0190744 3300046543 Bacteria 1397
1348 Ga0495645_0260561 3300046543 Bacteria 1148
1349 Ga0495645_0267992 3300046543 Bacteria 1128
1350 Ga0495645_0364684 3300046543 Bacteria 928
1351 Ga0495645_0433029 3300046543 Bacteria 832
1352 Ga0495645_0461707 3300046543 Unclassified 799
1353 Ga0495667_0000037 3300046559 Bacteria 133780
1354 Ga0495667_0000421 3300046559 Bacteria 27190
1355 Ga0495667_0000800 3300046559 Bacteria 20253
1356 Ga0495667_0004264 3300046559 Bacteria 9639
1357 Ga0495667_0009183 3300046559 Bacteria 6715
1358 Ga0495667_0011013 3300046559 Bacteria 6113
1359 Ga0495667_0019326 3300046559 Bacteria 4597
1360 Ga0495667_0027470 3300046559 Bacteria 3834
1361 Ga0495667_0034240 3300046559 Bacteria 3396
1362 Ga0495667_0043787 3300046559 Bacteria 2965
1363 Ga0495667_0056052 3300046559 Bacteria 2592
1364 Ga0495667_0066308 3300046559 Bacteria 2360
1365 Ga0495667_0090587 3300046559 Bacteria 1981
1366 Ga0495667_0157246 3300046559 Bacteria 1462
1367 Ga0495667_0411843 3300046559 Bacteria 851
1368 Ga0495667_0435459 3300046559 Unclassified 824
1369 Ga0495667_0544238 3300046559 Unclassified 725
1370 Ga0495634_0010433 3300046642 Bacteria 6805
1371 Ga0495634_0011439 3300046642 Bacteria 6462
1372 Ga0495634_0053227 3300046642 Bacteria 2712
1373 Ga0495634_0092595 3300046642 Bacteria 1961
1374 Ga0495634_0319851 3300046642 Bacteria 934
1375 Ga0495634_0500040 3300046642 Unclassified 713
1376 Ga0495634_0600131 3300046642 Bacteria 639
1377 Ga0495635_0002898 3300046663 Bacteria 11780
1378 Ga0495635_0007111 3300046663 Bacteria 7826
1379 Ga0495635_0032303 3300046663 Bacteria 3631
1380 Ga0495635_0040020 3300046663 Bacteria 3241
1381 Ga0495635_0042984 3300046663 Bacteria 3119
1382 Ga0495635_0059737 3300046663 Bacteria 2621
1383 Ga0495635_0064133 3300046663 Bacteria 2522
1384 Ga0495635_0122135 3300046663 Bacteria 1776
1385 Ga0495635_0144754 3300046663 Bacteria 1618
1386 Ga0495635_0214678 3300046663 Bacteria 1302
1387 Ga0495635_0655376 3300046663 Bacteria 683
1388 Ga0495635_0667590 3300046663 Unclassified 675
1389 Ga0495588_0165662 3300046674 Bacteria 1169
1390 Ga0495588_0248622 3300046674 Bacteria 938
1391 Ga0495657_0000094 3300046675 Bacteria 78779
1392 Ga0495657_0003003 3300046675 Bacteria 13956
1393 Ga0495657_0021904 3300046675 Bacteria 4582
1394 Ga0495657_0030345 3300046675 Bacteria 3787
1395 Ga0495657_0040493 3300046675 Bacteria 3195
1396 Ga0495657_0043467 3300046675 Bacteria 3064
1397 Ga0495657_0047804 3300046675 Bacteria 2890
1398 Ga0495657_0052593 3300046675 Bacteria 2729
1399 Ga0495657_0066023 3300046675 Bacteria 2378
1400 Ga0495657_0097164 3300046675 Bacteria 1881
1401 Ga0495657_0103176 3300046675 Bacteria 1814
1402 Ga0495657_0120284 3300046675 Bacteria 1654
1403 Ga0495657_0127573 3300046675 Unclassified 1597
1404 Ga0495657_0142898 3300046675 Bacteria 1490
1405 Ga0495599_0000040 3300046678 Bacteria 97423
1406 Ga0495599_0002900 3300046678 Bacteria 9976
1407 Ga0495599_0005848 3300046678 Bacteria 7385
1408 Ga0495599_0009981 3300046678 Bacteria 5813
1409 Ga0495599_0010351 3300046678 Bacteria 5703
1410 Ga0495599_0032221 3300046678 Bacteria 3290
1411 Ga0495599_0038601 3300046678 Bacteria 3001
1412 Ga0495599_0193223 3300046678 Bacteria 1251
1413 Ga0495599_0278142 3300046678 Bacteria 1014
1414 Ga0495599_0359470 3300046678 Unclassified 872
1415 Ga0495599_0384877 3300046678 Unclassified 837
1416 Ga0495599_0401143 3300046678 Bacteria 817
1417 Ga0495599_0408841 3300046678 Bacteria 807
1418 Ga0495623_0000284 3300046679 Bacteria 32990
1419 Ga0495623_0025339 3300046679 Bacteria 3820
1420 Ga0495623_0027339 3300046679 Bacteria 3669
1421 Ga0495623_0060472 3300046679 Unclassified 2377
1422 Ga0495623_0066130 3300046679 Bacteria 2259
1423 Ga0495623_0074365 3300046679 Bacteria 2111
1424 Ga0495623_0168398 3300046679 Bacteria 1282
1425 Ga0495623_0348223 3300046679 Bacteria 808
1426 Ga0495646_0010148 3300046680 Bacteria 5988
1427 Ga0495646_0020355 3300046680 Bacteria 4198
1428 Ga0495646_0033771 3300046680 Unclassified 3180
1429 Ga0495646_0053908 3300046680 Bacteria 2421
1430 Ga0495646_0098108 3300046680 Bacteria 1683
1431 Ga0495646_0148879 3300046680 Bacteria 1303
1432 Ga0495646_0472108 3300046680 Bacteria 646
1433 Ga0495647_0033564 3300046681 Bacteria 1918
1434 Ga0495647_0045938 3300046681 Bacteria 1680
1435 Ga0495647_0190530 3300046681 Bacteria 896
1436 Ga0495647_0215784 3300046681 Bacteria 845
1437 Ga0495647_0315318 3300046681 Unclassified 707
1438 Ga0495658_0000946 3300046683 Bacteria 15487
1439 Ga0495658_0035064 3300046683 Bacteria 2757
1440 Ga0495658_0085296 3300046683 Unclassified 1861
1441 Ga0495658_0092352 3300046683 Bacteria 1794
1442 Ga0495658_0831232 3300046683 Bacteria 591
1443 Ga0495658_0846115 3300046683 Unclassified 585
1444 Ga0495613_0004518 3300046689 Bacteria 10433
1445 Ga0495613_0011485 3300046689 Bacteria 6588
1446 Ga0495613_0063652 3300046689 Bacteria 2698
1447 Ga0495613_0072554 3300046689 Bacteria 2509
1448 Ga0495613_0078390 3300046689 Bacteria 2403
1449 Ga0495613_0085475 3300046689 Bacteria 2289
1450 Ga0495624_0002604 3300046690 Bacteria 13611
1451 Ga0495624_0006330 3300046690 Bacteria 8413
1452 Ga0495624_0017938 3300046690 Bacteria 4742
1453 Ga0495624_0032175 3300046690 Bacteria 3402
1454 Ga0495624_0048265 3300046690 Bacteria 2703
1455 Ga0495624_0197000 3300046690 Unclassified 1224
1456 Ga0495624_0326890 3300046690 Bacteria 923
1457 Ga0495624_0455125 3300046690 Bacteria 767
1458 Ga0495600_0000803 3300046809 Bacteria 16646
1459 Ga0495600_0003966 3300046809 Bacteria 8796
1460 Ga0495600_0008834 3300046809 Bacteria 6204
1461 Ga0495600_0015047 3300046809 Bacteria 4885
1462 Ga0495600_0046491 3300046809 Bacteria 2831
1463 Ga0495600_0062743 3300046809 Bacteria 2428
1464 Ga0495600_0068838 3300046809 Bacteria 2313
1465 Ga0495600_0078023 3300046809 Bacteria 2163
1466 Ga0495600_0079409 3300046809 Unclassified 2142
1467 Ga0495600_0154704 3300046809 Bacteria 1483
1468 Ga0495600_0403190 3300046809 Bacteria 851
1469 Ga0495581_0004483 3300047315 Bacteria 8074
1470 Ga0495581_0015778 3300047315 Bacteria 4386
1471 Ga0495581_0028979 3300047315 Bacteria 3210
1472 Ga0495581_0037596 3300047315 Bacteria 2802
1473 Ga0495581_0037870 3300047315 Bacteria 2791
1474 Ga0495604_0000040 3300047317 Bacteria 120837
1475 Ga0495604_0014873 3300047317 Bacteria 6207
1476 Ga0495604_0022068 3300047317 Bacteria 5081
1477 Ga0495604_0024377 3300047317 Bacteria 4826
1478 Ga0495604_0074084 3300047317 Bacteria 2567
1479 Ga0495604_0131783 3300047317 Bacteria 1796
1480 Ga0495604_0163256 3300047317 Bacteria 1572
1481 Ga0495604_0182639 3300047317 Bacteria 1466
1482 Ga0495604_0187379 3300047317 Unclassified 1444
1483 Ga0495674_0000257 3300047319 Bacteria 45119
1484 Ga0495674_0045612 3300047319 Bacteria 3892
1485 Ga0495674_0053795 3300047319 Bacteria 3537
1486 Ga0495674_0054363 3300047319 Bacteria 3516
1487 Ga0495674_0064729 3300047319 Bacteria 3177
1488 Ga0495674_0082232 3300047319 Bacteria 2761
1489 Ga0495674_0094041 3300047319 Bacteria 2557
1490 Ga0495674_0120504 3300047319 Bacteria 2216
1491 Ga0495674_0221591 3300047319 Bacteria 1563
1492 Ga0495674_0335528 3300047319 Bacteria 1229
1493 Ga0495674_0398343 3300047319 Unclassified 1111
1494 Ga0495674_0424028 3300047319 Bacteria 1071
1495 Ga0495674_0668777 3300047319 Bacteria 817
1496 Ga0495674_0740959 3300047319 Unclassified 768
1497 Ga0495674_0928457 3300047319 Unclassified 670
1498 Ga0495674_1019563 3300047319 Bacteria 633
1499 Ga0495674_1104308 3300047319 Unclassified 603
1500 Ga0495676_0000700 3300047321 Bacteria 27875
1501 Ga0495676_0020351 3300047321 Bacteria 5822
1502 Ga0495676_0047635 3300047321 Bacteria 3463
1503 Ga0495676_0150426 3300047321 Bacteria 1657
1504 Ga0495676_0435237 3300047321 Bacteria 866
1505 Ga0495680_0000010 3300047322 Bacteria 142931
1506 Ga0495680_0010497 3300047322 Bacteria 8264
1507 Ga0495680_0010698 3300047322 Bacteria 8182
1508 Ga0495680_0013172 3300047322 Bacteria 7226
1509 Ga0495680_0013767 3300047322 Bacteria 7038
1510 Ga0495680_0014838 3300047322 Bacteria 6735
1511 Ga0495680_0016768 3300047322 Bacteria 6280
1512 Ga0495680_0029749 3300047322 Bacteria 4469
