F495334

General Info

Members Datasets Scaffolds Average Seq Length
1686 1161 826 263

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937848649|2937852746
Length 293
Sequence WNCLTCDLSDLRLVGLFGDPKMNFWHKPMKNGPRIITVANQKGGVGKTTTAINLATALAAIGEKVLIVDLDPQGNASTGLGIDRKDRTVSSYDVLTGELELEAAAIPTAVPGLSIVPSTLDLLGIEMEIASAPDRVLRLRNALRAASARSAGFGYVLIDCPPSLNLLTLNSMAAADSVLVPLQCEFFALEGLSQLLETVEQVRRSINPDLTIQGIVLTMYDGRNNLANQVVQDVRQHMGDKVYETIIPRNVRVSEAPSYGKPAILYDLKCSGSQAYLQLASEVIRRERKLRAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
17 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
18 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
33 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
34 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
35 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
36 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
37 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
38 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
39 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
40 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
41 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
42 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
43 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
44 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
45 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
46 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
47 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
48 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
49 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
50 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
51 2516143018 Ensifer sp. BR816 Isolate Nodule
52 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
53 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
54 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
55 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
56 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
57 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
58 2519899620 Rhizobium sp. Pop5 Isolate Nodule
59 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
60 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
61 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
62 2534681786 Brucella suis 92/29 Isolate Unclassified
63 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
64 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
65 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
66 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
67 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
68 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
69 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
70 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
71 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
72 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
73 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
74 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
75 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
76 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
77 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
78 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
79 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
80 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
81 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
82 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
83 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
84 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
85 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
86 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
87 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
88 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
89 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
90 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
91 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
92 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
93 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
94 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
95 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
96 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
97 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
98 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
99 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
100 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
101 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
102 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
103 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
104 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
105 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
106 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
107 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
108 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
109 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
110 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
111 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
112 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
113 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
114 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
115 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
116 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
117 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
118 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
119 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
120 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
121 2643221557 Ensifer sp. Root558 Isolate Unclassified
122 2643221558 Rhizobium sp. Root149 Isolate Unclassified
123 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
124 2643221568 Rhizobium sp. Root564 Isolate Unclassified
125 2643221582 Rhizobium sp. Root651 Isolate Unclassified
126 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
127 2643221599 Rhizobium sp. Root708 Isolate Unclassified
128 2643221607 Rhizobium sp. Root73 Isolate Unclassified
129 2643221610 Ensifer sp. Root74 Isolate Unclassified
130 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
131 2643221626 Ensifer sp. Root31 Isolate Unclassified
132 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
133 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
134 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
135 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
136 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
137 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
138 2643221655 Ensifer sp. Root1252 Isolate Unclassified
139 2643221659 Ensifer sp. Root127 Isolate Unclassified
140 2643221668 Ensifer sp. Root423 Isolate Unclassified
141 2643221675 Ensifer sp. Root1298 Isolate Unclassified
142 2643221680 Ensifer sp. Root1312 Isolate Unclassified
143 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
144 2643221688 Rhizobium sp. Root482 Isolate Unclassified
145 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
146 2643221693 Rhizobium sp. Root491 Isolate Unclassified
147 2643221698 Ensifer sp. Root142 Isolate Unclassified
148 2643221712 Ensifer sp. Root258 Isolate Unclassified
149 2643221718 Rhizobium sp. Root268 Isolate Unclassified
150 2643221719 Rhizobium sp. Root274 Isolate Unclassified
151 2643221723 Ensifer sp. Root278 Isolate Unclassified
152 2643221726 Ensifer sp. Root954 Isolate Unclassified
153 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
154 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
155 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
156 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
157 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
158 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
159 2718217882 Rhizobium sp. N741 Isolate Nodule
160 2718217927 Rhizobium sp. N324 Isolate Nodule
161 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
162 2718218009 Rhizobium sp. N561 Isolate Nodule
163 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
164 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
165 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
166 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
167 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
168 2718218363 Rhizobium sp. N113 Isolate Nodule
169 2718218365 Rhizobium sp. N731 Isolate Nodule
170 2718218366 Rhizobium sp. N621 Isolate Nodule
171 2718218423 Rhizobium sp. N941 Isolate Nodule
172 2721755514 Rhizobium sp. N6212 Isolate Nodule
173 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
174 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
175 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
176 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
177 2721755809 Rhizobium sp. N541 Isolate Nodule
178 2721755810 Rhizobium sp. N871 Isolate Nodule
179 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
180 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
181 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
182 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
183 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
184 2728369365 Rhizobium sp. N1341 Isolate Nodule
185 2728369397 Rhizobium sp. N1314 Isolate Nodule
186 2738541293 Rhizobium sp. GV031 Isolate Unclassified
187 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
188 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
189 2738543024 Aminobacter sp. AP02 Isolate Unclassified
190 2751185800 Brucella pituitosa AA2 Isolate Unclassified
191 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
192 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
193 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
194 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
195 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
196 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
197 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
198 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
199 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
200 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
201 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
202 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
203 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
204 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
205 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
206 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
207 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
208 2791355256 Rhizobium sp. M10 Isolate Nodule
209 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
210 2791355260 Rhizobium sp. L9 Isolate Nodule
211 2791355261 Rhizobium sp. J15 Isolate Nodule
212 2791355262 Rhizobium sp. M1 Isolate Nodule
213 2791355263 Rhizobium chutanense C5 Isolate Nodule
214 2791355264 Rhizobium sp. S9 Isolate Nodule
215 2791355265 Rhizobium sp. H4 Isolate Nodule
216 2791355266 Rhizobium sp. L43 Isolate Nodule
217 2791355267 Rhizobium sp. L18 Isolate Nodule
218 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
219 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
220 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
221 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
222 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
223 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
224 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
225 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
226 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
227 2802429633 Rhizobium anhuiense J3 Isolate Nodule
228 2802429634 Rhizobium anhuiense S10 Isolate Nodule
229 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
230 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
231 2802429637 Rhizobium anhuiense C15 Isolate Nodule
232 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
233 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
234 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
235 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
236 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
237 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
238 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
239 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
240 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
241 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
242 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
243 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
244 2838048938 Rhizobium pisi 27/80 Isolate Nodule
245 2838061910 Rhizobium phaseoli L15 Isolate Nodule
246 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
247 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
248 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
249 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
250 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
251 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
252 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
253 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
254 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
255 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
256 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
257 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
258 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
259 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
260 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
261 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
262 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
263 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
264 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
265 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
266 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
267 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
268 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
269 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
270 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
271 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
272 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
273 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
274 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
275 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
276 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
277 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
278 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
279 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
280 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
281 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
282 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
283 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
284 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
285 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
286 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
287 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
288 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
289 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
290 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
291 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
292 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
293 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
294 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
295 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
296 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
297 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
298 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
299 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
300 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
301 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
302 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
303 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
304 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
305 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
306 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
307 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
308 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
309 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
310 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
311 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
312 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
313 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
314 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
315 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
316 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
317 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
318 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
319 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
320 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
321 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
322 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
323 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
324 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
325 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
326 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
327 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
328 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
329 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
330 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
331 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
332 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
333 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
334 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
335 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
336 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
337 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
