F495537

General Info

Members Datasets Scaffolds Average Seq Length
1739 1146 774 360

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10058539|Ga0157369_100585394
Length 390
Sequence MTTLSVQTPHTNAFPPGATSLPEASAVSGEHSVSIRDLSLSFGAVTVLEDLNLDIHDGEFLVLLGSSGCGKSTLLNCIAGLLEPTDGQIFIKGRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLRVAGLPKEDIAKRVARASAILQIEPLLQRKPAALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQQLKNTMIYVTHDQIEALTLADRIAIMKSGVIQQLADPVTIYNRPKNKFVAGFIGSPSMNFLDGELAEEGGRPVFKTNGVSFLLDGYSACEPLTPGRKVVLGVRPEHIKVDADIAGEEIHEAIVDIEEPMGADNLIWLKLAAHTLSVRVGGARRYAVGSKVRLGFDMTMASLFDAATEERI

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
17 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
18 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
19 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
33 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
34 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
35 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
36 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
37 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
38 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
39 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
40 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
41 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
42 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
43 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
44 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
45 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
46 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
47 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
48 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
49 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
50 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
51 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
52 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
53 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
54 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
55 2519899620 Rhizobium sp. Pop5 Isolate Nodule
56 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
57 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
58 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
59 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
60 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
61 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
62 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
63 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
64 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
65 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
66 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
67 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
68 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
69 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
70 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
71 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
72 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
73 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
74 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
75 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
76 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
77 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
78 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
79 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
80 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
81 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
82 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
83 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
84 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
85 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
86 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
87 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
88 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
89 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
90 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
91 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
92 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
93 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
94 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
95 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
96 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
97 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
98 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
99 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
100 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
101 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
102 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
103 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
104 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
105 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
106 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
107 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
108 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
109 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
110 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
111 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
112 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
113 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
114 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
115 2643221557 Ensifer sp. Root558 Isolate Unclassified
116 2643221568 Rhizobium sp. Root564 Isolate Unclassified
117 2643221582 Rhizobium sp. Root651 Isolate Unclassified
118 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
119 2643221599 Rhizobium sp. Root708 Isolate Unclassified
120 2643221610 Ensifer sp. Root74 Isolate Unclassified
121 2643221626 Ensifer sp. Root31 Isolate Unclassified
122 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
123 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
124 2643221638 Duganella sp. Root336D2 Isolate Unclassified
125 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
126 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
127 2643221655 Ensifer sp. Root1252 Isolate Unclassified
128 2643221659 Ensifer sp. Root127 Isolate Unclassified
129 2643221668 Ensifer sp. Root423 Isolate Unclassified
130 2643221675 Ensifer sp. Root1298 Isolate Unclassified
131 2643221680 Ensifer sp. Root1312 Isolate Unclassified
132 2643221688 Rhizobium sp. Root482 Isolate Unclassified
133 2643221693 Rhizobium sp. Root491 Isolate Unclassified
134 2643221698 Ensifer sp. Root142 Isolate Unclassified
135 2643221712 Ensifer sp. Root258 Isolate Unclassified
136 2643221719 Rhizobium sp. Root274 Isolate Unclassified
137 2643221723 Ensifer sp. Root278 Isolate Unclassified
138 2643221726 Ensifer sp. Root954 Isolate Unclassified
139 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
140 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
141 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
142 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
143 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
144 2718217882 Rhizobium sp. N741 Isolate Nodule
145 2718217927 Rhizobium sp. N324 Isolate Nodule
146 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
147 2718218009 Rhizobium sp. N561 Isolate Nodule
148 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
149 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
150 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
151 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
152 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
153 2718218363 Rhizobium sp. N113 Isolate Nodule
154 2718218365 Rhizobium sp. N731 Isolate Nodule
155 2718218366 Rhizobium sp. N621 Isolate Nodule
156 2718218423 Rhizobium sp. N941 Isolate Nodule
157 2721755514 Rhizobium sp. N6212 Isolate Nodule
158 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
159 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
160 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
161 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
162 2721755809 Rhizobium sp. N541 Isolate Nodule
163 2721755810 Rhizobium sp. N871 Isolate Nodule
164 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
165 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
166 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
167 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
168 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
169 2728369365 Rhizobium sp. N1341 Isolate Nodule
170 2728369397 Rhizobium sp. N1314 Isolate Nodule
171 2738541293 Rhizobium sp. GV031 Isolate Unclassified
172 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
173 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
174 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
175 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
176 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
177 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
178 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
179 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
180 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
181 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
182 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
183 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
184 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
185 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
186 2791355256 Rhizobium sp. M10 Isolate Nodule
187 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
188 2791355260 Rhizobium sp. L9 Isolate Nodule
189 2791355261 Rhizobium sp. J15 Isolate Nodule
190 2791355262 Rhizobium sp. M1 Isolate Nodule
191 2791355263 Rhizobium chutanense C5 Isolate Nodule
192 2791355264 Rhizobium sp. S9 Isolate Nodule
193 2791355265 Rhizobium sp. H4 Isolate Nodule
194 2791355266 Rhizobium sp. L43 Isolate Nodule
195 2791355267 Rhizobium sp. L18 Isolate Nodule
196 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
197 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
198 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
199 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
200 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
201 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
202 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
203 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
204 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
205 2802429633 Rhizobium anhuiense J3 Isolate Nodule
206 2802429634 Rhizobium anhuiense S10 Isolate Nodule
207 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
208 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
209 2802429637 Rhizobium anhuiense C15 Isolate Nodule
210 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
211 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
212 2818991436 Collimonas arenae 515 Isolate Unclassified
213 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
214 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
215 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
216 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
217 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
218 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
219 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
220 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
221 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
222 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
223 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
224 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
225 2838048938 Rhizobium pisi 27/80 Isolate Nodule
226 2838061910 Rhizobium phaseoli L15 Isolate Nodule
227 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
228 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
229 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
230 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
231 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
232 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
233 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
234 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
235 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
236 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
237 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
238 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
239 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
240 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
241 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
242 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
243 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
244 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
245 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
246 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
247 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
248 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
249 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
250 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
251 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
252 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
253 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
254 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
255 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
256 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
257 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
258 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
259 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
260 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
261 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
262 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
263 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
264 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
265 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
266 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
267 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
268 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
269 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
270 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
271 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
272 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
273 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
274 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
275 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
276 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
277 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
278 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
279 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
280 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
281 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
282 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
283 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
284 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
285 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
286 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
287 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
288 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
289 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
290 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
291 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
292 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
293 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
294 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
295 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
296 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
297 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
298 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
299 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
300 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
301 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
302 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
303 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
304 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
305 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
306 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
307 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
308 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
309 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
310 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
311 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
312 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
313 2844163670 Ensifer sp. 1H6 Isolate Unclassified
314 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
315 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
316 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
317 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
318 2854911287 Brucella lupini LUP21 Isolate Unclassified
319 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
320 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
321 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
322 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
323 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
324 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
325 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
326 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
327 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
328 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
329 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
330 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
331 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
332 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
333 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
334 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
335 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
336 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
337 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
338 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
339 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
340 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
341 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
342 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
343 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
344 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
345 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
346 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
347 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
348 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
349 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
350 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
351 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
352 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
353 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
354 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
355 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
356 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
357 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
358 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
359 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
360 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
361 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
362 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
363 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
364 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
365 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
366 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
367 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
368 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
369 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
370 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
371 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
372 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
373 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
374 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
375 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
376 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
377 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
378 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
379 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
380 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
381 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
382 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
383 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
384 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
385 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
386 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
387 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
388 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
389 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
390 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
391 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
392 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
393 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
394 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
395 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
396 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
397 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
398 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
399 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
400 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
401 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
402 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
403 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
404 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
405 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
406 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
407 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
408 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
409 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
410 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
411 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
412 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
413 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
414 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
415 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
416 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
417 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
418 2904424332 Duganella sp. 1411 Isolate Rhizosphere
419 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
420 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
421 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
422 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
423 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
424 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
425 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
426 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
427 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
428 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
429 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
430 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
431 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
432 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
433 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
434 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
435 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
436 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
437 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
438 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
439 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
440 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
441 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
442 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
443 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
444 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
445 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
446 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
447 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