1513 Ga0495680_0038010 3300047322 Bacteria 3851
1514 Ga0495680_0049590 3300047322 Bacteria 3288
1515 Ga0495680_0059578 3300047322 Bacteria 2946
1516 Ga0495680_0068511 3300047322 Bacteria 2710
1517 Ga0495680_0087590 3300047322 Bacteria 2341
1518 Ga0495680_0096053 3300047322 Unclassified 2214
1519 Ga0495680_0276036 3300047322 Unclassified 1185
1520 Ga0495680_0291630 3300047322 Unclassified 1147
1521 Ga0495680_0452998 3300047322 Bacteria 878
1522 Ga0495680_0510352 3300047322 Bacteria 815
1523 Ga0495680_0559823 3300047322 Bacteria 769
1524 Ga0495680_0573177 3300047322 Bacteria 758
1525 Ga0495675_0000111 3300047444 Bacteria 58822
1526 Ga0495675_0006911 3300047444 Bacteria 6968
1527 Ga0495675_0150205 3300047444 Unclassified 1440
1528 Ga0495675_0180580 3300047444 Bacteria 1292
1529 Ga0495675_0305886 3300047444 Bacteria 943
1530 Ga0495684_0000641 3300047471 Bacteria 28128
1531 Ga0495684_0009245 3300047471 Bacteria 7610
1532 Ga0495684_0009309 3300047471 Bacteria 7581
1533 Ga0495684_0018560 3300047471 Bacteria 5357
1534 Ga0495684_0020458 3300047471 Bacteria 5100
1535 Ga0495684_0031019 3300047471 Bacteria 4103
1536 Ga0495684_0034267 3300047471 Bacteria 3896
1537 Ga0495684_0079617 3300047471 Unclassified 2487
1538 Ga0495684_0083078 3300047471 Bacteria 2429
1539 Ga0495684_0125520 3300047471 Bacteria 1931
1540 Ga0495684_0129501 3300047471 Bacteria 1896
1541 Ga0495684_0198864 3300047471 Bacteria 1478
1542 Ga0495684_0217398 3300047471 Bacteria 1402
1543 Ga0495684_0375752 3300047471 Bacteria 1003
1544 Ga0495684_0416822 3300047471 Unclassified 939
1545 Ga0495684_0644354 3300047471 Bacteria 709
1546 Ga0495593_0009511 3300047673 Bacteria 5639
1547 Ga0495593_0018083 3300047673 Bacteria 3963
1548 Ga0495593_0043192 3300047673 Bacteria 2416
1549 Ga0495593_0157171 3300047673 Bacteria 1149
1550 Ga0495593_0500001 3300047673 Unclassified 609
1551 Ga0495602_0000130 3300048088 Bacteria 71178
1552 Ga0495602_0002822 3300048088 Bacteria 17774
1553 Ga0495602_0008980 3300048088 Bacteria 10415
1554 Ga0495602_0025415 3300048088 Bacteria 5731
1555 Ga0495602_0026049 3300048088 Bacteria 5648
1556 Ga0495602_0057636 3300048088 Bacteria 3406
1557 Ga0495602_0063939 3300048088 Bacteria 3185
1558 Ga0495602_0075199 3300048088 Bacteria 2867
1559 Ga0495602_0083382 3300048088 Bacteria 2678
1560 Ga0495602_0184792 3300048088 Unclassified 1604
1561 Ga0495602_0185362 3300048088 Bacteria 1601
1562 Ga0495602_0292628 3300048088 Bacteria 1195
1563 Ga0495602_0369990 3300048088 Unclassified 1029
1564 Ga0495602_0712107 3300048088 Unclassified 680
1565 Ga0495614_0005861 3300048089 Bacteria 5535
1566 Ga0495614_0026653 3300048089 Bacteria 2492
1567 Ga0495614_0030574 3300048089 Bacteria 2318
1568 Ga0495614_0325448 3300048089 Bacteria 713
1569 Ga0496100_0009329 3300048903 Bacteria 5514
1570 Ga0496100_0073862 3300048903 Unclassified 2283
1571 Ga0496100_0226749 3300048903 Bacteria 1373
1572 Ga0496100_0339081 3300048903 Bacteria 1133
1573 Ga0496100_0490707 3300048903 Unclassified 945
1574 Ga0496101_0065686 3300048904 Bacteria 2645
1575 Ga0496101_0240698 3300048904 Unclassified 1408
1576 Ga0496101_0292110 3300048904 Unclassified 1275
1577 Ga0496101_0457172 3300048904 Bacteria 1007
1578 Ga0496101_0901869 3300048904 Unclassified 696
1579 Ga0496101_0936434 3300048904 Bacteria 682
1580 Ga0496102_0021857 3300048905 Bacteria 5663
1581 Ga0496102_0047254 3300048905 Bacteria 3910
1582 Ga0496102_0065897 3300048905 Bacteria 3320
1583 Ga0496102_0119431 3300048905 Bacteria 2461
1584 Ga0496102_0264690 3300048905 Unclassified 1621
1585 Ga0496102_0439573 3300048905 Bacteria 1224
1586 Ga0496102_0471923 3300048905 Bacteria 1176
1587 Ga0496102_0539972 3300048905 Unclassified 1088
1588 Ga0496103_0019954 3300048906 Unclassified 4025
1589 Ga0496103_0129345 3300048906 Bacteria 1612
1590 Ga0496103_0591173 3300048906 Unclassified 707
1591 Ga0496103_0674244 3300048906 Unclassified 656
1592 Ga0496104_0001728 3300048907 Bacteria 18862
1593 Ga0496104_0005984 3300048907 Bacteria 10656
1594 Ga0496104_0013896 3300048907 Bacteria 7263
1595 Ga0496104_0096280 3300048907 Bacteria 2831
1596 Ga0496104_0213677 3300048907 Bacteria 1840
1597 Ga0496104_0394181 3300048907 Bacteria 1297
1598 Ga0496104_0537481 3300048907 Bacteria 1080
1599 Ga0496105_0005569 3300048908 Bacteria 9562
1600 Ga0496105_0009713 3300048908 Bacteria 7536
1601 Ga0496105_0024538 3300048908 Bacteria 4899
1602 Ga0496105_0047663 3300048908 Bacteria 3536
1603 Ga0496105_0497826 3300048908 Bacteria 957
1604 Ga0496106_0016858 3300048909 Bacteria 5406
1605 Ga0496106_0019946 3300048909 Bacteria 4972
1606 Ga0496106_0137287 3300048909 Bacteria 1921
1607 Ga0496106_0203804 3300048909 Bacteria 1575
1608 Ga0496107_0107452 3300048910 Bacteria 2049
1609 Ga0496107_0430193 3300048910 Bacteria 981
1610 Ga0496108_0003239 3300048911 Bacteria 13091
1611 Ga0496108_0027260 3300048911 Bacteria 4716
1612 Ga0496108_0031025 3300048911 Bacteria 4431
1613 Ga0496108_0046864 3300048911 Bacteria 3612
1614 Ga0496108_0054206 3300048911 Bacteria 3365
1615 Ga0496108_0069275 3300048911 Bacteria 2976
1616 Ga0496108_0121284 3300048911 Bacteria 2242
1617 Ga0496108_1197694 3300048911 Unclassified 642
1618 Ga0496109_0035177 3300048912 Bacteria 4516
1619 Ga0496109_0042748 3300048912 Bacteria 4106
1620 Ga0496109_0065907 3300048912 Bacteria 3315
1621 Ga0496109_0097059 3300048912 Bacteria 2731
1622 Ga0496109_0132392 3300048912 Bacteria 2328
1623 Ga0496109_0156639 3300048912 Bacteria 2134
1624 Ga0496109_0181416 3300048912 Bacteria 1977
1625 Ga0496109_0203472 3300048912 Bacteria 1862
1626 Ga0496109_0811560 3300048912 Bacteria 873
1627 Ga0496109_1118975 3300048912 Bacteria 724
1628 Ga0496109_1163527 3300048912 Bacteria 708
1629 Ga0496110_0009668 3300048913 Bacteria 7809
1630 Ga0496110_0018783 3300048913 Bacteria 5803
1631 Ga0496110_0036569 3300048913 Bacteria 4264
1632 Ga0496110_0385973 3300048913 Bacteria 1276
1633 Ga0496110_0425521 3300048913 Bacteria 1210
1634 Ga0496110_1087753 3300048913 Unclassified 707
1635 Ga0496110_1686624 3300048913 Unclassified 544
1636 Ga0496110_1887134 3300048913 Bacteria 507
1637 Ga0496111_0016631 3300048914 Bacteria 5072
1638 Ga0496111_0017434 3300048914 Bacteria 4965
1639 Ga0496111_0036631 3300048914 Bacteria 3508
1640 Ga0496111_0334317 3300048914 Unclassified 1121
1641 Ga0496111_0712600 3300048914 Bacteria 729
1642 Ga0496112_0041837 3300048915 Bacteria 4483
1643 Ga0496112_0059748 3300048915 Bacteria 3756
1644 Ga0496112_0105794 3300048915 Bacteria 2783
1645 Ga0496112_0129818 3300048915 Bacteria 2491
1646 Ga0496112_0202951 3300048915 Bacteria 1941
1647 Ga0496112_0230762 3300048915 Bacteria 1805
1648 Ga0496112_0247940 3300048915 Bacteria 1733
1649 Ga0496112_0464343 3300048915 Bacteria 1203
1650 Ga0496113_0011035 3300048916 Bacteria 6005
1651 Ga0496113_0215690 3300048916 Bacteria 1528
1652 Ga0496113_0408343 3300048916 Unclassified 1090
1653 Ga0496113_0537845 3300048916 Unclassified 937
1654 Ga0496114_0023617 3300048917 Bacteria 5018
1655 Ga0496114_0123980 3300048917 Bacteria 2225
1656 Ga0496114_0164480 3300048917 Bacteria 1931
1657 Ga0496114_0169086 3300048917 Bacteria 1904
1658 Ga0496114_0277953 3300048917 Bacteria 1476
1659 Ga0496114_1635398 3300048917 Unclassified 532
1660 Ga0496115_0011631 3300048918 Bacteria 6602
1661 Ga0496115_0099596 3300048918 Bacteria 2382
1662 Ga0496115_0260350 3300048918 Bacteria 1426
1663 Ga0496126_0020236 3300048929 Bacteria 6531
1664 Ga0496126_0052999 3300048929 Bacteria 3683
1665 nmdc:mga00v17_361463_c1 3300050491 Unclassified 944
1666 nmdc:mga00v17_994478_c1 3300050491 Bacteria 528
1667 nmdc:mga0yw44_12527_c1 3300050492 Bacteria 4426
1668 nmdc:mga0yw44_6553_c1 3300050492 Bacteria 5637
1669 nmdc:mga05p37_1049985_c1 3300050507 Bacteria 859
1670 nmdc:mga05p37_139868_c1 3300050507 Bacteria 2966
1671 nmdc:mga05p37_264060_c1 3300050507 Bacteria 2059
1672 nmdc:mga05p37_269737_c1 3300050507 Bacteria 2034
1673 nmdc:mga05p37_78117_c1 3300050507 Bacteria 4075
1674 nmdc:mga05p37_98037_c1 3300050507 Bacteria 3611
1675 nmdc:mga09592_487827_c1 3300050508 Bacteria 1061