338 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
339 2854911287 Brucella lupini LUP21 Isolate Unclassified
340 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
341 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
342 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
343 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
344 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
345 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
346 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
347 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
348 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
349 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
350 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
351 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
352 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
353 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
354 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
355 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
356 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
357 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
358 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
359 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
360 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
361 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
362 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
363 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
364 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
365 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
366 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
367 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
368 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
369 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
370 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
371 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
372 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
373 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
374 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
375 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
376 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
377 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
378 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
379 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
380 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
381 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
382 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
383 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
384 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
385 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
386 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
387 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
388 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
389 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
390 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
391 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
392 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
393 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
394 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
395 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
396 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
397 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
398 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
399 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
400 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
401 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
402 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
403 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
404 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
405 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
406 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
407 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
408 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
409 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
410 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
411 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
412 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
413 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
414 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
415 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
416 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
417 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
418 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
419 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
420 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
421 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
422 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
423 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
424 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
425 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
426 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
427 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
428 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
429 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
430 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
431 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
432 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
433 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
434 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
435 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
436 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
437 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
438 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
439 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
440 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
441 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
442 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
443 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
444 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
445 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
446 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
447 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
448 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
449 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
450 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
451 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
452 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
453 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
454 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
455 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
456 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
457 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
458 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
459 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
460 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
461 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
462 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
463 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
464 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
465 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
466 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
467 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
468 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
469 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
470 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
471 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
472 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
473 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
474 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
475 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
476 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
477 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
478 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
479 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
480 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
481 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
482 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
483 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
484 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
485 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
486 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
487 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
488 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
489 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
490 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
491 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
492 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
493 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
494 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
495 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
496 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
497 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
498 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
499 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
500 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
501 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
502 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
503 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
504 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
505 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
506 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
507 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
508 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
509 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
510 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
511 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
512 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
513 2933599457 Rhizobium phaseoli M3 Isolate Nodule
514 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
515 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
516 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
517 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
518 2936381700 Rhizobium chutanense C16 Isolate Unclassified
519 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
520 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
521 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
522 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
523 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
524 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
525 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
526 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
527 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
528 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
529 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
530 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
531 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
532 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
533 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
534 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
535 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
536 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
537 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
538 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
539 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
540 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
541 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
542 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
543 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
544 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
545 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
546 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
547 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
548 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
549 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
550 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
551 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
552 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
553 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
554 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
555 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
556 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
557 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
558 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
559 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
560 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
561 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
562 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
563 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
564 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
565 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
566 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
567 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
568 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
569 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
570 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
571 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
572 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
573 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
574 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
575 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
576 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
577 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
578 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
579 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
580 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
581 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
582 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
583 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
584 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
585 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
586 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
587 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
588 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
589 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
590 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
591 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
592 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
593 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
594 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
595 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
596 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
597 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
598 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
599 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
600 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
601 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
602 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
603 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
604 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
605 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
606 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
607 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
608 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
609 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
610 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
611 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
612 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
613 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
614 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
615 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
616 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
617 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
618 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
619 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
620 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
621 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
622 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
623 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
624 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
625 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
626 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
627 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
628 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
629 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
630 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
631 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
632 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
633 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
634 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
635 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
636 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
637 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
638 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
639 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
640 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
641 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
642 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
643 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
644 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
645 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
646 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
647 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