448 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
449 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
450 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
451 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
452 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
453 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
454 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
455 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
456 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
457 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
458 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
459 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
460 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
461 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
462 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
463 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
464 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
465 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
466 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
467 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
468 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
469 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
470 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
471 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
472 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
473 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
474 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
475 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
476 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
477 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
478 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
479 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
480 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
481 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
482 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
483 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
484 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
485 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
486 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
487 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
488 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
489 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
490 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
491 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
492 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
493 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
494 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
495 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
496 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
497 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
498 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
499 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
500 2932401849 Devosia sp. 2618 Isolate Rhizosphere
501 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
502 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
503 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
504 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
505 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
506 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
507 2933599457 Rhizobium phaseoli M3 Isolate Nodule
508 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
509 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
510 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
511 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
512 2936381700 Rhizobium chutanense C16 Isolate Unclassified
513 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
514 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
515 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
516 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
517 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
518 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
519 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
520 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
521 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
522 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
523 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
524 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
525 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
526 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
527 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
528 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
529 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
530 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
531 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
532 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
533 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
534 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
535 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
536 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
537 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
538 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
539 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
540 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
541 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
542 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
543 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
544 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
545 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
546 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
547 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
548 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
549 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
550 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
551 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
552 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
553 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
554 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
555 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
556 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
557 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
558 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
559 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
560 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
561 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
562 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
563 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
564 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
565 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
566 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
567 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
568 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
569 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
570 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
571 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
572 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
573 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
574 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
575 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
576 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
577 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
578 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
579 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
580 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
581 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
582 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
583 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
584 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
585 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
586 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
587 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
588 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
589 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
590 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
591 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
592 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
593 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
594 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
595 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
596 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
597 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
598 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
599 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
600 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
601 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
602 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
603 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
604 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
605 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
606 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
607 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
608 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
609 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
610 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
611 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
612 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
613 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
614 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
615 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
616 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
617 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
618 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
619 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
620 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
621 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
622 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
623 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
624 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
625 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
626 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
627 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
628 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
629 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
630 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
631 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
632 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
633 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
634 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
635 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
636 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
637 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
638 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
639 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
640 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
641 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
642 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
643 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
644 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
645 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
646 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
647 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
648 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
649 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
650 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
651 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
652 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
653 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
654 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
655 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
656 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
657 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
658 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
659 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
660 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
661 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
662 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
663 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
664 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
665 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
666 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
667 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
668 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
669 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
670 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
671 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
672 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
673 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
674 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
675 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
676 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
677 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
678 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
679 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
680 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
681 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
682 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
683 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
684 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
685 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
686 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
687 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
688 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
689 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
690 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
691 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
692 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
693 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
694 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
695 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
696 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
697 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
698 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
699 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
700 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
701 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
702 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
703 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
704 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
705 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
706 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
707 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
708 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
709 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
710 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
711 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
712 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
713 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
714 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
715 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
716 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
717 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
718 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
719 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
720 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
721 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
722 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
723 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
724 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
725 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
726 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
727 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
728 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
729 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
730 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
731 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
732 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
733 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
734 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
735 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
736 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
737 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
738 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
739 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
740 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
741 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
742 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
743 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
744 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
745 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
746 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
747 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
748 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
749 2996887358 Rhizobium sp. R711 Isolate Nodule
750 2996893221 Rhizobium sp. R635 Isolate Nodule
751 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
752 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
753 3004167301 Mesorhizobium loti 582 Isolate Unclassified
754 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
755 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
756 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
757 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
758 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
759 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
760 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
761 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
762 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
763 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
764 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
765 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
766 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
767 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
768 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
769 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
770 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
771 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
772 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
773 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
774 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
775 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
776 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
777 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
778 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
779 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
780 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
781 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
782 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
783 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
784 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
785 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
786 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
787 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
788 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
789 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
790 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
791 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
792 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
793 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
794 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
795 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
796 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
797 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
798 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
799 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
800 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
801 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
802 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
803 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
804 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
805 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
806 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
807 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
808 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
809 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
810 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
811 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
812 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
813 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
814 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
815 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
816 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
817 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
818 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
819 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
820 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
821 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
822 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
823 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
824 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
825 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
826 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
827 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
828 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
829 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
830 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
831 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
832 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
833 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
834 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
835 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
836 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
837 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
838 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
839 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
840 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
841 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
842 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
843 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
844 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
845 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
846 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
847 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
848 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
849 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
850 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
851 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
852 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
853 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
854 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
855 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
856 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
857 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
858 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
859 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
860 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
861 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
862 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
863 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
864 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
865 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
866 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
867 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
868 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
869 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
870 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