1676 nmdc:mga0qj67_286715_c1 3300050509 Bacteria 1334
1677 nmdc:mga0qj67_597220_c1 3300050509 Bacteria 883
1678 nmdc:mga06r32_1586_c1 3300050510 Bacteria 20490
1679 nmdc:mga06r32_485283_c1 3300050510 Bacteria 1213
1680 nmdc:mga08y16_146281_c1 3300050511 Bacteria 2457
1681 nmdc:mga08y16_182705_c1 3300050511 Bacteria 2177
1682 nmdc:mga08y16_27538_c1 3300050511 Bacteria 5988
1683 nmdc:mga08y16_30083_c1 3300050511 Bacteria 5717
1684 nmdc:mga0n895_1147983_c1 3300050512 Bacteria 753
1685 nmdc:mga0n895_1722097_c1 3300050512 Unclassified 589
1686 nmdc:mga0n895_205608_c1 3300050512 Bacteria 1999
1687 nmdc:mga0n895_28072_c1 3300050512 Bacteria 5351
1688 nmdc:mga0n895_4006_c1 3300050512 Bacteria 11980
1689 nmdc:mga0n895_47170_c1 3300050512 Bacteria 4212
1690 nmdc:mga0n895_474028_c1 3300050512 Bacteria 1263
1691 nmdc:mga0n895_475446_c1 3300050512 Unclassified 1261
1692 nmdc:mga0n895_633187_c1 3300050512 Bacteria 1069
1693 nmdc:mga0rr50_114849_c1 3300050513 Bacteria 2136
1694 nmdc:mga0rr50_13459_c1 3300050513 Bacteria 5327
1695 nmdc:mga0rr50_225611_c1 3300050513 Unclassified 1549
1696 nmdc:mga0rr50_226123_c1 3300050513 Bacteria 1547
1697 nmdc:mga0rr50_289822_c1 3300050513 Bacteria 1367
1698 nmdc:mga0rr50_50055_c1 3300050513 Bacteria 3095
1699 nmdc:mga0rr50_510610_c1 3300050513 Unclassified 1022
1700 nmdc:mga0rr50_5547_c1 3300050513 Bacteria 7543
1701 nmdc:mga0rr50_915273_c1 3300050513 Bacteria 748
1702 nmdc:mga08x19_111689_c1 3300050514 Bacteria 1824
1703 nmdc:mga08x19_219966_c1 3300050514 Bacteria 1305
1704 nmdc:mga08x19_481230_c1 3300050514 Bacteria 875
1705 nmdc:mga08x19_491163_c1 3300050514 Unclassified 866
1706 nmdc:mga08x19_51308_c1 3300050514 Bacteria 2650
1707 nmdc:mga0a205_1568058_c1 3300050515 Bacteria 507
1708 nmdc:mga0a205_20148_c1 3300050515 Bacteria 6292
1709 nmdc:mga0a205_43005_c1 3300050515 Bacteria 4355
1710 nmdc:mga0a205_45094_c1 3300050515 Bacteria 4251
1711 nmdc:mga0a205_497045_c1 3300050515 Unclassified 1077
1712 nmdc:mga0a205_57492_c1 3300050515 Bacteria 3756
1713 Ga0495601_0007905 3300053077 Bacteria 6263
1714 Ga0495601_0019038 3300053077 Bacteria 4183
1715 Ga0495601_0040024 3300053077 Bacteria 2935
1716 Ga0495601_0053164 3300053077 Unclassified 2559
1717 Ga0495601_0088130 3300053077 Bacteria 1996
1718 Ga0495601_0093801 3300053077 Bacteria 1934
1719 Ga0495601_0158429 3300053077 Bacteria 1479
1720 Ga0495601_0159689 3300053077 Unclassified 1473
1721 Ga0495601_0230971 3300053077 Bacteria 1208
1722 Ga0495601_0320700 3300053077 Bacteria 1009
1723 Ga0495601_0325432 3300053077 Bacteria 1001
1724 Ga0495601_0431746 3300053077 Bacteria 853
1725 Ga0495612_0006041 3300053078 Bacteria 4988
1726 Ga0495612_0024731 3300053078 Bacteria 2411
1727 Ga0495612_0032374 3300053078 Bacteria 2112
1728 Ga0495595_0000204 3300053084 Bacteria 24016
1729 Ga0495595_0017370 3300053084 Bacteria 3095
1730 Ga0495595_0021912 3300053084 Bacteria 2798
1731 Ga0495595_0053472 3300053084 Bacteria 1876
1732 Ga0495595_0061234 3300053084 Unclassified 1762
1733 Ga0495595_0062215 3300053084 Bacteria 1749
1734 Ga0495595_0086385 3300053084 Bacteria 1501
1735 Ga0495595_0566120 3300053084 Unclassified 580
1736 Ga0495619_0012940 3300053085 Bacteria 5255
1737 Ga0495619_0018409 3300053085 Bacteria 4432
1738 Ga0495619_0073122 3300053085 Bacteria 2297
1739 Ga0495619_0154585 3300053085 Bacteria 1583
1740 Ga0495619_0180006 3300053085 Bacteria 1462
1741 Ga0495619_0186568 3300053085 Bacteria 1435
1742 Ga0495619_0192053 3300053085 Bacteria 1413
1743 Ga0495619_0320892 3300053085 Unclassified 1072
1744 Ga0495619_0501854 3300053085 Unclassified 834
1745 Ga0495619_0846376 3300053085 Unclassified 617
1746 Ga0500554_027937 3300053102 Bacteria 1636
1747 Ga0587084_027844 3300059477 Bacteria 891
1748 Ga0587084_091673 3300059477 Unclassified 604
1749 Ga0587066_091206 3300059490 Bacteria 677
1750 Ga0587070_131178 3300059491 Bacteria 610
1751 Ga0587070_216049 3300059491 Bacteria 517
1752 Ga0587073_0032714 3300059492 Bacteria 1085
1753 Ga0587073_0085465 3300059492 Bacteria 792
1754 Ga0587077_147919 3300059493 Unclassified 611
1755 Ga0587083_0072319 3300059505 Unclassified 803
1756 Ga0587092_066169 3300059512 Bacteria 687
1757 Ga0587062_073076 3300059639 Bacteria 624
1758 Ga0587067_109788 3300059640 Bacteria 649
1759 Ga0587072_014866 3300059643 Bacteria 1316
1760 Ga0587076_133003 3300059645 Bacteria 588
1761 Ga0587078_050557 3300059646 Unclassified 608
1762 Ga0587079_023847 3300059647 Bacteria 1123
1763 Ga0587071_123395 3300060344 Bacteria 621
1764 Ga0587111_0014553 3300060346 Bacteria 1424
1765 Ga0163163_10318727
1766 JGI24737J22298_10048834
1767 JGI24751J29686_10003466
1768 JGI25404J52841_10015743
1769 JGI25404J52841_10122746
1770 Ga0058859_11761553
1771 Ga0058863_10863976
1772 Ga0058863_11945211
1773 Ga0058861_11806364
1774 Ga0058861_12027980
1775 Ga0058862_12725586
1776 Ga0058862_12799539
1777 Ga0070658_10013242
1778 Ga0070658_10022197
1779 Ga0070683_100331248
1780 Ga0070683_101935747
1781 Ga0070670_100047936
1782 Ga0070677_10744136
1783 Ga0068869_100005709
1784 Ga0068869_100108144
1785 Ga0068869_100393202
1786 Ga0068869_101035705
1787 Ga0070666_10113467
1788 Ga0070666_10407319
1789 Ga0070680_100011453
1790 Ga0070680_101415576
1791 Ga0070682_100005887
1792 Ga0070682_100115052
1793 Ga0070682_100279391
1794 Ga0070682_100377655
1795 Ga0070682_100532683
1796 Ga0070682_101158633
1797 Ga0070682_101631775
1798 Ga0068868_100007699
1799 Ga0068868_100022775
1800 Ga0068868_100137865
1801 Ga0068868_100979543
1802 Ga0068868_101077252
1803 Ga0070660_100040979
1804 Ga0070660_100183639
1805 Ga0070660_100255252
1806 Ga0070689_100328654
1807 Ga0070689_100366066
1808 Ga0070689_100385187
1809 Ga0070691_10127749
1810 Ga0070691_10227311
1811 Ga0070691_10236913
1812 Ga0070687_100049477
1813 Ga0070687_100422565
1814 Ga0070687_100437324
1815 Ga0070661_100012300
1816 Ga0070692_10002327
1817 Ga0070692_10017091
1818 Ga0070692_10236109
1819 Ga0070692_10426667
1820 Ga0070668_100142063
1821 Ga0070668_101359363
1822 Ga0070669_100179537
1823 Ga0070675_100005056
1824 Ga0070675_100013842
1825 Ga0070675_100883745
1826 Ga0070671_100011302
1827 Ga0070671_100159317
1828 Ga0070671_100634399
1829 Ga0070674_100160540
1830 Ga0070674_102065845
1831 Ga0070673_100055617
1832 Ga0070673_100166133
1833 Ga0070673_100837679
1834 Ga0070688_100270345
1835 Ga0070659_100008993
1836 Ga0070659_100032143
1837 Ga0070659_100598180
1838 Ga0070703_10009847
1839 Ga0070703_10178025
1840 Ga0070703_10417537
1841 Ga0070709_10010150
1842 Ga0070709_10024217
1843 Ga0070709_10033342
1844 Ga0070709_10130683
1845 Ga0070709_10178205
1846 Ga0070709_10303590
1847 Ga0070709_10521302
1848 Ga0070709_10531241
1849 Ga0070709_10561563
1850 Ga0070714_100001782
1851 Ga0070714_100005462
1852 Ga0070714_100014506
1853 Ga0070714_100016824
1854 Ga0070714_100043249
1855 Ga0070714_100048641
1856 Ga0070714_100063241
1857 Ga0070714_100081303
1858 Ga0070714_100107667
1859 Ga0070714_100145393
1860 Ga0070714_100341632
1861 Ga0070714_100422658
1862 Ga0070714_100844833
1863 Ga0070714_100862154
1864 Ga0070714_101049828
1865 Ga0070713_100002466
1866 Ga0070713_100010817
1867 Ga0070713_100010914
1868 Ga0070713_100013244
1869 Ga0070713_100016564
1870 Ga0070713_100020352
1871 Ga0070713_100046937
1872 Ga0070713_100074544
1873 Ga0070713_100098438
1874 Ga0070713_100127147
1875 Ga0070713_100153422
1876 Ga0070713_100303044
1877 Ga0070713_100353648
1878 Ga0070713_100383151
1879 Ga0070713_100884862
1880 Ga0070713_100928769
1881 Ga0070713_101557069
1882 Ga0070710_10002186
1883 Ga0070710_10003232
1884 Ga0070710_10026286
1885 Ga0070710_10069495
1886 Ga0070710_10128625
1887 Ga0070710_10135280
1888 Ga0070710_10146747
1889 Ga0070710_10232187
1890 Ga0070710_10266914
1891 Ga0070710_10272911
1892 Ga0070710_10294791
1893 Ga0070710_11386341
1894 Ga0070711_100009327
1895 Ga0070711_100010966
1896 Ga0070711_100017065
1897 Ga0070711_100019269
1898 Ga0070711_100057333
1899 Ga0070711_100117781
1900 Ga0070711_100140960
1901 Ga0070711_100229625
1902 Ga0070711_100256564
1903 Ga0070711_100350328
1904 Ga0070711_100619474
1905 Ga0070711_100728634
1906 Ga0070711_100846385