648 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
649 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
650 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
651 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
652 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
653 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
654 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
655 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
656 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
657 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
658 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
659 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
660 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
661 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
662 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
663 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
664 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
665 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
666 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
667 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
668 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
669 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
670 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
671 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
672 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
673 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
674 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
675 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
676 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
677 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
678 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
679 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
680 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
681 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
682 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
683 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
684 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
685 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
686 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
687 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
688 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
689 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
690 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
691 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
692 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
693 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
694 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
695 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
696 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
697 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
698 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
699 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
700 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
701 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
702 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
703 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
704 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
705 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
706 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
707 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
708 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
709 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
710 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
711 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
712 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
713 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
714 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
715 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
716 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
717 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
718 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
719 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
720 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
721 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
722 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
723 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
724 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
725 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
726 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
727 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
728 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
729 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
730 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
731 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
732 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
733 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
734 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
735 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
736 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
737 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
738 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
739 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
740 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
741 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
742 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
743 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
744 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
745 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
746 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
747 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
748 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
749 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
750 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
751 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
752 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
753 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
754 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
755 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
756 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
757 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
758 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
759 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
760 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
761 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
762 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
763 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
764 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
765 2996887358 Rhizobium sp. R711 Isolate Nodule
766 2996893221 Rhizobium sp. R635 Isolate Nodule
767 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
768 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
769 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
770 3004167301 Mesorhizobium loti 582 Isolate Unclassified
771 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
772 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
773 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
774 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
775 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
776 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
777 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
778 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
779 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
780 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
781 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
782 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
783 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
784 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
785 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
786 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
787 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
788 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
789 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
790 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
791 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
792 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
793 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
794 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
795 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
796 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
797 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
798 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
799 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
800 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
801 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
802 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
803 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
804 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
805 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
806 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
807 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
808 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
809 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
810 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
811 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
812 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
813 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
814 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
815 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
816 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
817 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
818 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
819 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
820 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
821 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
822 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
823 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
824 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
825 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
826 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
827 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
828 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
829 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
830 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
831 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
832 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
833 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
834 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
835 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
836 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
837 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
838 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
839 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
840 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
841 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
842 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
843 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
844 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
845 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
846 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
847 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
848 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
849 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
850 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
851 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
852 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
853 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
854 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
855 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
856 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
857 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
858 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
859 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
860 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
861 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
862 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
863 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
864 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
865 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
866 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
867 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
868 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
869 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
870 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
871 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
872 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
873 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
874 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
875 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
876 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
877 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
878 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
879 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
880 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
881 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
882 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
883 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
884 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
885 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
886 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
887 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
888 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
889 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
890 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
891 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
892 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
893 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
894 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
895 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
896 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
897 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
898 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
899 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
900 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
901 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
902 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
903 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
904 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
905 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
906 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
907 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
908 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
909 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
910 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
911 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
912 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
913 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
914 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
915 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
916 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
917 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
918 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
919 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
920 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
921 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
922 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
923 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
924 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
925 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
926 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
927 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
928 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
929 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
930 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
931 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
932 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
933 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
934 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
935 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
936 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
937 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
938 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
939 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
940 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
941 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
942 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
943 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
944 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
945 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
946 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
947 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
948 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
949 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
950 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
951 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
952 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
953 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
954 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
955 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
956 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
957 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
958 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