871 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
872 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
873 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
874 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
875 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
876 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
877 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
878 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
879 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
880 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
881 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
882 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
883 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
884 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
885 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
886 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
887 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
888 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
889 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
890 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
891 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
892 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
893 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
894 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
895 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
896 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
897 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
898 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
899 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
900 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
901 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
902 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
903 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
904 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
905 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
906 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
907 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
908 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
909 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
910 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
911 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
912 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
913 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
914 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
915 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
916 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
917 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
918 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
919 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
920 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
921 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
922 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
923 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
924 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
925 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
926 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
927 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
928 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
929 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
930 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
932 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
933 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
934 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
935 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
937 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
938 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
939 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
940 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
941 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
942 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
943 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
944 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
945 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
946 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
947 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
948 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
949 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
950 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
951 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
952 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
953 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
954 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
955 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
956 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
957 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
958 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
959 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
960 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
961 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
962 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
963 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
964 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
965 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
966 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
967 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
968 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
969 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
970 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
971 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
972 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
973 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
974 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
975 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
976 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
977 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
978 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
979 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
980 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
981 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
982 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
983 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
984 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
985 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
986 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
987 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
988 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
989 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
990 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
991 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
992 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
993 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
994 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
995 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
996 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
997 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
998 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
999 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1000 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1001 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1002 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1003 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1004 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1005 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1006 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1007 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1008 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1009 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1010 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1011 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1012 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1013 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1014 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1015 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1016 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1017 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1018 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1019 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1020 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1021 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1022 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1023 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1024 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1025 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1026 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1027 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1028 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1029 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1030 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1031 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1032 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1033 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1034 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1035 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1036 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1037 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1038 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1039 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1040 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1041 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1042 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1043 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1044 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1045 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1046 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1047 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1048 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1049 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1050 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1051 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1052 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1053 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1054 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
1055 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1056 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1057 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1058 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1059 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1060 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1061 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1062 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1063 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1064 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1065 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1066 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1067 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1068 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1069 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1070 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1071 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1072 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1073 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1074 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1075 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1076 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1077 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1078 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1079 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1080 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1081 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1082 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1083 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1084 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1085 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1086 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1087 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1088 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1089 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1090 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1091 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1092 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1093 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1094 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1095 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1096 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1097 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1098 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1099 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1100 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1101 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1102 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1103 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1104 8005258706 Rhizobium sp. R693 Isolate Nodule
1105 8005275841 Rhizobium sp. N4311 Isolate Nodule
1106 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1107 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1108 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1109 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1110 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1111 8005321885 Rhizobium sp. R72 Isolate Nodule
1112 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1113 8005382845 Rhizobium sp. R634 Isolate Nodule
1114 8005395548 Rhizobium sp. R339 Isolate Nodule
1115 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1116 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1117 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1118 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1119 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1120 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1121 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1122 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1123 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1124 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1125 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1126 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1127 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1128 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1129 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1130 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1131 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1132 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1133 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1134 8018176218 Rhizobium sp. N122 Isolate Nodule
1135 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1136 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1137 8024501048 Rhizobium sp. H4 Isolate Nodule
1138 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1139 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1140 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1141 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1142 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1143 8056382006 Rhizobium croatiense 13T Isolate Nodule
1144 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1145 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1146 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.45
Metatranscriptomes 0.12
Isolates 55.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 18.17
Nodule 43.76
Rhizoplane 1.32
Rhizosphere 21.05
Stem 0
Stem Tuber 0
Unclassified 15.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000002 3300001979 Bacteria 158865
2 JGI24740J21852_10000166 3300001979 Bacteria 26287
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25155J39150_1000021 3300002704 Bacteria 150730
5 JGI25155J39150_1000076 3300002704 Bacteria 59158
6 JGI25155J39150_1000246 3300002704 Bacteria 21013
7 JGI25156J39149_1000001 3300002705 Bacteria 354557
8 JGI25156J39149_1000022 3300002705 Bacteria 150730
9 JGI25156J39149_1000032 3300002705 Bacteria 118609
10 JGI25156J39149_1018978 3300002705 Bacteria 1256
11 JGI25162J39368_1000331 3300002737 Bacteria 41467
12 JGI25162J39368_1000376 3300002737 Bacteria 37963
13 JGI25162J39368_1000677 3300002737 Bacteria 23881
14 JGI25162J39368_1001207 3300002737 Bacteria 15046
15 JGI25154J39366_1000011 3300002738 Bacteria 296007
16 JGI25154J39366_1000048 3300002738 Bacteria 126252
17 JGI25154J39366_1000095 3300002738 Bacteria 79187
18 JGI25154J39366_1000223 3300002738 Bacteria 38684
19 JGI25158J39367_1000114 3300002739 Bacteria 18397
20 JGI25158J39367_1000586 3300002739 Bacteria 7234
21 JGI25157J39369_1000025 3300002741 Bacteria 150726
22 JGI25157J39369_1000030 3300002741 Bacteria 146112
23 JGI25157J39369_1000250 3300002741 Bacteria 40121
24 JGI25157J39369_1001392 3300002741 Bacteria 9335
25 JGI25152J39213_1001028 3300002773 Bacteria 13358
26 JGI25152J39213_1002374 3300002773 Bacteria 7223
27 JGI25152J39213_1002697 3300002773 Bacteria 6497
28 JGI25152J39213_1002735 3300002773 Bacteria 6431
29 JGI25152J39213_1004191 3300002773 Bacteria 4638
30 JGI25152J39213_1004233 3300002773 Bacteria 4592
31 JGI25152J39213_1007073 3300002773 Bacteria 2949
32 JGI25152J39213_1015934 3300002773 Bacteria 1467
33 JGI25150J39212_1003583 3300002774 Bacteria 3618
34 JGI25150J39212_1009736 3300002774 Bacteria 1816
35 JGI25159J45721_1000410 3300002987 Bacteria 19908
36 JGI25159J45721_1000901 3300002987 Bacteria 12936
37 JGI25151J46595_10000083 3300003187 Bacteria 130658
38 JGI25151J46595_10000341 3300003187 Bacteria 50002
39 JGI25151J46595_10000603 3300003187 Bacteria 31677
40 JGI25151J46595_10007493 3300003187 Bacteria 5339
41 JGI25165J46597_1000034 3300003214 Bacteria 292458
42 JGI25165J46597_1000075 3300003214 Bacteria 181212
43 JGI25165J46597_1000279 3300003214 Bacteria 65487
44 JGI25165J46597_1000449 3300003214 Bacteria 41467
45 JGI25165J46597_1001607 3300003214 Bacteria 10835
46 JGI25165J46597_1002413 3300003214 Bacteria 6088
47 JGI25153J46596_10000344 3300003215 Bacteria 32730
48 JGI25153J46596_10005098 3300003215 Bacteria 6939
49 JGI25153J46596_10005100 3300003215 Bacteria 6937
50 JGI25153J46596_10007239 3300003215 Bacteria 5491
51 JGI25153J46596_10008061 3300003215 Bacteria 5084
52 JGI25153J46596_10009300 3300003215 Bacteria 4589
53 JGI25153J46596_10017059 3300003215 Bacteria 2877
54 JGI25153J46596_10035004 3300003215 Bacteria 1633
55 JGI25153J46596_10036805 3300003215 Bacteria 1564
56 rootH1_10030284 3300003323 Bacteria 4417
57 JGI25160J50197_1000010 3300003354 Bacteria 279365
58 JGI25160J50197_1000216 3300003354 Bacteria 46708
59 JGI25160J50197_1000384 3300003354 Bacteria 28677
60 JGI25160J50197_1034397 3300003354 Bacteria 1259
61 JGI25161J50226_1000006 3300003374 Bacteria 279563
62 JGI25161J50226_1000138 3300003374 Bacteria 50562
63 JGI25161J50226_1000903 3300003374 Bacteria 10677
64 JGI25161J50226_1000938 3300003374 Bacteria 10424
65 JGI25161J50226_1001741 3300003374 Bacteria 6157
66 Ga0055538_1000107 3300003751 Bacteria 65487
67 Ga0055539_1000156 3300003752 Bacteria 65659
68 Ga0055533_1000157 3300003756 Bacteria 65487
69 Ga0055532_1000083 3300003758 Bacteria 118609
70 Ga0055525_1000210 3300003759 Bacteria 65487
71 Ga0055535_1000097 3300003761 Bacteria 95927
72 Ga0055542_1000299 3300003762 Bacteria 55023
73 Ga0055529_1004022 3300003763 Bacteria 2302
74 Ga0055526_1000400 3300003771 Bacteria 35032
75 Ga0055526_1000594 3300003771 Bacteria 28489
76 Ga0055526_1003126 3300003771 Bacteria 10723
77 Ga0055526_1004066 3300003771 Bacteria 8970
78 Ga0055526_1006188 3300003771 Bacteria 6584
79 Ga0055526_1027692 3300003771 Bacteria 1742
80 Ga0055537_1001818 3300003773 Bacteria 7726
81 Ga0055524_1000866 3300003775 Bacteria 19803
82 Ga0055524_1003883 3300003775 Bacteria 7088
83 Ga0055524_1005033 3300003775 Bacteria 5983
84 Ga0055524_1008933 3300003775 Bacteria 4121
85 Ga0055524_1031085 3300003775 Bacteria 1542
86 Ga0055534_1001505 3300003784 Bacteria 9176
87 Ga0055528_1000034 3300003790 Bacteria 118577
88 Ga0055528_1000358 3300003790 Bacteria 37118
89 Ga0055528_1001985 3300003790 Bacteria 11518
90 Ga0055528_1006402 3300003790 Bacteria 5343
91 Ga0055528_1009510 3300003790 Bacteria 4051
92 Ga0055528_1025218 3300003790 Bacteria 1754
93 Ga0055530_10001749 3300003791 Bacteria 15198
94 Ga0055530_10003711 3300003791 Bacteria 8501
95 Ga0055540_1000066 3300003792 Bacteria 122947
96 Ga0055540_1000354 3300003792 Bacteria 38972
97 Ga0055540_1000403 3300003792 Bacteria 35181
98 Ga0055540_1012783 3300003792 Bacteria 2612
99 Ga0055540_1013827 3300003792 Bacteria 2442
100 Ga0055531_10000031 3300003794 Bacteria 156686
101 Ga0055531_10000510 3300003794 Bacteria 35181
102 Ga0055531_10002784 3300003794 Bacteria 11477
103 Ga0055531_10007809 3300003794 Bacteria 5761
104 Ga0055541_1000103 3300003841 Bacteria 65632
105 Ga0058692_1002834 3300003856 Bacteria 5678
106 Ga0055543_1000053 3300004625 Bacteria 104589
107 Ga0055543_1000171 3300004625 Bacteria 54400
108 Ga0055543_1001102 3300004625 Bacteria 11677
109 Ga0055543_1001297 3300004625 Bacteria 10273
110 Ga0055543_1003000 3300004625 Bacteria 5224
111 Ga0065165_1000485 3300005262 Bacteria 61473
112 Ga0065165_1000717 3300005262 Bacteria 46746
113 Ga0065165_1008698 3300005262 Bacteria 4694
114 Ga0065165_1009792 3300005262 Bacteria 4238
115 Ga0065165_1010346 3300005262 Bacteria 4045
116 Ga0065165_1017039 3300005262 Bacteria 2693
117 Ga0070658_10129710 3300005327 Bacteria 2100
118 Ga0070658_10169371 3300005327 Bacteria 1834
119 Ga0070658_10320503 3300005327 Bacteria 1323
120 Ga0070676_10086348 3300005328 Bacteria 1914
121 Ga0070670_100028159 3300005331 Bacteria 4835
122 Ga0070660_100052493 3300005339 Bacteria 3143
123 Ga0070660_100174888 3300005339 Bacteria 1736
124 Ga0070689_100157762 3300005340 Bacteria 1832
125 Ga0070669_100024140 3300005353 Bacteria 4358
126 Ga0070669_100058561 3300005353 Bacteria 2827
127 Ga0070675_100052867 3300005354 Bacteria 3340
128 Ga0070674_100004332 3300005356 Bacteria 8089
129 Ga0070673_100095480 3300005364 Bacteria 2439
130 Ga0070688_100162465 3300005365 Bacteria 1535
131 Ga0070663_100212196 3300005455 Bacteria 1516
132 Ga0070678_100086397 3300005456 Bacteria 2393
133 Ga0070678_100167542 3300005456 Bacteria 1786
134 Ga0068867_100000050 3300005459 Bacteria 71814
135 Ga0068867_100195554 3300005459 Bacteria 1616
136 Ga0068853_100002082 3300005539 Bacteria 14838
137 Ga0068853_100469125 3300005539 Bacteria 1186
138 Ga0070672_100141803 3300005543 Bacteria 1983
139 Ga0070665_100048689 3300005548 Bacteria 4254
140 Ga0070665_100071066 3300005548 Bacteria 3487
141 Ga0068855_100028783 3300005563 Bacteria 6647
142 Ga0068855_100104953 3300005563 Bacteria 3250
143 Ga0068855_100338483 3300005563 Bacteria 1660
144 Ga0068857_100012090 3300005577 Bacteria 7506
145 Ga0068854_100078894 3300005578 Bacteria 2427
146 Ga0068856_100020306 3300005614 Bacteria 6453
147 Ga0068852_100001988 3300005616 Bacteria 13942
148 Ga0068852_100005916 3300005616 Bacteria 8795
149 Ga0068859_100175330 3300005617 Bacteria 2226
150 Ga0068851_10088966 3300005834 Bacteria 1624
151 Ga0068862_100306412 3300005844 Bacteria 1463
152 Ga0075365_10000306 3300006038 Bacteria 17174
153 Ga0075365_10000404 3300006038 Bacteria 15855
154 Ga0075365_10006498 3300006038 Bacteria 6436
155 Ga0075365_10009220 3300006038 Bacteria 5660
156 Ga0075365_10019892 3300006038 Bacteria 4153
157 Ga0075365_10021098 3300006038 Bacteria 4056
158 Ga0075365_10025031 3300006038 Bacteria 3774
159 Ga0075365_10060112 3300006038 Bacteria 2534
160 Ga0075368_10010112 3300006042 Bacteria 3407
161 Ga0075368_10032205 3300006042 Bacteria 2035
162 Ga0075368_10037830 3300006042 Bacteria 1887
163 Ga0075368_10051685 3300006042 Bacteria 1634
164 Ga0075363_100008310 3300006048 Bacteria 4827
165 Ga0075363_100061357 3300006048 Bacteria 2026
166 Ga0075363_100084650 3300006048 Bacteria 1739
167 Ga0075364_10000091 3300006051 Bacteria 36563
168 Ga0075364_10009866 3300006051 Bacteria 5744
169 Ga0075364_10011277 3300006051 Bacteria 5427
170 Ga0075364_10107695 3300006051 Bacteria 1858
171 Ga0075362_10003487 3300006177 Bacteria 5513
172 Ga0075362_10004177 3300006177 Bacteria 5152
173 Ga0075362_10006857 3300006177 Bacteria 4266