1907 Ga0070711_101576170
1908 Ga0070711_101828452
1909 Ga0070705_100042306
1910 Ga0070705_100053930
1911 Ga0070705_100182225
1912 Ga0070705_100660111
1913 Ga0070705_101217671
1914 Ga0070700_100013534
1915 Ga0070700_100063331
1916 Ga0070700_100081369
1917 Ga0070700_100343350
1918 Ga0070694_100029171
1919 Ga0070694_100117259
1920 Ga0070708_100161848
1921 Ga0070708_100229508
1922 Ga0070708_100259477
1923 Ga0070708_100468533
1924 Ga0070708_100745116
1925 Ga0070708_100799236
1926 Ga0070708_101157604
1927 Ga0070663_100011604
1928 Ga0070663_100014065
1929 Ga0070663_100457016
1930 Ga0070678_100002952
1931 Ga0070678_100490789
1932 Ga0070678_100958821
1933 Ga0070662_100005844
1934 Ga0070662_100358135
1935 Ga0070662_100842272
1936 Ga0070681_10025226
1937 Ga0070681_10403536
1938 Ga0070681_10537408
1939 Ga0070681_11066418
1940 Ga0070681_11490316
1941 Ga0070681_11555670
1942 Ga0070685_10065843
1943 Ga0070685_10066797
1944 Ga0070685_10757204
1945 Ga0070685_10795467
1946 Ga0070706_100007069
1947 Ga0070706_100051626
1948 Ga0070706_100220625
1949 Ga0070706_100304365
1950 Ga0070706_100387094
1951 Ga0070706_100431792
1952 Ga0070706_100470249
1953 Ga0070706_100663340
1954 Ga0070706_101210475
1955 Ga0070707_100248267
1956 Ga0070707_100537758
1957 Ga0070707_100554360
1958 Ga0070707_100670160
1959 Ga0070707_100962570
1960 Ga0070707_101497343
1961 Ga0070698_100006532
1962 Ga0070698_100012141
1963 Ga0070698_100035173
1964 Ga0070698_100086786
1965 Ga0070698_100171037
1966 Ga0070698_100330758
1967 Ga0070698_100743364
1968 Ga0070698_100978814
1969 Ga0070699_100014964
1970 Ga0070699_100081537
1971 Ga0070699_101376775
1972 Ga0070699_101506262
1973 Ga0070679_100009959
1974 Ga0070679_100366858
1975 Ga0070679_101678028
1976 Ga0070684_100023630
1977 Ga0070684_100108307
1978 Ga0070684_100227648
1979 Ga0070684_100436552
1980 Ga0070684_100634201
1981 Ga0070697_100051291
1982 Ga0070697_100153053
1983 Ga0070697_100200586
1984 Ga0070697_100233017
1985 Ga0070697_101027074
1986 Ga0068853_100071107
1987 Ga0070672_100152249
1988 Ga0070672_100286650
1989 Ga0070686_100120300
1990 Ga0070686_100794195
1991 Ga0070695_100094119
1992 Ga0070695_100128025
1993 Ga0070696_100010729
1994 Ga0070696_100265708
1995 Ga0070696_100426790
1996 Ga0070696_101923313
1997 Ga0070693_100009979
1998 Ga0070693_100056614
1999 Ga0070693_100190523
2000 Ga0070693_101265155
2001 Ga0070693_101334762
2002 Ga0070665_100044963
2003 Ga0070665_100390981
2004 Ga0070665_101705720
2005 Ga0070665_102468634
2006 Ga0070704_100937873
2007 Ga0068855_100041202
2008 Ga0068855_100215844
2009 Ga0070664_100004428
2010 Ga0070664_100150382
2011 Ga0070664_100474787
2012 Ga0070664_101055129
2013 Ga0068857_100079839
2014 Ga0068857_100112081
2015 Ga0068857_100678969
2016 Ga0068857_101696385
2017 Ga0068854_100075280
2018 Ga0068854_100228365
2019 Ga0068854_100247688
2020 Ga0068856_100012369
2021 Ga0068856_100023480
2022 Ga0068856_100029778
2023 Ga0068856_100047243
2024 Ga0068856_100078319
2025 Ga0068856_100101668
2026 Ga0068856_100119354
2027 Ga0068856_100777229
2028 Ga0068856_101316920
2029 Ga0068856_101394552
2030 Ga0070702_100005256
2031 Ga0070702_100053012
2032 Ga0070702_100109299
2033 Ga0070702_100725855
2034 Ga0068852_100074918
2035 Ga0068852_100082574
2036 Ga0068852_100150961
2037 Ga0068852_100160595
2038 Ga0068852_100239202
2039 Ga0068859_100094507
2040 Ga0068859_100556351
2041 Ga0068859_101284859
2042 Ga0068864_100252602
2043 Ga0068864_100527028
2044 Ga0068864_100758132
2045 Ga0068866_10045697
2046 Ga0068866_10414156
2047 Ga0068861_100050540
2048 Ga0068861_100068075
2049 Ga0068861_100268666
2050 Ga0068861_100366174
2051 Ga0068851_10130227
2052 Ga0068851_10807208
2053 Ga0068870_10024554
2054 Ga0068870_10428750
2055 Ga0068863_100015437
2056 Ga0068863_100147909
2057 Ga0068863_100326583
2058 Ga0068863_101580532
2059 Ga0068863_101993372
2060 Ga0068858_100030337
2061 Ga0068858_100122867
2062 Ga0068858_100212549
2063 Ga0068858_100582309
2064 Ga0068858_100822571
2065 Ga0068858_101039385
2066 Ga0068860_100107786
2067 Ga0068860_100173307
2068 Ga0068860_100177043
2069 Ga0068860_100361236
2070 Ga0068860_100384438
2071 Ga0068860_101098703
2072 Ga0068860_101391162
2073 Ga0068862_100016710
2074 Ga0068862_100338935
2075 Ga0068862_101302387
2076 Ga0068862_101645609
2077 Ga0081455_10069071
2078 Ga0081455_10106215
2079 Ga0081540_1000104
2080 Ga0081540_1000407
2081 Ga0081540_1012627
2082 Ga0070717_10003754
2083 Ga0070717_10017574
2084 Ga0070717_10017727
2085 Ga0070717_10034347
2086 Ga0070717_10044436
2087 Ga0070717_10046989
2088 Ga0070717_10071397
2089 Ga0070717_10098167
2090 Ga0070717_10261008
2091 Ga0070717_10354422
2092 Ga0070717_10405952
2093 Ga0070717_10409148
2094 Ga0070717_10496758
2095 Ga0070717_10797414
2096 Ga0070717_11350236
2097 Ga0075365_10009485
2098 Ga0075365_10018158
2099 Ga0075365_10330506
2100 Ga0075364_10202935
2101 Ga0075364_10479967
2102 Ga0075432_10044836
2103 Ga0070715_10006081
2104 Ga0070715_10023396
2105 Ga0070715_10041772
2106 Ga0070715_10053107
2107 Ga0070715_10473368
2108 Ga0070716_100007446
2109 Ga0070716_100016324
2110 Ga0070716_100018119
2111 Ga0070716_100040797
2112 Ga0070716_100062447
2113 Ga0070716_100109143
2114 Ga0070716_100115814
2115 Ga0070716_100187595
2116 Ga0070716_100309992
2117 Ga0070716_100460198
2118 Ga0070716_100782992
2119 Ga0070716_101002155
2120 Ga0070716_101050077
2121 Ga0070716_101163781
2122 Ga0070712_100017733
2123 Ga0070712_100022086
2124 Ga0070712_100023859
2125 Ga0070712_100026399
2126 Ga0070712_100037188
2127 Ga0070712_100041079
2128 Ga0070712_100043229
2129 Ga0070712_100049911
2130 Ga0070712_100062953
2131 Ga0070712_100108982
2132 Ga0070712_100114035
2133 Ga0070712_100136347
2134 Ga0070712_100175645
2135 Ga0070712_100241222
2136 Ga0070712_100278841
2137 Ga0070712_100488612
2138 Ga0070712_101245468
2139 Ga0070712_101650423
2140 Ga0097621_100007234
2141 Ga0097621_100089473
2142 Ga0097621_100168724
2143 Ga0097621_101184688
2144 Ga0068871_100026210
2145 Ga0068871_100076034
2146 Ga0068871_100738797
2147 Ga0068871_101080999
2148 Ga0068871_101204619
2149 Ga0068871_101914574
2150 Ga0075428_100178551
2151 Ga0075428_100278491
2152 Ga0075428_101385565
2153 Ga0075430_100232570
2154 Ga0075430_100413637
2155 Ga0075431_100006776
2156 Ga0075433_10018103
2157 Ga0075433_10019630
2158 Ga0075433_10027468
2159 Ga0075433_10104447
2160 Ga0075433_10154025
2161 Ga0075433_10716918
2162 Ga0075434_100004695
2163 Ga0075434_100007730
2164 Ga0075434_100071965
2165 Ga0075434_100112471
2166 Ga0075434_101305058
2167 Ga0075429_100361982
2168 Ga0068865_100033373
2169 Ga0068865_100037607
2170 Ga0068865_100133593
2171 Ga0068865_100628633
2172 Ga0075436_100004471
2173 Ga0075436_100008644
2174 Ga0075436_100208571
2175 Ga0075436_100363350
2176 Ga0075436_101151888
2177 Ga0097620_100094509
2178 Ga0097620_100556342
2179 Ga0097620_101284819
2180 Ga0075435_100004634
2181 Ga0075435_100016766
2182 Ga0075435_100023872
2183 Ga0075435_100046118
2184 Ga0075435_100070273
2185 Ga0075435_100073543
2186 Ga0075435_100401754
2187 Ga0075435_100456828
2188 Ga0075435_100791147
2189 Ga0099795_10163173
2190 Ga0105240_10144999
2191 Ga0105240_10373511
2192 Ga0111539_10012913
2193 Ga0111539_10018741
2194 Ga0111539_10180844
2195 Ga0111539_10194349
2196 Ga0105245_10011721
2197 Ga0105245_10017175
2198 Ga0105245_10019479
2199 Ga0105245_10043032
2200 Ga0105245_10626082
2201 Ga0105245_10776567
2202 Ga0105245_11445754
2203 Ga0105247_10009226
2204 Ga0105247_10055335
2205 Ga0105247_10060652
2206 Ga0105247_10092348
2207 Ga0105247_10110257
2208 Ga0105247_10746219
2209 Ga0105247_11164788
2210 Ga0105247_11832378
2211 Ga0114129_10319057
2212 Ga0114129_10320804
2213 Ga0114129_10425534
2214 Ga0114129_10481836
2215 Ga0114129_10797926
2216 Ga0114129_11848543
2217 Ga0105243_10186551
2218 Ga0105243_10235737
2219 Ga0105241_10003397
2220 Ga0105241_10154797
2221 Ga0105241_10259734
2222 Ga0105241_10379678
2223 Ga0105241_10696150
2224 Ga0105241_11108327
2225 Ga0105241_12413606
2226 Ga0105242_10181606
2227 Ga0105242_10301929
2228 Ga0105242_10520947
2229 Ga0105242_11060357
2230 Ga0105248_10044768