959 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
960 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
961 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
962 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
963 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
964 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
965 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
966 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
967 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
968 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
969 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
970 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
971 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
972 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
973 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
974 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
975 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
976 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
977 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
978 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
979 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
980 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
981 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
982 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
983 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
984 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
985 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
986 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
987 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
988 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
989 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
990 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
991 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
992 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
993 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
994 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
995 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
996 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
997 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
998 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
999 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1000 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1001 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1002 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1003 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1004 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1005 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1006 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1007 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1008 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1009 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1010 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1011 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1012 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1013 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1014 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1015 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1016 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1017 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1018 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1019 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1020 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1021 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1022 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
1023 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1024 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1025 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1026 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1027 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1028 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1029 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1030 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1031 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1032 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1033 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1034 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1035 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1036 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1037 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1038 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1039 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1040 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1041 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1042 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1043 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1044 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1045 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1046 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1047 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1048 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1049 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1050 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1051 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1052 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1053 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1054 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1055 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1056 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1057 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1058 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1059 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1060 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1061 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1062 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1063 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1064 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1065 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1066 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1067 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1068 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1069 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1070 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1071 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
1072 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1073 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1074 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1075 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1076 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1077 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1078 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1079 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1080 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1081 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1082 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1083 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1084 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1085 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1086 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1087 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1088 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1089 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1090 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1091 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1092 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1093 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1094 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1095 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1096 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1097 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1098 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1099 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1100 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1101 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1102 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1103 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1104 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1105 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1106 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1107 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1108 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1109 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1110 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1111 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1112 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1113 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1114 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1115 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1116 8005258706 Rhizobium sp. R693 Isolate Nodule
1117 8005275841 Rhizobium sp. N4311 Isolate Nodule
1118 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1119 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1120 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1121 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1122 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1123 8005321885 Rhizobium sp. R72 Isolate Nodule
1124 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1125 8005382845 Rhizobium sp. R634 Isolate Nodule
1126 8005395548 Rhizobium sp. R339 Isolate Nodule
1127 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1128 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1129 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1130 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1131 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1132 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1133 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1134 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1135 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1136 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1137 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1138 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1139 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1140 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1141 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1142 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1143 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1144 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1145 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1146 8018176218 Rhizobium sp. N122 Isolate Nodule
1147 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1148 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1149 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1150 8024501048 Rhizobium sp. H4 Isolate Nodule
1151 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1152 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1153 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1154 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1155 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1156 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1157 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1158 8056382006 Rhizobium croatiense 13T Isolate Nodule
1159 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1160 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1161 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.52
Metatranscriptomes 0.47
Isolates 51.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 18.8
Nodule 39.44
Rhizoplane 1.9
Rhizosphere 23.01
Stem 0
Stem Tuber 0
Unclassified 16.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008046 3300001979 Bacteria 4236
2 JGI24739J22299_10026028 3300001989 Bacteria 2055
3 JGI24735J21928_10010743 3300002067 Bacteria 2911
4 JGI25155J39150_1000018 3300002704 Bacteria 157606
5 JGI25156J39149_1000055 3300002705 Bacteria 87733
6 JGI25156J39149_1005781 3300002705 Bacteria 3503
7 JGI25162J39368_1000524 3300002737 Bacteria 28601
8 JGI25162J39368_1001321 3300002737 Bacteria 13874
9 JGI25154J39366_1000069 3300002738 Bacteria 96438
10 JGI25158J39367_1000191 3300002739 Bacteria 14579
11 JGI25157J39369_1000076 3300002741 Bacteria 87678
12 JGI25157J39369_1002158 3300002741 Bacteria 5464
13 JGI25152J39213_1000169 3300002773 Bacteria 44325
14 JGI25152J39213_1001739 3300002773 Bacteria 8902
15 JGI25152J39213_1002279 3300002773 Bacteria 7402
16 JGI25152J39213_1006926 3300002773 Bacteria 2997
17 JGI25152J39213_1014945 3300002773 Bacteria 1552
18 JGI25150J39212_1000018 3300002774 Bacteria 146535
19 JGI25150J39212_1001891 3300002774 Bacteria 5502
20 JGI25150J39212_1011092 3300002774 Bacteria 1647
21 JGI25159J45721_1000022 3300002987 Bacteria 119463
22 JGI25159J45721_1000486 3300002987 Bacteria 18238
23 JGI25159J45721_1003195 3300002987 Bacteria 5876
24 JGI25151J46595_10000034 3300003187 Bacteria 192271
25 JGI25151J46595_10000879 3300003187 Bacteria 23723
26 JGI25151J46595_10003252 3300003187 Bacteria 9039
27 JGI25151J46595_10007778 3300003187 Bacteria 5215
28 JGI25151J46595_10049730 3300003187 Bacteria 1435
29 JGI25406J46586_10065927 3300003203 Bacteria 1152
30 JGI25165J46597_1000052 3300003214 Bacteria 236064
31 JGI25165J46597_1000723 3300003214 Bacteria 25872
32 JGI25165J46597_1001341 3300003214 Bacteria 13817
33 JGI25165J46597_1001646 3300003214 Bacteria 10374
34 JGI25165J46597_1002217 3300003214 Bacteria 6809
35 JGI25153J46596_10000759 3300003215 Bacteria 19719
36 JGI25153J46596_10004655 3300003215 Bacteria 7336
37 JGI25153J46596_10004904 3300003215 Bacteria 7112
38 JGI25153J46596_10005257 3300003215 Bacteria 6806
39 JGI25153J46596_10016210 3300003215 Bacteria 2997
40 JGI25153J46596_10016213 3300003215 Bacteria 2997
41 JGI25153J46596_10041591 3300003215 Bacteria 1411
42 JGI25160J50197_1000051 3300003354 Bacteria 132923
43 JGI25160J50197_1000056 3300003354 Bacteria 119463
44 JGI25160J50197_1000317 3300003354 Bacteria 33502
45 JGI25160J50197_1024851 3300003354 Bacteria 1690
46 JGI25161J50226_1000011 3300003374 Bacteria 210140
47 JGI25161J50226_1000214 3300003374 Bacteria 36702
48 JGI25161J50226_1000451 3300003374 Bacteria 19047
49 JGI25161J50226_1002111 3300003374 Bacteria 5362
50 Ga0006562J51391_1044604 3300003578 Bacteria 2988
51 Ga0055539_1003028 3300003752 Bacteria 2418
52 Ga0055542_1000284 3300003762 Bacteria 56677
53 Ga0055529_1007878 3300003763 Bacteria 1431
54 Ga0055526_1001496 3300003771 Bacteria 16543
55 Ga0055526_1001864 3300003771 Bacteria 14599
56 Ga0055526_1003195 3300003771 Bacteria 10600
57 Ga0055524_1000962 3300003775 Bacteria 18149
58 Ga0055524_1001781 3300003775 Bacteria 11832
59 Ga0055524_1002678 3300003775 Bacteria 9022
60 Ga0055524_1003666 3300003775 Bacteria 7363
61 Ga0055524_1004018 3300003775 Bacteria 6937
62 Ga0055524_1006695 3300003775 Bacteria 4975
63 Ga0055524_1011005 3300003775 Bacteria 3562
64 Ga0055524_1014485 3300003775 Bacteria 2920
65 Ga0055536_1004102 3300003781 Bacteria 7571
66 Ga0055536_1017871 3300003781 Bacteria 2300
67 Ga0055528_1000452 3300003790 Bacteria 32857
68 Ga0055528_1001257 3300003790 Bacteria 16081
69 Ga0055528_1002057 3300003790 Bacteria 11232
70 Ga0055528_1004002 3300003790 Bacteria 7209
71 Ga0055528_1012948 3300003790 Bacteria 3200
72 Ga0055528_1016826 3300003790 Bacteria 2564
73 Ga0055540_1000597 3300003792 Bacteria 26126
74 Ga0055540_1004729 3300003792 Bacteria 6012
75 Ga0055540_1007895 3300003792 Bacteria 3925
76 Ga0055540_1016975 3300003792 Bacteria 2048
77 Ga0055540_1017617 3300003792 Bacteria 1987
78 Ga0055531_10018670 3300003794 Bacteria 2849
79 Ga0058692_1002316 3300003856 Bacteria 6438
80 Ga0055543_1000041 3300004625 Bacteria 118501
81 Ga0055543_1000330 3300004625 Bacteria 32518
82 Ga0055543_1000682 3300004625 Bacteria 17718
83 Ga0055543_1001229 3300004625 Bacteria 10697
84 Ga0065165_1000155 3300005262 Bacteria 119501
85 Ga0065165_1000303 3300005262 Bacteria 82513
86 Ga0065165_1002015 3300005262 Bacteria 18962
87 Ga0065165_1012660 3300005262 Bacteria 3417
88 Ga0065704_10145387 3300005289 Bacteria 1477
89 Ga0070670_100000711 3300005331 Bacteria 25830
90 Ga0070666_10163594 3300005335 Bacteria 1556
91 Ga0070682_100046169 3300005337 Bacteria 2702
92 Ga0070669_100052021 3300005353 Bacteria 2995
93 Ga0070663_100233991 3300005455 Bacteria 1448
94 Ga0068867_100041403 3300005459 Bacteria 3367
95 Ga0068853_100312445 3300005539 Bacteria 1455
96 Ga0070665_100001728 3300005548 Bacteria 24967
97 Ga0070665_100024473 3300005548 Bacteria 6081
98 Ga0070665_100027905 3300005548 Bacteria 5684
99 Ga0070665_100046994 3300005548 Bacteria 4332
100 Ga0070665_100065392 3300005548 Bacteria 3648
101 Ga0070665_100081432 3300005548 Bacteria 3243
102 Ga0068855_100209256 3300005563 Bacteria 2193
103 Ga0068854_100043122 3300005578 Bacteria 3196
104 Ga0068856_100009588 3300005614 Bacteria 9405
105 Ga0068856_100107833 3300005614 Bacteria 2781
106 Ga0068856_100109572 3300005614 Bacteria 2758
107 Ga0068851_10023620 3300005834 Bacteria 3007
108 Ga0068860_100214379 3300005843 Bacteria 1868
109 Ga0081540_1088199 3300005983 Bacteria 1372
110 Ga0081539_10000690 3300005985 Bacteria 67656
111 Ga0075365_10008818 3300006038 Bacteria 5751
112 Ga0075365_10011801 3300006038 Bacteria 5157
113 Ga0075365_10015484 3300006038 Bacteria 4616
114 Ga0075365_10035579 3300006038 Bacteria 3223
115 Ga0075365_10065362 3300006038 Bacteria 2438
116 Ga0075365_10128777 3300006038 Bacteria 1750
117 Ga0075365_10169525 3300006038 Bacteria 1523
118 Ga0075365_10247244 3300006038 Bacteria 1253
119 Ga0075365_10250840 3300006038 Bacteria 1244
120 Ga0075368_10000331 3300006042 Bacteria 13823
121 Ga0075368_10013009 3300006042 Bacteria 3052
122 Ga0075364_10000055 3300006051 Bacteria 41950
123 Ga0075364_10002563 3300006051 Bacteria 10184