174 Ga0075362_10013941 3300006177 Bacteria 3232
175 Ga0075362_10055983 3300006177 Bacteria 1774
176 Ga0075362_10085031 3300006177 Bacteria 1462
177 Ga0075367_10003915 3300006178 Bacteria 7181
178 Ga0075367_10005500 3300006178 Bacteria 6302
179 Ga0075367_10033987 3300006178 Bacteria 2942
180 Ga0075367_10083124 3300006178 Bacteria 1939
181 Ga0075369_10002190 3300006186 Bacteria 6906
182 Ga0075369_10008292 3300006186 Bacteria 3994
183 Ga0075369_10053616 3300006186 Bacteria 1750
184 Ga0075366_10001037 3300006195 Bacteria 13641
185 Ga0075370_10002020 3300006353 Bacteria 9197
186 Ga0075370_10024344 3300006353 Bacteria 3343
187 Ga0075370_10056651 3300006353 Bacteria 2228
188 Ga0075370_10063299 3300006353 Bacteria 2109
189 Ga0075370_10075308 3300006353 Bacteria 1935
190 Ga0075370_10089816 3300006353 Bacteria 1772
191 Ga0068871_100284620 3300006358 Bacteria 1447
192 Ga0097620_100175332 3300006931 Bacteria 2226
193 Ga0079104_1000610 3300006946 Bacteria 35237
194 Ga0099826_10000054 3300006948 Bacteria 71175
195 Ga0105250_10026148 3300009092 Bacteria 2351
196 Ga0105240_10000005 3300009093 Bacteria 702630
197 Ga0105240_10000097 3300009093 Bacteria 179135
198 Ga0105240_10001988 3300009093 Bacteria 33782
199 Ga0105240_10024039 3300009093 Bacteria 8046
200 Ga0105240_10190465 3300009093 Bacteria 2412
201 Ga0105245_10135389 3300009098 Bacteria 2315
202 Ga0105243_10001055 3300009148 Bacteria 25222
203 Ga0105243_10039379 3300009148 Bacteria 3684
204 Ga0105242_10104647 3300009176 Bacteria 2403
205 Ga0105237_10000809 3300009545 Bacteria 42758
206 Ga0105237_10023717 3300009545 Bacteria 6281
207 Ga0105237_10189908 3300009545 Bacteria 2054
208 Ga0105237_10205333 3300009545 Bacteria 1971
209 Ga0105238_10035822 3300009551 Bacteria 5044
210 Ga0105238_10040243 3300009551 Bacteria 4737
211 Ga0105249_10090311 3300009553 Bacteria 2864
212 Ga0123341_1000005 3300009765 Bacteria 150422
213 Ga0123342_1014890 3300009766 Bacteria 7276
214 Ga0123342_1022395 3300009766 Bacteria 4282
215 Ga0157373_10014621 3300013100 Bacteria 5753
216 Ga0157371_10000002 3300013102 Bacteria 665040
217 Ga0157371_10093106 3300013102 Bacteria 2135
218 Ga0157370_10000286 3300013104 Bacteria 64173
219 Ga0157370_10001170 3300013104 Bacteria 32703
220 Ga0157369_10058539 3300013105 Bacteria 4156
221 Ga0157369_10103886 3300013105 Bacteria 3027
222 Ga0157369_10254837 3300013105 Bacteria 1831
223 Ga0171463_1003 3300013249 Bacteria 695693
224 Ga0157374_10191683 3300013296 Bacteria 2000
225 Ga0157374_10226143 3300013296 Bacteria 1837
226 Ga0157378_10064584 3300013297 Bacteria 3275
227 Ga0163162_10297053 3300013306 Bacteria 1747
228 Ga0157375_10018133 3300013308 Bacteria 6378
229 Ga0157375_10072507 3300013308 Bacteria 3461
230 Ga0157375_10355709 3300013308 Bacteria 1630
231 Ga0163163_10324527 3300014325 Bacteria 1593
232 Ga0182008_10038844 3300014497 Bacteria 2380
233 Ga0182008_10052835 3300014497 Bacteria 2013
234 Ga0182008_10068277 3300014497 Bacteria 1749
235 Ga0182008_10081962 3300014497 Bacteria 1588
236 Ga0157377_10000037 3300014745 Bacteria 115076
237 Ga0157379_10050986 3300014968 Bacteria 3696
238 Ga0182006_1024659 3300015261 Bacteria 2478
239 Ga0182006_1058824 3300015261 Bacteria 1456
240 Ga0182007_10004491 3300015262 Bacteria 6311
241 Ga0182005_1000300 3300015265 Bacteria 30284
242 Ga0183363_1047 3300015690 Bacteria 39413
243 Ga0214544_1000029 3300021320 Bacteria 153924
244 Ga0214542_1000092 3300021321 Bacteria 117288
245 Ga0214542_1001614 3300021321 Bacteria 46380
246 Ga0214543_1000045 3300021327 Bacteria 152699
247 Ga0214543_1001395 3300021327 Bacteria 46435
248 Ga0213872_10021364 3300021361 Bacteria 2980
249 Ga0228710_1000013 3300022740 Bacteria 145976
250 Ga0209435_100012 3300025206 Bacteria 401621
251 Ga0209435_100013 3300025206 Bacteria 366789
252 Ga0209435_100033 3300025206 Bacteria 150395
253 Ga0209435_100404 3300025206 Bacteria 9261
254 Ga0209760_102404 3300025207 Bacteria 1755
255 Ga0209436_100085 3300025208 Bacteria 46798
256 Ga0209436_100181 3300025208 Bacteria 29748
257 Ga0209784_100019 3300025224 Bacteria 453558
258 Ga0209566_100017 3300025225 Bacteria 453558
259 Ga0209674_100031 3300025226 Bacteria 453558
260 Ga0209672_102960 3300025228 Bacteria 3752
261 Ga0209147_100030 3300025229 Bacteria 366789
262 Ga0209563_100035 3300025230 Bacteria 453558
263 Ga0207427_100311 3300025231 Bacteria 33858
264 Ga0209437_100038 3300025233 Bacteria 453558
265 Ga0209437_100047 3300025233 Bacteria 405163
266 Ga0209437_100131 3300025233 Bacteria 181264
267 Ga0209437_100165 3300025233 Bacteria 145009
268 Ga0209437_100317 3300025233 Bacteria 63136
269 Ga0209258_100542 3300025242 Bacteria 34693
270 Ga0207425_1000024 3300025245 Bacteria 328978
271 Ga0207425_1000486 3300025245 Bacteria 24952
272 Ga0207425_1000753 3300025245 Bacteria 16834
273 Ga0207425_1004620 3300025245 Bacteria 4079
274 Ga0207425_1012657 3300025245 Bacteria 1971
275 Ga0209646_1000021 3300025246 Bacteria 461083
276 Ga0209646_1000026 3300025246 Bacteria 401621
277 Ga0209646_1000034 3300025246 Bacteria 366789
278 Ga0209646_1000116 3300025246 Bacteria 150395
279 Ga0209026_1000014 3300025250 Bacteria 401621
280 Ga0209026_1000022 3300025250 Bacteria 366789
281 Ga0209026_1000100 3300025250 Bacteria 156131
282 Ga0209026_1000103 3300025250 Bacteria 152843
283 Ga0209026_1002657 3300025250 Bacteria 6494
284 Ga0209677_100020 3300025253 Bacteria 453558
285 Ga0209677_101049 3300025253 Bacteria 13144
286 Ga0209677_104762 3300025253 Bacteria 3786
287 Ga0209148_1000069 3300025254 Bacteria 334444
288 Ga0209148_1005611 3300025254 Bacteria 2849
289 Ga0209759_1000012 3300025256 Bacteria 401621
290 Ga0209759_1000018 3300025256 Bacteria 366789
291 Ga0209759_1000105 3300025256 Bacteria 150395
292 Ga0209759_1000438 3300025256 Bacteria 49192
293 Ga0209759_1000567 3300025256 Bacteria 37279
294 Ga0209759_1000726 3300025256 Bacteria 28884
295 Ga0209759_1010461 3300025256 Bacteria 2716
296 Ga0209129_1000184 3300025258 Bacteria 87102
297 Ga0209129_1000594 3300025258 Bacteria 24717
298 Ga0209129_1000703 3300025258 Bacteria 21754
299 Ga0209129_1000735 3300025258 Bacteria 21020
300 Ga0209129_1000962 3300025258 Bacteria 17318
301 Ga0209129_1001002 3300025258 Bacteria 16842
302 Ga0209129_1003786 3300025258 Bacteria 6351
303 Ga0209129_1005225 3300025258 Bacteria 4701
304 Ga0209233_1000028 3300025261 Bacteria 642062
305 Ga0209233_1000048 3300025261 Bacteria 453669
306 Ga0209233_1000049 3300025261 Bacteria 453558
307 Ga0209233_1000069 3300025261 Bacteria 367639
308 Ga0209233_1000132 3300025261 Bacteria 203971
309 Ga0209233_1000195 3300025261 Bacteria 125863
310 Ga0209233_1000675 3300025261 Bacteria 16414
311 Ga0209565_1000476 3300025263 Bacteria 29666
312 Ga0209455_1000135 3300025272 Bacteria 148007
313 Ga0209455_1006073 3300025272 Bacteria 3628
314 Ga0209455_1006462 3300025272 Bacteria 3454
315 Ga0209673_1000010 3300025273 Bacteria 596656
316 Ga0209673_1000013 3300025273 Bacteria 571633
317 Ga0209673_1000020 3300025273 Bacteria 430653
318 Ga0209673_1000296 3300025273 Bacteria 92350
319 Ga0209673_1000462 3300025273 Bacteria 68568
320 Ga0209673_1000607 3300025273 Bacteria 55095
321 Ga0209673_1000850 3300025273 Bacteria 39843
322 Ga0209673_1001263 3300025273 Bacteria 26028
323 Ga0209673_1010610 3300025273 Bacteria 3865
324 Ga0209130_1000021 3300025284 Bacteria 374278
325 Ga0209130_1000029 3300025284 Bacteria 323399
326 Ga0209130_1000081 3300025284 Bacteria 166440
327 Ga0209130_1000607 3300025284 Bacteria 34637
328 Ga0209130_1011586 3300025284 Bacteria 2353
329 Ga0209676_1000657 3300025292 Bacteria 49575
330 Ga0209676_1015891 3300025292 Bacteria 2747
331 Ga0209676_1023984 3300025292 Bacteria 1986
332 Ga0209025_1000050 3300025294 Bacteria 331531
333 Ga0209025_1000081 3300025294 Bacteria 265899
334 Ga0209025_1000119 3300025294 Bacteria 210606
335 Ga0209025_1000166 3300025294 Bacteria 164692
336 Ga0209025_1000959 3300025294 Bacteria 43491
337 Ga0209025_1001950 3300025294 Bacteria 23818
338 Ga0209025_1002744 3300025294 Bacteria 17833
339 Ga0209025_1003832 3300025294 Bacteria 13694
340 Ga0209025_1009418 3300025294 Bacteria 6807
341 Ga0209025_1012443 3300025294 Bacteria 5450
342 Ga0209025_1021164 3300025294 Bacteria 3517
343 Ga0209025_1048271 3300025294 Bacteria 1727
344 Ga0209564_1000205 3300025295 Bacteria 135901
345 Ga0209564_1000260 3300025295 Bacteria 112444
346 Ga0209564_1000278 3300025295 Bacteria 105405
347 Ga0209564_1000584 3300025295 Bacteria 57729
348 Ga0209564_1000920 3300025295 Bacteria 38309
349 Ga0209564_1001753 3300025295 Bacteria 20252
350 Ga0209564_1001811 3300025295 Bacteria 19728
351 Ga0209564_1008530 3300025295 Bacteria 5042
352 Ga0209758_1000076 3300025297 Bacteria 270615
353 Ga0209758_1000083 3300025297 Bacteria 257283
354 Ga0209758_1000418 3300025297 Bacteria 72150
355 Ga0209758_1001756 3300025297 Bacteria 24054
356 Ga0209758_1002029 3300025297 Bacteria 21765
357 Ga0209758_1003295 3300025297 Bacteria 14947
358 Ga0209758_1005225 3300025297 Bacteria 10173
359 Ga0209758_1010395 3300025297 Bacteria 5577
360 Ga0209758_1010800 3300025297 Bacteria 5403
361 Ga0209758_1011368 3300025297 Bacteria 5168
362 Ga0209758_1015740 3300025297 Bacteria 3894
363 Ga0209758_1022153 3300025297 Bacteria 2929
364 Ga0209758_1035669 3300025297 Bacteria 1956
365 Ga0209050_1000152 3300025298 Bacteria 161651
366 Ga0209050_1002301 3300025298 Bacteria 16848
367 Ga0209050_1003249 3300025298 Bacteria 12243
368 Ga0209050_1003397 3300025298 Bacteria 11800
369 Ga0209050_1004814 3300025298 Bacteria 8883
370 Ga0209050_1006307 3300025298 Bacteria 7067
371 Ga0209050_1006426 3300025298 Bacteria 6962
372 Ga0209050_1006986 3300025298 Bacteria 6493
373 Ga0209256_1000042 3300025299 Bacteria 341821
374 Ga0209256_1000383 3300025299 Bacteria 70773
375 Ga0209256_1000500 3300025299 Bacteria 57552
376 Ga0209256_1000588 3300025299 Bacteria 50690
377 Ga0209256_1001127 3300025299 Bacteria 30457
378 Ga0209256_1002281 3300025299 Bacteria 16192
379 Ga0209256_1003506 3300025299 Bacteria 10935
380 Ga0209256_1017452 3300025299 Bacteria 2382
381 Ga0207426_1000008 3300025302 Bacteria 848730
382 Ga0207426_1000010 3300025302 Bacteria 796003
383 Ga0207426_1000039 3300025302 Bacteria 439937
384 Ga0207426_1000074 3300025302 Bacteria 323399
385 Ga0207426_1000169 3300025302 Bacteria 164859
386 Ga0207426_1000952 3300025302 Bacteria 28571
387 Ga0209051_1000038 3300025303 Bacteria 320926
388 Ga0209051_1000611 3300025303 Bacteria 41422
389 Ga0209051_1001518 3300025303 Bacteria 19346
390 Ga0209051_1001923 3300025303 Bacteria 16078
391 Ga0209051_1002092 3300025303 Bacteria 15051
392 Ga0209051_1003836 3300025303 Bacteria 9627
393 Ga0209051_1006153 3300025303 Bacteria 6818
394 Ga0209051_1009112 3300025303 Bacteria 5153
395 Ga0209051_1014336 3300025303 Bacteria 3705
396 Ga0209051_1043796 3300025303 Bacteria 1566
397 Ga0209257_1000016 3300025304 Bacteria 908015
398 Ga0209257_1000374 3300025304 Bacteria 89683
399 Ga0209257_1000754 3300025304 Bacteria 48903
400 Ga0209257_1002801 3300025304 Bacteria 16394
401 Ga0209257_1008291 3300025304 Bacteria 5959
402 Ga0209257_1016092 3300025304 Bacteria 3052
403 Ga0207647_10019050 3300025904 Bacteria 4623
404 Ga0207705_10120866 3300025909 Bacteria 1943
405 Ga0207654_10151691 3300025911 Bacteria 1488
406 Ga0207695_10000011 3300025913 Bacteria 910221
407 Ga0207695_10000187 3300025913 Bacteria 179183
408 Ga0207695_10000896 3300025913 Bacteria 53929
409 Ga0207695_10018896 3300025913 Bacteria 7952
410 Ga0207695_10025218 3300025913 Bacteria 6662
411 Ga0207671_10000804 3300025914 Bacteria 39792
412 Ga0207671_10225888 3300025914 Bacteria 1468
413 Ga0207657_10022693 3300025919 Bacteria 5864
414 Ga0207657_10023146 3300025919 Bacteria 5791
415 Ga0207694_10013088 3300025924 Bacteria 6247
416 Ga0207694_10312208 3300025924 Bacteria 1296
417 Ga0207650_10019498 3300025925 Bacteria 4767
418 Ga0207690_10015171 3300025932 Bacteria 4665
419 Ga0207706_10075440 3300025933 Bacteria 2965
420 Ga0207709_10000837 3300025935 Bacteria 23596
421 Ga0207709_10278389 3300025935 Bacteria 1235
422 Ga0207669_10109811 3300025937 Bacteria 1845
423 Ga0207691_10153254 3300025940 Bacteria 2026
424 Ga0207667_10001159 3300025949 Bacteria 33115
425 Ga0207667_10053075 3300025949 Bacteria 4266
426 Ga0207667_10220750 3300025949 Bacteria 1942
427 Ga0207651_10039642 3300025960 Bacteria 3108
428 Ga0207651_10087834 3300025960 Bacteria 2264
429 Ga0207712_10052157 3300025961 Bacteria 2864
430 Ga0207668_10023946 3300025972 Bacteria 3934
431 Ga0207658_10334230 3300025986 Bacteria 1315
432 Ga0207639_10001242 3300026041 Bacteria 17273
433 Ga0207702_10031676 3300026078 Bacteria 4408
434 Ga0207702_10154732 3300026078 Bacteria 2089
435 Ga0207702_10235573 3300026078 Bacteria 1713
436 Ga0207648_10000056 3300026089 Bacteria 105754
437 Ga0207674_10019036 3300026116 Bacteria 7440
438 Ga0207674_10180265 3300026116 Bacteria 2064
439 Ga0207674_10201653 3300026116 Bacteria 1939
440 Ga0207675_100087934 3300026118 Bacteria 2919
441 Ga0207683_10033176 3300026121 Bacteria 4484
442 Ga0207683_10040887 3300026121 Bacteria 4048
443 Ga0207683_10200458 3300026121 Bacteria 1814
444 Ga0207698_10004513 3300026142 Bacteria 8490
445 Ga0207698_10005686 3300026142 Bacteria 7721
446 Ga0209281_1000036 3300027111 Bacteria 369415
447 Ga0209281_1000047 3300027111 Bacteria 326514
448 Ga0209281_1000221 3300027111 Bacteria 122380
449 Ga0209281_1000453 3300027111 Bacteria 58584
450 Ga0209371_1000012 3300027312 Bacteria 748304
451 Ga0209371_1001480 3300027312 Bacteria 15680
452 Ga0209371_1002509 3300027312 Bacteria 10168
453 Ga0209282_1000041 3300027666 Bacteria 122268
454 Ga0209282_1000140 3300027666 Bacteria 42807
455 Ga0268266_10050551 3300028379 Bacteria 3567
456 Ga0268266_10257478 3300028379 Bacteria 1616
457 Ga0268266_10365101 3300028379 Bacteria 1359
458 Ga0307515_10000023 3300028794 Bacteria 400846
459 Ga0307515_10002518 3300028794 Bacteria 39631
460 Ga0307515_10003222 3300028794 Bacteria 34542
461 Ga0307515_10006028 3300028794 Bacteria 24397
462 Ga0307515_10009985 3300028794 Bacteria 18277
463 Ga0307515_10260162 3300028794 Bacteria 1473
464 Ga0268256_1000013 3300030500 Bacteria 752103
465 Ga0268256_1002184 3300030500 Bacteria 10341
466 Ga0268256_1016541 3300030500 Bacteria 2110
467 Ga0307513_10003030 3300031456 Bacteria 22903
468 Ga0307513_10039598 3300031456 Bacteria 5223
469 Ga0307513_10186482 3300031456 Bacteria 1931
470 Ga0307408_100000073 3300031548 Bacteria 113106
471 Ga0307408_100004349 3300031548 Bacteria 9623
472 Ga0307408_100007688 3300031548 Bacteria 7130
473 Ga0307408_100080151 3300031548 Bacteria 2438
474 Ga0265314_10004985 3300031711 Bacteria 12103
475 Ga0307516_10000054 3300031730 Bacteria 126288
476 Ga0307405_10000781 3300031731 Bacteria 12489
477 Ga0307518_10061152 3300031838 Bacteria 2735
478 Ga0307406_10002228 3300031901 Bacteria 10545
479 Ga0307412_10001925 3300031911 Bacteria 11473
480 Ga0307412_10164466 3300031911 Bacteria 1653
481 Ga0315914_1000030 3300031967 Bacteria 102599
482 Ga0315913_1000017 3300033430 Bacteria 102835
483 Ga0315915_1000017 3300033464 Bacteria 148111
484 Ga0373939_0000153 3300035114 Bacteria 19455
485 Ga0373960_0000457 3300035121 Bacteria 8036
486 Ga0373962_0006116 3300035242 Bacteria 2910
487 Ga0373931_0008510 3300035691 Bacteria 4870
488 Ga0373927_0000178 3300035695 Bacteria 50343
489 Ga0373927_0000901 3300035695 Bacteria 22607
490 Ga0373925_0006563 3300037068 Bacteria 8549
491 Ga0373925_0056684 3300037068 Bacteria 2935
492 Ga0373925_0094537 3300037068 Bacteria 2289
493 Ga0395905_0001894 3300037471 Bacteria 24129
494 Ga0395905_0005481 3300037471 Bacteria 12945
495 Ga0395905_0028189 3300037471 Bacteria 5293
496 Ga0395905_0107203 3300037471 Bacteria 2623
497 Ga0395905_0297136 3300037471 Bacteria 1502
498 Ga0436365_0180687 3300039437 Bacteria 2583
499 Ga0436361_0138725 3300039447 Bacteria 20138
500 Ga0439465_0004233 3300041413 Bacteria 4668
501 Ga0439465_0018497 3300041413 Bacteria 2177
502 Ga0451845_0228987 3300041501 Bacteria 3244
503 Ga0451847_0438550 3300041503 Bacteria 3460
504 Ga0451851_0738755 3300041507 Bacteria 2035
505 Ga0451843_0770350 3300041509 Bacteria 2137
506 Ga0450906_001575 3300042145 Bacteria 4987
507 Ga0466969_0038328 3300044656 Bacteria 2412
508 Ga0466972_0007846 3300044658 Bacteria 5354
509 Ga0466965_0012110 3300044683 Bacteria 4050
510 Ga0466966_0004314 3300044684 Bacteria 9375
511 Ga0466971_0014186 3300044719 Bacteria 3503
512 Ga0466970_0013908 3300044765 Bacteria 4128
513 Ga0466960_0005504 3300044901 Bacteria 5021
514 Ga0466960_0120626 3300044901 Bacteria 1373
515 Ga0466959_0014245 3300045049 Bacteria 5771
516 Ga0451576_0000458 3300045051 Bacteria 92512
517 Ga0451576_0090694 3300045051 Bacteria 3179
518 Ga0466958_0078529 3300045836 Bacteria 2028
519 Ga0466967_0014709 3300045976 Bacteria 6110
520 Ga0466967_0284014 3300045976 Bacteria 1588
521 Ga0495592_0019928 3300046454 Bacteria 5099
522 Ga0495638_0036154 3300046460 Bacteria 3147
523 Ga0495651_0139896 3300046462 Bacteria 1756
524 Ga0495653_0040623 3300046463 Bacteria 3634
525 Ga0495653_0090528 3300046463 Bacteria 2238
526 Ga0495650_0000164 3300046471 Bacteria 147142
527 Ga0495664_0031014 3300046477 Bacteria 3133
528 Ga0495607_0007410 3300046501 Bacteria 7596
529 Ga0495607_0015078 3300046501 Bacteria 5019
530 Ga0495583_0000149 3300046506 Bacteria 117980
531 Ga0495583_0006184 3300046506 Bacteria 7884
532 Ga0495583_0055938 3300046506 Bacteria 1781
533 Ga0495606_0003738 3300046507 Bacteria 15855
534 Ga0495606_0010808 3300046507 Bacteria 7521
535 Ga0495606_0059647 3300046507 Bacteria 2447
536 Ga0495608_0011037 3300046511 Bacteria 6295
537 Ga0495610_0014249 3300046512 Bacteria 4681
538 Ga0495616_0049339 3300046513 Bacteria 2110
539 Ga0495628_0030682 3300046516 Bacteria 4351
540 Ga0495628_0031074 3300046516 Bacteria 4320
541 Ga0495631_0019547 3300046518 Bacteria 3175
542 Ga0495632_0000437 3300046519 Bacteria 39744
543 Ga0495643_0009837 3300046522 Bacteria 5914
544 Ga0495643_0014652 3300046522 Bacteria 4659
545 Ga0495643_0014700 3300046522 Bacteria 4650
546 Ga0495643_0082291 3300046522 Bacteria 1673
547 Ga0495648_0037761 3300046524 Bacteria 3099
548 Ga0495648_0065467 3300046524 Bacteria 2136
549 Ga0495648_0068399 3300046524 Bacteria 2072
550 Ga0495648_0092803 3300046524 Bacteria 1685
551 Ga0495652_0047551 3300046529 Bacteria 3678
552 Ga0495654_0000090 3300046530 Bacteria 101947
553 Ga0495609_0000702 3300046538 Bacteria 25786
554 Ga0495645_0056911 3300046543 Bacteria 2839
555 Ga0495622_0000007 3300046557 Bacteria 239352
556 Ga0495668_0000120 3300046616 Bacteria 117076
557 Ga0495668_0015280 3300046616 Bacteria 4487
558 Ga0495668_0026014 3300046616 Bacteria 3322
559 Ga0495625_0008400 3300046660 Bacteria 8816
560 Ga0495625_0009512 3300046660 Bacteria 8120
561 Ga0495625_0015491 3300046660 Bacteria 6036
562 Ga0495625_0177101 3300046660 Bacteria 1420
563 Ga0495659_0011022 3300046664 Bacteria 2911
564 Ga0495661_0009736 3300046665 Bacteria 6580
565 Ga0495661_0018520 3300046665 Bacteria 4578
566 Ga0495599_0028288 3300046678 Bacteria 3513
567 Ga0495623_0024443 3300046679 Bacteria 3893
568 Ga0495646_0020472 3300046680 Bacteria 4186
569 Ga0495624_0013513 3300046690 Bacteria 5566
570 Ga0495671_0023593 3300046692 Bacteria 3213
571 Ga0495649_0001781 3300046694 Bacteria 15872
572 Ga0495649_0011843 3300046694 Bacteria 5099
573 Ga0495649_0012264 3300046694 Bacteria 4996
574 Ga0495649_0056063 3300046694 Bacteria 2128
575 Ga0495589_0004600 3300046794 Bacteria 7335
576 Ga0495589_0022214 3300046794 Bacteria 3239
577 Ga0495660_0118768 3300046810 Bacteria 1340
578 Ga0495636_0006498 3300047318 Bacteria 4595
579 Ga0495636_0054285 3300047318 Bacteria 1683
580 Ga0495674_0011979 3300047319 Bacteria 8179
581 Ga0495672_0009839 3300047320 Bacteria 6879
582 Ga0495683_0029612 3300047323 Bacteria 2797
583 Ga0495687_036988 3300047443 Bacteria 2178
584 Ga0495687_038276 3300047443 Bacteria 2129
585 Ga0495675_0106832 3300047444 Bacteria 1749
586 Ga0495677_0021831 3300047445 Bacteria 2319
587 Ga0495679_009622 3300047446 Bacteria 3854
588 Ga0495681_0000886 3300047470 Bacteria 23149
589 Ga0495681_0023123 3300047470 Bacteria 3308
590 Ga0495686_0000075 3300047472 Bacteria 208031
591 Ga0495686_0000761 3300047472 Bacteria 42521
592 Ga0495686_0007146 3300047472 Bacteria 8409
593 Ga0495686_0054609 3300047472 Bacteria 2500
594 Ga0495602_0051271 3300048088 Bacteria 3676
595 Ga0495626_0071394 3300048091 Bacteria 1560
596 Ga0496100_0026713 3300048903 Bacteria 3542
597 Ga0496101_0210762 3300048904 Bacteria 1505
598 Ga0496102_0001123 3300048905 Bacteria 24545
599 Ga0496103_0027059 3300048906 Bacteria 3473
600 Ga0496104_0025058 3300048907 Bacteria 5496
601 Ga0496104_0239495 3300048907 Bacteria 1727
602 Ga0496105_0074327 3300048908 Bacteria 2807
603 Ga0496106_0002281 3300048909 Bacteria 14306
604 Ga0496106_0042115 3300048909 Bacteria 3424
605 Ga0496110_0155350 3300048913 Bacteria 2072
606 Ga0496114_0339672 3300048917 Bacteria 1328
607 Ga0496116_0000061 3300048919 Bacteria 271860
608 Ga0496116_0001006 3300048919 Bacteria 34404
609 Ga0496116_0001215 3300048919 Bacteria 30045
610 Ga0496116_0029164 3300048919 Bacteria 3983
611 Ga0496116_0032795 3300048919 Bacteria 3696
612 Ga0496116_0050408 3300048919 Bacteria 2773
613 Ga0496116_0153995 3300048919 Bacteria 1272
614 Ga0496117_0000016 3300048920 Bacteria 523642
615 Ga0496117_0013295 3300048920 Bacteria 7190
616 Ga0496117_0021541 3300048920 Bacteria 5209
617 Ga0496117_0030058 3300048920 Bacteria 4176
618 Ga0496117_0037531 3300048920 Bacteria 3608
619 Ga0496117_0062035 3300048920 Bacteria 2565
620 Ga0496118_0000535 3300048921 Bacteria 62444
621 Ga0496118_0009427 3300048921 Bacteria 9859
622 Ga0496118_0016390 3300048921 Bacteria 6801
623 Ga0496118_0035617 3300048921 Bacteria 4038
624 Ga0496118_0036469 3300048921 Bacteria 3975
625 Ga0496118_0070679 3300048921 Bacteria 2518
626 Ga0496119_0020432 3300048922 Bacteria 4834
627 Ga0496119_0041239 3300048922 Bacteria 2942
628 Ga0496119_0103711 3300048922 Bacteria 1592
629 Ga0496120_0000056 3300048923 Bacteria 180367
630 Ga0496120_0007056 3300048923 Bacteria 8438
631 Ga0496120_0013734 3300048923 Bacteria 5437
632 Ga0496120_0105648 3300048923 Bacteria 1480
633 Ga0496121_0000001 3300048924 Bacteria 1830318
634 Ga0496121_0003418 3300048924 Bacteria 22706
635 Ga0496121_0027413 3300048924 Bacteria 5332
636 Ga0496121_0081200 3300048924 Bacteria 2567
637 Ga0496121_0140361 3300048924 Bacteria 1794
638 Ga0496121_0188433 3300048924 Bacteria 1481
639 Ga0496121_0234919 3300048924 Bacteria 1281
640 Ga0496122_0000002 3300048925 Bacteria 905834
641 Ga0496122_0000134 3300048925 Bacteria 171080
642 Ga0496122_0000369 3300048925 Bacteria 96672
643 Ga0496122_0000525 3300048925 Bacteria 79294
644 Ga0496122_0005737 3300048925 Bacteria 14635
645 Ga0496122_0007566 3300048925 Bacteria 12019
646 Ga0496122_0019117 3300048925 Bacteria 6281
647 Ga0496122_0047006 3300048925 Bacteria 3336
648 Ga0496122_0051416 3300048925 Bacteria 3131
649 Ga0496122_0078295 3300048925 Bacteria 2316
650 Ga0496122_0120205 3300048925 Bacteria 1696
651 Ga0496122_0164190 3300048925 Bacteria 1349
652 Ga0496122_0168385 3300048925 Bacteria 1324
653 Ga0496123_0000002 3300048926 Bacteria 1811682
654 Ga0496123_0000054 3300048926 Bacteria 234046
655 Ga0496123_0000448 3300048926 Bacteria 73842
656 Ga0496123_0000583 3300048926 Bacteria 62248
657 Ga0496123_0010860 3300048926 Bacteria 7979
658 Ga0496123_0020950 3300048926 Bacteria 5096
659 Ga0496123_0024387 3300048926 Bacteria 4599
660 Ga0496123_0045151 3300048926 Bacteria 3005
661 Ga0496123_0095536 3300048926 Bacteria 1748
662 Ga0496123_0144340 3300048926 Bacteria 1295
663 Ga0496124_0000091 3300048927 Bacteria 189706
664 Ga0496124_0002111 3300048927 Bacteria 26799
665 Ga0496124_0002629 3300048927 Bacteria 23098
666 Ga0496124_0010219 3300048927 Bacteria 9534
667 Ga0496124_0011049 3300048927 Bacteria 9063
668 Ga0496124_0017189 3300048927 Bacteria 6830
669 Ga0496124_0044094 3300048927 Bacteria 3829
670 Ga0496124_0047345 3300048927 Bacteria 3679
671 Ga0496124_0060217 3300048927 Bacteria 3186
672 Ga0496124_0070083 3300048927 Bacteria 2909
673 Ga0496124_0076338 3300048927 Bacteria 2766
674 Ga0496124_0115561 3300048927 Bacteria 2153
675 Ga0496124_0170929 3300048927 Bacteria 1683
676 Ga0496124_0190179 3300048927 Bacteria 1572
677 Ga0496125_0000001 3300048928 Bacteria 1766138
678 Ga0496125_0000301 3300048928 Bacteria 96860
679 Ga0496125_0002081 3300048928 Bacteria 26974
680 Ga0496125_0003110 3300048928 Bacteria 20659
681 Ga0496125_0017725 3300048928 Bacteria 6779
682 Ga0496125_0022917 3300048928 Bacteria 5785
683 Ga0496125_0038324 3300048928 Bacteria 4150
684 Ga0496125_0059355 3300048928 Bacteria 3083
685 Ga0496125_0105914 3300048928 Bacteria 2054
686 Ga0496126_0001019 3300048929 Bacteria 47578