2231 Ga0105248_10249885
2232 Ga0105248_10440794
2233 Ga0105248_11798426
2234 Ga0105237_10396873
2235 Ga0105237_10953618
2236 Ga0105237_12665792
2237 Ga0105238_10081070
2238 Ga0105238_10683832
2239 Ga0105238_10870749
2240 Ga0105249_10202075
2241 Ga0105249_10299234
2242 Ga0105249_11092202
2243 Ga0105249_11765475
2244 Ga0105249_12855915
2245 Ga0099796_10003244
2246 Ga0105239_10086880
2247 Ga0105239_10203853
2248 Ga0105239_10239976
2249 Ga0105239_10657603
2250 Ga0105246_10004636
2251 Ga0105246_10246838
2252 Ga0105246_10334068
2253 Ga0105246_11397550
2254 Ga0157340_1019153
2255 Ga0157346_1008823
2256 Ga0157343_1012339
2257 Ga0154012_109650
2258 Ga0157373_10058229
2259 Ga0157373_10073191
2260 Ga0157371_10066452
2261 Ga0157371_10212903
2262 Ga0157371_10517304
2263 Ga0157371_10612433
2264 Ga0157370_10020387
2265 Ga0157370_10107173
2266 Ga0157370_11203259
2267 Ga0157369_10053400
2268 Ga0157369_10802442
2269 Ga0157369_11057129
2270 Ga0157369_11069493
2271 Ga0157369_11265449
2272 Ga0157374_10003370
2273 Ga0157374_10566076
2274 Ga0163162_10125876
2275 Ga0163162_10216040
2276 Ga0163162_10552114
2277 Ga0163162_11830778
2278 Ga0157372_10031567
2279 Ga0157372_10184675
2280 Ga0157372_10338065
2281 Ga0157372_10419262
2282 Ga0157372_10626520
2283 Ga0157372_10628438
2284 Ga0157372_11067061
2285 Ga0157372_11310973
2286 Ga0157372_11411541
2287 Ga0157372_11783205
2288 Ga0157375_10234748
2289 Ga0157375_10387373
2290 Ga0157375_11074882
2291 Ga0157375_11117211
2292 Ga0157375_12580062
2293 Ga0163163_10116651
2294 Ga0163163_10151441
2295 Ga0163163_10233622
2296 Ga0163163_10469917
2297 Ga0163163_10944767
2298 Ga0163163_11451896
2299 Ga0157380_10269619
2300 Ga0157380_10624806
2301 Ga0182008_10370965
2302 Ga0157377_10002762
2303 Ga0157377_10046848
2304 Ga0157377_10173808
2305 Ga0157379_10012062
2306 Ga0157379_10187511
2307 Ga0157379_10251809
2308 Ga0157379_10483919
2309 Ga0157376_10251799
2310 Ga0157376_10443643
2311 Ga0157376_10531030
2312 Ga0157376_10731319
2313 Ga0157376_11238749
2314 Ga0157376_12054895
2315 Ga0163161_10613258
2316 Ga0197907_10046920
2317 Ga0197907_10460177
2318 Ga0197907_10775795
2319 Ga0206356_10036912
2320 Ga0206349_1901982
2321 Ga0206351_10347265
2322 Ga0206350_10854846
2323 Ga0206350_11587344
2324 Ga0206354_10697934
2325 Ga0206354_10734318
2326 Ga0206353_10041774
2327 Ga0154015_1109481
2328 Ga0213876_10695116
2329 Ga0224712_10071118
2330 Ga0224712_10150220
2331 Ga0224712_10206935
2332 Ga0224569_110831
2333 Ga0228598_1071943
2334 Ga0228598_1078221
2335 Ga0207656_10144846
2336 Ga0207656_10163946
2337 Ga0207653_10001186
2338 Ga0207653_10064887
2339 Ga0207653_10096166
2340 Ga0207653_10226501
2341 Ga0207692_10000949
2342 Ga0207692_10001835
2343 Ga0207692_10012234
2344 Ga0207692_10056246
2345 Ga0207692_10073885
2346 Ga0207692_10083361
2347 Ga0207692_10149007
2348 Ga0207692_10234060
2349 Ga0207692_10258215
2350 Ga0207692_10309035
2351 Ga0207692_10338420
2352 Ga0207642_10179843
2353 Ga0207642_10648519
2354 Ga0207642_10731704
2355 Ga0207710_10188835
2356 Ga0207710_10388059
2357 Ga0207710_10487294
2358 Ga0207688_10010890
2359 Ga0207688_10011318
2360 Ga0207688_10063565
2361 Ga0207688_10076341
2362 Ga0207647_10092435
2363 Ga0207685_10035667
2364 Ga0207685_10048434
2365 Ga0207685_10093219
2366 Ga0207685_10405012
2367 Ga0207699_10000382
2368 Ga0207699_10001986
2369 Ga0207699_10002721
2370 Ga0207699_10009488
2371 Ga0207699_10010279
2372 Ga0207699_10021331
2373 Ga0207699_10033749
2374 Ga0207699_10037506
2375 Ga0207699_10060539
2376 Ga0207699_10186713
2377 Ga0207699_10346396
2378 Ga0207699_10400705
2379 Ga0207699_10475487
2380 Ga0207699_10645687
2381 Ga0207643_10001477
2382 Ga0207705_10016324
2383 Ga0207705_10291033
2384 Ga0207684_10001155
2385 Ga0207684_10250746
2386 Ga0207684_10346268
2387 Ga0207684_10414758
2388 Ga0207684_10485570
2389 Ga0207654_10003244
2390 Ga0207654_10116632
2391 Ga0207654_10207874
2392 Ga0207654_10548960
2393 Ga0207654_10700433
2394 Ga0207707_10008747
2395 Ga0207707_10659819
2396 Ga0207707_11109670
2397 Ga0207671_10214451
2398 Ga0207693_10003685
2399 Ga0207693_10003865
2400 Ga0207693_10004300
2401 Ga0207693_10006202
2402 Ga0207693_10009637
2403 Ga0207693_10012756
2404 Ga0207693_10039072
2405 Ga0207693_10070244
2406 Ga0207693_10081592
2407 Ga0207693_10082011
2408 Ga0207693_10121785
2409 Ga0207693_10124351
2410 Ga0207693_10189014
2411 Ga0207693_10207654
2412 Ga0207693_10239957
2413 Ga0207693_10804861
2414 Ga0207693_10923304
2415 Ga0207693_11460966
2416 Ga0207663_10007794
2417 Ga0207663_10012086
2418 Ga0207663_10019857
2419 Ga0207663_10022173
2420 Ga0207663_10022747
2421 Ga0207663_10110204
2422 Ga0207663_10232298
2423 Ga0207663_10250060
2424 Ga0207663_10268621
2425 Ga0207663_10396446
2426 Ga0207663_10751023
2427 Ga0207660_10172425
2428 Ga0207660_10457936
2429 Ga0207660_11131482
2430 Ga0207662_10005270
2431 Ga0207657_10032467
2432 Ga0207657_10091678
2433 Ga0207657_10175833
2434 Ga0207657_10971833
2435 Ga0207652_10255614
2436 Ga0207652_10376589
2437 Ga0207652_10421464
2438 Ga0207652_10427032
2439 Ga0207646_10089570
2440 Ga0207646_10108213
2441 Ga0207646_10231966
2442 Ga0207646_10298782
2443 Ga0207646_10316335
2444 Ga0207646_10453755
2445 Ga0207646_11565446
2446 Ga0207681_10120837
2447 Ga0207694_10010228
2448 Ga0207694_10140574
2449 Ga0207650_10017816
2450 Ga0207659_10005481
2451 Ga0207659_10017248
2452 Ga0207659_10082174
2453 Ga0207659_10785257
2454 Ga0207687_10013941
2455 Ga0207687_10016714
2456 Ga0207687_10375366
2457 Ga0207687_10529573
2458 Ga0207700_10000156
2459 Ga0207700_10002756
2460 Ga0207700_10003388
2461 Ga0207700_10009717
2462 Ga0207700_10010541
2463 Ga0207700_10011236
2464 Ga0207700_10038665
2465 Ga0207700_10053061
2466 Ga0207700_10069650
2467 Ga0207700_10085433
2468 Ga0207700_10145950
2469 Ga0207700_10281330
2470 Ga0207700_10303814
2471 Ga0207700_10339012
2472 Ga0207700_10476688
2473 Ga0207700_10572086
2474 Ga0207700_10913690
2475 Ga0207664_10001396
2476 Ga0207664_10002012
2477 Ga0207664_10005805
2478 Ga0207664_10014718
2479 Ga0207664_10027872
2480 Ga0207664_10039052
2481 Ga0207664_10043034
2482 Ga0207664_10047685
2483 Ga0207664_10056491
2484 Ga0207664_10096719
2485 Ga0207664_10161145
2486 Ga0207664_10166919
2487 Ga0207664_10294306
2488 Ga0207664_10305615
2489 Ga0207664_10335389
2490 Ga0207664_10341840
2491 Ga0207664_10354322
2492 Ga0207664_10354995
2493 Ga0207664_10418463
2494 Ga0207664_10471755
2495 Ga0207664_10489533
2496 Ga0207664_10500341
2497 Ga0207664_10610991
2498 Ga0207644_10054045
2499 Ga0207644_10062316
2500 Ga0207644_11104131
2501 Ga0207690_10262663
2502 Ga0207690_10455275
2503 Ga0207690_10924431
2504 Ga0207706_10041381
2505 Ga0207706_10098551
2506 Ga0207706_10100307
2507 Ga0207706_10307429
2508 Ga0207686_10075435
2509 Ga0207686_10135207
2510 Ga0207686_10237623
2511 Ga0207686_10754462
2512 Ga0207709_10161436
2513 Ga0207709_10623243
2514 Ga0207670_10305975
2515 Ga0207670_10674004
2516 Ga0207669_10335256
2517 Ga0207704_10041969
2518 Ga0207704_10076906
2519 Ga0207665_10000827
2520 Ga0207665_10013492
2521 Ga0207665_10016808
2522 Ga0207665_10018832
2523 Ga0207665_10025313
2524 Ga0207665_10057490
2525 Ga0207665_10100639
2526 Ga0207665_10599103
2527 Ga0207665_10665675
2528 Ga0207665_11139314
2529 Ga0207691_10130392
2530 Ga0207691_10269671
2531 Ga0207691_10476040
2532 Ga0207691_10563433
2533 Ga0207711_10198419
2534 Ga0207711_10243529
2535 Ga0207689_10004314
2536 Ga0207689_10040223
2537 Ga0207689_10099849
2538 Ga0207689_10136090
2539 Ga0207689_10608264
2540 Ga0207689_11171369
2541 Ga0207661_10008039
2542 Ga0207661_10273228
2543 Ga0207661_10533555
2544 Ga0207679_10003876
2545 Ga0207679_10012038
2546 Ga0207679_10119630
2547 Ga0207679_10277278
2548 Ga0207679_10434964
2549 Ga0207679_10608002
2550 Ga0207667_10222997
2551 Ga0207667_10517086
2552 Ga0207667_10836891
2553 Ga0207667_11394251
2554 Ga0207651_10013540
2555 Ga0207651_10065036
2556 Ga0207651_10366428
2557 Ga0207712_10205255
2558 Ga0207712_10355985
2559 Ga0207712_10362079
2560 Ga0207712_10761102
2561 Ga0207712_10892872
2562 Ga0207668_10026299
2563 Ga0207640_10047791
2564 Ga0207640_10063926