124 Ga0075364_10111164 3300006051 Bacteria 1828
125 Ga0075364_10113188 3300006051 Bacteria 1812
126 Ga0075364_10207119 3300006051 Bacteria 1330
127 Ga0075364_10376193 3300006051 Bacteria 969
128 Ga0075362_10003009 3300006177 Bacteria 5796
129 Ga0075367_10001276 3300006178 Bacteria 10645
130 Ga0075367_10008172 3300006178 Bacteria 5407
131 Ga0075367_10012825 3300006178 Bacteria 4487
132 Ga0075369_10000313 3300006186 Bacteria 14403
133 Ga0075369_10000392 3300006186 Bacteria 13230
134 Ga0075369_10000984 3300006186 Bacteria 9500
135 Ga0075369_10059281 3300006186 Bacteria 1667
136 Ga0075366_10010073 3300006195 Bacteria 5298
137 Ga0075366_10018892 3300006195 Bacteria 3984
138 Ga0075366_10059537 3300006195 Bacteria 2268
139 Ga0075366_10169644 3300006195 Bacteria 1324
140 Ga0075370_10003473 3300006353 Bacteria 7510
141 Ga0075370_10030140 3300006353 Bacteria 3026
142 Ga0079104_1000310 3300006946 Bacteria 61815
143 Ga0079104_1002619 3300006946 Bacteria 9415
144 Ga0099826_10000813 3300006948 Bacteria 16761
145 Ga0105251_10005877 3300009011 Bacteria 7935
146 Ga0105244_10061279 3300009036 Bacteria 1894
147 Ga0105244_10148610 3300009036 Bacteria 1123
148 Ga0105244_10151217 3300009036 Bacteria 1112
149 Ga0105250_10005594 3300009092 Bacteria 5620
150 Ga0105240_10000142 3300009093 Bacteria 146932
151 Ga0105240_10117420 3300009093 Bacteria 3207
152 Ga0105247_10027296 3300009101 Bacteria 3453
153 Ga0105243_10013389 3300009148 Bacteria 6202
154 Ga0105243_10065194 3300009148 Bacteria 2925
155 Ga0105241_10094484 3300009174 Bacteria 2365
156 Ga0105248_10015451 3300009177 Bacteria 8413
157 Ga0105237_10073189 3300009545 Bacteria 3419
158 Ga0105238_10241903 3300009551 Bacteria 1782
159 Ga0105238_10399002 3300009551 Bacteria 1368
160 Ga0105249_10027699 3300009553 Bacteria 5114
161 Ga0105249_10076570 3300009553 Bacteria 3101
162 Ga0105249_10164867 3300009553 Bacteria 2144
163 Ga0123341_1011001 3300009765 Bacteria 8249
164 Ga0123342_1006148 3300009766 Bacteria 16842
165 Ga0105239_10040928 3300010375 Bacteria 5078
166 Ga0105239_10098844 3300010375 Bacteria 3226
167 Ga0105239_10145918 3300010375 Bacteria 2639
168 Ga0105239_10222728 3300010375 Bacteria 2116
169 Ga0105246_10125589 3300011119 Bacteria 1908
170 Ga0157373_10017981 3300013100 Bacteria 5148
171 Ga0157373_10052766 3300013100 Bacteria 2892
172 Ga0157371_10000071 3300013102 Bacteria 164088
173 Ga0157371_10016970 3300013102 Bacteria 5421
174 Ga0157371_10208933 3300013102 Bacteria 1400
175 Ga0157370_10000079 3300013104 Bacteria 107305
176 Ga0157370_10250954 3300013104 Bacteria 1637
177 Ga0157369_10058030 3300013105 Bacteria 4175
178 Ga0157369_10155592 3300013105 Bacteria 2415
179 Ga0157369_10301116 3300013105 Bacteria 1668
180 Ga0171463_1004 3300013249 Bacteria 437207
181 Ga0157374_10515719 3300013296 Bacteria 1201
182 Ga0163162_10240203 3300013306 Bacteria 1942
183 Ga0163162_10264290 3300013306 Bacteria 1852
184 Ga0163162_10407197 3300013306 Bacteria 1493
185 Ga0163163_10667340 3300014325 Bacteria 1103
186 Ga0182006_1045002 3300015261 Bacteria 1719
187 Ga0182007_10009040 3300015262 Bacteria 4052
188 Ga0182005_1011399 3300015265 Bacteria 2535
189 Ga0183363_1129 3300015690 Bacteria 19181
190 Ga0214542_1000064 3300021321 Bacteria 127681
191 Ga0214542_1012059 3300021321 Bacteria 11445
192 Ga0214543_1000015 3300021327 Bacteria 305679
193 Ga0214543_1000063 3300021327 Bacteria 127694
194 Ga0228710_1000002 3300022740 Bacteria 287279
195 Ga0209435_100031 3300025206 Bacteria 164115
196 Ga0209436_100013 3300025208 Bacteria 131492
197 Ga0209436_100428 3300025208 Bacteria 18888
198 Ga0209436_106719 3300025208 Bacteria 2485
199 Ga0207427_108179 3300025231 Bacteria 1180
200 Ga0209437_100179 3300025233 Bacteria 134210
201 Ga0209437_100181 3300025233 Bacteria 132953
202 Ga0207425_1000035 3300025245 Bacteria 225942
203 Ga0207425_1000818 3300025245 Bacteria 15570
204 Ga0207425_1003762 3300025245 Bacteria 4742
205 Ga0207425_1006981 3300025245 Bacteria 3034
206 Ga0207425_1016727 3300025245 Bacteria 1624
207 Ga0207425_1017715 3300025245 Bacteria 1559
208 Ga0209646_1000102 3300025246 Bacteria 164115
209 Ga0209026_1000096 3300025250 Bacteria 164115
210 Ga0209026_1000141 3300025250 Bacteria 114545
211 Ga0209677_100353 3300025253 Bacteria 28643
212 Ga0209148_1000111 3300025254 Bacteria 198095
213 Ga0209148_1006902 3300025254 Bacteria 2411
214 Ga0209759_1000090 3300025256 Bacteria 164115
215 Ga0209759_1000354 3300025256 Bacteria 59742
216 Ga0209129_1000029 3300025258 Bacteria 401149
217 Ga0209129_1000050 3300025258 Bacteria 267408
218 Ga0209129_1000826 3300025258 Bacteria 19503
219 Ga0209129_1002308 3300025258 Bacteria 9478
220 Ga0209129_1003458 3300025258 Bacteria 6852
221 Ga0209129_1003466 3300025258 Bacteria 6840
222 Ga0209233_1000118 3300025261 Bacteria 236172
223 Ga0209233_1000185 3300025261 Bacteria 133788
224 Ga0209233_1000212 3300025261 Bacteria 110364
225 Ga0209233_1000263 3300025261 Bacteria 79293
226 Ga0209233_1002000 3300025261 Bacteria 7717
227 Ga0209455_1000206 3300025272 Bacteria 84430
228 Ga0209673_1000033 3300025273 Bacteria 335369
229 Ga0209673_1000050 3300025273 Bacteria 285287
230 Ga0209673_1000370 3300025273 Bacteria 81047
231 Ga0209673_1001845 3300025273 Bacteria 17300
232 Ga0209673_1002753 3300025273 Bacteria 11510
233 Ga0209673_1004411 3300025273 Bacteria 7553
234 Ga0209673_1009772 3300025273 Bacteria 4115
235 Ga0209673_1012920 3300025273 Bacteria 3328
236 Ga0209673_1017809 3300025273 Bacteria 2607
237 Ga0209130_1000009 3300025284 Bacteria 498952
238 Ga0209130_1000058 3300025284 Bacteria 210250
239 Ga0209130_1000133 3300025284 Bacteria 119561
240 Ga0209130_1003685 3300025284 Bacteria 6322
241 Ga0209130_1009201 3300025284 Bacteria 2840
242 Ga0209676_1003603 3300025292 Bacteria 9324
243 Ga0209676_1017298 3300025292 Bacteria 2559
244 Ga0209025_1000042 3300025294 Bacteria 370577
245 Ga0209025_1000132 3300025294 Bacteria 197432
246 Ga0209025_1000453 3300025294 Bacteria 80110
247 Ga0209025_1000536 3300025294 Bacteria 71932
248 Ga0209025_1000815 3300025294 Bacteria 50019
249 Ga0209025_1003984 3300025294 Bacteria 13258
250 Ga0209025_1008993 3300025294 Bacteria 7056
251 Ga0209025_1009137 3300025294 Bacteria 6969
252 Ga0209025_1023470 3300025294 Bacteria 3221
253 Ga0209025_1044776 3300025294 Bacteria 1844
254 Ga0209025_1082425 3300025294 Bacteria 1086
255 Ga0209564_1000193 3300025295 Bacteria 141731
256 Ga0209564_1000227 3300025295 Bacteria 125497
257 Ga0209564_1000284 3300025295 Bacteria 102684
258 Ga0209564_1002592 3300025295 Bacteria 13868
259 Ga0209564_1007808 3300025295 Bacteria 5431
260 Ga0209564_1010209 3300025295 Bacteria 4357
261 Ga0209564_1010789 3300025295 Bacteria 4164
262 Ga0209564_1021755 3300025295 Bacteria 2293
263 Ga0209758_1000299 3300025297 Bacteria 97367
264 Ga0209758_1000406 3300025297 Bacteria 73962
265 Ga0209758_1000864 3300025297 Bacteria 41937
266 Ga0209758_1001412 3300025297 Bacteria 28454
267 Ga0209758_1001462 3300025297 Bacteria 27731
268 Ga0209758_1003168 3300025297 Bacteria 15434
269 Ga0209758_1003902 3300025297 Bacteria 13025
270 Ga0209758_1005846 3300025297 Bacteria 9189
271 Ga0209758_1007065 3300025297 Bacteria 7785
272 Ga0209758_1022438 3300025297 Bacteria 2894
273 Ga0209758_1028206 3300025297 Bacteria 2380
274 Ga0209050_1002699 3300025298 Bacteria 14431
275 Ga0209050_1004678 3300025298 Bacteria 9092
276 Ga0209050_1004888 3300025298 Bacteria 8778
277 Ga0209256_1000286 3300025299 Bacteria 88880
278 Ga0209256_1001479 3300025299 Bacteria 24043
279 Ga0209256_1001610 3300025299 Bacteria 22074
280 Ga0209256_1001820 3300025299 Bacteria 19999
281 Ga0209256_1002679 3300025299 Bacteria 13959
282 Ga0209256_1003742 3300025299 Bacteria 10288
283 Ga0209256_1005463 3300025299 Bacteria 7300
284 Ga0209256_1013906 3300025299 Bacteria 2947
285 Ga0209256_1015132 3300025299 Bacteria 2720
286 Ga0207426_1000041 3300025302 Bacteria 433536
287 Ga0207426_1000131 3300025302 Bacteria 210250
288 Ga0207426_1000214 3300025302 Bacteria 137296
289 Ga0207426_1000248 3300025302 Bacteria 119561
290 Ga0207426_1000682 3300025302 Bacteria 40955
291 Ga0209051_1000118 3300025303 Bacteria 149426
292 Ga0209051_1000822 3300025303 Bacteria 32088
293 Ga0209051_1001039 3300025303 Bacteria 26259
294 Ga0209051_1011245 3300025303 Bacteria 4438
295 Ga0209051_1012570 3300025303 Bacteria 4089
296 Ga0209257_1003194 3300025304 Bacteria 14537
297 Ga0209257_1003966 3300025304 Bacteria 11990
298 Ga0209257_1008273 3300025304 Bacteria 5971
299 Ga0209257_1021432 3300025304 Bacteria 2347
300 Ga0209257_1031374 3300025304 Bacteria 1700
301 Ga0209257_1032740 3300025304 Bacteria 1644
302 Ga0207713_1039001 3300025735 Bacteria 2009
303 Ga0207680_10460929 3300025903 Bacteria 903
304 Ga0207647_10005393 3300025904 Bacteria 9389
305 Ga0207647_10029967 3300025904 Bacteria 3515
306 Ga0207647_10232840 3300025904 Bacteria 1059
307 Ga0207695_10000234 3300025913 Bacteria 146987
308 Ga0207671_10000234 3300025914 Bacteria 83448
309 Ga0207681_10044364 3300025923 Bacteria 2979
310 Ga0207650_10001757 3300025925 Bacteria 15368
311 Ga0207709_10041550 3300025935 Bacteria 2760
312 Ga0207709_10130227 3300025935 Bacteria 1713
313 Ga0207711_10015450 3300025941 Bacteria 6335
314 Ga0207667_10228498 3300025949 Bacteria 1906
315 Ga0207712_10015100 3300025961 Bacteria 4976
316 Ga0207640_10099697 3300025981 Bacteria 2033
317 Ga0207639_10264026 3300026041 Bacteria 1507
318 Ga0207678_10040358 3300026067 Bacteria 4048
319 Ga0207702_10028158 3300026078 Bacteria 4669
320 Ga0207702_10347382 3300026078 Bacteria 1418
321 Ga0207648_10017029 3300026089 Bacteria 6623
322 Ga0207683_10204603 3300026121 Bacteria 1795
323 Ga0207698_10158850 3300026142 Bacteria 1974
324 Ga0207698_10347438 3300026142 Bacteria 1400
325 Ga0209281_1000028 3300027111 Bacteria 440027
326 Ga0209281_1000030 3300027111 Bacteria 425931
327 Ga0209281_1000144 3300027111 Bacteria 172471
328 Ga0209371_1000037 3300027312 Bacteria 367074
329 Ga0209371_1001411 3300027312 Bacteria 16466
330 Ga0209282_1000004 3300027666 Bacteria 425931
331 Ga0209282_1000695 3300027666 Bacteria 16757
332 Ga0209813_10000656 3300027866 Bacteria 7932
333 Ga0209813_10005578 3300027866 Bacteria 3063
334 Ga0268266_10009948 3300028379 Bacteria 8347
335 Ga0268266_10020595 3300028379 Bacteria 5619
336 Ga0268266_10022456 3300028379 Bacteria 5376
337 Ga0268266_10024962 3300028379 Bacteria 5086
338 Ga0268266_10036055 3300028379 Bacteria 4208
339 Ga0268266_10048156 3300028379 Bacteria 3653
340 Ga0268266_10084479 3300028379 Bacteria 2772
341 Ga0268266_10107988 3300028379 Bacteria 2462
342 Ga0307515_10001049 3300028794 Bacteria 63286
343 Ga0307515_10001099 3300028794 Bacteria 61933
344 Ga0307515_10003215 3300028794 Bacteria 34578
345 Ga0307515_10012908 3300028794 Bacteria 15667
346 Ga0307515_10166092 3300028794 Bacteria 2224
347 Ga0307515_10405949 3300028794 Bacteria 986
348 Ga0268256_1000039 3300030500 Bacteria 354969
349 Ga0268256_1001490 3300030500 Bacteria 13902
350 Ga0307513_10001726 3300031456 Bacteria 31179
351 Ga0307513_10293864 3300031456 Bacteria 1395
352 Ga0307513_10322135 3300031456 Bacteria 1303
353 Ga0307408_100174389 3300031548 Bacteria 1719
354 Ga0307408_100214882 3300031548 Bacteria 1565
355 Ga0307405_10000700 3300031731 Bacteria 13004
356 Ga0307405_10105294 3300031731 Bacteria 1900
357 Ga0307405_10107309 3300031731 Bacteria 1885
358 Ga0307406_10025694 3300031901 Bacteria 3528
359 Ga0307412_10000412 3300031911 Bacteria 26116
360 Ga0307412_10180321 3300031911 Bacteria 1588
361 Ga0315914_1000001 3300031967 Bacteria 416633
362 Ga0307409_100057973 3300031995 Bacteria 3005
363 Ga0307416_100117991 3300032002 Bacteria 2357
364 Ga0307414_10281880 3300032004 Bacteria 1397
365 Ga0315913_1000022 3300033430 Bacteria 94546
366 Ga0315915_1000002 3300033464 Bacteria 425854
367 Ga0373943_0022408 3300035170 Bacteria 2927
368 Ga0373927_0000068 3300035695 Bacteria 75823
369 Ga0373925_0009713 3300037068 Bacteria 6995
370 Ga0395899_0000114 3300037312 Bacteria 134621
371 Ga0395900_0000154 3300037418 Bacteria 113757
372 Ga0395898_0000308 3300037466 Bacteria 113757
373 Ga0395905_0000145 3300037471 Bacteria 116795
374 Ga0395905_0000153 3300037471 Bacteria 113757
375 Ga0395905_0002522 3300037471 Bacteria 20214
376 Ga0395905_0003283 3300037471 Bacteria 17375
377 Ga0395905_0006080 3300037471 Bacteria 12205
378 Ga0395905_0109772 3300037471 Bacteria 2590
379 Ga0395905_0140183 3300037471 Bacteria 2275
380 Ga0395905_0203194 3300037471 Bacteria 1857
381 Ga0395901_0000107 3300038443 Bacteria 113757
382 Ga0395901_0128293 3300038443 Bacteria 2666
383 Ga0439436_0020168 3300041404 Bacteria 1986
384 Ga0439438_022143 3300041405 Bacteria 1766
385 Ga0439465_0002941 3300041413 Bacteria 5579
386 Ga0439465_0008560 3300041413 Bacteria 3228
387 Ga0439465_0087910 3300041413 Bacteria 1060
388 Ga0439465_0109789 3300041413 Bacteria 959
389 Ga0439465_0109951 3300041413 Bacteria 958
390 Ga0451787_786302 3300041441 Bacteria 3281
391 Ga0451791_1084156 3300041451 Bacteria 2283
392 Ga0451795_0936408 3300041456 Bacteria 1710
393 Ga0451835_0541352 3300041492 Bacteria 1606
394 Ga0451837_1266342 3300041494 Bacteria 2873
395 Ga0451839_0960768 3300041496 Bacteria 948
396 Ga0451839_1362450 3300041496 Bacteria 900
397 Ga0451845_0818217 3300041501 Bacteria 1202
398 Ga0451846_16062 3300041502 Bacteria 4334
399 Ga0451847_0888644 3300041503 Bacteria 1230
400 Ga0451848_00496 3300041504 Bacteria 1003
401 Ga0451849_0622848 3300041505 Bacteria 1609
402 Ga0451849_1184580 3300041505 Bacteria 888
403 Ga0451850_52452 3300041506 Bacteria 1113
404 Ga0451851_0296208 3300041507 Bacteria 1866
405 Ga0451851_1301903 3300041507 Bacteria 1545
406 Ga0451843_0006262 3300041509 Bacteria 2798
407 Ga0451843_0102315 3300041509 Bacteria 4344
408 Ga0451854_25229 3300041510 Bacteria 1677
409 Ga0451855_1956298 3300041511 Bacteria 1229
410 Ga0452271_63898 3300041916 Bacteria 1163
411 Ga0439449_0016640 3300042007 Bacteria 2763
412 Ga0439449_0082256 3300042007 Bacteria 1187
413 Ga0439462_0050030 3300042015 Bacteria 1122
414 Ga0450918_001271 3300042531 Bacteria 5116
415 Ga0466965_0038749 3300044683 Bacteria 2342
416 Ga0466968_0085444 3300044735 Bacteria 1392
417 Ga0466970_0057028 3300044765 Bacteria 2088
418 Ga0466960_0058815 3300044901 Bacteria 1878
419 Ga0466967_0122754 3300045976 Bacteria 2403
420 Ga0495590_0096483 3300046457 Bacteria 1048
421 Ga0495629_0228937 3300046459 Bacteria 1281
422 Ga0495638_0000110 3300046460 Bacteria 131410
423 Ga0495638_0009542 3300046460 Bacteria 6800
424 Ga0495638_0023446 3300046460 Bacteria 4035
425 Ga0495638_0072445 3300046460 Bacteria 2105
426 Ga0495605_0018627 3300046474 Bacteria 3718
427 Ga0495605_0018645 3300046474 Bacteria 3715
428 Ga0495585_0025166 3300046492 Bacteria 3412
429 Ga0495585_0273670 3300046492 Bacteria 836
430 Ga0495607_0009290 3300046501 Bacteria 6668
431 Ga0495583_0002526 3300046506 Bacteria 15489
432 Ga0495583_0030411 3300046506 Bacteria 2630
433 Ga0495583_0036690 3300046506 Bacteria 2329
434 Ga0495583_0038784 3300046506 Bacteria 2249
435 Ga0495606_0008486 3300046507 Bacteria 8914
436 Ga0495610_0000363 3300046512 Bacteria 47378
437 Ga0495610_0114438 3300046512 Bacteria 1191
438 Ga0495620_0026048 3300046515 Bacteria 2755
439 Ga0495620_0032808 3300046515 Bacteria 2362
440 Ga0495620_0124812 3300046515 Bacteria 1013
441 Ga0495631_0009141 3300046518 Bacteria 4963
442 Ga0495631_0062843 3300046518 Bacteria 1608
443 Ga0495632_0002260 3300046519 Bacteria 14836
444 Ga0495632_0004424 3300046519 Bacteria 9551
445 Ga0495632_0031879 3300046519 Bacteria 2720
446 Ga0495632_0043756 3300046519 Bacteria 2237
447 Ga0495643_0014831 3300046522 Bacteria 4627
448 Ga0495643_0083550 3300046522 Bacteria 1657
449 Ga0495648_0023661 3300046524 Bacteria 4200
450 Ga0495648_0033988 3300046524 Bacteria 3325
451 Ga0495654_0000143 3300046530 Bacteria 74495
452 Ga0495654_0029808 3300046530 Bacteria 2781
453 Ga0495654_0102439 3300046530 Bacteria 1316
454 Ga0495640_0124115 3300046533 Bacteria 1676
455 Ga0495609_0047715 3300046538 Bacteria 1916
456 Ga0495597_0003665 3300046542 Bacteria 8821
457 Ga0495622_0003807 3300046557 Bacteria 7049
458 Ga0495633_0017760 3300046558 Bacteria 3627
459 Ga0495668_0013032 3300046616 Bacteria 4920
460 Ga0495668_0028753 3300046616 Bacteria 3143
461 Ga0495668_0044115 3300046616 Bacteria 2478
462 Ga0495668_0078372 3300046616 Bacteria 1814
463 Ga0495668_0166161 3300046616 Bacteria 1209
464 Ga0495611_0066298 3300046648 Bacteria 1646
465 Ga0495625_0018152 3300046660 Bacteria 5499
466 Ga0495625_0025839 3300046660 Bacteria 4445
467 Ga0495625_0032212 3300046660 Bacteria 3891
468 Ga0495625_0032944 3300046660 Bacteria 3836
469 Ga0495625_0036901 3300046660 Bacteria 3588
470 Ga0495625_0060171 3300046660 Bacteria 2692
471 Ga0495625_0087218 3300046660 Bacteria 2164
472 Ga0495625_0114829 3300046660 Bacteria 1838
473 Ga0495625_0153453 3300046660 Bacteria 1547
474 Ga0495625_0350247 3300046660 Bacteria 934
475 Ga0495670_0124213 3300046691 Bacteria 1342
476 Ga0495649_0028221 3300046694 Bacteria 3111
477 Ga0495604_0040845 3300047317 Bacteria 3640
478 Ga0495672_0037794 3300047320 Bacteria 2951
479 Ga0495681_0006015 3300047470 Bacteria 8035
480 Ga0495681_0016034 3300047470 Bacteria 4222
481 Ga0495686_0002138 3300047472 Bacteria 19314
482 Ga0495686_0029027 3300047472 Bacteria 3600
483 Ga0495686_0034137 3300047472 Bacteria 3278
484 Ga0496100_0041778 3300048903 Bacteria 2925
485 Ga0496102_0027633 3300048905 Bacteria 5066
486 Ga0496102_0095857 3300048905 Bacteria 2750
487 Ga0496102_0231085 3300048905 Bacteria 1744
488 Ga0496102_0664044 3300048905 Bacteria 965
489 Ga0496103_0035386 3300048906 Bacteria 3057
490 Ga0496104_0019186 3300048907 Bacteria 6252
491 Ga0496104_0572581 3300048907 Bacteria 1040
492 Ga0496105_0106434 3300048908 Bacteria 2315
493 Ga0496106_0000209 3300048909 Bacteria 40829
494 Ga0496110_0034043 3300048913 Bacteria 4410
495 Ga0496110_0037462 3300048913 Bacteria 4215
496 Ga0496111_0000529 3300048914 Bacteria 19781
497 Ga0496112_0059923 3300048915 Bacteria 3751
498 Ga0496113_0125184 3300048916 Bacteria 2012
499 Ga0496113_0182693 3300048916 Bacteria 1663
500 Ga0496115_0559841 3300048918 Bacteria 913
501 Ga0496116_0000057 3300048919 Bacteria 281652