687 Ga0496126_0060207 3300048929 Bacteria 3416
688 Ga0496126_0060387 3300048929 Bacteria 3409
689 Ga0496126_0086418 3300048929 Bacteria 2764
690 Ga0496126_0278018 3300048929 Bacteria 1387
691 Ga0501032_0000018 3300049569 Bacteria 156275
692 Ga0501033_0000032 3300049570 Bacteria 156304
693 Ga0501033_0000167 3300049570 Bacteria 63051
694 Ga0501033_0082804 3300049570 Bacteria 2352
695 Ga0501034_0000103 3300049571 Bacteria 156304
696 Ga0501034_0001091 3300049571 Bacteria 38199
697 Ga0501034_0025599 3300049571 Bacteria 6008
698 Ga0501034_0119079 3300049571 Bacteria 2627
699 Ga0501034_0181332 3300049571 Bacteria 2070
700 Ga0501036_0000012 3300049572 Bacteria 156304
701 Ga0501036_0051169 3300049572 Bacteria 3497
702 Ga0501037_0000018 3300049573 Bacteria 156304
703 Ga0501038_0000017 3300049574 Bacteria 156304
704 Ga0501039_0000024 3300049575 Bacteria 156304
705 Ga0501040_0018285 3300049576 Bacteria 4652
706 Ga0501043_0000272 3300049579 Bacteria 46577
707 Ga0501043_0059396 3300049579 Bacteria 3001
708 Ga0501043_0079780 3300049579 Bacteria 2571
709 Ga0501046_0112918 3300049580 Bacteria 2074
710 Ga0501070_0061899 3300049586 Bacteria 3100
711 Ga0501074_0042463 3300049590 Bacteria 3291
712 Ga0501083_0063042 3300049744 Bacteria 2472
713 Ga0501279_000642 3300049775 Bacteria 4599
714 Ga0501035_0000040 3300049822 Bacteria 156262
715 Ga0501035_0021712 3300049822 Bacteria 5902
716 Ga0501035_0135179 3300049822 Bacteria 2147
717 Ga0501035_0156005 3300049822 Bacteria 1978
718 Ga0501035_0245029 3300049822 Bacteria 1523
719 Ga0501044_0000040 3300049823 Bacteria 156304
720 Ga0501044_0023564 3300049823 Bacteria 6547
721 Ga0501044_0076816 3300049823 Bacteria 3388
722 Ga0501044_0209219 3300049823 Bacteria 1905
723 Ga0501044_0280358 3300049823 Bacteria 1600
724 nmdc:mga03683_14071_c1 3300050489 Bacteria 2955
725 nmdc:mga03683_19297_c1 3300050489 Bacteria 2602
726 nmdc:mga03683_561_c1 3300050489 Bacteria 10695
727 nmdc:mga03683_86755_c1 3300050489 Bacteria 1359
728 nmdc:mga03n38_57677_c1 3300050490 Bacteria 1756
729 nmdc:mga00v17_123846_c1 3300050491 Bacteria 1648
730 nmdc:mga00v17_156_c1 3300050491 Bacteria 40197
731 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
732 nmdc:mga00v17_8320_c1 3300050491 Bacteria 5581
733 nmdc:mga00v17_92984_c1 3300050491 Bacteria 1896
734 nmdc:mga0yw44_17652_c1 3300050492 Bacteria 3889
735 nmdc:mga0yw44_23854_c1 3300050492 Bacteria 3453
736 nmdc:mga0yw44_3491_c1 3300050492 Bacteria 6991
737 nmdc:mga0yw44_54034_c1 3300050492 Bacteria 2440
738 nmdc:mga0k408_23153_c1 3300050493 Bacteria 3502
739 nmdc:mga06z11_69829_c1 3300050494 Bacteria 1856
740 nmdc:mga06z11_82305_c1 3300050494 Bacteria 1730
741 nmdc:mga07m45_1178_c1 3300050496 Bacteria 8827
742 nmdc:mga07m45_18207_c1 3300050496 Bacteria 3787
743 nmdc:mga07m45_53332_c1 3300050496 Bacteria 2284
744 nmdc:mga0sz30_14730_c1 3300050516 Bacteria 3083
745 nmdc:mga0sz30_2395_c1 3300050516 Bacteria 6693
746 nmdc:mga0sz30_3289_c1 3300050516 Bacteria 5811
747 nmdc:mga0sz30_3391_c1 3300050516 Bacteria 5733
748 Ga0500610_0002302 3300053079 Bacteria 6970
749 Ga0500560_012707 3300053107 Bacteria 2192
750 Ga0500658_0003533 3300053134 Bacteria 5899
751 Ga0500658_0008064 3300053134 Bacteria 3894
752 Ga0500559_0007674 3300053136 Bacteria 4763
753 Ga0500559_0027693 3300053136 Bacteria 2419
754 Ga0500561_0000065 3300053137 Bacteria 21109
755 Ga0500568_0005892 3300053139 Bacteria 6239
756 Ga0500573_0000259 3300053140 Bacteria 22228
757 Ga0500604_0000146 3300053151 Bacteria 21141
758 Ga0500604_0013437 3300053151 Bacteria 2219
759 Ga0500616_0000187 3300053153 Bacteria 101361
760 Ga0500616_0001178 3300053153 Bacteria 26604
761 Ga0500620_002918 3300053155 Bacteria 3560
762 Ga0500622_0001526 3300053156 Bacteria 18358
763 Ga0500622_0001869 3300053156 Bacteria 15912
764 Ga0500622_0002179 3300053156 Bacteria 14491
765 Ga0500624_000733 3300053157 Bacteria 8098
766 Ga0500634_0000001 3300053161 Bacteria 258285
767 Ga0500634_0000004 3300053161 Bacteria 214946
768 Ga0500634_0062281 3300053161 Bacteria 1976
769 Ga0500636_0000034 3300053177 Bacteria 72555
770 Ga0500636_0010356 3300053177 Bacteria 5438
771 Ga0500636_0029235 3300053177 Bacteria 3255
772 Ga0587067_010921 3300059640 Bacteria 1388
773 Ga0587072_000304 3300059643 Bacteria 4621
774 Ga0466962_0030986 3300061719 Bacteria 2560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0031014 Ga0495664_0031014_2240_3115 280
2 3300003792 Ga0055540_1013827 Ga0055540_10138273 314
3 3300005364 Ga0070673_100095480 Ga0070673_1000954803 318
4 3300025960 Ga0207651_10087834 Ga0207651_100878342 318
5 3300045976 Ga0466967_0284014 Ga0466967_0284014_319_1332 323
6 3300061719 Ga0466962_0030986 Ga0466962_0030986_1515_2528 323
7 3300048907 Ga0496104_0025058 Ga0496104_0025058_425_1465 325
8 3300002705 JGI25156J39149_1018978 JGI25156J39149_10189781 329
9 3300003761 Ga0055535_1000097 Ga0055535_100009775 329
10 3300005327 Ga0070658_10129710 Ga0070658_101297101 329
11 3300005339 Ga0070660_100052493 Ga0070660_1000524933 329
12 3300005539 Ga0068853_100469125 Ga0068853_1004691251 329
13 3300005563 Ga0068855_100338483 Ga0068855_1003384831 329
14 3300013296 Ga0157374_10191683 Ga0157374_101916832 329
15 3300013306 Ga0163162_10297053 Ga0163162_102970532 329
16 3300025256 Ga0209759_1000726 Ga0209759_100072621 329
17 3300025919 Ga0207657_10022693 Ga0207657_100226932 329
18 3300025932 Ga0207690_10015171 Ga0207690_100151712 329
19 3300025949 Ga0207667_10220750 Ga0207667_102207502 329
20 3300046506 Ga0495583_0000149 Ga0495583_0000149_109125_110153 329
21 3300046507 Ga0495606_0010808 Ga0495606_0010808_181_1209 329
22 3300046616 Ga0495668_0015280 Ga0495668_0015280_2355_3383 329
23 3300046694 Ga0495649_0001781 Ga0495649_0001781_315_1343 329
24 3300046794 Ga0495589_0004600 Ga0495589_0004600_3748_4776 329
25 3300047472 Ga0495686_0054609 Ga0495686_0054609_598_1626 329
26 3300048917 Ga0496114_0339672 Ga0496114_0339672_72_1100 329
27 3300053177 Ga0500636_0010356 Ga0500636_0010356_2866_3894 329
28 3300025253 Ga0209677_101049 Ga0209677_1010492 330
29 3300025303 Ga0209051_1006153 Ga0209051_10061531 330
30 3300005327 Ga0070658_10169371 Ga0070658_101693712 331
31 3300048929 Ga0496126_0001019 Ga0496126_0001019_19313_20401 333
32 iso_pu_bacteria 2906393657 2906396695 333
33 3300005327 Ga0070658_10320503 Ga0070658_103205032 334
34 3300005563 Ga0068855_100028783 Ga0068855_1000287838 334
35 3300006353 Ga0075370_10075308 Ga0075370_100753082 334
36 3300013308 Ga0157375_10072507 Ga0157375_100725073 334
37 3300025256 Ga0209759_1010461 Ga0209759_10104613 334
38 3300025909 Ga0207705_10120866 Ga0207705_101208662 334
39 3300025949 Ga0207667_10001159 Ga0207667_1000115928 334
40 3300026116 Ga0207674_10201653 Ga0207674_102016532 334
41 3300047318 Ga0495636_0006498 Ga0495636_0006498_3026_4069 334
42 3300048905 Ga0496102_0001123 Ga0496102_0001123_3323_4366 334
43 3300048906 Ga0496103_0027059 Ga0496103_0027059_2004_3047 334
44 3300050496 nmdc:mga07m45_1178_c1 nmdc:mga07m45_1178_c1_7232_8278 334
45 3300044656 Ga0466969_0038328 Ga0466969_0038328_421_1470 335
46 3300044683 Ga0466965_0012110 Ga0466965_0012110_1892_2941 335
47 3300044684 Ga0466966_0004314 Ga0466966_0004314_5186_6235 335
48 3300044719 Ga0466971_0014186 Ga0466971_0014186_1504_2553 335
49 3300044765 Ga0466970_0013908 Ga0466970_0013908_827_1876 335
50 3300045049 Ga0466959_0014245 Ga0466959_0014245_4548_5597 335
51 3300045836 Ga0466958_0078529 Ga0466958_0078529_382_1431 335
52 3300045976 Ga0466967_0014709 Ga0466967_0014709_2911_3960 335
53 3300046524 Ga0495648_0065467 Ga0495648_0065467_232_1278 335
54 3300039437 Ga0436365_0180687 Ga0436365_0180687_264_1343 337
55 3300053153 Ga0500616_0000187 Ga0500616_0000187_60940_62088 337
56 3300050496 nmdc:mga07m45_53332_c1 nmdc:mga07m45_53332_c1_1066_2112 338
57 3300046524 Ga0495648_0092803 Ga0495648_0092803_528_1589 339
58 iso_pu_bacteria 2906386501 2906392027 339
59 3300003794 Ga0055531_10000031 Ga0055531_10000031113 340
60 3300025298 Ga0209050_1003397 Ga0209050_10033974 340
61 3300025303 Ga0209051_1009112 Ga0209051_10091123 340
62 3300025304 Ga0209257_1000016 Ga0209257_1000016584 340
63 3300031548 Ga0307408_100000073 Ga0307408_10000007334 340
64 3300035114 Ga0373939_0000153 Ga0373939_0000153_15988_17040 340
65 3300035121 Ga0373960_0000457 Ga0373960_0000457_6880_7932 340
66 3300035242 Ga0373962_0006116 Ga0373962_0006116_1656_2708 340
67 3300035691 Ga0373931_0008510 Ga0373931_0008510_473_1525 340
68 3300053140 Ga0500573_0000259 Ga0500573_0000259_4604_5698 340
69 iso_pu_bacteria 2979793036 2979797042 340
70 3300026078 Ga0207702_10235573 Ga0207702_102355732 341
71 3300037471 Ga0395905_0001894 Ga0395905_0001894_812_1867 341
72 3300059640 Ga0587067_010921 Ga0587067_010921_13_1047 341
73 3300005616 Ga0068852_100001988 Ga0068852_1000019884 342
74 3300026142 Ga0207698_10004513 Ga0207698_100045137 342
75 3300053161 Ga0500634_0000001 Ga0500634_0000001_125923_126963 343
76 iso_pu_bacteria 2738541317 2738946066 343
77 3300005459 Ga0068867_100000050 Ga0068867_10000005021 344
78 3300006177 Ga0075362_10006857 Ga0075362_100068573 344
79 3300009148 Ga0105243_10001055 Ga0105243_100010559 344
80 3300025935 Ga0207709_10000837 Ga0207709_100008375 344
81 3300026089 Ga0207648_10000056 Ga0207648_1000005620 344
82 3300028794 Ga0307515_10006028 Ga0307515_1000602818 344
83 3300031730 Ga0307516_10000054 Ga0307516_1000005485 344
84 iso_pu_bacteria 2643221554 2643790419 344
85 iso_pu_bacteria 2643221638 2644215626 344
86 3300046460 Ga0495638_0036154 Ga0495638_0036154_138_1232 345
87 3300046501 Ga0495607_0007410 Ga0495607_0007410_4548_5642 345
88 3300046506 Ga0495583_0055938 Ga0495583_0055938_412_1506 345
89 3300046513 Ga0495616_0049339 Ga0495616_0049339_634_1728 345
90 3300046522 Ga0495643_0082291 Ga0495643_0082291_336_1430 345
91 3300046538 Ga0495609_0000702 Ga0495609_0000702_7153_8247 345
92 3300046616 Ga0495668_0000120 Ga0495668_0000120_106066_107109 345
93 3300046616 Ga0495668_0026014 Ga0495668_0026014_728_1822 345
94 3300046660 Ga0495625_0008400 Ga0495625_0008400_2964_4058 345
95 3300046664 Ga0495659_0011022 Ga0495659_0011022_504_1598 345
96 3300046665 Ga0495661_0018520 Ga0495661_0018520_2328_3422 345
97 3300046694 Ga0495649_0056063 Ga0495649_0056063_531_1625 345
98 3300047318 Ga0495636_0054285 Ga0495636_0054285_86_1180 345
99 3300047443 Ga0495687_038276 Ga0495687_038276_532_1626 345
100 3300047445 Ga0495677_0021831 Ga0495677_0021831_468_1562 345
101 3300047446 Ga0495679_009622 Ga0495679_009622_1819_2913 345
102 3300047470 Ga0495681_0023123 Ga0495681_0023123_2129_3223 345
103 3300047472 Ga0495686_0007146 Ga0495686_0007146_2693_3736 345
104 iso_pu_bacteria 2548876994 2550694086 345
105 iso_pu_bacteria 2818991445 2819591861 345
106 iso_pu_bacteria 2884811622 2884816792 345
107 iso_pu_bacteria 2884836552 2884837674 345
108 iso_pu_bacteria 2884852848 2884853966 345
109 iso_pu_bacteria 2896154374 2896154917 345
110 3300005331 Ga0070670_100028159 Ga0070670_1000281594 346
111 3300005354 Ga0070675_100052867 Ga0070675_1000528673 346
112 3300005844 Ga0068862_100306412 Ga0068862_1003064121 346
113 3300013308 Ga0157375_10018133 Ga0157375_100181332 346
114 3300025925 Ga0207650_10019498 Ga0207650_100194984 346
115 3300025933 Ga0207706_10075440 Ga0207706_100754402 346
116 3300025960 Ga0207651_10039642 Ga0207651_100396423 346
117 3300025986 Ga0207658_10334230 Ga0207658_103342302 346
118 3300026118 Ga0207675_100087934 Ga0207675_1000879344 346
119 3300046516 Ga0495628_0031074 Ga0495628_0031074_2538_3623 346
120 3300046794 Ga0495589_0022214 Ga0495589_0022214_1738_2835 346
121 3300047319 Ga0495674_0011979 Ga0495674_0011979_6069_7154 346
122 3300047320 Ga0495672_0009839 Ga0495672_0009839_1828_2901 346
123 3300047472 Ga0495686_0000075 Ga0495686_0000075_173984_175081 346
124 3300048913 Ga0496110_0155350 Ga0496110_0155350_11_1063 346
125 iso_pu_bacteria 2511231003 2511251781 346
126 iso_pu_bacteria 2818991436 2819541357 346
127 3300005340 Ga0070689_100157762 Ga0070689_1001577622 347
128 3300005353 Ga0070669_100058561 Ga0070669_1000585613 347
129 3300005365 Ga0070688_100162465 Ga0070688_1001624651 347
130 3300005456 Ga0070678_100167542 Ga0070678_1001675422 347
131 3300005617 Ga0068859_100175330 Ga0068859_1001753302 347
132 3300006931 Ga0097620_100175332 Ga0097620_1001753322 347
133 3300009176 Ga0105242_10104647 Ga0105242_101046472 347
134 3300013297 Ga0157378_10064584 Ga0157378_100645843 347
135 3300013308 Ga0157375_10355709 Ga0157375_103557092 347
136 3300026121 Ga0207683_10033176 Ga0207683_100331764 347
137 3300049775 Ga0501279_000642 Ga0501279_000642_1524_2618 347
138 3300002739 JGI25158J39367_1000586 JGI25158J39367_10005862 348
139 3300002774 JGI25150J39212_1003583 JGI25150J39212_10035832 348
140 3300003374 JGI25161J50226_1000903 JGI25161J50226_10009037 348
141 3300003771 Ga0055526_1003126 Ga0055526_10031265 348
142 3300003773 Ga0055537_1001818 Ga0055537_10018184 348
143 3300003775 Ga0055524_1008933 Ga0055524_10089333 348
144 3300003784 Ga0055534_1001505 Ga0055534_10015053 348
145 3300003790 Ga0055528_1009510 Ga0055528_10095102 348
146 3300003791 Ga0055530_10001749 Ga0055530_100017498 348
147 3300003791 Ga0055530_10003711 Ga0055530_100037113 348
148 3300003794 Ga0055531_10002784 Ga0055531_100027848 348
149 3300006038 Ga0075365_10021098 Ga0075365_100210983 348
150 3300014968 Ga0157379_10050986 Ga0157379_100509864 348
151 3300025208 Ga0209436_100181 Ga0209436_1001817 348
152 3300025245 Ga0207425_1000486 Ga0207425_10004868 348
153 3300025258 Ga0209129_1005225 Ga0209129_10052254 348
154 3300025263 Ga0209565_1000476 Ga0209565_10004767 348
155 3300025284 Ga0209130_1000607 Ga0209130_100060723 348
156 3300025295 Ga0209564_1001811 Ga0209564_10018118 348
157 3300025298 Ga0209050_1000152 Ga0209050_10001528 348
158 3300025298 Ga0209050_1002301 Ga0209050_10023014 348
159 3300025303 Ga0209051_1014336 Ga0209051_10143363 348
160 3300025304 Ga0209257_1000374 Ga0209257_10003748 348
161 3300025304 Ga0209257_1008291 Ga0209257_10082912 348
162 3300026121 Ga0207683_10200458 Ga0207683_102004582 348
163 3300031548 Ga0307408_100004349 Ga0307408_1000043498 348
164 3300031548 Ga0307408_100007688 Ga0307408_1000076884 348
165 3300046660 Ga0495625_0177101 Ga0495625_0177101_296_1396 348
166 3300050489 nmdc:mga03683_561_c1 nmdc:mga03683_561_c1_2743_3882 348
167 3300053079 Ga0500610_0002302 Ga0500610_0002302_1675_2769 348
168 3300053136 Ga0500559_0027693 Ga0500559_0027693_554_1639 348
169 3300002704 JGI25155J39150_1000076 JGI25155J39150_100007643 349
170 3300002704 JGI25155J39150_1000246 JGI25155J39150_100024612 349
171 3300002705 JGI25156J39149_1000032 JGI25156J39149_100003233 349
172 3300002738 JGI25154J39366_1000095 JGI25154J39366_100009543 349
173 3300002738 JGI25154J39366_1000223 JGI25154J39366_10002233 349
174 3300002741 JGI25157J39369_1000250 JGI25157J39369_10002505 349
175 3300003758 Ga0055532_1000083 Ga0055532_100008380 349
176 3300005563 Ga0068855_100104953 Ga0068855_1001049532 349
177 3300005616 Ga0068852_100005916 Ga0068852_1000059163 349
178 3300006038 Ga0075365_10060112 Ga0075365_100601122 349
179 3300009093 Ga0105240_10001988 Ga0105240_1000198814 349
180 3300009551 Ga0105238_10035822 Ga0105238_100358222 349
181 3300014497 Ga0182008_10068277 Ga0182008_100682771 349
182 3300025206 Ga0209435_100013 Ga0209435_10001333 349
183 3300025206 Ga0209435_100404 Ga0209435_1004043 349
184 3300025229 Ga0209147_100030 Ga0209147_100030321 349
185 3300025233 Ga0209437_100317 Ga0209437_10031745 349
186 3300025242 Ga0209258_100542 Ga0209258_10054212 349
187 3300025246 Ga0209646_1000021 Ga0209646_1000021379 349
188 3300025246 Ga0209646_1000034 Ga0209646_100003433 349
189 3300025250 Ga0209026_1000022 Ga0209026_100002233 349
190 3300025250 Ga0209026_1002657 Ga0209026_10026572 349
191 3300025256 Ga0209759_1000018 Ga0209759_100001833 349
192 3300025256 Ga0209759_1000567 Ga0209759_100056735 349
193 3300025272 Ga0209455_1006073 Ga0209455_10060733 349
194 3300025913 Ga0207695_10000896 Ga0207695_1000089633 349
195 3300025949 Ga0207667_10053075 Ga0207667_100530754 349
196 3300026142 Ga0207698_10005686 Ga0207698_100056867 349
197 3300031838 Ga0307518_10061152 Ga0307518_100611522 349
198 3300046463 Ga0495653_0090528 Ga0495653_0090528_49_1104 349
199 3300046660 Ga0495625_0009512 Ga0495625_0009512_142_1266 349
200 3300046665 Ga0495661_0009736 Ga0495661_0009736_97_1152 349
201 3300047444 Ga0495675_0106832 Ga0495675_0106832_214_1269 349
202 3300048925 Ga0496122_0000134 Ga0496122_0000134_47855_48979 349
203 3300048926 Ga0496123_0000583 Ga0496123_0000583_14144_15268 349
204 3300048928 Ga0496125_0003110 Ga0496125_0003110_2178_3302 349
205 iso_pu_bacteria 2854911287 2854913490 349
206 iso_pu_bacteria 2924214083 2924215170 349
207 iso_pu_bacteria 8004395343 8004402988 349
208 3300002737 JGI25162J39368_1000677 JGI25162J39368_100067713 350
209 3300003214 JGI25165J46597_1000279 JGI25165J46597_100027953 350
210 3300003751 Ga0055538_1000107 Ga0055538_100010712 350
211 3300003752 Ga0055539_1000156 Ga0055539_100015612 350
212 3300003756 Ga0055533_1000157 Ga0055533_100015753 350
213 3300003759 Ga0055525_1000210 Ga0055525_100021053 350
214 3300003841 Ga0055541_1000103 Ga0055541_100010353 350
215 3300006042 Ga0075368_10037830 Ga0075368_100378302 350
216 3300009093 Ga0105240_10024039 Ga0105240_100240395 350
217 3300015261 Ga0182006_1058824 Ga0182006_10588242 350
218 3300015265 Ga0182005_1000300 Ga0182005_100030033 350
219 3300021361 Ga0213872_10021364 Ga0213872_100213642 350
220 3300025207 Ga0209760_102404 Ga0209760_1024042 350
221 3300025224 Ga0209784_100019 Ga0209784_10001929 350
222 3300025225 Ga0209566_100017 Ga0209566_10001729 350
223 3300025226 Ga0209674_100031 Ga0209674_10003129 350
224 3300025230 Ga0209563_100035 Ga0209563_10003529 350
225 3300025231 Ga0207427_100311 Ga0207427_10031114 350
226 3300025233 Ga0209437_100038 Ga0209437_10003829 350
227 3300025253 Ga0209677_100020 Ga0209677_10002029 350
228 3300025261 Ga0209233_1000049 Ga0209233_100004929 350
229 3300025913 Ga0207695_10018896 Ga0207695_100188965 350
230 3300037471 Ga0395905_0297136 Ga0395905_0297136_83_1195 350
231 3300039447 Ga0436361_0138725 Ga0436361_0138725_4332_5468 350
232 3300046454 Ga0495592_0019928 Ga0495592_0019928_2086_3207 350
233 3300046462 Ga0495651_0139896 Ga0495651_0139896_15_1136 350
234 3300046463 Ga0495653_0040623 Ga0495653_0040623_621_1742 350
235 3300046511 Ga0495608_0011037 Ga0495608_0011037_1944_3065 350
236 3300046516 Ga0495628_0030682 Ga0495628_0030682_1928_3049 350
237 3300046529 Ga0495652_0047551 Ga0495652_0047551_947_2068 350
238 3300046543 Ga0495645_0056911 Ga0495645_0056911_1076_2197 350
239 3300046557 Ga0495622_0000007 Ga0495622_0000007_165477_166538 350
240 3300046678 Ga0495599_0028288 Ga0495599_0028288_525_1646 350
241 3300046679 Ga0495623_0024443 Ga0495623_0024443_1146_2267 350
242 3300046680 Ga0495646_0020472 Ga0495646_0020472_1886_3007 350
243 3300046690 Ga0495624_0013513 Ga0495624_0013513_1155_2276 350
244 3300048088 Ga0495602_0051271 Ga0495602_0051271_945_2066 350
245 3300048924 Ga0496121_0027413 Ga0496121_0027413_2316_3461 350
246 3300005459 Ga0068867_100195554 Ga0068867_1001955542 351
247 3300009553 Ga0105249_10090311 Ga0105249_100903112 351
248 3300025961 Ga0207712_10052157 Ga0207712_100521572 351
249 3300031711 Ga0265314_10004985 Ga0265314_1000498510 351
250 3300037068 Ga0373925_0094537 Ga0373925_0094537_1091_2254 351
251 3300044901 Ga0466960_0120626 Ga0466960_0120626_49_1119 351
252 3300046471 Ga0495650_0000164 Ga0495650_0000164_102546_103646 351
253 3300046507 Ga0495606_0003738 Ga0495606_0003738_1759_2859 351
254 iso_pu_bacteria 2837651117 2837654142 351
255 iso_pu_bacteria 2932401849 2932403599 351
256 3300002704 JGI25155J39150_1000021 JGI25155J39150_100002125 352
257 3300002705 JGI25156J39149_1000022 JGI25156J39149_100002225 352
258 3300002738 JGI25154J39366_1000048 JGI25154J39366_100004890 352
259 3300002741 JGI25157J39369_1000025 JGI25157J39369_1000025116 352
260 3300025206 Ga0209435_100033 Ga0209435_100033108 352
261 3300025246 Ga0209646_1000116 Ga0209646_100011623 352
262 3300025250 Ga0209026_1000103 Ga0209026_1000103108 352
263 3300025256 Ga0209759_1000105 Ga0209759_100010523 352
264 iso_pu_bacteria 2791355082 2792581760 352
265 iso_pu_bacteria 2904424332 2904426782 352
266 iso_pu_bacteria 8049293176 8049294964 352
267 3300045051 Ga0451576_0000458 Ga0451576_0000458_46388_47467 353
268 iso_pu_bacteria 2510065057 2510303288 353
269 iso_pu_bacteria 2510461069 2510840038 353
270 iso_pu_bacteria 2510917028 2511181661 353
271 iso_pu_bacteria 2511231052 2511501974 353
272 iso_pu_bacteria 2512875026 2512971089 353
273 iso_pu_bacteria 2513237086 2513582629 353
274 iso_pu_bacteria 2513237088 2513594694 353
275 iso_pu_bacteria 2513237089 2513604554 353
276 iso_pu_bacteria 2513237091 2513615469 353
277 iso_pu_bacteria 2513237140 2513881258 353
278 iso_pu_bacteria 2513237143 2513902389 353
279 iso_pu_bacteria 2513237146 2513926061 353
280 iso_pu_bacteria 2513237156 2513984591 353
281 iso_pu_bacteria 2513237160 2514007607 353
282 iso_pu_bacteria 2515154107 2515608767 353
283 iso_pu_bacteria 2516653046 2516893270 353
284 iso_pu_bacteria 2517487022 2517570027 353
285 iso_pu_bacteria 2524023207 2524448830 353
286 iso_pu_bacteria 2534681796 2535516609 353
287 iso_pu_bacteria 2551306084 2551675152 353
288 iso_pu_bacteria 2551306084 2551680522 353
289 iso_pu_bacteria 2551306085 2551688055 353
290 iso_pu_bacteria 2551306086 2551691137 353
291 iso_pu_bacteria 2551306087 2551699983 353
292 iso_pu_bacteria 2551306089 2551712019 353
293 iso_pu_bacteria 2551306090 2551722510 353
294 iso_pu_bacteria 2551306091 2551727857 353
295 iso_pu_bacteria 2551306092 2551738935 353
296 iso_pu_bacteria 2551306093 2551741783 353
297 iso_pu_bacteria 2582581294 2585200290 353
298 iso_pu_bacteria 2582581304 2585254876 353
299 iso_pu_bacteria 2585427594 2585846835 353
300 iso_pu_bacteria 2599185170 2599417537 353
301 iso_pu_bacteria 2643221634 2644192597 353
302 iso_pu_bacteria 2643221643 2644239686 353
303 iso_pu_bacteria 2643221653 2644298402 353
304 iso_pu_bacteria 2643221719 2644656631 353
305 iso_pu_bacteria 2657244999 2657681197 353
306 iso_pu_bacteria 2802428858 2802719522 353
307 iso_pu_bacteria 2802428859 2802726885 353
308 iso_pu_bacteria 2802428860 2802732256 353
309 iso_pu_bacteria 2802428861 2802739859 353
310 iso_pu_bacteria 2802428862 2802745365 353
311 iso_pu_bacteria 2802428863 2802752757 353
312 iso_pu_bacteria 2802429268 2804752397 353
313 iso_pu_bacteria 2818991272 2819241737 353
314 iso_pu_bacteria 2838035591 2838038250 353
315 iso_pu_bacteria 2838074704 2838079588 353
316 iso_pu_bacteria 2838661181 2838661873 353
317 iso_pu_bacteria 2855825444 2855825993 353
318 iso_pu_bacteria 2855839649 2855841338 353
319 iso_pu_bacteria 2858800743 2858802325 353
320 iso_pu_bacteria 2896384573 2896384848 353
321 iso_pu_bacteria 2913295892 2913300836 353
322 iso_pu_bacteria 2915980308 2915981885 353
323 iso_pu_bacteria 2915986958 2915991336 353
324 iso_pu_bacteria 2915993759 2915994360 353
325 iso_pu_bacteria 2916000859 2916004381 353
326 iso_pu_bacteria 2916007675 2916008145 353
327 iso_pu_bacteria 2916014648 2916015084 353
328 iso_pu_bacteria 2916021584 2916024231 353
329 iso_pu_bacteria 2916028427 2916031763 353
330 iso_pu_bacteria 2916035215 2916041275 353
331 iso_pu_bacteria 2916041962 2916042737 353
332 iso_pu_bacteria 2916048683 2916052281 353
333 iso_pu_bacteria 2916055098 2916056432 353
334 iso_pu_bacteria 2916061851 2916067571 353
335 iso_pu_bacteria 2916076590 2916080868 353
336 iso_pu_bacteria 2920760137 2920766089 353
337 iso_pu_bacteria 2921201388 2921204707 353
338 iso_pu_bacteria 2921208531 2921209560 353
339 iso_pu_bacteria 2921237296 2921240728 353
340 iso_pu_bacteria 2921244191 2921244639 353
341 iso_pu_bacteria 2921250672 2921251168 353
342 iso_pu_bacteria 2921257292 2921262463 353
343 iso_pu_bacteria 2921263974 2921265111 353
344 iso_pu_bacteria 2921282425 2921283772 353
345 iso_pu_bacteria 2921289301 2921296320 353
346 iso_pu_bacteria 2921296804 2921299376 353
347 iso_pu_bacteria 2924144063 2924147103 353
348 iso_pu_bacteria 2924150972 2924155253 353
349 iso_pu_bacteria 2924158325 2924160768 353
350 iso_pu_bacteria 2924165586 2924167346 353
351 iso_pu_bacteria 2924172951 2924178987 353
352 iso_pu_bacteria 2924179722 2924184075 353
353 iso_pu_bacteria 2924186466 2924189064 353
354 iso_pu_bacteria 2924193448 2924194791 353
355 iso_pu_bacteria 2924200457 2924203361 353
356 iso_pu_bacteria 2924207177 2924208835 353
357 iso_pu_bacteria 2924221636 2924226513 353
358 iso_pu_bacteria 2924228884 2924229945 353
359 iso_pu_bacteria 2933016740 2933019653 353
360 iso_pu_bacteria 2936996657 2936998119 353
361 iso_pu_bacteria 2937002841 2937005069 353
362 iso_pu_bacteria 2937009748 2937012203 353