2565 Ga0207640_10083607
2566 Ga0207640_10447977
2567 Ga0207677_10008292
2568 Ga0207677_10013105
2569 Ga0207677_10111282
2570 Ga0207677_10260269
2571 Ga0207677_11054440
2572 Ga0207677_11368968
2573 Ga0207677_11610072
2574 Ga0207703_10018287
2575 Ga0207703_10065521
2576 Ga0207703_10460870
2577 Ga0207703_10733653
2578 Ga0207639_10148398
2579 Ga0207639_10936882
2580 Ga0207639_11683215
2581 Ga0207678_10000571
2582 Ga0207678_10008530
2583 Ga0207678_10039266
2584 Ga0207678_10520902
2585 Ga0207708_10025598
2586 Ga0207708_10079452
2587 Ga0207708_10103125
2588 Ga0207708_10509670
2589 Ga0207702_10011510
2590 Ga0207702_10011865
2591 Ga0207702_10020025
2592 Ga0207702_10057124
2593 Ga0207702_10060038
2594 Ga0207702_10108584
2595 Ga0207702_10130621
2596 Ga0207702_10319159
2597 Ga0207641_10007274
2598 Ga0207641_10277293
2599 Ga0207641_10692648
2600 Ga0207641_10853770
2601 Ga0207641_11135330
2602 Ga0207641_11289191
2603 Ga0207648_10121425
2604 Ga0207676_10014581
2605 Ga0207676_10137180
2606 Ga0207676_10930036
2607 Ga0207676_11572071
2608 Ga0207676_11961666
2609 Ga0207674_10017738
2610 Ga0207674_10103809
2611 Ga0207674_10149401
2612 Ga0207674_11064517
2613 Ga0207675_100045236
2614 Ga0207675_100358107
2615 Ga0207675_100736754
2616 Ga0207675_101173437
2617 Ga0207683_10003351
2618 Ga0207683_10011951
2619 Ga0207683_10023507
2620 Ga0207683_10031230
2621 Ga0207683_10134204
2622 Ga0207683_11125649
2623 Ga0207698_10011480
2624 Ga0207698_10202021
2625 Ga0207698_10211044
2626 Ga0207698_10251524
2627 Ga0207698_10370663
2628 Ga0207698_10720269
2629 Ga0207698_11176151
2630 Ga0207428_10022119
2631 Ga0207428_10037031
2632 Ga0207428_10038618
2633 Ga0207428_10101678
2634 Ga0268266_10148679
2635 Ga0268266_10223698
2636 Ga0268266_10877141
2637 Ga0268266_11633618
2638 Ga0268265_10310227
2639 Ga0268265_10992821
2640 Ga0268265_12372267
2641 Ga0268264_11511417
2642 Ga0265326_10007839
2643 Ga0265319_1010112
2644 Ga0265334_10000580
2645 Ga0265318_10000194
2646 Ga0265322_10007374
2647 Ga0265338_10005413
2648 Ga0265338_10707315
2649 Ga0265760_10065404
2650 Ga0265330_10000730
2651 Ga0265332_10000843
2652 Ga0265328_10011532
2653 Ga0265320_10018276
2654 Ga0265320_10033110
2655 Ga0265325_10000203
2656 Ga0265329_10004054
2657 Ga0265340_10000614
2658 Ga0265339_10038764
2659 Ga0265331_10002005
2660 Ga0265327_10025146
2661 Ga0265316_10000977
2662 Ga0307408_102301429
2663 Ga0265313_10001583
2664 Ga0265314_10032259
2665 Ga0265342_10001105
2666 Ga0307406_10407727
2667 Ga0307409_100033772
2668 Ga0307409_100804628
2669 Ga0307411_10773345
2670 Ga0307415_100028205
2671 Ga0307415_100844022
2672 Ga0373930_0034201
2673 Ga0373930_0039097
2674 Ga0373930_0119338
2675 Ga0373948_0002617
2676 Ga0373948_0034373
2677 Ga0373958_0056031
2678 Ga0373958_0073225
2679 Ga0373959_0103596
2680 Ga0373938_0000786
2681 Ga0373938_0050188
2682 Ga0373926_0001583
2683 Ga0373926_0040371
2684 Ga0373926_0178754
2685 Ga0373928_0015051
2686 Ga0373929_0086236
2687 Ga0373934_0004946
2688 Ga0373934_0088436
2689 Ga0373934_0096311
2690 Ga0373934_0157898
2691 Ga0373940_0043795
2692 Ga0373940_0113999
2693 Ga0373944_0001507
2694 Ga0373944_0002613
2695 Ga0373944_0063558
2696 Ga0373944_0068111
2697 Ga0373944_0135814
2698 Ga0373951_0009620
2699 Ga0373952_0008357
2700 Ga0373952_0104235
2701 Ga0373923_0000360
2702 Ga0373923_0017774
2703 Ga0373923_0022734
2704 Ga0373923_0034967
2705 Ga0373923_0071364
2706 Ga0373923_0078204
2707 Ga0373923_0094825
2708 Ga0373932_0001030
2709 Ga0373932_0011323
2710 Ga0373932_0022573
2711 Ga0373932_0086528
2712 Ga0373936_0000848
2713 Ga0373936_0005713
2714 Ga0373936_0047631
2715 Ga0373936_0054534
2716 Ga0373936_0167373
2717 Ga0373939_0026006
2718 Ga0373939_0031214
2719 Ga0373939_0280245
2720 Ga0373941_0002052
2721 Ga0373941_0012468
2722 Ga0373941_0049370
2723 Ga0373945_0000180
2724 Ga0373945_0000330
2725 Ga0373945_0232190
2726 Ga0373945_0354775
2727 Ga0373953_0000061
2728 Ga0373953_0002146
2729 Ga0373953_0013441
2730 Ga0373953_0048468
2731 Ga0373953_0085932
2732 Ga0373953_0212492
2733 Ga0373954_0001600
2734 Ga0373954_0025111
2735 Ga0373954_0039472
2736 Ga0373954_0051972
2737 Ga0373954_0087546
2738 Ga0373954_0417522
2739 Ga0373956_0000860
2740 Ga0373956_0003968
2741 Ga0373956_0011717
2742 Ga0373956_0020518
2743 Ga0373956_0105013
2744 Ga0373956_0169805
2745 Ga0373956_0428437
2746 Ga0373957_0000360
2747 Ga0373957_0000832
2748 Ga0373957_0002259
2749 Ga0373957_0002760
2750 Ga0373957_0008572
2751 Ga0373957_0104108
2752 Ga0373957_0237507
2753 Ga0373960_0106917
2754 Ga0373943_0001628
2755 Ga0373943_0002968
2756 Ga0373943_0012078
2757 Ga0373943_0019860
2758 Ga0373943_0066574
2759 Ga0373943_0193271
2760 Ga0373943_0345500
2761 Ga0373946_0001056
2762 Ga0373946_0001301
2763 Ga0373946_0003253
2764 Ga0373946_0048787
2765 Ga0373946_0082131
2766 Ga0373946_0215369
2767 Ga0373946_0222662
2768 Ga0373946_0261093
2769 Ga0373955_0000018
2770 Ga0373955_0004186
2771 Ga0373955_0031583
2772 Ga0373955_0076092
2773 Ga0373955_0091183
2774 Ga0373955_0109963
2775 Ga0373955_0257882
2776 Ga0373955_0312582
2777 Ga0373955_0443969
2778 Ga0373955_0618705
2779 Ga0373955_0747636
2780 Ga0373942_0050192
2781 Ga0373961_0023559
2782 Ga0373961_0207514
2783 Ga0373962_0038690
2784 Ga0373924_0000135
2785 Ga0373924_0002433
2786 Ga0373924_0009284
2787 Ga0373924_0010395
2788 Ga0373924_0011342
2789 Ga0373924_0019412
2790 Ga0373924_0067883
2791 Ga0373924_0090116
2792 Ga0373924_0174516
2793 Ga0373924_0342837
2794 Ga0373931_0006527
2795 Ga0373931_0019910
2796 Ga0373931_0084098
2797 Ga0373931_0263352
2798 Ga0373931_0896155
2799 Ga0373931_0967021
2800 Ga0373935_0000268
2801 Ga0373935_0009010
2802 Ga0373935_0016166
2803 Ga0373935_0022407
2804 Ga0373935_0133967
2805 Ga0373935_0220173
2806 Ga0373935_0306024
2807 Ga0373935_0452116
2808 Ga0373935_0593266
2809 Ga0373935_0683809
2810 Ga0373935_0947499
2811 Ga0373935_1232597
2812 Ga0373935_1269727
2813 Ga0373927_0008506
2814 Ga0373927_0010147
2815 Ga0373927_0014979
2816 Ga0373927_0174847
2817 Ga0373927_0184794
2818 Ga0373933_0000003
2819 Ga0373933_0005672
2820 Ga0373933_0014841
2821 Ga0373933_0017241
2822 Ga0373933_0020085
2823 Ga0373933_0022806
2824 Ga0373933_0023349
2825 Ga0373933_0045946
2826 Ga0373933_0167934
2827 Ga0373933_0231717
2828 Ga0373933_0235238
2829 Ga0373933_0436035
2830 Ga0373933_0495742
2831 Ga0373933_1056539
2832 Ga0373947_0000374
2833 Ga0373947_0020201
2834 Ga0373947_0034022
2835 Ga0373947_0035392
2836 Ga0373947_0328048
2837 Ga0373947_0404216
2838 Ga0373947_0417756
2839 Ga0373947_0595298
2840 Ga0373947_0637709
2841 Ga0373937_0000016
2842 Ga0373937_0005352
2843 Ga0373937_0012476
2844 Ga0373937_0102857
2845 Ga0373937_0105413
2846 Ga0373937_0114133
2847 Ga0373937_0141769
2848 Ga0373937_0181821
2849 Ga0373937_0242772
2850 Ga0373937_0246563
2851 Ga0373937_2019151
2852 Ga0373925_0001174
2853 Ga0373925_0010255
2854 Ga0373925_0020229
2855 Ga0373925_0032585
2856 Ga0373925_0035606
2857 Ga0373925_0038415
2858 Ga0373925_0058021
2859 Ga0373925_0072731
2860 Ga0373925_0256974
2861 Ga0373925_0295006
2862 Ga0373925_0407793
2863 Ga0373925_0436164
2864 Ga0373925_0544266
2865 Ga0373925_0602044
2866 Ga0373925_0936220
2867 Ga0373925_1494568
2868 Ga0373925_1576613
2869 Ga0395899_0003362
2870 Ga0395900_0002558
2871 Ga0395900_0181538
2872 Ga0395900_0932135
2873 Ga0395898_0043181
2874 Ga0395898_0117792
2875 Ga0395898_0312056
2876 Ga0395898_0449208
2877 Ga0395905_0002554
2878 Ga0395905_0156420
2879 Ga0436364_0441041
2880 Ga0436364_0844683
2881 Ga0395901_0002375
2882 Ga0395901_0222606
2883 Ga0436365_0255797
2884 Ga0436365_0426892
2885 Ga0436365_0464844
2886 Ga0436360_0189120
2887 Ga0436363_0280449
2888 Ga0436363_0349492
2889 Ga0436363_1620924
2890 Ga0436362_0478452
2891 Ga0436362_0558682
2892 Ga0451853_3176466
2893 Ga0439448_0071681
2894 Ga0439463_021757
2895 Ga0450902_028456
2896 Ga0439459_0059592
2897 Ga0439464_0042218
2898 Ga0439440_0028544
2899 Ga0439440_0107102
2900 Ga0466963_0104496
2901 Ga0466964_0652663
2902 Ga0466959_0167529
2903 Ga0466967_0090419
2904 Ga0466967_0100033
2905 Ga0495592_0000116
2906 Ga0495592_0006999
2907 Ga0495592_0017920