502 Ga0496116_0002951 3300048919 Bacteria 17324
503 Ga0496116_0004307 3300048919 Bacteria 13619
504 Ga0496116_0007377 3300048919 Bacteria 9769
505 Ga0496116_0012871 3300048919 Bacteria 6795
506 Ga0496116_0013281 3300048919 Bacteria 6657
507 Ga0496116_0027111 3300048919 Bacteria 4175
508 Ga0496116_0049893 3300048919 Bacteria 2793
509 Ga0496116_0089513 3300048919 Bacteria 1877
510 Ga0496117_0000031 3300048920 Bacteria 381048
511 Ga0496117_0004374 3300048920 Bacteria 15663
512 Ga0496117_0005859 3300048920 Bacteria 12714
513 Ga0496117_0008418 3300048920 Bacteria 9802
514 Ga0496117_0008839 3300048920 Bacteria 9505
515 Ga0496117_0025271 3300048920 Bacteria 4673
516 Ga0496117_0057733 3300048920 Bacteria 2693
517 Ga0496117_0062376 3300048920 Bacteria 2555
518 Ga0496118_0000208 3300048921 Bacteria 102645
519 Ga0496118_0008309 3300048921 Bacteria 10754
520 Ga0496118_0009542 3300048921 Bacteria 9773
521 Ga0496118_0010424 3300048921 Bacteria 9207
522 Ga0496118_0018069 3300048921 Bacteria 6382
523 Ga0496118_0026041 3300048921 Bacteria 4996
524 Ga0496118_0117856 3300048921 Bacteria 1741
525 Ga0496119_0010018 3300048922 Bacteria 8021
526 Ga0496119_0027187 3300048922 Bacteria 3941
527 Ga0496119_0028420 3300048922 Bacteria 3815
528 Ga0496119_0057969 3300048922 Bacteria 2337
529 Ga0496119_0058422 3300048922 Bacteria 2324
530 Ga0496119_0059282 3300048922 Bacteria 2300
531 Ga0496119_0098164 3300048922 Bacteria 1649
532 Ga0496119_0173109 3300048922 Bacteria 1138
533 Ga0496120_0000387 3300048923 Bacteria 71224
534 Ga0496120_0003353 3300048923 Bacteria 14696
535 Ga0496120_0009286 3300048923 Bacteria 6995
536 Ga0496120_0031754 3300048923 Bacteria 3193
537 Ga0496121_0000034 3300048924 Bacteria 377095
538 Ga0496121_0000888 3300048924 Bacteria 53958
539 Ga0496121_0003956 3300048924 Bacteria 20474
540 Ga0496121_0006665 3300048924 Bacteria 14205
541 Ga0496121_0011216 3300048924 Bacteria 9985
542 Ga0496121_0017687 3300048924 Bacteria 7256
543 Ga0496121_0021103 3300048924 Bacteria 6399
544 Ga0496121_0026581 3300048924 Bacteria 5446
545 Ga0496121_0062440 3300048924 Bacteria 3051
546 Ga0496121_0099186 3300048924 Bacteria 2252
547 Ga0496121_0368692 3300048924 Bacteria 951
548 Ga0496121_0423096 3300048924 Bacteria 866
549 Ga0496122_0000023 3300048925 Bacteria 381035
550 Ga0496122_0000082 3300048925 Bacteria 209159
551 Ga0496122_0000308 3300048925 Bacteria 107960
552 Ga0496122_0001941 3300048925 Bacteria 31047
553 Ga0496122_0009040 3300048925 Bacteria 10577
554 Ga0496122_0009440 3300048925 Bacteria 10278
555 Ga0496122_0016216 3300048925 Bacteria 7071
556 Ga0496122_0024313 3300048925 Bacteria 5303
557 Ga0496122_0046997 3300048925 Bacteria 3336
558 Ga0496122_0056321 3300048925 Bacteria 2931
559 Ga0496122_0069421 3300048925 Bacteria 2523
560 Ga0496122_0099299 3300048925 Bacteria 1952
561 Ga0496122_0179827 3300048925 Bacteria 1263
562 Ga0496122_0188034 3300048925 Bacteria 1222
563 Ga0496123_0000027 3300048926 Bacteria 306773
564 Ga0496123_0000066 3300048926 Bacteria 210327
565 Ga0496123_0000067 3300048926 Bacteria 209159
566 Ga0496123_0004280 3300048926 Bacteria 15189
567 Ga0496123_0005944 3300048926 Bacteria 12020
568 Ga0496123_0007760 3300048926 Bacteria 10011
569 Ga0496123_0014489 3300048926 Bacteria 6531
570 Ga0496123_0014788 3300048926 Bacteria 6443
571 Ga0496123_0017159 3300048926 Bacteria 5840
572 Ga0496123_0032615 3300048926 Bacteria 3766
573 Ga0496123_0091795 3300048926 Bacteria 1799
574 Ga0496123_0143543 3300048926 Bacteria 1300
575 Ga0496123_0147973 3300048926 Bacteria 1272
576 Ga0496124_0000294 3300048927 Bacteria 93153
577 Ga0496124_0001215 3300048927 Bacteria 39879
578 Ga0496124_0003574 3300048927 Bacteria 18903
579 Ga0496124_0004183 3300048927 Bacteria 17010
580 Ga0496124_0008477 3300048927 Bacteria 10743
581 Ga0496124_0021552 3300048927 Bacteria 5936
582 Ga0496124_0041507 3300048927 Bacteria 3969
583 Ga0496124_0066054 3300048927 Bacteria 3014
584 Ga0496124_0071829 3300048927 Bacteria 2867
585 Ga0496124_0132601 3300048927 Bacteria 1977
586 Ga0496124_0138206 3300048927 Bacteria 1926
587 Ga0496124_0196553 3300048927 Bacteria 1538
588 Ga0496125_0000030 3300048928 Bacteria 375023
589 Ga0496125_0000288 3300048928 Bacteria 99681
590 Ga0496125_0004702 3300048928 Bacteria 15559
591 Ga0496125_0005090 3300048928 Bacteria 14802
592 Ga0496125_0006385 3300048928 Bacteria 12774
593 Ga0496125_0010417 3300048928 Bacteria 9407
594 Ga0496125_0051919 3300048928 Bacteria 3377
595 Ga0496125_0122995 3300048928 Bacteria 1845
596 Ga0496125_0124822 3300048928 Bacteria 1827
597 Ga0496125_0225126 3300048928 Bacteria 1204
598 Ga0496126_0000115 3300048929 Bacteria 188546
599 Ga0496126_0000258 3300048929 Bacteria 113843
600 Ga0496126_0061541 3300048929 Bacteria 3372
601 Ga0496126_0125055 3300048929 Bacteria 2227
602 Ga0496126_0266582 3300048929 Bacteria 1422
603 Ga0496126_0281803 3300048929 Bacteria 1376
604 Ga0496126_0447962 3300048929 Bacteria 1039
605 Ga0496126_0519990 3300048929 Bacteria 948
606 Ga0495678_051307 3300049459 Bacteria 1595
607 Ga0501300_002486 3300049523 Bacteria 2755
608 Ga0501031_0000009 3300049568 Bacteria 155116
609 Ga0501031_0038311 3300049568 Bacteria 3129
610 Ga0501031_0081844 3300049568 Bacteria 2105
611 Ga0501031_0109836 3300049568 Bacteria 1801
612 Ga0501031_0153985 3300049568 Bacteria 1502
613 Ga0501031_0160215 3300049568 Bacteria 1471
614 Ga0501032_0000001 3300049569 Bacteria 422097
615 Ga0501032_0000017 3300049569 Bacteria 158303
616 Ga0501032_0004117 3300049569 Bacteria 11017
617 Ga0501032_0161419 3300049569 Bacteria 1472
618 Ga0501032_0164065 3300049569 Bacteria 1458
619 Ga0501032_0188048 3300049569 Bacteria 1350
620 Ga0501032_0209990 3300049569 Bacteria 1269
621 Ga0501033_0000029 3300049570 Bacteria 158294
622 Ga0501033_0000741 3300049570 Bacteria 29982
623 Ga0501033_0000898 3300049570 Bacteria 27225
624 Ga0501033_0001913 3300049570 Bacteria 18117
625 Ga0501033_0015463 3300049570 Bacteria 5788
626 Ga0501033_0020825 3300049570 Bacteria 4951
627 Ga0501033_0041445 3300049570 Bacteria 3435
628 Ga0501033_0048357 3300049570 Bacteria 3159
629 Ga0501033_0142767 3300049570 Bacteria 1731
630 Ga0501033_0340796 3300049570 Bacteria 1051
631 Ga0501034_0000102 3300049571 Bacteria 158302
632 Ga0501034_0006657 3300049571 Bacteria 12393
633 Ga0501034_0008076 3300049571 Bacteria 11161
634 Ga0501034_0008287 3300049571 Bacteria 11001
635 Ga0501034_0048481 3300049571 Bacteria 4287
636 Ga0501034_0101447 3300049571 Bacteria 2871
637 Ga0501034_0116412 3300049571 Bacteria 2661
638 Ga0501034_0154163 3300049571 Bacteria 2272
639 Ga0501034_0379969 3300049571 Bacteria 1337
640 Ga0501036_0000011 3300049572 Bacteria 158302
641 Ga0501036_0000804 3300049572 Bacteria 23330
642 Ga0501036_0297214 3300049572 Bacteria 1351
643 Ga0501037_0000015 3300049573 Bacteria 161311
644 Ga0501037_0000089 3300049573 Bacteria 85102
645 Ga0501037_0000091 3300049573 Bacteria 84811
646 Ga0501037_0060985 3300049573 Bacteria 2751
647 Ga0501037_0125928 3300049573 Bacteria 1839
648 Ga0501038_0000016 3300049574 Bacteria 159150
649 Ga0501038_0000402 3300049574 Bacteria 37516
650 Ga0501038_0229756 3300049574 Bacteria 1477
651 Ga0501039_0000022 3300049575 Bacteria 160858
652 Ga0501039_0000023 3300049575 Bacteria 158026
653 Ga0501039_0045660 3300049575 Bacteria 3385
654 Ga0501040_0029026 3300049576 Bacteria 3732
655 Ga0501040_0494081 3300049576 Bacteria 882
656 Ga0501042_0026781 3300049578 Bacteria 4051
657 Ga0501043_0000007 3300049579 Bacteria 224595
658 Ga0501043_0000093 3300049579 Bacteria 80521
659 Ga0501043_0000372 3300049579 Bacteria 40661
660 Ga0501043_0064351 3300049579 Bacteria 2879
661 Ga0501043_0092471 3300049579 Bacteria 2378
662 Ga0501046_0012425 3300049580 Bacteria 7249
663 Ga0501046_0087767 3300049580 Bacteria 2396
664 Ga0501046_0148875 3300049580 Bacteria 1767
665 Ga0501047_0001169 3300049581 Bacteria 26022
666 Ga0501047_0092127 3300049581 Bacteria 2909
667 Ga0501047_0214148 3300049581 Bacteria 1784
668 Ga0501048_0146250 3300049582 Bacteria 1671
669 Ga0501048_0460991 3300049582 Bacteria 910
670 Ga0501067_0152752 3300049583 Bacteria 1286
671 Ga0501068_0006869 3300049584 Bacteria 6291
672 Ga0501068_0114354 3300049584 Bacteria 1680
673 Ga0501068_0211120 3300049584 Bacteria 1233
674 Ga0501069_0000001 3300049585 Bacteria 289100
675 Ga0501069_0038095 3300049585 Bacteria 2654
676 Ga0501069_0095787 3300049585 Bacteria 1681
677 Ga0501070_0000071 3300049586 Bacteria 86669
678 Ga0501070_0000771 3300049586 Bacteria 29156
679 Ga0501070_0001656 3300049586 Bacteria 19742
680 Ga0501070_0017382 3300049586 Bacteria 6037
681 Ga0501070_0055100 3300049586 Bacteria 3296
682 Ga0501070_0089623 3300049586 Bacteria 2545
683 Ga0501070_0144438 3300049586 Bacteria 1964
684 Ga0501070_0183253 3300049586 Bacteria 1723
685 Ga0501070_0409529 3300049586 Bacteria 1096
686 Ga0501071_0004826 3300049587 Bacteria 8591
687 Ga0501073_0003390 3300049589 Bacteria 11984
688 Ga0501074_0000003 3300049590 Bacteria 116101
689 Ga0501074_0092052 3300049590 Bacteria 2171
690 Ga0501074_0120102 3300049590 Bacteria 1879
691 Ga0501080_0000090 3300049742 Bacteria 61585
692 Ga0501080_0037802 3300049742 Bacteria 4507
693 Ga0501080_0243365 3300049742 Bacteria 1641
694 Ga0501083_0000012 3300049744 Bacteria 178668
695 Ga0501035_0000037 3300049822 Bacteria 160921
696 Ga0501035_0000038 3300049822 Bacteria 158818
697 Ga0501035_0000336 3300049822 Bacteria 54776
698 Ga0501035_0000646 3300049822 Bacteria 38403
699 Ga0501035_0002118 3300049822 Bacteria 19744
700 Ga0501035_0003768 3300049822 Bacteria 14446
701 Ga0501035_0056753 3300049822 Bacteria 3492
702 Ga0501035_0106057 3300049822 Bacteria 2464
703 Ga0501035_0144586 3300049822 Bacteria 2066
704 Ga0501035_0473060 3300049822 Bacteria 1034
705 Ga0501044_0000018 3300049823 Bacteria 225885
706 Ga0501044_0000046 3300049823 Bacteria 146812
707 Ga0501044_0004660 3300049823 Bacteria 15346
708 Ga0501044_0070887 3300049823 Bacteria 3544
709 Ga0501044_0080832 3300049823 Bacteria 3291
710 Ga0501044_0116263 3300049823 Bacteria 2680
711 Ga0501044_0155940 3300049823 Bacteria 2263
712 Ga0501044_0375518 3300049823 Bacteria 1337
713 Ga0501044_0557299 3300049823 Bacteria 1043
714 Ga0501044_0642147 3300049823 Bacteria 951
715 Ga0501045_0073807 3300049824 Bacteria 2512
716 nmdc:mga03683_2458_c1 3300050489 Bacteria 5759
717 nmdc:mga03n38_17445_c1 3300050490 Bacteria 2812
718 nmdc:mga03n38_71079_c1 3300050490 Bacteria 1611
719 nmdc:mga00v17_125199_c1 3300050491 Bacteria 1639
720 nmdc:mga00v17_134185_c1 3300050491 Bacteria 1584
721 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
722 nmdc:mga00v17_324172_c1 3300050491 Bacteria 1001
723 nmdc:mga00v17_431_c1 3300050491 Bacteria 23635
724 nmdc:mga00v17_75770_c1 3300050491 Bacteria 2092
725 nmdc:mga00v17_81892_c1 3300050491 Bacteria 2017
726 nmdc:mga0yw44_119249_c1 3300050492 Bacteria 1698
727 nmdc:mga0yw44_1587_c2 3300050492 Bacteria 8177
728 nmdc:mga0yw44_1628_c1 3300050492 Bacteria 9032
729 nmdc:mga0yw44_164075_c1 3300050492 Bacteria 1456
730 nmdc:mga0yw44_180042_c1 3300050492 Bacteria 1391
731 nmdc:mga0yw44_240508_c1 3300050492 Bacteria 1203
732 nmdc:mga0yw44_25626_c2 3300050492 Bacteria 2964
733 nmdc:mga0yw44_29246_c1 3300050492 Bacteria 3180
734 nmdc:mga0yw44_86646_c1 3300050492 Bacteria 1973
735 nmdc:mga0k408_157793_c1 3300050493 Bacteria 1351
736 nmdc:mga0k408_3676_c1 3300050493 Bacteria 8116
737 nmdc:mga06z11_104916_c1 3300050494 Bacteria 1556
738 nmdc:mga06z11_114220_c1 3300050494 Bacteria 1499
739 nmdc:mga06z11_2118_c1 3300050494 Bacteria 7526
740 nmdc:mga06z11_28056_c1 3300050494 Bacteria 2697
741 nmdc:mga06z11_332165_c1 3300050494 Bacteria 908
742 nmdc:mga06z11_5062_c1 3300050494 Bacteria 5247
743 nmdc:mga04h51_39041_c1 3300050495 Bacteria 1541
744 nmdc:mga04h51_6294_c1 3300050495 Bacteria 3070
745 nmdc:mga07m45_10477_c1 3300050496 Bacteria 4845
746 nmdc:mga07m45_374873_c1 3300050496 Bacteria 826
747 nmdc:mga0sz30_13711_c1 3300050516 Bacteria 3179
748 nmdc:mga0sz30_2924_c1 3300050516 Bacteria 6124
749 nmdc:mga0sz30_55500_c1 3300050516 Bacteria 1686
750 Ga0500610_0011546 3300053079 Bacteria 4029
751 Ga0500578_0019247 3300053086 Bacteria 4382
752 Ga0500578_0050156 3300053086 Bacteria 2677
753 Ga0500643_000411 3300053087 Bacteria 32710
754 Ga0500643_004409 3300053087 Bacteria 6379
755 Ga0500643_004901 3300053087 Bacteria 5893
756 Ga0500643_012816 3300053087 Bacteria 2989
757 Ga0500643_023987 3300053087 Bacteria 1942
758 Ga0500646_0006695 3300053090 Bacteria 2931
759 Ga0500646_0046538 3300053090 Bacteria 1238
760 Ga0500651_0011997 3300053093 Bacteria 5242
761 Ga0500555_005686 3300053103 Bacteria 3536
762 Ga0500555_008223 3300053103 Bacteria 2972
763 Ga0500556_0009403 3300053104 Bacteria 2840
764 Ga0500556_0014812 3300053104 Bacteria 2390
765 Ga0500556_0100341 3300053104 Bacteria 1114
766 Ga0500557_000398 3300053105 Bacteria 5691
767 Ga0500560_001605 3300053107 Bacteria 4001
768 Ga0500560_018919 3300053107 Bacteria 1929
769 Ga0500562_000876 3300053108 Bacteria 7313
770 Ga0500562_048507 3300053108 Bacteria 1134
771 Ga0500569_011445 3300053109 Bacteria 2119
772 Ga0500594_0003502 3300053118 Bacteria 3454
773 Ga0500618_000513 3300053125 Bacteria 24523
774 Ga0500618_001619 3300053125 Bacteria 9745
775 Ga0500618_002829 3300053125 Bacteria 6253
776 Ga0500618_008883 3300053125 Bacteria 2771
777 Ga0500618_023169 3300053125 Bacteria 1505
778 Ga0500621_007448 3300053126 Bacteria 3577
779 Ga0500621_081022 3300053126 Bacteria 1301
780 Ga0500652_117154 3300053131 Bacteria 1113
781 Ga0500655_000376 3300053133 Bacteria 9603
782 Ga0500655_001263 3300053133 Bacteria 4805
783 Ga0500655_024401 3300053133 Bacteria 1145
784 Ga0500658_0001925 3300053134 Bacteria 8127
785 Ga0500559_0074872 3300053136 Bacteria 1530
786 Ga0500561_0000122 3300053137 Bacteria 14939
787 Ga0500568_0000010 3300053139 Bacteria 249043
788 Ga0500568_0000247 3300053139 Bacteria 45994
789 Ga0500568_0001724 3300053139 Bacteria 13585
790 Ga0500568_0017640 3300053139 Bacteria 3147
791 Ga0500568_0022137 3300053139 Bacteria 2725
792 Ga0500568_0096891 3300053139 Bacteria 1109
793 Ga0500573_0002132 3300053140 Bacteria 9757
794 Ga0500573_0002450 3300053140 Bacteria 9282
795 Ga0500590_000271 3300053148 Bacteria 16202
796 Ga0500604_0002160 3300053151 Bacteria 5410
797 Ga0500604_0003631 3300053151 Bacteria 4152
798 Ga0500604_0068900 3300053151 Bacteria 1124
799 Ga0500616_0000448 3300053153 Bacteria 53998
800 Ga0500616_0001820 3300053153 Bacteria 19372
801 Ga0500616_0007147 3300053153 Bacteria 7144
802 Ga0500616_0010751 3300053153 Bacteria 5459
803 Ga0500616_0172516 3300053153 Bacteria 981
804 Ga0500620_000306 3300053155 Bacteria 9390
805 Ga0500622_0000169 3300053156 Bacteria 70224
806 Ga0500622_0000441 3300053156 Bacteria 39445
807 Ga0500622_0003398 3300053156 Bacteria 10704
808 Ga0500627_0001834 3300053158 Bacteria 6063
809 Ga0500627_0002598 3300053158 Bacteria 5399
810 Ga0500627_0018943 3300053158 Bacteria 2734
811 Ga0500627_0128084 3300053158 Bacteria 1146
812 Ga0500627_0163919 3300053158 Bacteria 1002
813 Ga0500633_0000081 3300053160 Bacteria 14125
814 Ga0500633_0099159 3300053160 Bacteria 1071
815 Ga0500634_0000956 3300053161 Bacteria 10406
816 Ga0500634_0001545 3300053161 Bacteria 9045
817 Ga0500636_0000030 3300053177 Bacteria 77501
818 Ga0500636_0002620 3300053177 Bacteria 9993
819 Ga0500645_003289 3300053730 Bacteria 6651
820 Ga0500645_004116 3300053730 Bacteria 5682
821 Ga0500645_004791 3300053730 Bacteria 5118
822 Ga0500645_017926 3300053730 Bacteria 2216
823 Ga0500645_018238 3300053730 Bacteria 2193
824 Ga0587067_014834 3300059640 Bacteria 1254
825 Ga0587072_005168 3300059643 Bacteria 1938
826 Ga0501082_0270955 3300060353 Bacteria 1477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0045660 Ga0501039_0045660_2658_3374 238
2 3300050496 nmdc:mga07m45_374873_c1 nmdc:mga07m45_374873_c1_42_788 246
3 3300037471 Ga0395905_0002522 Ga0395905_0002522_6970_7758 250
4 3300006051 Ga0075364_10000055 Ga0075364_100000553 251
5 3300032004 Ga0307414_10281880 Ga0307414_102818802 251
6 3300050491 nmdc:mga00v17_431_c1 nmdc:mga00v17_431_c1_1198_1989 251
7 3300048924 Ga0496121_0000888 Ga0496121_0000888_4562_5353 252
8 3300049523 Ga0501300_002486 Ga0501300_002486_726_1520 252
9 3300013306 Ga0163162_10407197 Ga0163162_104071972 255
10 3300049571 Ga0501034_0116412 Ga0501034_0116412_934_1734 255
11 3300006051 Ga0075364_10111164 Ga0075364_101111642 256
12 iso_pu_bacteria 2854911287 2854913701 256
13 iso_pu_bacteria 8054558443 8054559973 256
14 3300049576 Ga0501040_0494081 Ga0501040_0494081_25_798 257
15 3300015261 Ga0182006_1045002 Ga0182006_10450022 258
16 iso_pu_bacteria 2511231027 2511391875 258
17 iso_pu_bacteria 2765235802 2765465763 258
18 iso_pu_bacteria 2767802442 2770199121 258
19 iso_pu_bacteria 2775506902 2776269525 258
20 iso_pu_bacteria 2775506904 2776282456 258
21 iso_pu_bacteria 2839993093 2839993405 258
22 iso_pu_bacteria 2840764183 2840766415 258
23 iso_pu_bacteria 2842871566 2842874027 258
24 iso_pu_bacteria 2904578770 2904579945 258
25 iso_pu_bacteria 2919119836 2919120383 258
26 iso_pu_bacteria 2928521798 2928522712 258
27 iso_pu_bacteria 2954011201 2954013906 258
28 iso_pu_bacteria 2965119406 2965124382 258
29 iso_pu_bacteria 3002141150 3002141746 258
30 iso_pu_bacteria 8056875544 8056878361 258
31 3300009553 Ga0105249_10027699 Ga0105249_100276992 259
32 3300025961 Ga0207712_10015100 Ga0207712_100151004 259
33 3300037471 Ga0395905_0000145 Ga0395905_0000145_27328_28185 259
34 3300037471 Ga0395905_0003283 Ga0395905_0003283_11599_12447 259
35 3300037471 Ga0395905_0140183 Ga0395905_0140183_1285_2139 259
36 3300038443 Ga0395901_0128293 Ga0395901_0128293_1571_2542 259
37 3300048929 Ga0496126_0061541 Ga0496126_0061541_1070_1969 259
38 3300053087 Ga0500643_000411 Ga0500643_000411_8786_9652 259
39 iso_pu_bacteria 2510917026 2511168427 259
40 iso_pu_bacteria 2513237305 2514421928 259
41 iso_pu_bacteria 2513237351 2514586563 259
42 iso_pu_bacteria 2534681786 2535485501 259
43 iso_pu_bacteria 2585427633 2585998077 259
44 iso_pu_bacteria 2585427634 2586002656 259
45 iso_pu_bacteria 2599185301 2599938835 259
46 iso_pu_bacteria 2600254933 2600377442 259
47 iso_pu_bacteria 2643221558 2643814887 259