363 iso_pu_bacteria 2937016420 2937018638 353
364 iso_pu_bacteria 2937023124 2937028977 353
365 iso_pu_bacteria 2937029754 2937031281 353
366 iso_pu_bacteria 2937036028 2937038578 353
367 iso_pu_bacteria 2937042894 2937047349 353
368 iso_pu_bacteria 2937049772 2937050945 353
369 iso_pu_bacteria 2937056579 2937061539 353
370 iso_pu_bacteria 2937063883 2937065224 353
371 iso_pu_bacteria 2937071275 2937073053 353
372 iso_pu_bacteria 2937078374 2937079803 353
373 iso_pu_bacteria 2937084907 2937087056 353
374 iso_pu_bacteria 2937091812 2937097593 353
375 iso_pu_bacteria 2937098957 2937099540 353
376 iso_pu_bacteria 2937106411 2937110014 353
377 iso_pu_bacteria 2937113482 2937116264 353
378 iso_pu_bacteria 2937119839 2937123074 353
379 iso_pu_bacteria 2937126314 2937128713 353
380 iso_pu_bacteria 2957375807 2957376589 353
381 iso_pu_bacteria 2957382221 2957384807 353
382 iso_pu_bacteria 2957388812 2957394849 353
383 iso_pu_bacteria 2957395598 2957398265 353
384 iso_pu_bacteria 2957402308 2957403201 353
385 iso_pu_bacteria 2957408893 2957411594 353
386 iso_pu_bacteria 2957415311 2957418318 353
387 iso_pu_bacteria 2957422303 2957423291 353
388 iso_pu_bacteria 2957430029 2957432804 353
389 iso_pu_bacteria 2957437181 2957441269 353
390 iso_pu_bacteria 2957443900 2957444993 353
391 iso_pu_bacteria 2957450854 2957455974 353
392 iso_pu_bacteria 2957457609 2957459915 353
393 iso_pu_bacteria 2957464669 2957465997 353
394 iso_pu_bacteria 2957471148 2957477092 353
395 iso_pu_bacteria 2957478035 2957479214 353
396 iso_pu_bacteria 2957484790 2957486261 353
397 iso_pu_bacteria 2957491536 2957498034 353
398 iso_pu_bacteria 2957498199 2957498697 353
399 iso_pu_bacteria 2957505466 2957507652 353
400 iso_pu_bacteria 2960584000 2960584308 353
401 iso_pu_bacteria 2960591022 2960592712 353
402 iso_pu_bacteria 2960597568 2960602682 353
403 iso_pu_bacteria 2960603979 2960605939 353
404 iso_pu_bacteria 2960610863 2960612425 353
405 iso_pu_bacteria 2960617483 2960620009 353
406 iso_pu_bacteria 2960624210 2960630919 353
407 iso_pu_bacteria 2960631154 2960632829 353
408 iso_pu_bacteria 2960637947 2960639857 353
409 iso_pu_bacteria 2960645483 2960650510 353
410 iso_pu_bacteria 2960652885 2960660034 353
411 iso_pu_bacteria 2960660292 2960660845 353
412 iso_pu_bacteria 2960667422 2960670971 353
413 iso_pu_bacteria 2960674078 2960675908 353
414 iso_pu_bacteria 2960680706 2960681864 353
415 iso_pu_bacteria 2960687367 2960689955 353
416 iso_pu_bacteria 2960693952 2960694656 353
417 iso_pu_bacteria 2964607997 2964609190 353
418 iso_pu_bacteria 2964615318 2964616581 353
419 iso_pu_bacteria 2964621998 2964622577 353
420 iso_pu_bacteria 2964628898 2964635798 353
421 iso_pu_bacteria 2964636051 2964640952 353
422 iso_pu_bacteria 2964643177 2964649478 353
423 iso_pu_bacteria 2964649959 2964651782 353
424 iso_pu_bacteria 2964656573 2964661006 353
425 iso_pu_bacteria 2964663802 2964667048 353
426 iso_pu_bacteria 2964670856 2964677506 353
427 iso_pu_bacteria 2964678106 2964684096 353
428 iso_pu_bacteria 2964685014 2964686491 353
429 iso_pu_bacteria 2964691889 2964692858 353
430 iso_pu_bacteria 2964698721 2964702317 353
431 iso_pu_bacteria 2964705432 2964711849 353
432 iso_pu_bacteria 2964712639 2964716766 353
433 iso_pu_bacteria 2964719344 2964723895 353
434 iso_pu_bacteria 2967664464 2967664722 353
435 iso_pu_bacteria 2967671571 2967672565 353
436 iso_pu_bacteria 2967678726 2967681852 353
437 iso_pu_bacteria 2967686174 2967690780 353
438 iso_pu_bacteria 2967693043 2967695250 353
439 iso_pu_bacteria 2967699805 2967700802 353
440 iso_pu_bacteria 2967706974 2967707793 353
441 iso_pu_bacteria 2967714385 2967716666 353
442 iso_pu_bacteria 2967721400 2967721667 353
443 iso_pu_bacteria 2967728569 2967734988 353
444 iso_pu_bacteria 2967735183 2967736865 353
445 iso_pu_bacteria 2967742019 2967744123 353
446 iso_pu_bacteria 2967748971 2967755486 353
447 iso_pu_bacteria 2967755722 2967758754 353
448 iso_pu_bacteria 2967762386 2967765384 353
449 iso_pu_bacteria 2967769361 2967775662 353
450 iso_pu_bacteria 2967775926 2967782287 353
451 iso_pu_bacteria 2970019648 2970026514 353
452 iso_pu_bacteria 2970026789 2970031006 353
453 iso_pu_bacteria 2970033650 2970039726 353
454 iso_pu_bacteria 2970040964 2970046716 353
455 iso_pu_bacteria 2970047711 2970054426 353
456 iso_pu_bacteria 2970054988 2970057807 353
457 iso_pu_bacteria 2970061556 2970066702 353
458 iso_pu_bacteria 2970068827 2970072995 353
459 iso_pu_bacteria 2970076120 2970077463 353
460 iso_pu_bacteria 2970082768 2970086192 353
461 iso_pu_bacteria 2970088815 2970091168 353
462 iso_pu_bacteria 2970095765 2970097293 353
463 iso_pu_bacteria 2970102677 2970107504 353
464 iso_pu_bacteria 2970109326 2970110861 353
465 iso_pu_bacteria 2970116247 2970122161 353
466 iso_pu_bacteria 2970122695 2970122985 353
467 iso_pu_bacteria 2970129317 2970131688 353
468 iso_pu_bacteria 2970143518 2970144095 353
469 iso_pu_bacteria 2970149975 2970154251 353
470 iso_pu_bacteria 2970156795 2970160212 353
471 iso_pu_bacteria 2970164137 2970167127 353
472 iso_pu_bacteria 2970170962 2970173279 353
473 iso_pu_bacteria 2970177841 2970180316 353
474 iso_pu_bacteria 2970184632 2970187584 353
475 iso_pu_bacteria 2970191845 2970193341 353
476 iso_pu_bacteria 2977516862 2977522398 353
477 iso_pu_bacteria 2977523885 2977529038 353
478 iso_pu_bacteria 2977530762 2977531674 353
479 iso_pu_bacteria 2977537788 2977540559 353
480 iso_pu_bacteria 2977544691 2977549089 353
481 iso_pu_bacteria 2977551784 2977554413 353
482 iso_pu_bacteria 2977558990 2977560187 353
483 iso_pu_bacteria 2977565890 2977572255 353
484 iso_pu_bacteria 2977572785 2977575294 353
485 iso_pu_bacteria 2977579622 2977580178 353
486 iso_pu_bacteria 2989771324 2989774943 353
487 iso_pu_bacteria 2989776772 2989778930 353
488 iso_pu_bacteria 2996887358 2996891824 353
489 iso_pu_bacteria 3005409236 3005414976 353
490 iso_pu_bacteria 3005452660 3005454359 353
491 iso_pu_bacteria 648276728 648739562 353
492 iso_pu_bacteria 8003992118 8003993853 353
493 iso_pu_bacteria 8003999396 8004001398 353
494 iso_pu_bacteria 8005246636 8005248483 353
495 iso_pu_bacteria 8005258706 8005263155 353
496 iso_pu_bacteria 8005321885 8005326351 353
497 iso_pu_bacteria 8005542996 8005545267 353
498 iso_pu_bacteria 8054558443 8054560257 353
499 3300005456 Ga0070678_100086397 Ga0070678_1000863972 354
500 3300026116 Ga0207674_10180265 Ga0207674_101802652 354
501 3300049571 Ga0501034_0025599 Ga0501034_0025599_1686_2759 354
502 3300049822 Ga0501035_0135179 Ga0501035_0135179_521_1597 354
503 3300049823 Ga0501044_0280358 Ga0501044_0280358_384_1463 354
504 iso_pu_bacteria 2510917022 2511135129 354
505 iso_pu_bacteria 2524023209 2524460264 354
506 iso_pu_bacteria 2537561587 2537877766 354
507 iso_pu_bacteria 2551306086 2551693963 354
508 iso_pu_bacteria 2551306087 2551698096 354
509 iso_pu_bacteria 2551306092 2551733170 354
510 iso_pu_bacteria 2554235003 2554245550 354
511 iso_pu_bacteria 2558860242 2559296620 354
512 iso_pu_bacteria 2558860983 2561468291 354
513 iso_pu_bacteria 2582581307 2585270869 354
514 iso_pu_bacteria 2582581308 2585277217 354
515 iso_pu_bacteria 2582581315 2585323774 354
516 iso_pu_bacteria 2582581316 2585331753 354
517 iso_pu_bacteria 2585427527 2585534047 354
518 iso_pu_bacteria 2585427530 2585552102 354
519 iso_pu_bacteria 2585427531 2585558593 354
520 iso_pu_bacteria 2585427608 2585897956 354
521 iso_pu_bacteria 2585427609 2585904438 354
522 iso_pu_bacteria 2585428125 2587980445 354
523 iso_pu_bacteria 2599185156 2599331588 354
524 iso_pu_bacteria 2599185210 2599602887 354
525 iso_pu_bacteria 2600255279 2601610496 354
526 iso_pu_bacteria 2600255308 2601747174 354
527 iso_pu_bacteria 2615840626 2616308595 354
528 iso_pu_bacteria 2615840698 2616557100 354
529 iso_pu_bacteria 2617270742 2617385652 354
530 iso_pu_bacteria 2643221568 2643854245 354
531 iso_pu_bacteria 2643221582 2643917407 354
532 iso_pu_bacteria 2643221693 2644520749 354
533 iso_pu_bacteria 2667528174 2671111701 354
534 iso_pu_bacteria 2775507266 2778174033 354
535 iso_pu_bacteria 2791355253 2793279940 354
536 iso_pu_bacteria 2808606387 2808987073 354
537 iso_pu_bacteria 2818991439 2819560624 354
538 iso_pu_bacteria 2818991448 2819612781 354
539 iso_pu_bacteria 2818991453 2819637894 354
540 iso_pu_bacteria 2838029111 2838030075 354
541 iso_pu_bacteria 2838675328 2838677883 354
542 iso_pu_bacteria 2838714209 2838717212 354
543 iso_pu_bacteria 2838719591 2838722178 354
544 iso_pu_bacteria 2838724970 2838727961 354
545 iso_pu_bacteria 2839993093 2839996551 354
546 iso_pu_bacteria 2841846520 2841849620 354
547 iso_pu_bacteria 2841859092 2841861344 354
548 iso_pu_bacteria 2842124991 2842127632 354
549 iso_pu_bacteria 2842130223 2842132776 354
550 iso_pu_bacteria 2842152218 2842154769 354
551 iso_pu_bacteria 2842170452 2842173268 354
552 iso_pu_bacteria 2842175837 2842178390 354
553 iso_pu_bacteria 2842187318 2842190320 354
554 iso_pu_bacteria 2842211629 2842214634 354
555 iso_pu_bacteria 2842224351 2842227353 354
556 iso_pu_bacteria 2842298080 2842302027 354
557 iso_pu_bacteria 2842357229 2842357506 354
558 iso_pu_bacteria 2842475841 2842476640 354
559 iso_pu_bacteria 2842482326 2842484820 354
560 iso_pu_bacteria 2842502639 2842503603 354
561 iso_pu_bacteria 2842509118 2842511419 354
562 iso_pu_bacteria 2842515876 2842518389 354
563 iso_pu_bacteria 2842871566 2842874221 354
564 iso_pu_bacteria 2842922631 2842923986 354
565 iso_pu_bacteria 2852387548 2852389915 354
566 iso_pu_bacteria 2856342000 2856349194 354
567 iso_pu_bacteria 2888343758 2888345440 354
568 iso_pu_bacteria 2891373044 2891373158 354
569 iso_pu_bacteria 2899792073 2899795600 354
570 iso_pu_bacteria 2899803654 2899809014 354
571 iso_pu_bacteria 2899845264 2899849926 354
572 iso_pu_bacteria 2904578770 2904582498 354
573 iso_pu_bacteria 2913308742 2913311351 354
574 iso_pu_bacteria 2919114240 2919117470 354
575 iso_pu_bacteria 2919119836 2919123977 354
576 iso_pu_bacteria 2919166419 2919168632 354
577 iso_pu_bacteria 2919408235 2919411673 354
578 iso_pu_bacteria 2924754689 2924755117 354
579 iso_pu_bacteria 2926754445 2926758916 354
580 iso_pu_bacteria 2926760298 2926763572 354
581 iso_pu_bacteria 2928521798 2928525046 354
582 iso_pu_bacteria 2929138655 2929138833 354
583 iso_pu_bacteria 2933006813 2933009848 354
584 iso_pu_bacteria 2933011516 2933014016 354
585 iso_pu_bacteria 2933594066 2933595803 354
586 iso_pu_bacteria 2978969890 2978971322 354
587 iso_pu_bacteria 2979089926 2979091388 354
588 iso_pu_bacteria 2979095461 2979096911 354
589 iso_pu_bacteria 2979100975 2979101418 354
590 iso_pu_bacteria 2984509177 2984510630 354
591 iso_pu_bacteria 2984518228 2984518667 354
592 iso_pu_bacteria 2984537506 2984538979 354
593 iso_pu_bacteria 2984587000 2984588467 354
594 iso_pu_bacteria 2984601300 2984605676 354
595 iso_pu_bacteria 2989349275 2989349418 354
596 iso_pu_bacteria 3005416602 3005420090 354
597 iso_pu_bacteria 650716007 650843042 354
598 iso_pu_bacteria 8003570095 8003574249 354
599 iso_pu_bacteria 8005289223 8005289922 354
600 iso_pu_bacteria 8005314921 8005317041 354
601 iso_pu_bacteria 8005484373 8005485164 354
602 iso_pu_bacteria 8005645114 8005645327 354
603 iso_pu_bacteria 8005658619 8005659562 354
604 iso_pu_bacteria 8005682033 8005683172 354
605 iso_pu_bacteria 8018150411 8018152645 354
606 iso_pu_bacteria 8054460903 8054464585 354
607 iso_pu_bacteria 8056875544 8056877782 354
608 iso_pu_bacteria 8057575449 8057576850 354
609 3300003792 Ga0055540_1000403 Ga0055540_100040318 355
610 3300003794 Ga0055531_10000510 Ga0055531_1000051016 355
611 3300005328 Ga0070676_10086348 Ga0070676_100863482 355
612 3300005339 Ga0070660_100174888 Ga0070660_1001748882 355
613 3300005356 Ga0070674_100004332 Ga0070674_1000043324 355
614 3300005543 Ga0070672_100141803 Ga0070672_1001418032 355
615 3300005577 Ga0068857_100012090 Ga0068857_10001209010 355
616 3300006051 Ga0075364_10000091 Ga0075364_1000009135 355
617 3300006358 Ga0068871_100284620 Ga0068871_1002846201 355
618 3300006946 Ga0079104_1000610 Ga0079104_100061020 355
619 3300009545 Ga0105237_10205333 Ga0105237_102053332 355
620 3300014325 Ga0163163_10324527 Ga0163163_103245272 355
621 3300025292 Ga0209676_1000657 Ga0209676_100065723 355
622 3300025298 Ga0209050_1004814 Ga0209050_10048148 355
623 3300025303 Ga0209051_1001923 Ga0209051_10019233 355
624 3300025304 Ga0209257_1000754 Ga0209257_100075420 355
625 3300025913 Ga0207695_10025218 Ga0207695_100252182 355
626 3300025919 Ga0207657_10023146 Ga0207657_100231466 355
627 3300025937 Ga0207669_10109811 Ga0207669_101098111 355
628 3300025940 Ga0207691_10153254 Ga0207691_101532542 355
629 3300025972 Ga0207668_10023946 Ga0207668_100239462 355
630 3300026116 Ga0207674_10019036 Ga0207674_100190363 355
631 3300026121 Ga0207683_10040887 Ga0207683_100408873 355
632 3300027111 Ga0209281_1000036 Ga0209281_1000036261 355
633 3300027111 Ga0209281_1000047 Ga0209281_1000047203 355
634 3300048924 Ga0496121_0140361 Ga0496121_0140361_590_1687 355
635 3300048927 Ga0496124_0060217 Ga0496124_0060217_1264_2346 355
636 3300048928 Ga0496125_0000301 Ga0496125_0000301_13803_14885 355
637 3300049570 Ga0501033_0000167 Ga0501033_0000167_19552_20637 355
638 3300049571 Ga0501034_0001091 Ga0501034_0001091_28410_29492 355
639 3300049822 Ga0501035_0021712 Ga0501035_0021712_3347_4432 355
640 3300050491 nmdc:mga00v17_156_c1 nmdc:mga00v17_156_c1_6780_7877 355
641 3300053151 Ga0500604_0000146 Ga0500604_0000146_17308_18393 355
642 iso_pu_bacteria 2510065019 2510133448 355
643 iso_pu_bacteria 2510461076 2510894835 355
644 iso_pu_bacteria 2510917030 2511194369 355
645 iso_pu_bacteria 2510917030 2511195064 355
646 iso_pu_bacteria 2513237084 2513572365 355
647 iso_pu_bacteria 2513237085 2513577420 355
648 iso_pu_bacteria 2513237093 2513629945 355
649 iso_pu_bacteria 2513237103 2513708589 355
650 iso_pu_bacteria 2513237159 2513997061 355
651 iso_pu_bacteria 2513237162 2514021960 355
652 iso_pu_bacteria 2515075009 2515112413 355
653 iso_pu_bacteria 2515154113 2515632762 355
654 iso_pu_bacteria 2515154114 2515639910 355
655 iso_pu_bacteria 2515154116 2515655885 355
656 iso_pu_bacteria 2515154134 2515740321 355
657 iso_pu_bacteria 2516653077 2517036145 355
658 iso_pu_bacteria 2516653085 2517076535 355
659 iso_pu_bacteria 2517093000 2517095302 355
660 iso_pu_bacteria 2517287029 2517406906 355
661 iso_pu_bacteria 2582581298 2585221943 355
662 iso_pu_bacteria 2582581298 2585222634 355
663 iso_pu_bacteria 2582581304 2585258663 355
664 iso_pu_bacteria 2585427526 2585527774 355
665 iso_pu_bacteria 2585427528 2585537669 355
666 iso_pu_bacteria 2585427529 2585543887 355
667 iso_pu_bacteria 2585427529 2585545217 355
668 iso_pu_bacteria 2585427593 2585835619 355
669 iso_pu_bacteria 2599185236 2599720981 355
670 iso_pu_bacteria 2599185352 2600193086 355
671 iso_pu_bacteria 2643221551 2643776756 355
672 iso_pu_bacteria 2643221555 2643795204 355
673 iso_pu_bacteria 2643221557 2643803586 355
674 iso_pu_bacteria 2643221610 2644067553 355
675 iso_pu_bacteria 2643221626 2644148630 355
676 iso_pu_bacteria 2643221655 2644309093 355
677 iso_pu_bacteria 2643221659 2644332921 355
678 iso_pu_bacteria 2643221668 2644375233 355
679 iso_pu_bacteria 2643221675 2644418606 355
680 iso_pu_bacteria 2643221680 2644451973 355
681 iso_pu_bacteria 2643221688 2644491803 355
682 iso_pu_bacteria 2643221698 2644545907 355
683 iso_pu_bacteria 2643221712 2644615035 355
684 iso_pu_bacteria 2643221723 2644676572 355
685 iso_pu_bacteria 2643221726 2644690735 355
686 iso_pu_bacteria 2718217927 2719389985 355
687 iso_pu_bacteria 2724679232 2725948589 355
688 iso_pu_bacteria 2738541293 2738803369 355
689 iso_pu_bacteria 2738541333 2739036632 355
690 iso_pu_bacteria 2756170246 2756670985 355
691 iso_pu_bacteria 2765235942 2766067419 355
692 iso_pu_bacteria 2802429633 2806046182 355
693 iso_pu_bacteria 2802429634 2806054562 355
694 iso_pu_bacteria 2802429635 2806060566 355
695 iso_pu_bacteria 2802429636 2806064976 355
696 iso_pu_bacteria 2802429637 2806072235 355
697 iso_pu_bacteria 2821123053 2821129477 355
698 iso_pu_bacteria 2838686498 2838691919 355
699 iso_pu_bacteria 2838729681 2838732934 355
700 iso_pu_bacteria 2838736955 2838738491 355
701 iso_pu_bacteria 2838742623 2838745812 355
702 iso_pu_bacteria 2841840854 2841841140 355
703 iso_pu_bacteria 2841851746 2841855729 355
704 iso_pu_bacteria 2842110456 2842114271 355
705 iso_pu_bacteria 2842140634 2842140918 355
706 iso_pu_bacteria 2842156927 2842157279 355
707 iso_pu_bacteria 2842163707 2842167937 355
708 iso_pu_bacteria 2842180545 2842181137 355
709 iso_pu_bacteria 2842217011 2842217380 355
710 iso_pu_bacteria 2842229732 2842230805 355
711 iso_pu_bacteria 2842243621 2842245089 355
712 iso_pu_bacteria 2842257432 2842258902 355
713 iso_pu_bacteria 2842271015 2842276428 355
714 iso_pu_bacteria 2842304105 2842304432 355
715 iso_pu_bacteria 2842317721 2842319339 355
716 iso_pu_bacteria 2842495871 2842498909 355
717 iso_pu_bacteria 2842521101 2842522697 355
718 iso_pu_bacteria 2844163670 2844167588 355
719 iso_pu_bacteria 2844454524 2844459025 355
720 iso_pu_bacteria 2857516855 2857519843 355
721 iso_pu_bacteria 2857531043 2857535121 355
722 iso_pu_bacteria 2891048133 2891050895 355
723 iso_pu_bacteria 2919100787 2919103104 355
724 iso_pu_bacteria 2919100787 2919106517 355
725 iso_pu_bacteria 2933570622 2933571706 355
726 iso_pu_bacteria 2933586486 2933590366 355
727 iso_pu_bacteria 2935901341 2935905546 355
728 iso_pu_bacteria 2936367885 2936372562 355
729 iso_pu_bacteria 2936375103 2936376442 355
730 iso_pu_bacteria 3004167301 3004167408 355
731 iso_pu_bacteria 3005445848 3005448252 355
732 iso_pu_bacteria 3005445848 3005451707 355
733 iso_pu_bacteria 639633055 639648671 355
734 iso_pu_bacteria 8005275841 8005276109 355
735 iso_pu_bacteria 8005307578 8005309861 355
736 iso_pu_bacteria 8005376324 8005379358 355
737 iso_pu_bacteria 8005460587 8005463084 355
738 iso_pu_bacteria 8005556819 8005557575 355
739 iso_pu_bacteria 8005563573 8005568746 355
740 iso_pu_bacteria 8005570704 8005574369 355
741 iso_pu_bacteria 8018163183 8018166662 355
742 iso_pu_bacteria 8023680758 8023685248 355
743 iso_pu_bacteria 8024479707 8024483406 355
744 iso_pu_bacteria 8057874678 8057874925 355
745 3300003187 JGI25151J46595_10000603 JGI25151J46595_1000060324 356
746 3300003215 JGI25153J46596_10009300 JGI25153J46596_100093003 356
747 3300003771 Ga0055526_1006188 Ga0055526_10061882 356
748 3300003790 Ga0055528_1025218 Ga0055528_10252182 356
749 3300004625 Ga0055543_1003000 Ga0055543_10030002 356
750 3300005262 Ga0065165_1008698 Ga0065165_10086982 356
751 3300006038 Ga0075365_10000306 Ga0075365_1000030613 356
752 3300006042 Ga0075368_10010112 Ga0075368_100101122 356
753 3300006177 Ga0075362_10003487 Ga0075362_100034872 356
754 3300006178 Ga0075367_10033987 Ga0075367_100339872 356
755 3300006195 Ga0075366_10001037 Ga0075366_100010375 356
756 3300006353 Ga0075370_10024344 Ga0075370_100243442 356
757 3300014745 Ga0157377_10000037 Ga0157377_1000003761 356
758 3300021321 Ga0214542_1001614 Ga0214542_100161422 356
759 3300021327 Ga0214543_1001395 Ga0214543_100139522 356
760 3300022740 Ga0228710_1000013 Ga0228710_100001395 356
761 3300025273 Ga0209673_1000296 Ga0209673_100029645 356
762 3300025294 Ga0209025_1000166 Ga0209025_1000166148 356
763 3300025295 Ga0209564_1000584 Ga0209564_100058454 356
764 3300025297 Ga0209758_1005225 Ga0209758_10052256 356
765 3300025297 Ga0209758_1035669 Ga0209758_10356692 356
766 3300025299 Ga0209256_1000383 Ga0209256_100038351 356
767 3300025299 Ga0209256_1017452 Ga0209256_10174522 356
768 3300025302 Ga0207426_1000039 Ga0207426_1000039237 356
769 3300025303 Ga0209051_1002092 Ga0209051_10020923 356
770 3300025303 Ga0209051_1043796 Ga0209051_10437962 356
771 3300027111 Ga0209281_1000221 Ga0209281_100022135 356
772 3300027111 Ga0209281_1000453 Ga0209281_10004537 356
773 3300027666 Ga0209282_1000041 Ga0209282_100004135 356
774 3300028794 Ga0307515_10260162 Ga0307515_102601621 356
775 3300031548 Ga0307408_100080151 Ga0307408_1000801512 356
776 3300031967 Ga0315914_1000030 Ga0315914_100003096 356
777 3300033430 Ga0315913_1000017 Ga0315913_100001794 356
778 3300033464 Ga0315915_1000017 Ga0315915_100001771 356
779 3300035695 Ga0373927_0000178 Ga0373927_0000178_35074_36159 356
780 3300037068 Ga0373925_0006563 Ga0373925_0006563_6904_7989 356
781 3300037471 Ga0395905_0005481 Ga0395905_0005481_4365_5447 356
782 3300041501 Ga0451845_0228987 Ga0451845_0228987_1141_2232 356
783 3300041503 Ga0451847_0438550 Ga0451847_0438550_128_1213 356
784 3300046522 Ga0495643_0014700 Ga0495643_0014700_2169_3269 356
785 3300048924 Ga0496121_0003418 Ga0496121_0003418_5331_6434 356
786 3300048925 Ga0496122_0005737 Ga0496122_0005737_9937_11043 356
787 3300049569 Ga0501032_0000018 Ga0501032_0000018_112546_113655 356
788 3300049570 Ga0501033_0000032 Ga0501033_0000032_112557_113666 356
789 3300049571 Ga0501034_0000103 Ga0501034_0000103_42639_43748 356
790 3300049572 Ga0501036_0000012 Ga0501036_0000012_112557_113666 356
791 3300049573 Ga0501037_0000018 Ga0501037_0000018_42639_43748 356
792 3300049574 Ga0501038_0000017 Ga0501038_0000017_42639_43748 356
793 3300049575 Ga0501039_0000024 Ga0501039_0000024_42639_43748 356
794 3300049576 Ga0501040_0018285 Ga0501040_0018285_235_1344 356
795 3300049579 Ga0501043_0000272 Ga0501043_0000272_14569_15678 356
796 3300049586 Ga0501070_0061899 Ga0501070_0061899_1299_2408 356
797 3300049822 Ga0501035_0000040 Ga0501035_0000040_42597_43706 356
798 3300049823 Ga0501044_0000040 Ga0501044_0000040_42639_43748 356
799 3300050496 nmdc:mga07m45_18207_c1 nmdc:mga07m45_18207_c1_1614_2699 356
800 3300053134 Ga0500658_0003533 Ga0500658_0003533_2689_3780 356
801 3300053151 Ga0500604_0013437 Ga0500604_0013437_202_1302 356
802 iso_pu_bacteria 2508501122 2509111221 356
803 iso_pu_bacteria 2509276021 2509391011 356
804 iso_pu_bacteria 2509276033 2509441829 356
805 iso_pu_bacteria 2510461076 2510893304 356
806 iso_pu_bacteria 2510917022 2511135748 356
807 iso_pu_bacteria 2510917028 2511181410 356
808 iso_pu_bacteria 2513237144 2513913877 356
809 iso_pu_bacteria 2513237162 2514019236 356
810 iso_pu_bacteria 2515154113 2515634275 356
811 iso_pu_bacteria 2515154114 2515641848 356
812 iso_pu_bacteria 2515154116 2515658873 356
813 iso_pu_bacteria 2517093000 2517100144 356
814 iso_pu_bacteria 2517287029 2517411327 356
815 iso_pu_bacteria 2519899620 2520376834 356
816 iso_pu_bacteria 2529292951 2530648556 356
817 iso_pu_bacteria 2582581307 2585274880 356
818 iso_pu_bacteria 2582581308 2585277940 356
819 iso_pu_bacteria 2582581316 2585333266 356
820 iso_pu_bacteria 2582581866 2585395634 356
821 iso_pu_bacteria 2582581867 2585405127 356
822 iso_pu_bacteria 2585427527 2585533196 356
823 iso_pu_bacteria 2585427528 2585538865 356
824 iso_pu_bacteria 2585427530 2585555617 356
825 iso_pu_bacteria 2585427590 2585823329 356
826 iso_pu_bacteria 2585427593 2585836816 356
827 iso_pu_bacteria 2585427608 2585902377 356
828 iso_pu_bacteria 2585427609 2585907998 356
829 iso_pu_bacteria 2585428125 2587983418 356
830 iso_pu_bacteria 2615840624 2616294282 356
831 iso_pu_bacteria 2615840626 2616309137 356
832 iso_pu_bacteria 2615840698 2616555347 356
833 iso_pu_bacteria 2617270742 2617386127 356
834 iso_pu_bacteria 2667528174 2671115570 356
835 iso_pu_bacteria 2718217882 2719184241 356
836 iso_pu_bacteria 2718217997 2719669581 356
837 iso_pu_bacteria 2718218009 2719729814 356
838 iso_pu_bacteria 2718218199 2720494597 356
839 iso_pu_bacteria 2718218363 2721144064 356
840 iso_pu_bacteria 2718218365 2721156752 356
841 iso_pu_bacteria 2718218366 2721161439 356
842 iso_pu_bacteria 2718218423 2721403624 356
843 iso_pu_bacteria 2721755514 2722837392 356
844 iso_pu_bacteria 2721755686 2723574171 356
845 iso_pu_bacteria 2721755809 2724035200 356
846 iso_pu_bacteria 2721755810 2724040968 356
847 iso_pu_bacteria 2721755823 2724108252 356
848 iso_pu_bacteria 2724679232 2725946421 356
849 iso_pu_bacteria 2728369365 2730162381 356
850 iso_pu_bacteria 2728369397 2730295513 356
851 iso_pu_bacteria 2738541333 2739034287 356
852 iso_pu_bacteria 2738543031 2739348212 356
853 iso_pu_bacteria 2751185821 2753459236 356
854 iso_pu_bacteria 2775507266 2778173461 356
855 iso_pu_bacteria 2791355259 2793312841 356
856 iso_pu_bacteria 2791355260 2793321867 356
857 iso_pu_bacteria 2791355261 2793326890 356
858 iso_pu_bacteria 2791355262 2793334606 356
859 iso_pu_bacteria 2791355263 2793340646 356
860 iso_pu_bacteria 2791355264 2793348567 356
861 iso_pu_bacteria 2791355265 2793354189 356
862 iso_pu_bacteria 2791355266 2793361732 356
863 iso_pu_bacteria 2791355267 2793367249 356
864 iso_pu_bacteria 2802429605 2805929804 356
865 iso_pu_bacteria 2802429633 2806043088 356