2908 Ga0495592_0019499
2909 Ga0495592_0076016
2910 Ga0495592_0114071
2911 Ga0495592_0167062
2912 Ga0495592_0288556
2913 Ga0495592_0298778
2914 Ga0495592_0300116
2915 Ga0495592_0327487
2916 Ga0495592_0418739
2917 Ga0495603_0039544
2918 Ga0495603_0043628
2919 Ga0495603_0395187
2920 Ga0495629_0003179
2921 Ga0495629_0049067
2922 Ga0495629_0059086
2923 Ga0495629_0077735
2924 Ga0495629_0650742
2925 Ga0495629_0760598
2926 Ga0495641_0001952
2927 Ga0495641_0019077
2928 Ga0495641_0022429
2929 Ga0495641_0041441
2930 Ga0495641_0058480
2931 Ga0495641_0095454
2932 Ga0495641_0411834
2933 Ga0495641_0528390
2934 Ga0495651_0000009
2935 Ga0495651_0006098
2936 Ga0495651_0012073
2937 Ga0495651_0014354
2938 Ga0495651_0025318
2939 Ga0495651_0030794
2940 Ga0495651_0032117
2941 Ga0495651_0038319
2942 Ga0495651_0158059
2943 Ga0495651_0163956
2944 Ga0495651_0165889
2945 Ga0495651_0180396
2946 Ga0495651_0199508
2947 Ga0495651_0199745
2948 Ga0495651_0295023
2949 Ga0495653_0001057
2950 Ga0495653_0011491
2951 Ga0495653_0018727
2952 Ga0495653_0025298
2953 Ga0495653_0025742
2954 Ga0495653_0025926
2955 Ga0495653_0029010
2956 Ga0495653_0046335
2957 Ga0495653_0076811
2958 Ga0495653_0081376
2959 Ga0495653_0093855
2960 Ga0495653_0124807
2961 Ga0495653_0170506
2962 Ga0495653_0297210
2963 Ga0495653_0601169
2964 Ga0495653_0602003
2965 Ga0495580_0000900
2966 Ga0495580_0036534
2967 Ga0495580_0110406
2968 Ga0495580_0566721
2969 Ga0495582_0001399
2970 Ga0495582_0025720
2971 Ga0495582_0032243
2972 Ga0495582_0036144
2973 Ga0495582_0267110
2974 Ga0495639_0002222
2975 Ga0495639_0020728
2976 Ga0495639_0026940
2977 Ga0495639_0099918
2978 Ga0495639_0117264
2979 Ga0495639_0214240
2980 Ga0495639_0279751
2981 Ga0495662_0008680
2982 Ga0495662_0023663
2983 Ga0495662_0029676
2984 Ga0495662_0031440
2985 Ga0495662_0033704
2986 Ga0495662_0069691
2987 Ga0495662_0082193
2988 Ga0495662_0213777
2989 Ga0495662_0250492
2990 Ga0495664_0019681
2991 Ga0495664_0026889
2992 Ga0495664_0030255
2993 Ga0495664_0044510
2994 Ga0495664_0047929
2995 Ga0495664_0072516
2996 Ga0495664_0095125
2997 Ga0495664_0225396
2998 Ga0495664_0314091
2999 Ga0495664_0353267
3000 Ga0495664_0401150
3001 Ga0495664_0569882
3002 Ga0495664_0930599
3003 Ga0495594_0005006
3004 Ga0495608_0000019
3005 Ga0495608_0004481
3006 Ga0495608_0011269
3007 Ga0495608_0011645
3008 Ga0495608_0012752
3009 Ga0495608_0017826
3010 Ga0495608_0044919
3011 Ga0495608_0054997
3012 Ga0495608_0074761
3013 Ga0495608_0112328
3014 Ga0495608_0241099
3015 Ga0495608_0343605
3016 Ga0495618_0006736
3017 Ga0495618_0014710
3018 Ga0495618_0017092
3019 Ga0495618_0033991
3020 Ga0495618_0045378
3021 Ga0495618_0066823
3022 Ga0495618_0098447
3023 Ga0495618_0156310
3024 Ga0495618_0166001
3025 Ga0495618_0299964
3026 Ga0495618_0326188
3027 Ga0495620_0370176
3028 Ga0495628_0000487
3029 Ga0495628_0028198
3030 Ga0495628_0056091
3031 Ga0495628_0071001
3032 Ga0495628_0078610
3033 Ga0495628_0079322
3034 Ga0495628_0096624
3035 Ga0495628_0170790
3036 Ga0495628_0222459
3037 Ga0495628_0282064
3038 Ga0495628_0291187
3039 Ga0495628_0300312
3040 Ga0495628_0413996
3041 Ga0495628_0616721
3042 Ga0495628_0731997
3043 Ga0495630_0009386
3044 Ga0495630_0014713
3045 Ga0495630_0018848
3046 Ga0495630_0026862
3047 Ga0495630_0027228
3048 Ga0495630_0087173
3049 Ga0495630_0087772
3050 Ga0495630_0106606
3051 Ga0495630_0155776
3052 Ga0495630_1003100
3053 Ga0495666_0008314
3054 Ga0495666_0094884
3055 Ga0495652_0000082
3056 Ga0495652_0001084
3057 Ga0495652_0014619
3058 Ga0495652_0016263
3059 Ga0495652_0067816
3060 Ga0495652_0073538
3061 Ga0495652_0074971
3062 Ga0495652_0085318
3063 Ga0495652_0086326
3064 Ga0495652_0185471
3065 Ga0495652_0249961
3066 Ga0495652_0311528
3067 Ga0495652_0321084
3068 Ga0495652_0645350
3069 Ga0495665_0008673
3070 Ga0495665_0049185
3071 Ga0495665_0082628
3072 Ga0495665_0088407
3073 Ga0495665_0111653
3074 Ga0495665_0146193
3075 Ga0495665_0211031
3076 Ga0495640_0015109
3077 Ga0495640_0017597
3078 Ga0495640_0020301
3079 Ga0495640_0033180
3080 Ga0495640_0049760
3081 Ga0495640_0059001
3082 Ga0495640_0075262
3083 Ga0495640_0084767
3084 Ga0495640_0148536
3085 Ga0495640_0181958
3086 Ga0495640_0319389
3087 Ga0495586_0038174
3088 Ga0495586_0077563
3089 Ga0495586_0129586
3090 Ga0495586_0159291
3091 Ga0495586_0324389
3092 Ga0495586_0406291
3093 Ga0495586_0485292
3094 Ga0495587_0000041
3095 Ga0495587_0002545
3096 Ga0495587_0003164
3097 Ga0495587_0006468
3098 Ga0495587_0020245
3099 Ga0495587_0077639
3100 Ga0495587_0082492
3101 Ga0495587_0085962
3102 Ga0495587_0108321
3103 Ga0495645_0030131
3104 Ga0495645_0035787
3105 Ga0495645_0040681
3106 Ga0495645_0052142
3107 Ga0495645_0062859
3108 Ga0495645_0072059
3109 Ga0495645_0114655
3110 Ga0495645_0117802
3111 Ga0495645_0190744
3112 Ga0495645_0260561
3113 Ga0495645_0267992
3114 Ga0495645_0364684
3115 Ga0495645_0433029
3116 Ga0495645_0461707
3117 Ga0495667_0000037
3118 Ga0495667_0000421
3119 Ga0495667_0000800
3120 Ga0495667_0004264
3121 Ga0495667_0009183
3122 Ga0495667_0011013
3123 Ga0495667_0019326
3124 Ga0495667_0027470
3125 Ga0495667_0034240
3126 Ga0495667_0043787
3127 Ga0495667_0056052
3128 Ga0495667_0066308
3129 Ga0495667_0090587
3130 Ga0495667_0157246
3131 Ga0495667_0411843
3132 Ga0495667_0435459
3133 Ga0495667_0544238
3134 Ga0495634_0010433
3135 Ga0495634_0011439
3136 Ga0495634_0053227
3137 Ga0495634_0092595
3138 Ga0495634_0319851
3139 Ga0495634_0500040
3140 Ga0495634_0600131
3141 Ga0495635_0002898
3142 Ga0495635_0007111
3143 Ga0495635_0032303
3144 Ga0495635_0040020
3145 Ga0495635_0042984
3146 Ga0495635_0059737
3147 Ga0495635_0064133
3148 Ga0495635_0122135
3149 Ga0495635_0144754
3150 Ga0495635_0214678
3151 Ga0495635_0655376
3152 Ga0495635_0667590
3153 Ga0495588_0165662
3154 Ga0495588_0248622
3155 Ga0495657_0000094
3156 Ga0495657_0003003
3157 Ga0495657_0021904
3158 Ga0495657_0030345
3159 Ga0495657_0040493
3160 Ga0495657_0043467
3161 Ga0495657_0047804
3162 Ga0495657_0052593
3163 Ga0495657_0066023
3164 Ga0495657_0097164
3165 Ga0495657_0103176
3166 Ga0495657_0120284
3167 Ga0495657_0127573
3168 Ga0495657_0142898
3169 Ga0495599_0000040
3170 Ga0495599_0002900
3171 Ga0495599_0005848
3172 Ga0495599_0009981
3173 Ga0495599_0010351
3174 Ga0495599_0032221
3175 Ga0495599_0038601
3176 Ga0495599_0193223
3177 Ga0495599_0278142
3178 Ga0495599_0359470
3179 Ga0495599_0384877
3180 Ga0495599_0401143
3181 Ga0495599_0408841
3182 Ga0495623_0000284
3183 Ga0495623_0025339
3184 Ga0495623_0027339
3185 Ga0495623_0060472
3186 Ga0495623_0066130
3187 Ga0495623_0074365
3188 Ga0495623_0168398
3189 Ga0495623_0348223
3190 Ga0495646_0010148
3191 Ga0495646_0020355
3192 Ga0495646_0033771
3193 Ga0495646_0053908
3194 Ga0495646_0098108
3195 Ga0495646_0148879
3196 Ga0495646_0472108
3197 Ga0495647_0033564
3198 Ga0495647_0045938
3199 Ga0495647_0190530
3200 Ga0495647_0215784
3201 Ga0495647_0315318
3202 Ga0495658_0000946
3203 Ga0495658_0035064
3204 Ga0495658_0085296
3205 Ga0495658_0092352
3206 Ga0495658_0831232
3207 Ga0495658_0846115
3208 Ga0495613_0004518
3209 Ga0495613_0011485
3210 Ga0495613_0063652
3211 Ga0495613_0072554
3212 Ga0495613_0078390
3213 Ga0495613_0085475
3214 Ga0495624_0002604
3215 Ga0495624_0006330
3216 Ga0495624_0017938
3217 Ga0495624_0032175
3218 Ga0495624_0048265
3219 Ga0495624_0197000
3220 Ga0495624_0326890
3221 Ga0495624_0455125
3222 Ga0495600_0000803
3223 Ga0495600_0003966
3224 Ga0495600_0008834
3225 Ga0495600_0015047
3226 Ga0495600_0046491
3227 Ga0495600_0062743
3228 Ga0495600_0068838
3229 Ga0495600_0078023
3230 Ga0495600_0079409
3231 Ga0495600_0154704
3232 Ga0495600_0403190
3233 Ga0495581_0004483
3234 Ga0495581_0015778
3235 Ga0495581_0028979
3236 Ga0495581_0037596
3237 Ga0495581_0037870
3238 Ga0495604_0000040
3239 Ga0495604_0014873
3240 Ga0495604_0022068
3241 Ga0495604_0024377
3242 Ga0495604_0074084
3243 Ga0495604_0131783
3244 Ga0495604_0163256
3245 Ga0495604_0182639
3246 Ga0495604_0187379
3247 Ga0495674_0000257
3248 Ga0495674_0045612
3249 Ga0495674_0053795
3250 Ga0495674_0054363
3251 Ga0495674_0064729
3252 Ga0495674_0082232
3253 Ga0495674_0094041
3254 Ga0495674_0120504
3255 Ga0495674_0221591