48 iso_pu_bacteria 2643221568 2643854822 259
49 iso_pu_bacteria 2643221623 2644133943 259
50 iso_pu_bacteria 2693429783 2694627682 259
51 iso_pu_bacteria 2693429784 2694636793 259
52 iso_pu_bacteria 2721755686 2723573322 259
53 iso_pu_bacteria 2738543024 2739310265 259
54 iso_pu_bacteria 2751185800 2753360490 259
55 iso_pu_bacteria 2757320392 2757570405 259
56 iso_pu_bacteria 2758568016 2758642930 259
57 iso_pu_bacteria 2847670302 2847673604 259
58 iso_pu_bacteria 2847686936 2847690119 259
59 iso_pu_bacteria 2854916844 2854922315 259
60 iso_pu_bacteria 2856314179 2856318927 259
61 iso_pu_bacteria 2856349417 2856353026 259
62 iso_pu_bacteria 2856356410 2856362155 259
63 iso_pu_bacteria 2856364286 2856367360 259
64 iso_pu_bacteria 2857349434 2857353127 259
65 iso_pu_bacteria 2869285874 2869288501 259
66 iso_pu_bacteria 2871429161 2871431168 259
67 iso_pu_bacteria 2871444079 2871449143 259
68 iso_pu_bacteria 2871488783 2871491598 259
69 iso_pu_bacteria 2871495908 2871498846 259
70 iso_pu_bacteria 2874102143 2874102408 259
71 iso_pu_bacteria 2874146452 2874150542 259
72 iso_pu_bacteria 2874155637 2874158283 259
73 iso_pu_bacteria 2876369609 2876369827 259
74 iso_pu_bacteria 2876377896 2876383172 259
75 iso_pu_bacteria 2876392853 2876399085 259
76 iso_pu_bacteria 2876413966 2876416591 259
77 iso_pu_bacteria 2878035449 2878039271 259
78 iso_pu_bacteria 2878745973 2878747772 259
79 iso_pu_bacteria 2878753008 2878754786 259
80 iso_pu_bacteria 2878760144 2878763064 259
81 iso_pu_bacteria 2878767105 2878770034 259
82 iso_pu_bacteria 2881147464 2881148398 259
83 iso_pu_bacteria 2881155292 2881159464 259
84 iso_pu_bacteria 2881161766 2881165183 259
85 iso_pu_bacteria 2881845957 2881846521 259
86 iso_pu_bacteria 2881853255 2881861059 259
87 iso_pu_bacteria 2881861095 2881862045 259
88 iso_pu_bacteria 2882632389 2882635209 259
89 iso_pu_bacteria 2882912400 2882915865 259
90 iso_pu_bacteria 2885305155 2885307060 259
91 iso_pu_bacteria 2885318864 2885325714 259
92 iso_pu_bacteria 2885326080 2885328662 259
93 iso_pu_bacteria 2885334103 2885339030 259
94 iso_pu_bacteria 2885342637 2885347089 259
95 iso_pu_bacteria 2885350715 2885353594 259
96 iso_pu_bacteria 2888350351 2888353401 259
97 iso_pu_bacteria 2889010040 2889015117 259
98 iso_pu_bacteria 2889016732 2889019805 259
99 iso_pu_bacteria 2889790730 2889795797 259
100 iso_pu_bacteria 2889914905 2889916367 259
101 iso_pu_bacteria 2891048133 2891048624 259
102 iso_pu_bacteria 2894652903 2894653722 259
103 iso_pu_bacteria 2903492973 2903500319 259
104 iso_pu_bacteria 2903492973 2903502253 259
105 iso_pu_bacteria 2903540706 2903543648 259
106 iso_pu_bacteria 2904659560 2904665612 259
107 iso_pu_bacteria 2906308376 2906310945 259
108 iso_pu_bacteria 2906321335 2906323056 259
109 iso_pu_bacteria 2906328253 2906334022 259
110 iso_pu_bacteria 2906414383 2906418998 259
111 iso_pu_bacteria 2915650412 2915650587 259
112 iso_pu_bacteria 2919166419 2919170458 259
113 iso_pu_bacteria 2919171160 2919176883 259
114 iso_pu_bacteria 2922130491 2922136481 259
115 iso_pu_bacteria 2922158528 2922162618 259
116 iso_pu_bacteria 2922185730 2922193166 259
117 iso_pu_bacteria 2924726620 2924728177 259
118 iso_pu_bacteria 2924762789 2924767528 259
119 iso_pu_bacteria 2924784321 2924791006 259
120 iso_pu_bacteria 2929138655 2929142002 259
121 iso_pu_bacteria 2937822353 2937823429 259
122 iso_pu_bacteria 2937843397 2937843747 259
123 iso_pu_bacteria 2977864932 2977872207 259
124 iso_pu_bacteria 2978969890 2978972746 259
125 iso_pu_bacteria 2979742915 2979743086 259
126 iso_pu_bacteria 2984587000 2984590998 259
127 iso_pu_bacteria 2987666974 2987667156 259
128 iso_pu_bacteria 2995392953 2995394308 259
129 iso_pu_bacteria 2996336353 2996341622 259
130 iso_pu_bacteria 8002285264 8002286344 259
131 iso_pu_bacteria 8018150411 8018153105 259
132 iso_pu_bacteria 8054460903 8054463886 259
133 3300049569 Ga0501032_0000001 Ga0501032_0000001_156950_157744 260
134 3300049570 Ga0501033_0000898 Ga0501033_0000898_20816_21610 260
135 3300049571 Ga0501034_0006657 Ga0501034_0006657_3726_4514 260
136 3300049571 Ga0501034_0008076 Ga0501034_0008076_9299_10087 260
137 3300049571 Ga0501034_0008287 Ga0501034_0008287_9988_10782 260
138 3300049571 Ga0501034_0101447 Ga0501034_0101447_2039_2827 260
139 3300049572 Ga0501036_0000804 Ga0501036_0000804_16934_17728 260
140 3300049573 Ga0501037_0000091 Ga0501037_0000091_78410_79204 260
141 3300049574 Ga0501038_0000402 Ga0501038_0000402_15693_16487 260
142 3300049575 Ga0501039_0000022 Ga0501039_0000022_20817_21611 260
143 3300049579 Ga0501043_0000093 Ga0501043_0000093_64163_64957 260
144 3300049580 Ga0501046_0087767 Ga0501046_0087767_1354_2148 260
145 3300049822 Ga0501035_0000336 Ga0501035_0000336_36688_37482 260
146 iso_pu_bacteria 2508501127 2509143087 260
147 iso_pu_bacteria 2509276019 2509377991 260
148 iso_pu_bacteria 2509276021 2509389234 260
149 iso_pu_bacteria 2509276033 2509444797 260
150 iso_pu_bacteria 2510065019 2510135421 260
151 iso_pu_bacteria 2510065057 2510305822 260
152 iso_pu_bacteria 2510461069 2510839189 260
153 iso_pu_bacteria 2510461076 2510896880 260
154 iso_pu_bacteria 2510917028 2511185227 260
155 iso_pu_bacteria 2510917030 2511199354 260
156 iso_pu_bacteria 2511231052 2511498588 260
157 iso_pu_bacteria 2512047086 2512534737 260
158 iso_pu_bacteria 2512875016 2512933695 260
159 iso_pu_bacteria 2512875024 2512961846 260
160 iso_pu_bacteria 2512875026 2512973451 260
161 iso_pu_bacteria 2513237084 2513572880 260
162 iso_pu_bacteria 2513237085 2513580413 260
163 iso_pu_bacteria 2513237086 2513586364 260
164 iso_pu_bacteria 2513237088 2513597848 260
165 iso_pu_bacteria 2513237089 2513602032 260
166 iso_pu_bacteria 2513237091 2513615821 260
167 iso_pu_bacteria 2513237093 2513634915 260
168 iso_pu_bacteria 2513237103 2513711524 260
169 iso_pu_bacteria 2513237138 2513865127 260
170 iso_pu_bacteria 2513237140 2513885387 260
171 iso_pu_bacteria 2513237143 2513904656 260
172 iso_pu_bacteria 2513237144 2513912903 260
173 iso_pu_bacteria 2513237146 2513929496 260
174 iso_pu_bacteria 2513237156 2513983486 260
175 iso_pu_bacteria 2513237159 2514001719 260
176 iso_pu_bacteria 2513237160 2514003369 260
177 iso_pu_bacteria 2513237162 2514023182 260
178 iso_pu_bacteria 2515075009 2515114593 260
179 iso_pu_bacteria 2515154107 2515612432 260
180 iso_pu_bacteria 2515154113 2515634987 260
181 iso_pu_bacteria 2515154114 2515644449 260
182 iso_pu_bacteria 2515154116 2515660974 260
183 iso_pu_bacteria 2515154134 2515741776 260
184 iso_pu_bacteria 2516143018 2516205696 260
185 iso_pu_bacteria 2516653046 2516894865 260
186 iso_pu_bacteria 2516653077 2517038236 260
187 iso_pu_bacteria 2516653085 2517078514 260
188 iso_pu_bacteria 2517093000 2517097253 260
189 iso_pu_bacteria 2517287029 2517408358 260
190 iso_pu_bacteria 2517487022 2517571546 260
191 iso_pu_bacteria 2519899620 2520379796 260
192 iso_pu_bacteria 2524023207 2524450318 260
193 iso_pu_bacteria 2529292951 2530647181 260
194 iso_pu_bacteria 2537561587 2537874460 260
195 iso_pu_bacteria 2551306084 2551678469 260
196 iso_pu_bacteria 2551306085 2551685174 260
197 iso_pu_bacteria 2551306086 2551694002 260
198 iso_pu_bacteria 2551306087 2551704510 260
199 iso_pu_bacteria 2551306089 2551710798 260
200 iso_pu_bacteria 2551306090 2551717206 260
201 iso_pu_bacteria 2551306090 2551718204 260
202 iso_pu_bacteria 2551306090 2551720985 260
203 iso_pu_bacteria 2551306091 2551724596 260
204 iso_pu_bacteria 2551306092 2551734490 260
205 iso_pu_bacteria 2551306093 2551740723 260
206 iso_pu_bacteria 2554235003 2554248990 260
207 iso_pu_bacteria 2558860100 2558867507 260
208 iso_pu_bacteria 2558860242 2559296078 260
209 iso_pu_bacteria 2558860983 2561468551 260
210 iso_pu_bacteria 2582581283 2585166504 260
211 iso_pu_bacteria 2582581294 2585201550 260
212 iso_pu_bacteria 2582581298 2585224109 260
213 iso_pu_bacteria 2582581299 2585231871 260
214 iso_pu_bacteria 2582581304 2585257173 260
215 iso_pu_bacteria 2582581306 2585267175 260
216 iso_pu_bacteria 2582581865 2585388226 260
217 iso_pu_bacteria 2582581867 2585399941 260
218 iso_pu_bacteria 2585427526 2585529187 260
219 iso_pu_bacteria 2585427528 2585543004 260
220 iso_pu_bacteria 2585427529 2585549809 260
221 iso_pu_bacteria 2585427590 2585821030 260
222 iso_pu_bacteria 2585427593 2585839227 260
223 iso_pu_bacteria 2585427594 2585845063 260
224 iso_pu_bacteria 2597489875 2597810842 260
225 iso_pu_bacteria 2599185170 2599419962 260
226 iso_pu_bacteria 2599185210 2599603129 260
227 iso_pu_bacteria 2599185236 2599722638 260
228 iso_pu_bacteria 2599185352 2600193975 260
229 iso_pu_bacteria 2600255279 2601610966 260
230 iso_pu_bacteria 2600255308 2601747740 260
231 iso_pu_bacteria 2615840624 2616297547 260
232 iso_pu_bacteria 2643221551 2643777315 260
233 iso_pu_bacteria 2643221555 2643795763 260
234 iso_pu_bacteria 2643221557 2643807939 260
235 iso_pu_bacteria 2643221582 2643921602 260
236 iso_pu_bacteria 2643221595 2643985964 260
237 iso_pu_bacteria 2643221599 2644002645 260
238 iso_pu_bacteria 2643221607 2644052442 260
239 iso_pu_bacteria 2643221610 2644068870 260
240 iso_pu_bacteria 2643221626 2644146355 260
241 iso_pu_bacteria 2643221627 2644154451 260
242 iso_pu_bacteria 2643221634 2644194648 260
243 iso_pu_bacteria 2643221636 2644201175 260
244 iso_pu_bacteria 2643221637 2644209666 260
245 iso_pu_bacteria 2643221643 2644240313 260
246 iso_pu_bacteria 2643221653 2644299688 260
247 iso_pu_bacteria 2643221655 2644310374 260
248 iso_pu_bacteria 2643221659 2644334841 260
249 iso_pu_bacteria 2643221668 2644378404 260
250 iso_pu_bacteria 2643221675 2644419941 260
251 iso_pu_bacteria 2643221680 2644453297 260
252 iso_pu_bacteria 2643221686 2644484720 260
253 iso_pu_bacteria 2643221688 2644492557 260
254 iso_pu_bacteria 2643221693 2644521656 260
255 iso_pu_bacteria 2643221698 2644544965 260
256 iso_pu_bacteria 2643221712 2644615385 260
257 iso_pu_bacteria 2643221718 2644653194 260
258 iso_pu_bacteria 2643221719 2644657916 260
259 iso_pu_bacteria 2643221723 2644675096 260
260 iso_pu_bacteria 2643221726 2644688676 260
261 iso_pu_bacteria 2657244999 2657682310 260
262 iso_pu_bacteria 2687453392 2688596186 260
263 iso_pu_bacteria 2690316117 2692319837 260
264 iso_pu_bacteria 2718217882 2719183132 260
265 iso_pu_bacteria 2718217927 2719387852 260
266 iso_pu_bacteria 2718217997 2719667472 260
267 iso_pu_bacteria 2718218009 2719733849 260
268 iso_pu_bacteria 2718218199 2720493892 260
269 iso_pu_bacteria 2718218232 2720615353 260
270 iso_pu_bacteria 2718218233 2720622141 260
271 iso_pu_bacteria 2718218235 2720633495 260
272 iso_pu_bacteria 2718218269 2720777193 260
273 iso_pu_bacteria 2718218363 2721149244 260
274 iso_pu_bacteria 2718218365 2721160646 260
275 iso_pu_bacteria 2718218366 2721166057 260
276 iso_pu_bacteria 2718218423 2721401485 260
277 iso_pu_bacteria 2721755514 2722842227 260
278 iso_pu_bacteria 2721755556 2723028791 260
279 iso_pu_bacteria 2721755684 2723562404 260
280 iso_pu_bacteria 2721755685 2723569100 260
281 iso_pu_bacteria 2721755809 2724040299 260
282 iso_pu_bacteria 2721755810 2724046605 260
283 iso_pu_bacteria 2721755819 2724091800 260
284 iso_pu_bacteria 2721755822 2724106365 260
285 iso_pu_bacteria 2721755823 2724112172 260
286 iso_pu_bacteria 2724679232 2725945783 260
287 iso_pu_bacteria 2728369352 2730109727 260
288 iso_pu_bacteria 2728369365 2730166367 260
289 iso_pu_bacteria 2728369397 2730300278 260
290 iso_pu_bacteria 2738541293 2738801022 260
291 iso_pu_bacteria 2738541317 2738947099 260
292 iso_pu_bacteria 2738541333 2739037700 260
293 iso_pu_bacteria 2751185821 2753458478 260
294 iso_pu_bacteria 2756170246 2756673580 260
295 iso_pu_bacteria 2765235942 2766064082 260
296 iso_pu_bacteria 2775507049 2776915661 260
297 iso_pu_bacteria 2791355082 2792582340 260
298 iso_pu_bacteria 2791355091 2792621806 260
299 iso_pu_bacteria 2791355092 2792628937 260
300 iso_pu_bacteria 2791355094 2792640077 260
301 iso_pu_bacteria 2791355253 2793281833 260
302 iso_pu_bacteria 2791355256 2793295461 260
303 iso_pu_bacteria 2791355259 2793317959 260
304 iso_pu_bacteria 2791355260 2793324565 260
305 iso_pu_bacteria 2791355261 2793329608 260
306 iso_pu_bacteria 2791355262 2793332404 260
307 iso_pu_bacteria 2791355263 2793338998 260
308 iso_pu_bacteria 2791355264 2793346768 260
309 iso_pu_bacteria 2791355265 2793356784 260
310 iso_pu_bacteria 2791355266 2793359204 260
311 iso_pu_bacteria 2791355267 2793366072 260
312 iso_pu_bacteria 2802428858 2802717088 260
313 iso_pu_bacteria 2802428859 2802724924 260
314 iso_pu_bacteria 2802428860 2802729674 260
315 iso_pu_bacteria 2802428861 2802737020 260
316 iso_pu_bacteria 2802428862 2802743425 260
317 iso_pu_bacteria 2802428863 2802749449 260
318 iso_pu_bacteria 2802429268 2804753796 260
319 iso_pu_bacteria 2802429605 2805930911 260
320 iso_pu_bacteria 2802429606 2805936760 260
321 iso_pu_bacteria 2802429633 2806047756 260
322 iso_pu_bacteria 2802429634 2806055332 260
323 iso_pu_bacteria 2802429635 2806062213 260
324 iso_pu_bacteria 2802429636 2806070028 260
325 iso_pu_bacteria 2802429637 2806076672 260
326 iso_pu_bacteria 2808606387 2808988096 260
327 iso_pu_bacteria 2818991272 2819244464 260
328 iso_pu_bacteria 2818991439 2819561088 260
329 iso_pu_bacteria 2821123053 2821129207 260
330 iso_pu_bacteria 2837651117 2837651386 260
331 iso_pu_bacteria 2838016132 2838018154 260
332 iso_pu_bacteria 2838022645 2838023835 260
333 iso_pu_bacteria 2838035591 2838042012 260
334 iso_pu_bacteria 2838042994 2838046758 260
335 iso_pu_bacteria 2838048938 2838050987 260
336 iso_pu_bacteria 2838061910 2838062753 260
337 iso_pu_bacteria 2838068647 2838072298 260
338 iso_pu_bacteria 2838074704 2838078061 260
339 iso_pu_bacteria 2838661181 2838668137 260
340 iso_pu_bacteria 2838668709 2838674231 260
341 iso_pu_bacteria 2838675328 2838678541 260
342 iso_pu_bacteria 2838680041 2838683707 260
343 iso_pu_bacteria 2838686498 2838693347 260
344 iso_pu_bacteria 2838694306 2838698235 260
345 iso_pu_bacteria 2838701080 2838706634 260
346 iso_pu_bacteria 2838707686 2838711350 260
347 iso_pu_bacteria 2838714209 2838718371 260
348 iso_pu_bacteria 2838719591 2838722837 260
349 iso_pu_bacteria 2838724970 2838728437 260
350 iso_pu_bacteria 2838729681 2838735341 260
351 iso_pu_bacteria 2838736955 2838742224 260
352 iso_pu_bacteria 2838742623 2838748110 260
353 iso_pu_bacteria 2841734538 2841736578 260
354 iso_pu_bacteria 2841840854 2841846080 260
355 iso_pu_bacteria 2841851746 2841857413 260
356 iso_pu_bacteria 2841859092 2841863354 260
357 iso_pu_bacteria 2841864319 2841867583 260
358 iso_pu_bacteria 2842077413 2842081151 260
359 iso_pu_bacteria 2842110456 2842116598 260
360 iso_pu_bacteria 2842118031 2842122072 260
361 iso_pu_bacteria 2842124991 2842129097 260
362 iso_pu_bacteria 2842130223 2842133434 260
363 iso_pu_bacteria 2842140634 2842145784 260
364 iso_pu_bacteria 2842146304 2842148963 260
365 iso_pu_bacteria 2842152218 2842155655 260
366 iso_pu_bacteria 2842156927 2842162412 260
367 iso_pu_bacteria 2842163707 2842166887 260
368 iso_pu_bacteria 2842170452 2842174387 260
369 iso_pu_bacteria 2842175837 2842179048 260
370 iso_pu_bacteria 2842180545 2842186052 260
371 iso_pu_bacteria 2842187318 2842190795 260
372 iso_pu_bacteria 2842192696 2842194716 260
373 iso_pu_bacteria 2842198810 2842201189 260
374 iso_pu_bacteria 2842205361 2842207585 260
375 iso_pu_bacteria 2842211629 2842214881 260
376 iso_pu_bacteria 2842217011 2842221959 260
377 iso_pu_bacteria 2842224351 2842227602 260
378 iso_pu_bacteria 2842229732 2842235511 260
379 iso_pu_bacteria 2842237096 2842241086 260
380 iso_pu_bacteria 2842243621 2842249206 260
381 iso_pu_bacteria 2842250916 2842256425 260
382 iso_pu_bacteria 2842257432 2842263161 260
383 iso_pu_bacteria 2842264693 2842269274 260
384 iso_pu_bacteria 2842271015 2842277815 260
385 iso_pu_bacteria 2842278818 2842280704 260
386 iso_pu_bacteria 2842285085 2842290350 260
387 iso_pu_bacteria 2842291075 2842294808 260
388 iso_pu_bacteria 2842304105 2842305642 260
389 iso_pu_bacteria 2842311132 2842311590 260
390 iso_pu_bacteria 2842317721 2842323650 260
391 iso_pu_bacteria 2842341865 2842346872 260
392 iso_pu_bacteria 2842363717 2842366097 260
393 iso_pu_bacteria 2842370503 2842375174 260
394 iso_pu_bacteria 2842377471 2842381207 260
395 iso_pu_bacteria 2842384541 2842388277 260
396 iso_pu_bacteria 2842395702 2842395766 260
397 iso_pu_bacteria 2842422224 2842425930 260
398 iso_pu_bacteria 2842428310 2842433442 260
399 iso_pu_bacteria 2842434925 2842439503 260
400 iso_pu_bacteria 2842441272 2842446189 260
401 iso_pu_bacteria 2842447887 2842448572 260
402 iso_pu_bacteria 2842462802 2842467691 260
403 iso_pu_bacteria 2842469257 2842474345 260
404 iso_pu_bacteria 2842489311 2842491342 260
405 iso_pu_bacteria 2842495871 2842501923 260
406 iso_pu_bacteria 2842515876 2842519909 260
407 iso_pu_bacteria 2842521101 2842527058 260
408 iso_pu_bacteria 2844002411 2844003250 260
409 iso_pu_bacteria 2844009547 2844010992 260
410 iso_pu_bacteria 2844454524 2844456804 260
411 iso_pu_bacteria 2847417321 2847420939 260
412 iso_pu_bacteria 2848992105 2848995770 260
413 iso_pu_bacteria 2850079185 2850082753 260
414 iso_pu_bacteria 2854896431 2854897791 260
415 iso_pu_bacteria 2855872281 2855873634 260
416 iso_pu_bacteria 2856328259 2856329468 260
417 iso_pu_bacteria 2856334872 2856339771 260
418 iso_pu_bacteria 2856342000 2856348127 260
419 iso_pu_bacteria 2857516855 2857519762 260
420 iso_pu_bacteria 2857531043 2857536148 260
421 iso_pu_bacteria 2858800743 2858803552 260
422 iso_pu_bacteria 2869162929 2869168661 260
423 iso_pu_bacteria 2869169390 2869171414 260
424 iso_pu_bacteria 2869234852 2869240172 260
425 iso_pu_bacteria 2869249662 2869254016 260
426 iso_pu_bacteria 2869256925 2869258141 260
427 iso_pu_bacteria 2869264136 2869269843 260
428 iso_pu_bacteria 2869271264 2869275280 260
429 iso_pu_bacteria 2871451962 2871453819 260
430 iso_pu_bacteria 2871459585 2871464749 260
431 iso_pu_bacteria 2871466892 2871473496 260
432 iso_pu_bacteria 2871474448 2871478564 260
433 iso_pu_bacteria 2871481445 2871484729 260