866 iso_pu_bacteria 2802429634 2806051040 356
867 iso_pu_bacteria 2802429635 2806057791 356
868 iso_pu_bacteria 2802429636 2806065492 356
869 iso_pu_bacteria 2802429637 2806075267 356
870 iso_pu_bacteria 2818991448 2819610930 356
871 iso_pu_bacteria 2818991461 2819684752 356
872 iso_pu_bacteria 2838022645 2838027152 356
873 iso_pu_bacteria 2838029111 2838030436 356
874 iso_pu_bacteria 2838061910 2838066425 356
875 iso_pu_bacteria 2838668709 2838669087 356
876 iso_pu_bacteria 2838680041 2838686042 356
877 iso_pu_bacteria 2838694306 2838700587 356
878 iso_pu_bacteria 2838701080 2838701253 356
879 iso_pu_bacteria 2838707686 2838713866 356
880 iso_pu_bacteria 2841864319 2841865652 356
881 iso_pu_bacteria 2842077413 2842082980 356
882 iso_pu_bacteria 2842118031 2842124211 356
883 iso_pu_bacteria 2842146304 2842146682 356
884 iso_pu_bacteria 2842192696 2842193925 356
885 iso_pu_bacteria 2842198810 2842200626 356
886 iso_pu_bacteria 2842205361 2842208499 356
887 iso_pu_bacteria 2842237096 2842243279 356
888 iso_pu_bacteria 2842250916 2842251088 356
889 iso_pu_bacteria 2842278818 2842282155 356
890 iso_pu_bacteria 2842285085 2842289184 356
891 iso_pu_bacteria 2842291075 2842297239 356
892 iso_pu_bacteria 2842341865 2842345582 356
893 iso_pu_bacteria 2842363717 2842363879 356
894 iso_pu_bacteria 2842370503 2842376339 356
895 iso_pu_bacteria 2842377471 2842383633 356
896 iso_pu_bacteria 2842384541 2842390772 356
897 iso_pu_bacteria 2842402390 2842407390 356
898 iso_pu_bacteria 2842409023 2842413361 356
899 iso_pu_bacteria 2842415677 2842420004 356
900 iso_pu_bacteria 2842475841 2842477284 356
901 iso_pu_bacteria 2842489311 2842490678 356
902 iso_pu_bacteria 2842502639 2842504081 356
903 iso_pu_bacteria 2842509118 2842512579 356
904 iso_pu_bacteria 2852387548 2852393171 356
905 iso_pu_bacteria 2871488783 2871493461 356
906 iso_pu_bacteria 2874168670 2874175021 356
907 iso_pu_bacteria 2878753008 2878757504 356
908 iso_pu_bacteria 2881845957 2881846820 356
909 iso_pu_bacteria 2882632389 2882639440 356
910 iso_pu_bacteria 2903492973 2903501233 356
911 iso_pu_bacteria 2919408235 2919412226 356
912 iso_pu_bacteria 2923556063 2923561340 356
913 iso_pu_bacteria 2935894831 2935900903 356
914 iso_pu_bacteria 2936367885 2936370879 356
915 iso_pu_bacteria 2936381700 2936382568 356
916 iso_pu_bacteria 2937822353 2937822494 356
917 iso_pu_bacteria 2958172287 2958173353 356
918 iso_pu_bacteria 2961170736 2961175168 356
919 iso_pu_bacteria 2967996073 2967999830 356
920 iso_pu_bacteria 2968003550 2968008189 356
921 iso_pu_bacteria 2970503327 2970507756 356
922 iso_pu_bacteria 2977821940 2977826662 356
923 iso_pu_bacteria 2979808191 2979812940 356
924 iso_pu_bacteria 2980125574 2980127581 356
925 iso_pu_bacteria 2987652177 2987658327 356
926 iso_pu_bacteria 3003930520 3003933781 356
927 iso_pu_bacteria 3005416602 3005422399 356
928 iso_pu_bacteria 8004374579 8004379078 356
929 iso_pu_bacteria 8005258706 8005260599 356
930 iso_pu_bacteria 8005301065 8005307384 356
931 iso_pu_bacteria 8005314921 8005320264 356
932 iso_pu_bacteria 8005430974 8005435737 356
933 iso_pu_bacteria 8005484373 8005488001 356
934 iso_pu_bacteria 8005570704 8005575939 356
935 iso_pu_bacteria 8005645114 8005651577 356
936 iso_pu_bacteria 8005688590 8005688673 356
937 iso_pu_bacteria 8005695170 8005695296 356
938 iso_pu_bacteria 8018127388 8018134596 356
939 iso_pu_bacteria 8018176218 8018180694 356
940 iso_pu_bacteria 8024501048 8024506981 356
941 iso_pu_bacteria 8056375014 8056381922 356
942 iso_pu_bacteria 8056382006 8056385451 356
943 3300002739 JGI25158J39367_1000114 JGI25158J39367_100011410 357
944 3300002773 JGI25152J39213_1001028 JGI25152J39213_10010284 357
945 3300002773 JGI25152J39213_1002374 JGI25152J39213_10023745 357
946 3300002773 JGI25152J39213_1002735 JGI25152J39213_10027352 357
947 3300002773 JGI25152J39213_1007073 JGI25152J39213_10070732 357
948 3300002773 JGI25152J39213_1015934 JGI25152J39213_10159341 357
949 3300002774 JGI25150J39212_1009736 JGI25150J39212_10097362 357
950 3300002987 JGI25159J45721_1000901 JGI25159J45721_10009012 357
951 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008371 357
952 3300003214 JGI25165J46597_1000034 JGI25165J46597_1000034133 357
953 3300003215 JGI25153J46596_10007239 JGI25153J46596_100072394 357
954 3300003215 JGI25153J46596_10008061 JGI25153J46596_100080612 357
955 3300003215 JGI25153J46596_10017059 JGI25153J46596_100170592 357
956 3300003215 JGI25153J46596_10035004 JGI25153J46596_100350042 357
957 3300003215 JGI25153J46596_10036805 JGI25153J46596_100368052 357
958 3300003354 JGI25160J50197_1034397 JGI25160J50197_10343971 357
959 3300003374 JGI25161J50226_1000138 JGI25161J50226_100013815 357
960 3300003771 Ga0055526_1004066 Ga0055526_10040664 357
961 3300003775 Ga0055524_1000866 Ga0055524_10008668 357
962 3300003775 Ga0055524_1003883 Ga0055524_10038834 357
963 3300003775 Ga0055524_1031085 Ga0055524_10310852 357
964 3300003790 Ga0055528_1000358 Ga0055528_100035818 357
965 3300003790 Ga0055528_1001985 Ga0055528_10019852 357
966 3300003792 Ga0055540_1000354 Ga0055540_100035418 357
967 3300003792 Ga0055540_1012783 Ga0055540_10127832 357
968 3300004625 Ga0055543_1000053 Ga0055543_100005346 357
969 3300005262 Ga0065165_1010346 Ga0065165_10103464 357
970 3300005262 Ga0065165_1017039 Ga0065165_10170392 357
971 3300005548 Ga0070665_100048689 Ga0070665_1000486893 357
972 3300006038 Ga0075365_10000404 Ga0075365_100004043 357
973 3300006048 Ga0075363_100061357 Ga0075363_1000613572 357
974 3300006051 Ga0075364_10107695 Ga0075364_101076952 357
975 3300006177 Ga0075362_10013941 Ga0075362_100139413 357
976 3300006186 Ga0075369_10008292 Ga0075369_100082922 357
977 3300006353 Ga0075370_10056651 Ga0075370_100566513 357
978 3300006353 Ga0075370_10089816 Ga0075370_100898162 357
979 3300009092 Ga0105250_10026148 Ga0105250_100261483 357
980 3300009093 Ga0105240_10190465 Ga0105240_101904653 357
981 3300009545 Ga0105237_10023717 Ga0105237_100237174 357
982 3300009766 Ga0123342_1014890 Ga0123342_10148901 357
983 3300009766 Ga0123342_1022395 Ga0123342_10223952 357
984 3300014497 Ga0182008_10081962 Ga0182008_100819622 357
985 3300015261 Ga0182006_1024659 Ga0182006_10246592 357
986 3300025208 Ga0209436_100085 Ga0209436_10008533 357
987 3300025245 Ga0207425_1000024 Ga0207425_1000024179 357
988 3300025245 Ga0207425_1004620 Ga0207425_10046202 357
989 3300025258 Ga0209129_1000184 Ga0209129_100018467 357
990 3300025258 Ga0209129_1000703 Ga0209129_10007034 357
991 3300025258 Ga0209129_1000735 Ga0209129_100073517 357
992 3300025258 Ga0209129_1003786 Ga0209129_10037865 357
993 3300025261 Ga0209233_1000028 Ga0209233_1000028137 357
994 3300025273 Ga0209673_1000010 Ga0209673_100001018 357
995 3300025273 Ga0209673_1000013 Ga0209673_1000013309 357
996 3300025273 Ga0209673_1000850 Ga0209673_100085015 357
997 3300025273 Ga0209673_1001263 Ga0209673_100126325 357
998 3300025273 Ga0209673_1010610 Ga0209673_10106104 357
999 3300025284 Ga0209130_1000081 Ga0209130_100008143 357
1000 3300025284 Ga0209130_1011586 Ga0209130_10115862 357
1001 3300025294 Ga0209025_1000050 Ga0209025_1000050148 357
1002 3300025294 Ga0209025_1003832 Ga0209025_100383213 357
1003 3300025294 Ga0209025_1009418 Ga0209025_10094183 357
1004 3300025294 Ga0209025_1012443 Ga0209025_10124434 357
1005 3300025294 Ga0209025_1021164 Ga0209025_10211642 357
1006 3300025294 Ga0209025_1048271 Ga0209025_10482712 357
1007 3300025295 Ga0209564_1000260 Ga0209564_100026064 357
1008 3300025295 Ga0209564_1000920 Ga0209564_100092038 357
1009 3300025295 Ga0209564_1008530 Ga0209564_10085304 357
1010 3300025297 Ga0209758_1000083 Ga0209758_1000083109 357
1011 3300025297 Ga0209758_1001756 Ga0209758_10017564 357
1012 3300025297 Ga0209758_1010395 Ga0209758_10103954 357
1013 3300025297 Ga0209758_1011368 Ga0209758_10113684 357
1014 3300025297 Ga0209758_1022153 Ga0209758_10221532 357
1015 3300025298 Ga0209050_1003249 Ga0209050_10032495 357
1016 3300025299 Ga0209256_1000588 Ga0209256_100058838 357
1017 3300025299 Ga0209256_1001127 Ga0209256_100112718 357
1018 3300025302 Ga0207426_1000008 Ga0207426_1000008523 357
1019 3300025302 Ga0207426_1000952 Ga0207426_10009526 357
1020 3300025303 Ga0209051_1000611 Ga0209051_100061125 357
1021 3300025303 Ga0209051_1003836 Ga0209051_10038362 357
1022 3300025304 Ga0209257_1002801 Ga0209257_100280114 357
1023 3300025304 Ga0209257_1016092 Ga0209257_10160922 357
1024 3300028379 Ga0268266_10050551 Ga0268266_100505514 357
1025 3300031456 Ga0307513_10039598 Ga0307513_100395984 357
1026 3300031731 Ga0307405_10000781 Ga0307405_100007817 357
1027 3300031911 Ga0307412_10001925 Ga0307412_100019254 357
1028 3300037471 Ga0395905_0028189 Ga0395905_0028189_611_1717 357
1029 3300041413 Ga0439465_0018497 Ga0439465_0018497_119_1210 357
1030 3300041507 Ga0451851_0738755 Ga0451851_0738755_26_1132 357
1031 3300044658 Ga0466972_0007846 Ga0466972_0007846_1400_2500 357
1032 3300044901 Ga0466960_0005504 Ga0466960_0005504_3563_4666 357
1033 3300046530 Ga0495654_0000090 Ga0495654_0000090_65689_66798 357
1034 3300048908 Ga0496105_0074327 Ga0496105_0074327_1352_2437 357
1035 3300048909 Ga0496106_0042115 Ga0496106_0042115_2043_3134 357
1036 3300048919 Ga0496116_0001006 Ga0496116_0001006_29397_30482 357
1037 3300048919 Ga0496116_0032795 Ga0496116_0032795_2468_3553 357
1038 3300048919 Ga0496116_0153995 Ga0496116_0153995_57_1163 357
1039 3300048920 Ga0496117_0037531 Ga0496117_0037531_2304_3389 357
1040 3300048921 Ga0496118_0070679 Ga0496118_0070679_61_1146 357
1041 3300048922 Ga0496119_0020432 Ga0496119_0020432_573_1673 357
1042 3300048922 Ga0496119_0041239 Ga0496119_0041239_1375_2460 357
1043 3300048923 Ga0496120_0007056 Ga0496120_0007056_4170_5270 357
1044 3300048924 Ga0496121_0081200 Ga0496121_0081200_1150_2235 357
1045 3300048924 Ga0496121_0188433 Ga0496121_0188433_199_1290 357
1046 3300048924 Ga0496121_0234919 Ga0496121_0234919_15_1100 357
1047 3300048925 Ga0496122_0007566 Ga0496122_0007566_3925_5010 357
1048 3300048925 Ga0496122_0051416 Ga0496122_0051416_1727_2818 357
1049 3300048925 Ga0496122_0120205 Ga0496122_0120205_153_1238 357
1050 3300048925 Ga0496122_0164190 Ga0496122_0164190_30_1115 357
1051 3300048926 Ga0496123_0010860 Ga0496123_0010860_1028_2113 357
1052 3300048926 Ga0496123_0024387 Ga0496123_0024387_3253_4344 357
1053 3300048927 Ga0496124_0011049 Ga0496124_0011049_6059_7144 357
1054 3300048927 Ga0496124_0017189 Ga0496124_0017189_2394_3479 357
1055 3300048927 Ga0496124_0044094 Ga0496124_0044094_1481_2566 357
1056 3300048927 Ga0496124_0190179 Ga0496124_0190179_389_1474 357
1057 3300048928 Ga0496125_0017725 Ga0496125_0017725_2537_3622 357
1058 3300048928 Ga0496125_0038324 Ga0496125_0038324_564_1649 357
1059 3300048929 Ga0496126_0086418 Ga0496126_0086418_1341_2426 357
1060 3300049570 Ga0501033_0082804 Ga0501033_0082804_1052_2155 357
1061 3300049571 Ga0501034_0119079 Ga0501034_0119079_193_1296 357
1062 3300049579 Ga0501043_0079780 Ga0501043_0079780_29_1114 357
1063 3300049744 Ga0501083_0063042 Ga0501083_0063042_1094_2185 357
1064 3300049822 Ga0501035_0245029 Ga0501035_0245029_255_1358 357
1065 3300049823 Ga0501044_0023564 Ga0501044_0023564_337_1440 357
1066 3300049823 Ga0501044_0076816 Ga0501044_0076816_1456_2541 357
1067 3300050489 nmdc:mga03683_14071_c1 nmdc:mga03683_14071_c1_1297_2385 357
1068 3300050491 nmdc:mga00v17_92984_c1 nmdc:mga00v17_92984_c1_525_1613 357
1069 3300053156 Ga0500622_0002179 Ga0500622_0002179_9540_10625 357
1070 iso_pu_bacteria 2503198000 2503199765 357
1071 iso_pu_bacteria 2508501123 2509114747 357
1072 iso_pu_bacteria 2508501127 2509142410 357
1073 iso_pu_bacteria 2509276018 2509372004 357
1074 iso_pu_bacteria 2509276021 2509392529 357
1075 iso_pu_bacteria 2509276022 2509394694 357
1076 iso_pu_bacteria 2509276033 2509446556 357
1077 iso_pu_bacteria 2509276033 2509446558 357
1078 iso_pu_bacteria 2510065059 2510318725 357
1079 iso_pu_bacteria 2511231027 2511391055 357
1080 iso_pu_bacteria 2512875024 2512960836 357
1081 iso_pu_bacteria 2513237090 2513608927 357
1082 iso_pu_bacteria 2513237164 2514036607 357
1083 iso_pu_bacteria 2513237305 2514417418 357
1084 iso_pu_bacteria 2529292951 2530645654 357
1085 iso_pu_bacteria 2597489875 2597811014 357
1086 iso_pu_bacteria 2615840624 2616292341 357
1087 iso_pu_bacteria 2687453392 2688597019 357
1088 iso_pu_bacteria 2693429783 2694630279 357
1089 iso_pu_bacteria 2693429784 2694635613 357
1090 iso_pu_bacteria 2718217882 2719181304 357
1091 iso_pu_bacteria 2718217927 2719385912 357
1092 iso_pu_bacteria 2718217997 2719665728 357
1093 iso_pu_bacteria 2718218009 2719732053 357
1094 iso_pu_bacteria 2718218199 2720492148 357
1095 iso_pu_bacteria 2718218232 2720613413 357
1096 iso_pu_bacteria 2718218233 2720620291 357
1097 iso_pu_bacteria 2718218235 2720631715 357
1098 iso_pu_bacteria 2718218269 2720775443 357
1099 iso_pu_bacteria 2718218363 2721147398 357
1100 iso_pu_bacteria 2718218365 2721158932 357
1101 iso_pu_bacteria 2718218366 2721164316 357
1102 iso_pu_bacteria 2718218423 2721399691 357
1103 iso_pu_bacteria 2721755514 2722840486 357
1104 iso_pu_bacteria 2721755556 2723027061 357
1105 iso_pu_bacteria 2721755684 2723560673 357
1106 iso_pu_bacteria 2721755685 2723567262 357
1107 iso_pu_bacteria 2721755809 2724038504 357
1108 iso_pu_bacteria 2721755810 2724044809 357
1109 iso_pu_bacteria 2721755819 2724090050 357
1110 iso_pu_bacteria 2721755822 2724104527 357
1111 iso_pu_bacteria 2721755823 2724110321 357
1112 iso_pu_bacteria 2728369352 2730107997 357
1113 iso_pu_bacteria 2728369365 2730164541 357
1114 iso_pu_bacteria 2728369397 2730298564 357
1115 iso_pu_bacteria 2738541293 2738804203 357
1116 iso_pu_bacteria 2757320392 2757572118 357
1117 iso_pu_bacteria 2767802442 2770198897 357
1118 iso_pu_bacteria 2775506902 2776272876 357
1119 iso_pu_bacteria 2775506904 2776282281 357
1120 iso_pu_bacteria 2791355123 2792748229 357
1121 iso_pu_bacteria 2791355256 2793294805 357
1122 iso_pu_bacteria 2791355259 2793312383 357
1123 iso_pu_bacteria 2791355260 2793322922 357
1124 iso_pu_bacteria 2791355261 2793331011 357
1125 iso_pu_bacteria 2791355262 2793335929 357
1126 iso_pu_bacteria 2791355263 2793341647 357
1127 iso_pu_bacteria 2791355264 2793348947 357
1128 iso_pu_bacteria 2791355265 2793352945 357
1129 iso_pu_bacteria 2791355266 2793364352 357
1130 iso_pu_bacteria 2791355267 2793366863 357
1131 iso_pu_bacteria 2802429605 2805925827 357
1132 iso_pu_bacteria 2802429606 2805933453 357
1133 iso_pu_bacteria 2838016132 2838018084 357
1134 iso_pu_bacteria 2838022645 2838026291 357
1135 iso_pu_bacteria 2838042994 2838043570 357
1136 iso_pu_bacteria 2838048938 2838053487 357
1137 iso_pu_bacteria 2838061910 2838065682 357
1138 iso_pu_bacteria 2838068647 2838074397 357
1139 iso_pu_bacteria 2838668709 2838673743 357
1140 iso_pu_bacteria 2838680041 2838682083 357
1141 iso_pu_bacteria 2838694306 2838696655 357
1142 iso_pu_bacteria 2838701080 2838706239 357
1143 iso_pu_bacteria 2838707686 2838710106 357
1144 iso_pu_bacteria 2841734538 2841737519 357
1145 iso_pu_bacteria 2841864319 2841864407 357
1146 iso_pu_bacteria 2842077413 2842078279 357
1147 iso_pu_bacteria 2842118031 2842119213 357
1148 iso_pu_bacteria 2842146304 2842150993 357
1149 iso_pu_bacteria 2842192696 2842194392 357
1150 iso_pu_bacteria 2842198810 2842201776 357
1151 iso_pu_bacteria 2842205361 2842205910 357
1152 iso_pu_bacteria 2842237096 2842239518 357
1153 iso_pu_bacteria 2842250916 2842255861 357
1154 iso_pu_bacteria 2842264693 2842265917 357
1155 iso_pu_bacteria 2842278818 2842279367 357
1156 iso_pu_bacteria 2842285085 2842286017 357
1157 iso_pu_bacteria 2842291075 2842291941 357
1158 iso_pu_bacteria 2842311132 2842314363 357
1159 iso_pu_bacteria 2842317721 2842317787 357
1160 iso_pu_bacteria 2842341865 2842345243 357
1161 iso_pu_bacteria 2842363717 2842364689 357
1162 iso_pu_bacteria 2842370503 2842372650 357
1163 iso_pu_bacteria 2842377471 2842378337 357
1164 iso_pu_bacteria 2842384541 2842385722 357
1165 iso_pu_bacteria 2842395702 2842398810 357
1166 iso_pu_bacteria 2842402390 2842403377 357
1167 iso_pu_bacteria 2842409023 2842409250 357
1168 iso_pu_bacteria 2842415677 2842415904 357
1169 iso_pu_bacteria 2842422224 2842427487 357
1170 iso_pu_bacteria 2842428310 2842429446 357
1171 iso_pu_bacteria 2842434925 2842436059 357
1172 iso_pu_bacteria 2842441272 2842442406 357
1173 iso_pu_bacteria 2842447887 2842450697 357
1174 iso_pu_bacteria 2842462802 2842463867 357
1175 iso_pu_bacteria 2842469257 2842470388 357
1176 iso_pu_bacteria 2842489311 2842490145 357
1177 iso_pu_bacteria 2842495871 2842496058 357
1178 iso_pu_bacteria 2844009547 2844012364 357
1179 iso_pu_bacteria 2847670302 2847674739 357
1180 iso_pu_bacteria 2856314179 2856317375 357
1181 iso_pu_bacteria 2856328259 2856334638 357
1182 iso_pu_bacteria 2856334872 2856341216 357
1183 iso_pu_bacteria 2856349417 2856350733 357
1184 iso_pu_bacteria 2857367948 2857371724 357
1185 iso_pu_bacteria 2869162929 2869165750 357
1186 iso_pu_bacteria 2869169390 2869172801 357
1187 iso_pu_bacteria 2869234852 2869241586 357
1188 iso_pu_bacteria 2869242130 2869246980 357
1189 iso_pu_bacteria 2869249662 2869254152 357
1190 iso_pu_bacteria 2869256925 2869257815 357
1191 iso_pu_bacteria 2869264136 2869269997 357
1192 iso_pu_bacteria 2869271264 2869277432 357
1193 iso_pu_bacteria 2871435913 2871439251 357
1194 iso_pu_bacteria 2871451962 2871456011 357
1195 iso_pu_bacteria 2871459585 2871463457 357
1196 iso_pu_bacteria 2871474448 2871477002 357
1197 iso_pu_bacteria 2871481445 2871481752 357
1198 iso_pu_bacteria 2874109183 2874113465 357
1199 iso_pu_bacteria 2874116593 2874116766 357
1200 iso_pu_bacteria 2874131515 2874135693 357
1201 iso_pu_bacteria 2874162495 2874163089 357
1202 iso_pu_bacteria 2876386047 2876392542 357
1203 iso_pu_bacteria 2876399893 2876402632 357
1204 iso_pu_bacteria 2876406927 2876411516 357
1205 iso_pu_bacteria 2876420981 2876421373 357
1206 iso_pu_bacteria 2878035449 2878038413 357
1207 iso_pu_bacteria 2878730984 2878735582 357
1208 iso_pu_bacteria 2878738818 2878744754 357
1209 iso_pu_bacteria 2878774303 2878776744 357
1210 iso_pu_bacteria 2878781027 2878782791 357
1211 iso_pu_bacteria 2878788777 2878795594 357
1212 iso_pu_bacteria 2881155292 2881160829 357
1213 iso_pu_bacteria 2881853255 2881858031 357
1214 iso_pu_bacteria 2885312484 2885313076 357
1215 iso_pu_bacteria 2885342637 2885344171 357
1216 iso_pu_bacteria 2885350715 2885352862 357
1217 iso_pu_bacteria 2888337043 2888338082 357
1218 iso_pu_bacteria 2888350351 2888354745 357
1219 iso_pu_bacteria 2889010040 2889016362 357
1220 iso_pu_bacteria 2889016732 2889018614 357
1221 iso_pu_bacteria 2894652903 2894656812 357
1222 iso_pu_bacteria 2903513507 2903514352 357
1223 iso_pu_bacteria 2906354277 2906360467 357
1224 iso_pu_bacteria 2906363423 2906363467 357
1225 iso_pu_bacteria 2906370794 2906376259 357
1226 iso_pu_bacteria 2906401398 2906403022 357
1227 iso_pu_bacteria 2906408224 2906409106 357
1228 iso_pu_bacteria 2906414383 2906417440 357
1229 iso_pu_bacteria 2906427513 2906430514 357
1230 iso_pu_bacteria 2922130491 2922136348 357
1231 iso_pu_bacteria 2922151315 2922156562 357
1232 iso_pu_bacteria 2922172374 2922173745 357
1233 iso_pu_bacteria 2922178524 2922180890 357
1234 iso_pu_bacteria 2922185730 2922187538 357
1235 iso_pu_bacteria 2924710171 2924710631 357
1236 iso_pu_bacteria 2924718760 2924723641 357
1237 iso_pu_bacteria 2924733363 2924739040 357
1238 iso_pu_bacteria 2924741084 2924746922 357
1239 iso_pu_bacteria 2924748358 2924749634 357
1240 iso_pu_bacteria 2924776078 2924782785 357
1241 iso_pu_bacteria 2933599457 2933604853 357
1242 iso_pu_bacteria 2935894831 2935897490 357
1243 iso_pu_bacteria 2936381700 2936387232 357
1244 iso_pu_bacteria 2937836603 2937840244 357
1245 iso_pu_bacteria 2937861824 2937864637 357
1246 iso_pu_bacteria 2937868953 2937873845 357
1247 iso_pu_bacteria 2937980651 2937983939 357
1248 iso_pu_bacteria 2958064165 2958070403 357
1249 iso_pu_bacteria 2958071322 2958071453 357
1250 iso_pu_bacteria 2958100919 2958103735 357
1251 iso_pu_bacteria 2958108152 2958114500 357
1252 iso_pu_bacteria 2958122699 2958129474 357
1253 iso_pu_bacteria 2958137437 2958141435 357
1254 iso_pu_bacteria 2958144490 2958151209 357
1255 iso_pu_bacteria 2958158011 2958159991 357
1256 iso_pu_bacteria 2961127735 2961130278 357
1257 iso_pu_bacteria 2961136820 2961140430 357
1258 iso_pu_bacteria 2961183825 2961190200 357
1259 iso_pu_bacteria 2965025482 2965027089 357
1260 iso_pu_bacteria 2965032056 2965035152 357
1261 iso_pu_bacteria 2965040258 2965047414 357
1262 iso_pu_bacteria 2965047637 2965050942 357
1263 iso_pu_bacteria 2965089291 2965095704 357
1264 iso_pu_bacteria 2965102966 2965109436 357
1265 iso_pu_bacteria 2965119406 2965123395 357
1266 iso_pu_bacteria 2970489779 2970492763 357
1267 iso_pu_bacteria 2970510686 2970516582 357
1268 iso_pu_bacteria 2970524798 2970527146 357
1269 iso_pu_bacteria 2970532167 2970535165 357
1270 iso_pu_bacteria 2970540015 2970544173 357
1271 iso_pu_bacteria 2970547951 2970551183 357
1272 iso_pu_bacteria 2970593180 2970600215 357
1273 iso_pu_bacteria 2970619444 2970622484 357
1274 iso_pu_bacteria 2970627176 2970629735 357
1275 iso_pu_bacteria 2977851361 2977857935 357
1276 iso_pu_bacteria 2977872689 2977872828 357
1277 iso_pu_bacteria 2977898635 2977906355 357
1278 iso_pu_bacteria 2977907340 2977912891 357
1279 iso_pu_bacteria 2977915119 2977917671 357
1280 iso_pu_bacteria 2977935797 2977937807 357
1281 iso_pu_bacteria 2977950692 2977956895 357
1282 iso_pu_bacteria 2977957713 2977965166 357
1283 iso_pu_bacteria 2979710463 2979710966 357
1284 iso_pu_bacteria 2979742915 2979743659 357
1285 iso_pu_bacteria 2979764755 2979771539 357
1286 iso_pu_bacteria 2979772303 2979775811 357
1287 iso_pu_bacteria 2987645492 2987651418 357
1288 iso_pu_bacteria 2987673487 2987673566 357
1289 iso_pu_bacteria 2996386984 2996387225 357
1290 iso_pu_bacteria 2996893221 2996894040 357
1291 iso_pu_bacteria 3000135777 3000139366 357
1292 iso_pu_bacteria 3004195979 3004199464 357
1293 iso_pu_bacteria 3004232784 3004236197 357
1294 iso_pu_bacteria 3004239961 3004242759 357
1295 iso_pu_bacteria 3004268573 3004274150 357
1296 iso_pu_bacteria 3004334049 3004336004 357
1297 iso_pu_bacteria 649633066 649871575 357
1298 iso_pu_bacteria 8004300914 8004302236 357
1299 iso_pu_bacteria 8004312739 8004313905 357
1300 iso_pu_bacteria 8004361976 8004364708 357
1301 iso_pu_bacteria 8004633249 8004637464 357
1302 iso_pu_bacteria 8004695233 8004698471 357
1303 iso_pu_bacteria 8004727605 8004733937 357
1304 iso_pu_bacteria 8005275841 8005280693 357
1305 iso_pu_bacteria 8005282627 8005287094 357
1306 iso_pu_bacteria 8005289223 8005293216 357
1307 iso_pu_bacteria 8005301065 8005302679 357
1308 iso_pu_bacteria 8005382845 8005385362 357
1309 iso_pu_bacteria 8005395548 8005396645 357
1310 iso_pu_bacteria 8005430974 8005435940 357
1311 iso_pu_bacteria 8005497431 8005500459 357
1312 iso_pu_bacteria 8005619151 8005621837 357
1313 iso_pu_bacteria 8005626139 8005627079 357
1314 iso_pu_bacteria 8005668836 8005671877 357
1315 iso_pu_bacteria 8005688590 8005694695 357
1316 iso_pu_bacteria 8005695170 8005699883 357
1317 iso_pu_bacteria 8018127388 8018130037 357
1318 iso_pu_bacteria 8018176218 8018179710 357
1319 iso_pu_bacteria 8024501048 8024501520 357
1320 iso_pu_bacteria 8055617313 8055619237 357
1321 iso_pu_bacteria 8056375014 8056376748 357
1322 iso_pu_bacteria 8056382006 8056387959 357
1323 3300001979 JGI24740J21852_10000166 JGI24740J21852_1000016623 358
1324 3300002704 JGI25155J39150_1000001 JGI25155J39150_100000132 358
1325 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001300 358
1326 3300002737 JGI25162J39368_1000331 JGI25162J39368_100033132 358
1327 3300002737 JGI25162J39368_1001207 JGI25162J39368_100120712 358
1328 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001183 358
1329 3300002741 JGI25157J39369_1000030 JGI25157J39369_1000030102 358
1330 3300002987 JGI25159J45721_1000410 JGI25159J45721_10004102 358
1331 3300003187 JGI25151J46595_10007493 JGI25151J46595_100074934 358
1332 3300003214 JGI25165J46597_1000449 JGI25165J46597_100044932 358
1333 3300003214 JGI25165J46597_1001607 JGI25165J46597_100160711 358
1334 3300003214 JGI25165J46597_1002413 JGI25165J46597_10024133 358
1335 3300003354 JGI25160J50197_1000010 JGI25160J50197_100001088 358
1336 3300003354 JGI25160J50197_1000216 JGI25160J50197_10002169 358
1337 3300003374 JGI25161J50226_1000006 JGI25161J50226_100000688 358
1338 3300003374 JGI25161J50226_1000938 JGI25161J50226_10009389 358
1339 3300003771 Ga0055526_1000594 Ga0055526_100059419 358
1340 3300003794 Ga0055531_10007809 Ga0055531_100078095 358
1341 3300003856 Ga0058692_1002834 Ga0058692_10028344 358
1342 3300004625 Ga0055543_1000171 Ga0055543_10001711 358