3256 Ga0495674_0335528
3257 Ga0495674_0398343
3258 Ga0495674_0424028
3259 Ga0495674_0668777
3260 Ga0495674_0740959
3261 Ga0495674_0928457
3262 Ga0495674_1019563
3263 Ga0495674_1104308
3264 Ga0495676_0000700
3265 Ga0495676_0020351
3266 Ga0495676_0047635
3267 Ga0495676_0150426
3268 Ga0495676_0435237
3269 Ga0495680_0000010
3270 Ga0495680_0010497
3271 Ga0495680_0010698
3272 Ga0495680_0013172
3273 Ga0495680_0013767
3274 Ga0495680_0014838
3275 Ga0495680_0016768
3276 Ga0495680_0029749
3277 Ga0495680_0038010
3278 Ga0495680_0049590
3279 Ga0495680_0059578
3280 Ga0495680_0068511
3281 Ga0495680_0087590
3282 Ga0495680_0096053
3283 Ga0495680_0276036
3284 Ga0495680_0291630
3285 Ga0495680_0452998
3286 Ga0495680_0510352
3287 Ga0495680_0559823
3288 Ga0495680_0573177
3289 Ga0495675_0000111
3290 Ga0495675_0006911
3291 Ga0495675_0150205
3292 Ga0495675_0180580
3293 Ga0495675_0305886
3294 Ga0495684_0000641
3295 Ga0495684_0009245
3296 Ga0495684_0009309
3297 Ga0495684_0018560
3298 Ga0495684_0020458
3299 Ga0495684_0031019
3300 Ga0495684_0034267
3301 Ga0495684_0079617
3302 Ga0495684_0083078
3303 Ga0495684_0125520
3304 Ga0495684_0129501
3305 Ga0495684_0198864
3306 Ga0495684_0217398
3307 Ga0495684_0375752
3308 Ga0495684_0416822
3309 Ga0495684_0644354
3310 Ga0495593_0009511
3311 Ga0495593_0018083
3312 Ga0495593_0043192
3313 Ga0495593_0157171
3314 Ga0495593_0500001
3315 Ga0495602_0000130
3316 Ga0495602_0002822
3317 Ga0495602_0008980
3318 Ga0495602_0025415
3319 Ga0495602_0026049
3320 Ga0495602_0057636
3321 Ga0495602_0063939
3322 Ga0495602_0075199
3323 Ga0495602_0083382
3324 Ga0495602_0184792
3325 Ga0495602_0185362
3326 Ga0495602_0292628
3327 Ga0495602_0369990
3328 Ga0495602_0712107
3329 Ga0495614_0005861
3330 Ga0495614_0026653
3331 Ga0495614_0030574
3332 Ga0495614_0325448
3333 Ga0496100_0009329
3334 Ga0496100_0073862
3335 Ga0496100_0226749
3336 Ga0496100_0339081
3337 Ga0496100_0490707
3338 Ga0496101_0065686
3339 Ga0496101_0240698
3340 Ga0496101_0292110
3341 Ga0496101_0457172
3342 Ga0496101_0901869
3343 Ga0496101_0936434
3344 Ga0496102_0021857
3345 Ga0496102_0047254
3346 Ga0496102_0065897
3347 Ga0496102_0119431
3348 Ga0496102_0264690
3349 Ga0496102_0439573
3350 Ga0496102_0471923
3351 Ga0496102_0539972
3352 Ga0496103_0019954
3353 Ga0496103_0129345
3354 Ga0496103_0591173
3355 Ga0496103_0674244
3356 Ga0496104_0001728
3357 Ga0496104_0005984
3358 Ga0496104_0013896
3359 Ga0496104_0096280
3360 Ga0496104_0213677
3361 Ga0496104_0394181
3362 Ga0496104_0537481
3363 Ga0496105_0005569
3364 Ga0496105_0009713
3365 Ga0496105_0024538
3366 Ga0496105_0047663
3367 Ga0496105_0497826
3368 Ga0496106_0016858
3369 Ga0496106_0019946
3370 Ga0496106_0137287
3371 Ga0496106_0203804
3372 Ga0496107_0107452
3373 Ga0496107_0430193
3374 Ga0496108_0003239
3375 Ga0496108_0027260
3376 Ga0496108_0031025
3377 Ga0496108_0046864
3378 Ga0496108_0054206
3379 Ga0496108_0069275
3380 Ga0496108_0121284
3381 Ga0496108_1197694
3382 Ga0496109_0035177
3383 Ga0496109_0042748
3384 Ga0496109_0065907
3385 Ga0496109_0097059
3386 Ga0496109_0132392
3387 Ga0496109_0156639
3388 Ga0496109_0181416
3389 Ga0496109_0203472
3390 Ga0496109_0811560
3391 Ga0496109_1118975
3392 Ga0496109_1163527
3393 Ga0496110_0009668
3394 Ga0496110_0018783
3395 Ga0496110_0036569
3396 Ga0496110_0385973
3397 Ga0496110_0425521
3398 Ga0496110_1087753
3399 Ga0496110_1686624
3400 Ga0496110_1887134
3401 Ga0496111_0016631
3402 Ga0496111_0017434
3403 Ga0496111_0036631
3404 Ga0496111_0334317
3405 Ga0496111_0712600
3406 Ga0496112_0041837
3407 Ga0496112_0059748
3408 Ga0496112_0105794
3409 Ga0496112_0129818
3410 Ga0496112_0202951
3411 Ga0496112_0230762
3412 Ga0496112_0247940
3413 Ga0496112_0464343
3414 Ga0496113_0011035
3415 Ga0496113_0215690
3416 Ga0496113_0408343
3417 Ga0496113_0537845
3418 Ga0496114_0023617
3419 Ga0496114_0123980
3420 Ga0496114_0164480
3421 Ga0496114_0169086
3422 Ga0496114_0277953
3423 Ga0496114_1635398
3424 Ga0496115_0011631
3425 Ga0496115_0099596
3426 Ga0496115_0260350
3427 Ga0496126_0020236
3428 Ga0496126_0052999
3429 nmdc:mga00v17_361463_c1
3430 nmdc:mga00v17_994478_c1
3431 nmdc:mga0yw44_12527_c1
3432 nmdc:mga0yw44_6553_c1
3433 nmdc:mga05p37_1049985_c1
3434 nmdc:mga05p37_139868_c1
3435 nmdc:mga05p37_264060_c1
3436 nmdc:mga05p37_269737_c1
3437 nmdc:mga05p37_78117_c1
3438 nmdc:mga05p37_98037_c1
3439 nmdc:mga09592_487827_c1
3440 nmdc:mga0qj67_286715_c1
3441 nmdc:mga0qj67_597220_c1
3442 nmdc:mga06r32_1586_c1
3443 nmdc:mga06r32_485283_c1
3444 nmdc:mga08y16_146281_c1
3445 nmdc:mga08y16_182705_c1
3446 nmdc:mga08y16_27538_c1
3447 nmdc:mga08y16_30083_c1
3448 nmdc:mga0n895_1147983_c1
3449 nmdc:mga0n895_1722097_c1
3450 nmdc:mga0n895_205608_c1
3451 nmdc:mga0n895_28072_c1
3452 nmdc:mga0n895_4006_c1
3453 nmdc:mga0n895_47170_c1
3454 nmdc:mga0n895_474028_c1
3455 nmdc:mga0n895_475446_c1
3456 nmdc:mga0n895_633187_c1
3457 nmdc:mga0rr50_114849_c1
3458 nmdc:mga0rr50_13459_c1
3459 nmdc:mga0rr50_225611_c1
3460 nmdc:mga0rr50_226123_c1
3461 nmdc:mga0rr50_289822_c1
3462 nmdc:mga0rr50_50055_c1
3463 nmdc:mga0rr50_510610_c1
3464 nmdc:mga0rr50_5547_c1
3465 nmdc:mga0rr50_915273_c1
3466 nmdc:mga08x19_111689_c1
3467 nmdc:mga08x19_219966_c1
3468 nmdc:mga08x19_481230_c1
3469 nmdc:mga08x19_491163_c1
3470 nmdc:mga08x19_51308_c1
3471 nmdc:mga0a205_1568058_c1
3472 nmdc:mga0a205_20148_c1
3473 nmdc:mga0a205_43005_c1
3474 nmdc:mga0a205_45094_c1
3475 nmdc:mga0a205_497045_c1
3476 nmdc:mga0a205_57492_c1
3477 Ga0495601_0007905
3478 Ga0495601_0019038
3479 Ga0495601_0040024
3480 Ga0495601_0053164
3481 Ga0495601_0088130
3482 Ga0495601_0093801
3483 Ga0495601_0158429
3484 Ga0495601_0159689
3485 Ga0495601_0230971
3486 Ga0495601_0320700
3487 Ga0495601_0325432
3488 Ga0495601_0431746
3489 Ga0495612_0006041
3490 Ga0495612_0024731
3491 Ga0495612_0032374
3492 Ga0495595_0000204
3493 Ga0495595_0017370
3494 Ga0495595_0021912
3495 Ga0495595_0053472
3496 Ga0495595_0061234
3497 Ga0495595_0062215
3498 Ga0495595_0086385
3499 Ga0495595_0566120
3500 Ga0495619_0012940
3501 Ga0495619_0018409
3502 Ga0495619_0073122
3503 Ga0495619_0154585
3504 Ga0495619_0180006
3505 Ga0495619_0186568
3506 Ga0495619_0192053
3507 Ga0495619_0320892
3508 Ga0495619_0501854
3509 Ga0495619_0846376
3510 Ga0500554_027937
3511 Ga0587084_027844
3512 Ga0587084_091673
3513 Ga0587066_091206
3514 Ga0587070_131178
3515 Ga0587070_216049
3516 Ga0587073_0032714
3517 Ga0587073_0085465
3518 Ga0587077_147919
3519 Ga0587083_0072319
3520 Ga0587092_066169
3521 Ga0587062_073076
3522 Ga0587067_109788
3523 Ga0587072_014866
3524 Ga0587076_133003
3525 Ga0587078_050557
3526 Ga0587079_023847
3527 Ga0587071_123395
3528 Ga0587111_0014553

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rdr-assembly1.cif.gz_A circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces 0.4807 38 144
3hf1-assembly1.cif.gz_A crystal structure of human p53r2 0.4334 25 148
4djn-assembly1.cif.gz_B crystal structure of a ribonucleotide reductase m2 b (rnrr2) from homo sapiens at 2.20 a resolution 0.4306 25 148
7eyd-assembly1.cif.gz_19 cryo-em structure of cyanobacterial phycobilisome from anabaena sp. pcc 7120 0.4194 12 148
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.4178 4 147
ID Description Score Start End Superfamily
2lyiA01 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Spidroin, repetitive domain 0.4791 7 147 1.10.274.60
af_A1Z9P3_1388_1576_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4775 7 144 1.10.287.1490
af_I1K868_479_658_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.463 82 143 1.25.40.10
af_I1KXX2_1_136_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4503 8 139 1.20.1410.10
af_Q03001_381_494_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4478 10 144 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A6P2C682-F1-model_v4 Uncharacterized protein 0.9544 1 148
AF-A0A538FQZ1-F1-model_v4 Uncharacterized protein 0.9491 1 120
AF-A0A6P2C682-F1-model_v4 Uncharacterized protein 0.9482 1 148
AF-A0A538LQB7-F1-model_v4 FHA domain-containing protein 0.9455 1 145 GO:0016020
GO:0016491
GO:0051536
AF-A0A3C0XF14-F1-model_v4 Uncharacterized protein 0.9265 25 148

Map