1343 3300004625 Ga0055543_1001102 Ga0055543_10011029 358
1344 3300005262 Ga0065165_1000485 Ga0065165_100048553 358
1345 3300005262 Ga0065165_1000717 Ga0065165_10007179 358
1346 3300005262 Ga0065165_1009792 Ga0065165_10097922 358
1347 3300005548 Ga0070665_100071066 Ga0070665_1000710662 358
1348 3300005614 Ga0068856_100020306 Ga0068856_1000203065 358
1349 3300006042 Ga0075368_10032205 Ga0075368_100322052 358
1350 3300006048 Ga0075363_100008310 Ga0075363_1000083104 358
1351 3300006051 Ga0075364_10011277 Ga0075364_100112772 358
1352 3300006177 Ga0075362_10004177 Ga0075362_100041774 358
1353 3300006178 Ga0075367_10083124 Ga0075367_100831242 358
1354 3300006186 Ga0075369_10053616 Ga0075369_100536162 358
1355 3300006948 Ga0099826_10000054 Ga0099826_1000005420 358
1356 3300009093 Ga0105240_10000005 Ga0105240_10000005610 358
1357 3300009148 Ga0105243_10039379 Ga0105243_100393792 358
1358 3300009545 Ga0105237_10000809 Ga0105237_100008094 358
1359 3300013100 Ga0157373_10014621 Ga0157373_100146215 358
1360 3300013102 Ga0157371_10000002 Ga0157371_10000002430 358
1361 3300013102 Ga0157371_10093106 Ga0157371_100931062 358
1362 3300013104 Ga0157370_10000286 Ga0157370_1000028610 358
1363 3300013104 Ga0157370_10001170 Ga0157370_100011702 358
1364 3300013105 Ga0157369_10058539 Ga0157369_100585394 358
1365 3300013105 Ga0157369_10103886 Ga0157369_101038862 358
1366 3300013249 Ga0171463_1003 Ga0171463_1003634 358
1367 3300015262 Ga0182007_10004491 Ga0182007_100044915 358
1368 3300015690 Ga0183363_1047 Ga0183363_104716 358
1369 3300025206 Ga0209435_100012 Ga0209435_10001282 358
1370 3300025228 Ga0209672_102960 Ga0209672_1029603 358
1371 3300025233 Ga0209437_100047 Ga0209437_100047212 358
1372 3300025233 Ga0209437_100165 Ga0209437_100165116 358
1373 3300025246 Ga0209646_1000026 Ga0209646_100002682 358
1374 3300025250 Ga0209026_1000014 Ga0209026_100001482 358
1375 3300025253 Ga0209677_104762 Ga0209677_1047625 358
1376 3300025256 Ga0209759_1000012 Ga0209759_100001282 358
1377 3300025261 Ga0209233_1000048 Ga0209233_1000048190 358
1378 3300025261 Ga0209233_1000069 Ga0209233_1000069246 358
1379 3300025261 Ga0209233_1000195 Ga0209233_100019526 358
1380 3300025272 Ga0209455_1006462 Ga0209455_10064622 358
1381 3300025284 Ga0209130_1000021 Ga0209130_1000021179 358
1382 3300025284 Ga0209130_1000029 Ga0209130_1000029289 358
1383 3300025292 Ga0209676_1015891 Ga0209676_10158912 358
1384 3300025292 Ga0209676_1023984 Ga0209676_10239841 358
1385 3300025294 Ga0209025_1000119 Ga0209025_100011991 358
1386 3300025294 Ga0209025_1000959 Ga0209025_10009593 358
1387 3300025294 Ga0209025_1001950 Ga0209025_100195010 358
1388 3300025295 Ga0209564_1000278 Ga0209564_100027879 358
1389 3300025297 Ga0209758_1000418 Ga0209758_100041816 358
1390 3300025297 Ga0209758_1015740 Ga0209758_10157404 358
1391 3300025298 Ga0209050_1006307 Ga0209050_10063073 358
1392 3300025298 Ga0209050_1006426 Ga0209050_10064266 358
1393 3300025299 Ga0209256_1000042 Ga0209256_100004229 358
1394 3300025299 Ga0209256_1003506 Ga0209256_10035069 358
1395 3300025302 Ga0207426_1000010 Ga0207426_1000010179 358
1396 3300025302 Ga0207426_1000074 Ga0207426_10000749 358
1397 3300025913 Ga0207695_10000011 Ga0207695_10000011308 358
1398 3300025914 Ga0207671_10000804 Ga0207671_100008046 358
1399 3300025935 Ga0207709_10278389 Ga0207709_102783891 358
1400 3300026078 Ga0207702_10031676 Ga0207702_100316762 358
1401 3300027312 Ga0209371_1000012 Ga0209371_1000012175 358
1402 3300027312 Ga0209371_1002509 Ga0209371_10025099 358
1403 3300027666 Ga0209282_1000140 Ga0209282_10001402 358
1404 3300028379 Ga0268266_10257478 Ga0268266_102574782 358
1405 3300028794 Ga0307515_10000023 Ga0307515_10000023286 358
1406 3300028794 Ga0307515_10002518 Ga0307515_100025189 358
1407 3300030500 Ga0268256_1000013 Ga0268256_1000013175 358
1408 3300030500 Ga0268256_1016541 Ga0268256_10165412 358
1409 3300031456 Ga0307513_10003030 Ga0307513_1000303010 358
1410 3300031456 Ga0307513_10186482 Ga0307513_101864822 358
1411 3300031911 Ga0307412_10164466 Ga0307412_101644662 358
1412 3300041413 Ga0439465_0004233 Ga0439465_0004233_2348_3439 358
1413 3300042145 Ga0450906_001575 Ga0450906_001575_1633_2724 358
1414 3300046507 Ga0495606_0059647 Ga0495606_0059647_184_1275 358
1415 3300046692 Ga0495671_0023593 Ga0495671_0023593_1939_3027 358
1416 3300047470 Ga0495681_0000886 Ga0495681_0000886_103_1191 358
1417 3300047472 Ga0495686_0000761 Ga0495686_0000761_3506_4597 358
1418 3300048907 Ga0496104_0239495 Ga0496104_0239495_323_1411 358
1419 3300048919 Ga0496116_0000061 Ga0496116_0000061_257375_258505 358
1420 3300048919 Ga0496116_0029164 Ga0496116_0029164_367_1455 358
1421 3300048919 Ga0496116_0050408 Ga0496116_0050408_1603_2694 358
1422 3300048920 Ga0496117_0000016 Ga0496117_0000016_311179_312267 358
1423 3300048920 Ga0496117_0021541 Ga0496117_0021541_126_1217 358
1424 3300048920 Ga0496117_0030058 Ga0496117_0030058_1993_3081 358
1425 3300048921 Ga0496118_0000535 Ga0496118_0000535_3550_4638 358
1426 3300048921 Ga0496118_0016390 Ga0496118_0016390_5256_6347 358
1427 3300048921 Ga0496118_0035617 Ga0496118_0035617_573_1661 358
1428 3300048921 Ga0496118_0036469 Ga0496118_0036469_513_1601 358
1429 3300048923 Ga0496120_0000056 Ga0496120_0000056_156_1244 358
1430 3300048923 Ga0496120_0013734 Ga0496120_0013734_3167_4255 358
1431 3300048924 Ga0496121_0000001 Ga0496121_0000001_274872_275960 358
1432 3300048925 Ga0496122_0000002 Ga0496122_0000002_311840_312928 358
1433 3300048925 Ga0496122_0000369 Ga0496122_0000369_84941_86056 358
1434 3300048925 Ga0496122_0000525 Ga0496122_0000525_20745_21833 358
1435 3300048925 Ga0496122_0019117 Ga0496122_0019117_4976_6064 358
1436 3300048925 Ga0496122_0168385 Ga0496122_0168385_78_1169 358
1437 3300048926 Ga0496123_0000002 Ga0496123_0000002_1498755_1499843 358
1438 3300048926 Ga0496123_0000002 Ga0496123_0000002_311840_312928 358
1439 3300048926 Ga0496123_0000054 Ga0496123_0000054_143257_144372 358
1440 3300048926 Ga0496123_0000448 Ga0496123_0000448_1557_2645 358
1441 3300048926 Ga0496123_0144340 Ga0496123_0144340_49_1140 358
1442 3300048927 Ga0496124_0000091 Ga0496124_0000091_65324_66412 358
1443 3300048927 Ga0496124_0002629 Ga0496124_0002629_2954_4042 358
1444 3300048927 Ga0496124_0010219 Ga0496124_0010219_2184_3272 358
1445 3300048927 Ga0496124_0076338 Ga0496124_0076338_116_1207 358
1446 3300048927 Ga0496124_0170929 Ga0496124_0170929_342_1457 358
1447 3300048928 Ga0496125_0000001 Ga0496125_0000001_386898_387986 358
1448 3300048928 Ga0496125_0002081 Ga0496125_0002081_20511_21599 358
1449 3300048929 Ga0496126_0060207 Ga0496126_0060207_1745_2833 358
1450 3300048929 Ga0496126_0060387 Ga0496126_0060387_98_1186 358
1451 3300048929 Ga0496126_0278018 Ga0496126_0278018_202_1290 358
1452 3300049571 Ga0501034_0181332 Ga0501034_0181332_202_1317 358
1453 3300049572 Ga0501036_0051169 Ga0501036_0051169_2003_3118 358
1454 3300049579 Ga0501043_0059396 Ga0501043_0059396_1085_2200 358
1455 3300049580 Ga0501046_0112918 Ga0501046_0112918_354_1469 358
1456 3300049590 Ga0501074_0042463 Ga0501074_0042463_1573_2688 358
1457 3300049822 Ga0501035_0156005 Ga0501035_0156005_110_1225 358
1458 3300049823 Ga0501044_0209219 Ga0501044_0209219_37_1152 358
1459 3300050489 nmdc:mga03683_19297_c1 nmdc:mga03683_19297_c1_672_1760 358
1460 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_91048_92136 358
1461 3300050491 nmdc:mga00v17_8320_c1 nmdc:mga00v17_8320_c1_3995_5083 358
1462 3300050492 nmdc:mga0yw44_23854_c1 nmdc:mga0yw44_23854_c1_1737_2825 358
1463 3300050493 nmdc:mga0k408_23153_c1 nmdc:mga0k408_23153_c1_722_1810 358
1464 3300050516 nmdc:mga0sz30_14730_c1 nmdc:mga0sz30_14730_c1_1809_2897 358
1465 3300050516 nmdc:mga0sz30_2395_c1 nmdc:mga0sz30_2395_c1_753_1841 358
1466 3300053107 Ga0500560_012707 Ga0500560_012707_833_1921 358
1467 3300053136 Ga0500559_0007674 Ga0500559_0007674_302_1402 358
1468 3300053137 Ga0500561_0000065 Ga0500561_0000065_18935_20023 358
1469 3300053153 Ga0500616_0001178 Ga0500616_0001178_1816_2928 358
1470 3300053155 Ga0500620_002918 Ga0500620_002918_170_1276 358
1471 3300053156 Ga0500622_0001869 Ga0500622_0001869_12284_13369 358
1472 3300053157 Ga0500624_000733 Ga0500624_000733_6828_7916 358
1473 3300053161 Ga0500634_0000004 Ga0500634_0000004_41892_42983 358
1474 3300053161 Ga0500634_0062281 Ga0500634_0062281_661_1752 358
1475 3300053177 Ga0500636_0000034 Ga0500636_0000034_27625_28713 358
1476 3300053177 Ga0500636_0029235 Ga0500636_0029235_160_1248 358
1477 3300059643 Ga0587072_000304 Ga0587072_000304_3230_4318 358
1478 iso_pu_bacteria 2510917026 2511171669 358
1479 iso_pu_bacteria 2585427633 2585996027 358
1480 iso_pu_bacteria 2585427634 2586000631 358
1481 iso_pu_bacteria 2600254933 2600375702 358
1482 iso_pu_bacteria 2643221595 2643987558 358
1483 iso_pu_bacteria 2643221627 2644157921 358
1484 iso_pu_bacteria 2844002411 2844008922 358
1485 iso_pu_bacteria 2854896431 2854899358 358
1486 iso_pu_bacteria 2854916844 2854917970 358
1487 iso_pu_bacteria 2856320880 2856322858 358
1488 iso_pu_bacteria 2869278585 2869285599 358
1489 iso_pu_bacteria 2871466892 2871471803 358
1490 iso_pu_bacteria 2874123672 2874128996 358
1491 iso_pu_bacteria 2874139085 2874142063 358
1492 iso_pu_bacteria 2906378014 2906383510 358
1493 iso_pu_bacteria 2919171160 2919174960 358
1494 iso_pu_bacteria 2924762789 2924765279 358
1495 iso_pu_bacteria 2937877337 2937881519 358
1496 iso_pu_bacteria 2937972304 2937977516 358
1497 iso_pu_bacteria 2958034702 2958041614 358
1498 iso_pu_bacteria 2958041894 2958048004 358
1499 iso_pu_bacteria 2958084443 2958087924 358
1500 iso_pu_bacteria 2958092219 2958098066 358
1501 iso_pu_bacteria 2968016561 2968020515 358
1502 iso_pu_bacteria 2970469710 2970473812 358
1503 iso_pu_bacteria 2987666974 2987672234 358
1504 iso_pu_bacteria 2996348954 2996352866 358
1505 iso_pu_bacteria 3004275668 3004279548 358
1506 iso_pu_bacteria 3004289098 3004292520 358
1507 3300002741 JGI25157J39369_1001392 JGI25157J39369_10013922 359
1508 3300002773 JGI25152J39213_1002697 JGI25152J39213_10026973 359
1509 3300002773 JGI25152J39213_1004191 JGI25152J39213_10041912 359
1510 3300002773 JGI25152J39213_1004233 JGI25152J39213_10042334 359
1511 3300003215 JGI25153J46596_10005098 JGI25153J46596_100050983 359
1512 3300003215 JGI25153J46596_10005100 JGI25153J46596_100051003 359
1513 3300003762 Ga0055542_1000299 Ga0055542_100029926 359
1514 3300003763 Ga0055529_1004022 Ga0055529_10040222 359
1515 3300005353 Ga0070669_100024140 Ga0070669_1000241403 359
1516 3300005455 Ga0070663_100212196 Ga0070663_1002121962 359
1517 3300005539 Ga0068853_100002082 Ga0068853_1000020823 359
1518 3300005578 Ga0068854_100078894 Ga0068854_1000788943 359
1519 3300005834 Ga0068851_10088966 Ga0068851_100889662 359
1520 3300006038 Ga0075365_10009220 Ga0075365_100092203 359
1521 3300006038 Ga0075365_10025031 Ga0075365_100250313 359
1522 3300006042 Ga0075368_10051685 Ga0075368_100516852 359
1523 3300006048 Ga0075363_100084650 Ga0075363_1000846502 359
1524 3300006051 Ga0075364_10009866 Ga0075364_100098663 359
1525 3300006178 Ga0075367_10005500 Ga0075367_100055004 359
1526 3300006353 Ga0075370_10063299 Ga0075370_100632992 359
1527 3300009098 Ga0105245_10135389 Ga0105245_101353892 359
1528 3300009545 Ga0105237_10189908 Ga0105237_101899082 359
1529 3300009551 Ga0105238_10040243 Ga0105238_100402434 359
1530 3300013105 Ga0157369_10254837 Ga0157369_102548372 359
1531 3300013296 Ga0157374_10226143 Ga0157374_102261432 359
1532 3300014497 Ga0182008_10052835 Ga0182008_100528351 359
1533 3300025245 Ga0207425_1000753 Ga0207425_100075312 359
1534 3300025245 Ga0207425_1012657 Ga0207425_10126572 359
1535 3300025250 Ga0209026_1000100 Ga0209026_100010071 359
1536 3300025254 Ga0209148_1000069 Ga0209148_1000069109 359
1537 3300025256 Ga0209759_1000438 Ga0209759_10004387 359
1538 3300025258 Ga0209129_1000962 Ga0209129_100096212 359
1539 3300025258 Ga0209129_1001002 Ga0209129_10010028 359
1540 3300025261 Ga0209233_1000675 Ga0209233_10006758 359
1541 3300025272 Ga0209455_1000135 Ga0209455_100013578 359
1542 3300025294 Ga0209025_1002744 Ga0209025_10027448 359
1543 3300025297 Ga0209758_1002029 Ga0209758_100202910 359
1544 3300025297 Ga0209758_1003295 Ga0209758_10032953 359
1545 3300025904 Ga0207647_10019050 Ga0207647_100190504 359
1546 3300025911 Ga0207654_10151691 Ga0207654_101516912 359
1547 3300025914 Ga0207671_10225888 Ga0207671_102258882 359
1548 3300025924 Ga0207694_10013088 Ga0207694_100130884 359
1549 3300025924 Ga0207694_10312208 Ga0207694_103122082 359
1550 3300026041 Ga0207639_10001242 Ga0207639_1000124213 359
1551 3300028379 Ga0268266_10365101 Ga0268266_103651012 359
1552 3300031901 Ga0307406_10002228 Ga0307406_100022282 359
1553 3300037471 Ga0395905_0107203 Ga0395905_0107203_1358_2467 359
1554 3300045051 Ga0451576_0090694 Ga0451576_0090694_501_1616 359
1555 3300046512 Ga0495610_0014249 Ga0495610_0014249_1489_2568 359
1556 3300046519 Ga0495632_0000437 Ga0495632_0000437_33524_34603 359
1557 3300046522 Ga0495643_0014652 Ga0495643_0014652_1911_2990 359
1558 3300046524 Ga0495648_0068399 Ga0495648_0068399_950_2029 359
1559 3300046694 Ga0495649_0012264 Ga0495649_0012264_2188_3267 359
1560 3300048904 Ga0496101_0210762 Ga0496101_0210762_157_1236 359
1561 3300048909 Ga0496106_0002281 Ga0496106_0002281_233_1312 359
1562 3300048919 Ga0496116_0001215 Ga0496116_0001215_8762_9841 359
1563 3300048920 Ga0496117_0013295 Ga0496117_0013295_5999_7078 359
1564 3300048920 Ga0496117_0062035 Ga0496117_0062035_1472_2551 359
1565 3300048921 Ga0496118_0009427 Ga0496118_0009427_4218_5297 359
1566 3300048925 Ga0496122_0078295 Ga0496122_0078295_261_1340 359
1567 3300048926 Ga0496123_0020950 Ga0496123_0020950_182_1261 359
1568 3300048926 Ga0496123_0045151 Ga0496123_0045151_600_1679 359
1569 3300048927 Ga0496124_0002111 Ga0496124_0002111_168_1247 359
1570 3300048927 Ga0496124_0047345 Ga0496124_0047345_168_1247 359
1571 3300048927 Ga0496124_0070083 Ga0496124_0070083_1467_2546 359
1572 3300048928 Ga0496125_0022917 Ga0496125_0022917_2241_3320 359
1573 3300048928 Ga0496125_0105914 Ga0496125_0105914_752_1858 359
1574 3300050489 nmdc:mga03683_86755_c1 nmdc:mga03683_86755_c1_228_1337 359
1575 3300050490 nmdc:mga03n38_57677_c1 nmdc:mga03n38_57677_c1_625_1734 359
1576 3300050491 nmdc:mga00v17_123846_c1 nmdc:mga00v17_123846_c1_284_1390 359
1577 3300050492 nmdc:mga0yw44_54034_c1 nmdc:mga0yw44_54034_c1_411_1517 359
1578 3300050494 nmdc:mga06z11_82305_c1 nmdc:mga06z11_82305_c1_254_1366 359
1579 3300053134 Ga0500658_0008064 Ga0500658_0008064_2624_3703 359
1580 3300053139 Ga0500568_0005892 Ga0500568_0005892_2035_3114 359
1581 3300053156 Ga0500622_0001526 Ga0500622_0001526_2259_3338 359
1582 iso_pu_bacteria 2512875016 2512932815 359
1583 iso_pu_bacteria 2588253730 2588518867 359
1584 iso_pu_bacteria 2599185301 2599939808 359
1585 iso_pu_bacteria 2856356410 2856361800 359
1586 iso_pu_bacteria 2856364286 2856366907 359
1587 iso_pu_bacteria 2857349434 2857352206 359
1588 iso_pu_bacteria 2869285874 2869287681 359
1589 iso_pu_bacteria 2871429161 2871435629 359
1590 iso_pu_bacteria 2871444079 2871445964 359
1591 iso_pu_bacteria 2871495908 2871496490 359
1592 iso_pu_bacteria 2874102143 2874107877 359
1593 iso_pu_bacteria 2874146452 2874151312 359
1594 iso_pu_bacteria 2874155637 2874158946 359
1595 iso_pu_bacteria 2876363079 2876364935 359
1596 iso_pu_bacteria 2876369609 2876373128 359
1597 iso_pu_bacteria 2876392853 2876397762 359
1598 iso_pu_bacteria 2876413966 2876417365 359
1599 iso_pu_bacteria 2878745973 2878749192 359
1600 iso_pu_bacteria 2878760144 2878760718 359
1601 iso_pu_bacteria 2878767105 2878767657 359
1602 iso_pu_bacteria 2881147464 2881149645 359
1603 iso_pu_bacteria 2881161766 2881166525 359
1604 iso_pu_bacteria 2885305155 2885308007 359
1605 iso_pu_bacteria 2885318864 2885322498 359
1606 iso_pu_bacteria 2885326080 2885331630 359
1607 iso_pu_bacteria 2885334103 2885341955 359
1608 iso_pu_bacteria 2903448605 2903449603 359
1609 iso_pu_bacteria 2903492973 2903498656 359
1610 iso_pu_bacteria 2903521522 2903522329 359
1611 iso_pu_bacteria 2903528002 2903528708 359
1612 iso_pu_bacteria 2903540706 2903541284 359
1613 iso_pu_bacteria 2904659560 2904664413 359
1614 iso_pu_bacteria 2906308376 2906310230 359
1615 iso_pu_bacteria 2906321335 2906324295 359
1616 iso_pu_bacteria 2906328253 2906333122 359
1617 iso_pu_bacteria 2922158528 2922164316 359
1618 iso_pu_bacteria 2924784321 2924786800 359
1619 iso_pu_bacteria 2937813078 2937817054 359
1620 iso_pu_bacteria 2937848649 2937852260 359
1621 iso_pu_bacteria 2937891427 2937892745 359
1622 iso_pu_bacteria 2937994558 2937995140 359
1623 iso_pu_bacteria 2958115193 2958120948 359
1624 iso_pu_bacteria 2958130278 2958132083 359
1625 iso_pu_bacteria 2958165035 2958165595 359
1626 iso_pu_bacteria 2958179912 2958181897 359
1627 iso_pu_bacteria 2961077736 2961079741 359
1628 iso_pu_bacteria 2961114664 2961119412 359
1629 iso_pu_bacteria 2961163497 2961164054 359
1630 iso_pu_bacteria 2963644680 2963646391 359
1631 iso_pu_bacteria 2965018300 2965018880 359
1632 iso_pu_bacteria 2968083720 2968087083 359
1633 iso_pu_bacteria 2968091066 2968091275 359
1634 iso_pu_bacteria 2968097103 2968099162 359
1635 iso_pu_bacteria 2968110612 2968115667 359
1636 iso_pu_bacteria 2968117919 2968119033 359
1637 iso_pu_bacteria 2968128360 2968134574 359
1638 iso_pu_bacteria 2968171901 2968172457 359
1639 iso_pu_bacteria 2970554993 2970555571 359
1640 iso_pu_bacteria 2977843712 2977847345 359
1641 iso_pu_bacteria 2977858184 2977863612 359
1642 iso_pu_bacteria 2977864932 2977870156 359
1643 iso_pu_bacteria 2977922695 2977926488 359
1644 iso_pu_bacteria 2977942078 2977945163 359
1645 iso_pu_bacteria 2977986579 2977988692 359
1646 iso_pu_bacteria 2979779861 2979782834 359
1647 iso_pu_bacteria 2987636660 2987639390 359
1648 iso_pu_bacteria 2987659509 2987660062 359
1649 iso_pu_bacteria 2996341866 2996348385 359
1650 iso_pu_bacteria 3004188549 3004189110 359
1651 iso_pu_bacteria 3004203850 3004204366 359
1652 iso_pu_bacteria 3004211236 3004217827 359
1653 iso_pu_bacteria 3004218560 3004221125 359
1654 iso_pu_bacteria 637000159 637075897 359
1655 iso_pu_bacteria 8004387939 8004389466 359
1656 iso_pu_bacteria 8004445564 8004446460 359
1657 iso_pu_bacteria 8004640170 8004643333 359
1658 iso_pu_bacteria 8004703790 8004712300 359
1659 iso_pu_bacteria 8004714634 8004717864 359
1660 3300001979 JGI24740J21852_10000002 JGI24740J21852_1000000244 360
1661 3300002737 JGI25162J39368_1000376 JGI25162J39368_100037615 360
1662 3300003187 JGI25151J46595_10000341 JGI25151J46595_100003415 360
1663 3300003214 JGI25165J46597_1000075 JGI25165J46597_100007524 360
1664 3300003215 JGI25153J46596_10000344 JGI25153J46596_1000034433 360
1665 3300003323 rootH1_10030284 rootH1_100302844 360
1666 3300003354 JGI25160J50197_1000384 JGI25160J50197_100038414 360
1667 3300003374 JGI25161J50226_1001741 JGI25161J50226_10017414 360
1668 3300003771 Ga0055526_1000400 Ga0055526_10004002 360
1669 3300003771 Ga0055526_1027692 Ga0055526_10276921 360
1670 3300003775 Ga0055524_1005033 Ga0055524_10050335 360
1671 3300003790 Ga0055528_1000034 Ga0055528_10000341 360
1672 3300003790 Ga0055528_1006402 Ga0055528_10064023 360
1673 3300003792 Ga0055540_1000066 Ga0055540_100006640 360
1674 3300004625 Ga0055543_1001297 Ga0055543_10012976 360
1675 3300006038 Ga0075365_10006498 Ga0075365_100064982 360
1676 3300006038 Ga0075365_10019892 Ga0075365_100198924 360
1677 3300006177 Ga0075362_10055983 Ga0075362_100559831 360
1678 3300006177 Ga0075362_10085031 Ga0075362_100850312 360
1679 3300006178 Ga0075367_10003915 Ga0075367_100039154 360
1680 3300006186 Ga0075369_10002190 Ga0075369_100021903 360
1681 3300006353 Ga0075370_10002020 Ga0075370_100020202 360
1682 3300009093 Ga0105240_10000097 Ga0105240_10000097113 360
1683 3300009765 Ga0123341_1000005 Ga0123341_1000005100 360
1684 3300014497 Ga0182008_10038844 Ga0182008_100388442 360
1685 3300021320 Ga0214544_1000029 Ga0214544_100002974 360
1686 3300021321 Ga0214542_1000092 Ga0214542_100009242 360
1687 3300021327 Ga0214543_1000045 Ga0214543_100004574 360
1688 3300025233 Ga0209437_100131 Ga0209437_10013122 360
1689 3300025254 Ga0209148_1005611 Ga0209148_10056112 360
1690 3300025258 Ga0209129_1000594 Ga0209129_100059425 360
1691 3300025261 Ga0209233_1000132 Ga0209233_100013241 360
1692 3300025273 Ga0209673_1000020 Ga0209673_1000020195 360
1693 3300025273 Ga0209673_1000462 Ga0209673_100046252 360
1694 3300025273 Ga0209673_1000607 Ga0209673_100060736 360
1695 3300025294 Ga0209025_1000081 Ga0209025_1000081105 360
1696 3300025295 Ga0209564_1000205 Ga0209564_10002051 360
1697 3300025295 Ga0209564_1001753 Ga0209564_100175318 360
1698 3300025297 Ga0209758_1000076 Ga0209758_100007687 360
1699 3300025297 Ga0209758_1010800 Ga0209758_10108002 360
1700 3300025298 Ga0209050_1006986 Ga0209050_10069864 360
1701 3300025299 Ga0209256_1000500 Ga0209256_100050022 360
1702 3300025299 Ga0209256_1002281 Ga0209256_100228113 360
1703 3300025302 Ga0207426_1000169 Ga0207426_100016950 360
1704 3300025303 Ga0209051_1000038 Ga0209051_1000038114 360
1705 3300025303 Ga0209051_1001518 Ga0209051_100151822 360
1706 3300025913 Ga0207695_10000187 Ga0207695_10000187117 360
1707 3300026078 Ga0207702_10154732 Ga0207702_101547321 360
1708 3300027312 Ga0209371_1001480 Ga0209371_100148010 360
1709 3300028794 Ga0307515_10003222 Ga0307515_100032227 360
1710 3300028794 Ga0307515_10009985 Ga0307515_1000998513 360
1711 3300030500 Ga0268256_1002184 Ga0268256_10021846 360
1712 3300035695 Ga0373927_0000901 Ga0373927_0000901_21368_22450 360
1713 3300037068 Ga0373925_0056684 Ga0373925_0056684_103_1185 360
1714 3300041509 Ga0451843_0770350 Ga0451843_0770350_62_1144 360
1715 3300046501 Ga0495607_0015078 Ga0495607_0015078_3471_4553 360
1716 3300046506 Ga0495583_0006184 Ga0495583_0006184_5338_6420 360
1717 3300046518 Ga0495631_0019547 Ga0495631_0019547_102_1184 360
1718 3300046522 Ga0495643_0009837 Ga0495643_0009837_3279_4361 360
1719 3300046524 Ga0495648_0037761 Ga0495648_0037761_932_2014 360
1720 3300046660 Ga0495625_0015491 Ga0495625_0015491_1597_2679 360
1721 3300046694 Ga0495649_0011843 Ga0495649_0011843_3176_4258 360
1722 3300046810 Ga0495660_0118768 Ga0495660_0118768_152_1234 360
1723 3300047323 Ga0495683_0029612 Ga0495683_0029612_781_1863 360
1724 3300047443 Ga0495687_036988 Ga0495687_036988_232_1314 360
1725 3300048091 Ga0495626_0071394 Ga0495626_0071394_30_1112 360
1726 3300048903 Ga0496100_0026713 Ga0496100_0026713_269_1351 360
1727 3300048922 Ga0496119_0103711 Ga0496119_0103711_221_1303 360
1728 3300048923 Ga0496120_0105648 Ga0496120_0105648_188_1270 360
1729 3300048925 Ga0496122_0047006 Ga0496122_0047006_295_1377 360
1730 3300048926 Ga0496123_0095536 Ga0496123_0095536_331_1413 360
1731 3300048927 Ga0496124_0115561 Ga0496124_0115561_1030_2112 360
1732 3300048928 Ga0496125_0059355 Ga0496125_0059355_1886_2968 360
1733 3300050492 nmdc:mga0yw44_17652_c1 nmdc:mga0yw44_17652_c1_2746_3828 360
1734 3300050492 nmdc:mga0yw44_3491_c1 nmdc:mga0yw44_3491_c1_98_1180 360
1735 3300050494 nmdc:mga06z11_69829_c1 nmdc:mga06z11_69829_c1_538_1620 360
1736 3300050516 nmdc:mga0sz30_3289_c1 nmdc:mga0sz30_3289_c1_4713_5795 360
1737 3300050516 nmdc:mga0sz30_3391_c1 nmdc:mga0sz30_3391_c1_3028_4110 360
1738 iso_pu_bacteria 2643221599 2644004944 360
1739 iso_pu_bacteria 3005452660 3005458278 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17912

OB_MalK

MalK OB fold domain

264

317

0.97

PF00005

ABC_tran

ABC transporter

48

191

0.95

PF08402

TOBE_2

TOBE domain

310

382

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.9552 301 330
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9517 4 233
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9478 3 217
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9442 4 233
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9439 1 358
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9746 1 217 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9716 5 237 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9681 5 234 3.40.50.300
6bz0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9663 301 327 3.50.50.60
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9658 1 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9772 49 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A7H4SIF3-F1-model_v4 deleted 0.9708 2 149
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9639 49 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A1V4RJG8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9634 5 147 GO:0005524
GO:0016887
GO:0055052
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9579 1 159 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.31 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map