434 iso_pu_bacteria 2874123672 2874126322 260
435 iso_pu_bacteria 2874162495 2874163700 260
436 iso_pu_bacteria 2874168670 2874170561 260
437 iso_pu_bacteria 2876363079 2876364050 260
438 iso_pu_bacteria 2876386047 2876387545 260
439 iso_pu_bacteria 2876399893 2876401087 260
440 iso_pu_bacteria 2876406927 2876407358 260
441 iso_pu_bacteria 2876420981 2876423745 260
442 iso_pu_bacteria 2878730984 2878738633 260
443 iso_pu_bacteria 2878738818 2878739838 260
444 iso_pu_bacteria 2878774303 2878780017 260
445 iso_pu_bacteria 2878781027 2878782034 260
446 iso_pu_bacteria 2878788777 2878789208 260
447 iso_pu_bacteria 2885312484 2885313940 260
448 iso_pu_bacteria 2888343758 2888344552 260
449 iso_pu_bacteria 2891373044 2891377791 260
450 iso_pu_bacteria 2896384573 2896390087 260
451 iso_pu_bacteria 2899792073 2899794818 260
452 iso_pu_bacteria 2899803654 2899805007 260
453 iso_pu_bacteria 2903448605 2903453850 260
454 iso_pu_bacteria 2903521522 2903525790 260
455 iso_pu_bacteria 2903528002 2903532663 260
456 iso_pu_bacteria 2906378014 2906379157 260
457 iso_pu_bacteria 2906386501 2906386854 260
458 iso_pu_bacteria 2906401398 2906402987 260
459 iso_pu_bacteria 2906408224 2906408962 260
460 iso_pu_bacteria 2913295892 2913300286 260
461 iso_pu_bacteria 2913308742 2913312072 260
462 iso_pu_bacteria 2915980308 2915981713 260
463 iso_pu_bacteria 2916000859 2916004475 260
464 iso_pu_bacteria 2916014648 2916019865 260
465 iso_pu_bacteria 2916021584 2916023931 260
466 iso_pu_bacteria 2916028427 2916031856 260
467 iso_pu_bacteria 2916041962 2916043430 260
468 iso_pu_bacteria 2916048683 2916050645 260
469 iso_pu_bacteria 2916055098 2916058691 260
470 iso_pu_bacteria 2916061851 2916066484 260
471 iso_pu_bacteria 2916068649 2916076084 260
472 iso_pu_bacteria 2916076590 2916082573 260
473 iso_pu_bacteria 2919100787 2919107945 260
474 iso_pu_bacteria 2919114240 2919118372 260
475 iso_pu_bacteria 2921237296 2921240356 260
476 iso_pu_bacteria 2921250672 2921252802 260
477 iso_pu_bacteria 2921257292 2921260441 260
478 iso_pu_bacteria 2921263974 2921267525 260
479 iso_pu_bacteria 2921289301 2921293980 260
480 iso_pu_bacteria 2921296804 2921302300 260
481 iso_pu_bacteria 2922151315 2922153547 260
482 iso_pu_bacteria 2922172374 2922173234 260
483 iso_pu_bacteria 2922178524 2922185038 260
484 iso_pu_bacteria 2923556063 2923559970 260
485 iso_pu_bacteria 2924150972 2924157660 260
486 iso_pu_bacteria 2924165586 2924168526 260
487 iso_pu_bacteria 2924172951 2924175798 260
488 iso_pu_bacteria 2924179722 2924183467 260
489 iso_pu_bacteria 2924186466 2924190214 260
490 iso_pu_bacteria 2924214083 2924214890 260
491 iso_pu_bacteria 2924221636 2924227133 260
492 iso_pu_bacteria 2924710171 2924710428 260
493 iso_pu_bacteria 2924718760 2924719012 260
494 iso_pu_bacteria 2924733363 2924740527 260
495 iso_pu_bacteria 2924741084 2924746616 260
496 iso_pu_bacteria 2924748358 2924754032 260
497 iso_pu_bacteria 2924754689 2924762013 260
498 iso_pu_bacteria 2924776078 2924778767 260
499 iso_pu_bacteria 2926754445 2926754901 260
500 iso_pu_bacteria 2926760298 2926762066 260
501 iso_pu_bacteria 2933006813 2933010499 260
502 iso_pu_bacteria 2933011516 2933015829 260
503 iso_pu_bacteria 2933016740 2933017814 260
504 iso_pu_bacteria 2933570622 2933572149 260
505 iso_pu_bacteria 2933586486 2933592796 260
506 iso_pu_bacteria 2933594066 2933597433 260
507 iso_pu_bacteria 2933599457 2933602850 260
508 iso_pu_bacteria 2935894831 2935898112 260
509 iso_pu_bacteria 2935901341 2935903446 260
510 iso_pu_bacteria 2936367885 2936370080 260
511 iso_pu_bacteria 2936375103 2936379256 260
512 iso_pu_bacteria 2936381700 2936381767 260
513 iso_pu_bacteria 2936996657 2936997436 260
514 iso_pu_bacteria 2937002841 2937004100 260
515 iso_pu_bacteria 2937009748 2937010363 260
516 iso_pu_bacteria 2937016420 2937020645 260
517 iso_pu_bacteria 2937023124 2937023176 260
518 iso_pu_bacteria 2937029754 2937031725 260
519 iso_pu_bacteria 2937036028 2937037792 260
520 iso_pu_bacteria 2937042894 2937043156 260
521 iso_pu_bacteria 2937056579 2937059373 260
522 iso_pu_bacteria 2937063883 2937070499 260
523 iso_pu_bacteria 2937071275 2937076117 260
524 iso_pu_bacteria 2937078374 2937081490 260
525 iso_pu_bacteria 2937084907 2937090878 260
526 iso_pu_bacteria 2937091812 2937093346 260
527 iso_pu_bacteria 2937098957 2937104327 260
528 iso_pu_bacteria 2937106411 2937113244 260
529 iso_pu_bacteria 2937113482 2937114244 260
530 iso_pu_bacteria 2937119839 2937120242 260
531 iso_pu_bacteria 2937126314 2937129777 260
532 iso_pu_bacteria 2937836603 2937838839 260
533 iso_pu_bacteria 2937861824 2937865395 260
534 iso_pu_bacteria 2937868953 2937874628 260
535 iso_pu_bacteria 2937980651 2937983973 260
536 iso_pu_bacteria 2957375807 2957376792 260
537 iso_pu_bacteria 2957382221 2957384921 260
538 iso_pu_bacteria 2957388812 2957395196 260
539 iso_pu_bacteria 2957395598 2957399709 260
540 iso_pu_bacteria 2957402308 2957405547 260
541 iso_pu_bacteria 2957408893 2957411712 260
542 iso_pu_bacteria 2957415311 2957417469 260
543 iso_pu_bacteria 2957422303 2957422366 260
544 iso_pu_bacteria 2957430029 2957430080 260
545 iso_pu_bacteria 2957437181 2957441670 260
546 iso_pu_bacteria 2957450854 2957454677 260
547 iso_pu_bacteria 2957457609 2957461000 260
548 iso_pu_bacteria 2957464669 2957466507 260
549 iso_pu_bacteria 2957471148 2957475393 260
550 iso_pu_bacteria 2957478035 2957481451 260
551 iso_pu_bacteria 2957484790 2957489083 260
552 iso_pu_bacteria 2957491536 2957494433 260
553 iso_pu_bacteria 2957498199 2957505172 260
554 iso_pu_bacteria 2957505466 2957508268 260
555 iso_pu_bacteria 2958071322 2958072356 260
556 iso_pu_bacteria 2958108152 2958111538 260
557 iso_pu_bacteria 2958137437 2958139055 260
558 iso_pu_bacteria 2958158011 2958163970 260
559 iso_pu_bacteria 2960584000 2960589445 260
560 iso_pu_bacteria 2960591022 2960592800 260
561 iso_pu_bacteria 2960597568 2960597897 260
562 iso_pu_bacteria 2960603979 2960607489 260
563 iso_pu_bacteria 2960610863 2960613677 260
564 iso_pu_bacteria 2960624210 2960629062 260
565 iso_pu_bacteria 2960631154 2960634197 260
566 iso_pu_bacteria 2960637947 2960643583 260
567 iso_pu_bacteria 2960645483 2960650706 260
568 iso_pu_bacteria 2960652885 2960659188 260
569 iso_pu_bacteria 2960667422 2960673289 260
570 iso_pu_bacteria 2960674078 2960674882 260
571 iso_pu_bacteria 2960680706 2960681725 260
572 iso_pu_bacteria 2960687367 2960689335 260
573 iso_pu_bacteria 2960693952 2960700651 260
574 iso_pu_bacteria 2961136820 2961138877 260
575 iso_pu_bacteria 2961183825 2961185631 260
576 iso_pu_bacteria 2963644680 2963645508 260
577 iso_pu_bacteria 2964607997 2964608225 260
578 iso_pu_bacteria 2964615318 2964621669 260
579 iso_pu_bacteria 2964621998 2964625831 260
580 iso_pu_bacteria 2964628898 2964629534 260
581 iso_pu_bacteria 2964636051 2964639223 260
582 iso_pu_bacteria 2964643177 2964643608 260
583 iso_pu_bacteria 2964663802 2964669400 260
584 iso_pu_bacteria 2964670856 2964676866 260
585 iso_pu_bacteria 2964678106 2964681679 260
586 iso_pu_bacteria 2964685014 2964687453 260
587 iso_pu_bacteria 2964691889 2964695142 260
588 iso_pu_bacteria 2964698721 2964699160 260
589 iso_pu_bacteria 2964705432 2964711203 260
590 iso_pu_bacteria 2964712639 2964712659 260
591 iso_pu_bacteria 2964719344 2964719780 260
592 iso_pu_bacteria 2965025482 2965026778 260
593 iso_pu_bacteria 2965032056 2965039474 260
594 iso_pu_bacteria 2965047637 2965054621 260
595 iso_pu_bacteria 2967671571 2967675607 260
596 iso_pu_bacteria 2967678726 2967681248 260
597 iso_pu_bacteria 2967686174 2967692427 260
598 iso_pu_bacteria 2967693043 2967699399 260
599 iso_pu_bacteria 2967699805 2967704813 260
600 iso_pu_bacteria 2967706974 2967713799 260
601 iso_pu_bacteria 2967714385 2967721196 260
602 iso_pu_bacteria 2967721400 2967724962 260
603 iso_pu_bacteria 2967728569 2967731832 260
604 iso_pu_bacteria 2967742019 2967745460 260
605 iso_pu_bacteria 2967748971 2967752616 260
606 iso_pu_bacteria 2967755722 2967757747 260
607 iso_pu_bacteria 2967762386 2967765796 260
608 iso_pu_bacteria 2967769361 2967770346 260
609 iso_pu_bacteria 2967775926 2967780515 260
610 iso_pu_bacteria 2968138860 2968142347 260
611 iso_pu_bacteria 2970019648 2970021989 260
612 iso_pu_bacteria 2970026789 2970028678 260
613 iso_pu_bacteria 2970033650 2970038983 260
614 iso_pu_bacteria 2970047711 2970049624 260
615 iso_pu_bacteria 2970054988 2970058836 260
616 iso_pu_bacteria 2970061556 2970066760 260
617 iso_pu_bacteria 2970068827 2970071174 260
618 iso_pu_bacteria 2970076120 2970076718 260
619 iso_pu_bacteria 2970082768 2970086749 260
620 iso_pu_bacteria 2970088815 2970092743 260
621 iso_pu_bacteria 2970095765 2970101171 260
622 iso_pu_bacteria 2970102677 2970104611 260
623 iso_pu_bacteria 2970109326 2970113927 260
624 iso_pu_bacteria 2970122695 2970124506 260
625 iso_pu_bacteria 2970136068 2970140893 260
626 iso_pu_bacteria 2970143518 2970147335 260
627 iso_pu_bacteria 2970149975 2970155841 260
628 iso_pu_bacteria 2970156795 2970161184 260
629 iso_pu_bacteria 2970164137 2970170755 260
630 iso_pu_bacteria 2970170962 2970174088 260
631 iso_pu_bacteria 2970177841 2970182118 260
632 iso_pu_bacteria 2970191845 2970197913 260
633 iso_pu_bacteria 2970489779 2970493600 260
634 iso_pu_bacteria 2970510686 2970512238 260
635 iso_pu_bacteria 2970524798 2970526273 260
636 iso_pu_bacteria 2970532167 2970536260 260
637 iso_pu_bacteria 2970540015 2970541099 260
638 iso_pu_bacteria 2970547951 2970550873 260
639 iso_pu_bacteria 2970619444 2970620720 260
640 iso_pu_bacteria 2977516862 2977520208 260
641 iso_pu_bacteria 2977523885 2977527397 260
642 iso_pu_bacteria 2977530762 2977531200 260
643 iso_pu_bacteria 2977537788 2977544470 260
644 iso_pu_bacteria 2977544691 2977547149 260
645 iso_pu_bacteria 2977551784 2977558012 260
646 iso_pu_bacteria 2977558990 2977564723 260
647 iso_pu_bacteria 2977565890 2977571312 260
648 iso_pu_bacteria 2977572785 2977577246 260
649 iso_pu_bacteria 2977579622 2977583343 260
650 iso_pu_bacteria 2977872689 2977876766 260
651 iso_pu_bacteria 2977898635 2977903478 260
652 iso_pu_bacteria 2977935797 2977937985 260
653 iso_pu_bacteria 2977950692 2977955392 260
654 iso_pu_bacteria 2979100975 2979104637 260
655 iso_pu_bacteria 2979764755 2979770001 260
656 iso_pu_bacteria 2979772303 2979772494 260
657 iso_pu_bacteria 2979793036 2979793090 260
658 iso_pu_bacteria 2984509177 2984513566 260
659 iso_pu_bacteria 2984518228 2984522854 260
660 iso_pu_bacteria 2984537506 2984542161 260
661 iso_pu_bacteria 2984601300 2984601590 260
662 iso_pu_bacteria 2987645492 2987645930 260
663 iso_pu_bacteria 2987673487 2987675787 260
664 iso_pu_bacteria 2989349275 2989355074 260
665 iso_pu_bacteria 2989771324 2989771759 260
666 iso_pu_bacteria 2989776772 2989780251 260
667 iso_pu_bacteria 2996386984 2996389057 260
668 iso_pu_bacteria 2996887358 2996890459 260
669 iso_pu_bacteria 2996893221 2996896209 260
670 iso_pu_bacteria 3000135777 3000137577 260
671 iso_pu_bacteria 3003930520 3003931142 260
672 iso_pu_bacteria 3004167301 3004173506 260
673 iso_pu_bacteria 3004239961 3004243043 260
674 iso_pu_bacteria 3004248173 3004250753 260
675 iso_pu_bacteria 3004268573 3004274395 260
676 iso_pu_bacteria 3005409236 3005415962 260
677 iso_pu_bacteria 3005445848 3005449846 260
678 iso_pu_bacteria 3005452660 3005456137 260
679 iso_pu_bacteria 637000159 637076808 260
680 iso_pu_bacteria 639633055 639650613 260
681 iso_pu_bacteria 643692032 643827527 260
682 iso_pu_bacteria 648276728 648737308 260
683 iso_pu_bacteria 649633066 649870745 260
684 iso_pu_bacteria 650716007 650741294 260
685 iso_pu_bacteria 8003570095 8003573644 260
686 iso_pu_bacteria 8003992118 8003995455 260
687 iso_pu_bacteria 8003999396 8004003214 260
688 iso_pu_bacteria 8004300914 8004303054 260
689 iso_pu_bacteria 8004395343 8004399919 260
690 iso_pu_bacteria 8004633249 8004639891 260
691 iso_pu_bacteria 8004695233 8004701373 260
692 iso_pu_bacteria 8004727605 8004730193 260
693 iso_pu_bacteria 8005246636 8005249412 260
694 iso_pu_bacteria 8005258706 8005262646 260
695 iso_pu_bacteria 8005275841 8005282610 260
696 iso_pu_bacteria 8005282627 8005286575 260
697 iso_pu_bacteria 8005289223 8005291987 260
698 iso_pu_bacteria 8005301065 8005306126 260
699 iso_pu_bacteria 8005307578 8005309700 260
700 iso_pu_bacteria 8005321885 8005324986 260
701 iso_pu_bacteria 8005376324 8005381390 260
702 iso_pu_bacteria 8005395548 8005398436 260
703 iso_pu_bacteria 8005430974 8005431963 260
704 iso_pu_bacteria 8005460587 8005465288 260
705 iso_pu_bacteria 8005497431 8005497866 260
706 iso_pu_bacteria 8005542996 8005546871 260
707 iso_pu_bacteria 8005556819 8005561353 260
708 iso_pu_bacteria 8005563573 8005565975 260
709 iso_pu_bacteria 8005570704 8005572024 260
710 iso_pu_bacteria 8005619151 8005623600 260
711 iso_pu_bacteria 8005626139 8005630839 260
712 iso_pu_bacteria 8005658619 8005660964 260
713 iso_pu_bacteria 8005668836 8005669272 260
714 iso_pu_bacteria 8005688590 8005694177 260
715 iso_pu_bacteria 8005695170 8005695823 260
716 iso_pu_bacteria 8018127388 8018128668 260
717 iso_pu_bacteria 8018163183 8018164910 260
718 iso_pu_bacteria 8018176218 8018177650 260
719 iso_pu_bacteria 8023680758 8023686731 260
720 iso_pu_bacteria 8024479707 8024484550 260
721 iso_pu_bacteria 8024501048 8024504023 260
722 iso_pu_bacteria 8049293176 8049296397 260
723 iso_pu_bacteria 8055431914 8055432957 260
724 iso_pu_bacteria 8055617313 8055618130 260
725 iso_pu_bacteria 8056375014 8056380584 260
726 iso_pu_bacteria 8056382006 8056383356 260
727 iso_pu_bacteria 8057874678 8057879469 260
728 iso_pu_bacteria 2510917022 2511135845 261
729 iso_pu_bacteria 2524023209 2524461185 261
730 iso_pu_bacteria 2582581307 2585272065 261
731 iso_pu_bacteria 2582581308 2585279630 261
732 iso_pu_bacteria 2582581315 2585327467 261
733 iso_pu_bacteria 2582581316 2585333994 261
734 iso_pu_bacteria 2585427527 2585535709 261
735 iso_pu_bacteria 2585427530 2585551087 261
736 iso_pu_bacteria 2585427531 2585563390 261
737 iso_pu_bacteria 2585427608 2585897189 261
738 iso_pu_bacteria 2585427609 2585909103 261
739 iso_pu_bacteria 2585428125 2587984517 261
740 iso_pu_bacteria 2599185156 2599335749 261
741 iso_pu_bacteria 2615840626 2616306417 261
742 iso_pu_bacteria 2615840698 2616551095 261
743 iso_pu_bacteria 2617270742 2617382326 261
744 iso_pu_bacteria 2667528174 2671116026 261
745 iso_pu_bacteria 2775507266 2778179219 261
746 iso_pu_bacteria 2818991448 2819611975 261
747 iso_pu_bacteria 2818991453 2819638485 261
748 iso_pu_bacteria 2842298080 2842302629 261
749 iso_pu_bacteria 2842357229 2842358869 261
750 iso_pu_bacteria 2842482326 2842485283 261
751 iso_pu_bacteria 2842509118 2842514690 261
752 iso_pu_bacteria 2842922631 2842926463 261
753 iso_pu_bacteria 2852387548 2852392106 261
754 iso_pu_bacteria 2919408235 2919411456 261
755 iso_pu_bacteria 2958172287 2958176816 261
756 iso_pu_bacteria 2996310559 2996311632 261
757 iso_pu_bacteria 3005416602 3005416886 261
758 iso_pu_bacteria 8005314921 8005315910 261
759 iso_pu_bacteria 8005484373 8005486997 261
760 iso_pu_bacteria 8005645114 8005645194 261
761 iso_pu_bacteria 8005682033 8005687360 261
762 iso_pu_bacteria 8024486573 8024491014 261
763 iso_pu_bacteria 8046767195 8046768370 261
764 iso_pu_bacteria 8057575449 8057581961 261
765 3300005262 Ga0065165_1002015 Ga0065165_10020153 262
766 3300006038 Ga0075365_10128777 Ga0075365_101287772 262
767 3300006038 Ga0075365_10250840 Ga0075365_102508402 262
768 3300009551 Ga0105238_10399002 Ga0105238_103990022 262
769 3300044683 Ga0466965_0038749 Ga0466965_0038749_1202_1990 262
770 3300044765 Ga0466970_0057028 Ga0466970_0057028_562_1350 262
771 3300046691 Ga0495670_0124213 Ga0495670_0124213_40_834 262
772 3300048925 Ga0496122_0000082 Ga0496122_0000082_140411_141199 262
773 3300048926 Ga0496123_0000067 Ga0496123_0000067_67961_68749 262
774 3300049568 Ga0501031_0081844 Ga0501031_0081844_840_1634 262
775 3300049569 Ga0501032_0188048 Ga0501032_0188048_394_1188 262
776 3300049572 Ga0501036_0297214 Ga0501036_0297214_359_1153 262
777 3300049584 Ga0501068_0211120 Ga0501068_0211120_110_904 262
778 3300049585 Ga0501069_0038095 Ga0501069_0038095_1674_2468 262
779 3300049586 Ga0501070_0001656 Ga0501070_0001656_7689_8483 262
780 3300049586 Ga0501070_0089623 Ga0501070_0089623_1328_2122 262
781 3300049822 Ga0501035_0106057 Ga0501035_0106057_323_1117 262
782 3300049823 Ga0501044_0070887 Ga0501044_0070887_2355_3149 262
783 3300049823 Ga0501044_0155940 Ga0501044_0155940_1297_2091 262
784 3300050491 nmdc:mga00v17_324172_c1 nmdc:mga00v17_324172_c1_99_893 262
785 3300050492 nmdc:mga0yw44_180042_c1 nmdc:mga0yw44_180042_c1_453_1247 262
786 3300050492 nmdc:mga0yw44_240508_c1 nmdc:mga0yw44_240508_c1_217_1011 262
787 3300001989 JGI24739J22299_10026028 JGI24739J22299_100260282 263
788 3300002067 JGI24735J21928_10010743 JGI24735J21928_100107433 263
789 3300002705 JGI25156J39149_1005781 JGI25156J39149_10057813 263
790 3300002741 JGI25157J39369_1002158 JGI25157J39369_10021582 263
791 3300003214 JGI25165J46597_1000052 JGI25165J46597_100005277 263
792 3300003762 Ga0055542_1000284 Ga0055542_100028421 263
793 3300003763 Ga0055529_1007878 Ga0055529_10078782 263
794 3300003781 Ga0055536_1017871 Ga0055536_10178713 263
795 3300005455 Ga0070663_100233991 Ga0070663_1002339912 263
796 3300005548 Ga0070665_100046994 Ga0070665_1000469943 263
797 3300005614 Ga0068856_100109572 Ga0068856_1001095723 263
798 3300006038 Ga0075365_10008818 Ga0075365_100088184 263
799 3300006038 Ga0075365_10011801 Ga0075365_100118013 263
800 3300006051 Ga0075364_10002563 Ga0075364_100025635 263
801 3300006051 Ga0075364_10113188 Ga0075364_101131882 263
802 3300009093 Ga0105240_10117420 Ga0105240_101174203 263
803 3300010375 Ga0105239_10098844 Ga0105239_100988442 263
804 3300013102 Ga0157371_10016970 Ga0157371_100169703 263
805 3300013104 Ga0157370_10250954 Ga0157370_102509542 263
806 3300013105 Ga0157369_10058030 Ga0157369_100580303 263
807 3300013105 Ga0157369_10155592 Ga0157369_101555922 263
808 3300025250 Ga0209026_1000141 Ga0209026_1000141120 263
809 3300025254 Ga0209148_1000111 Ga0209148_100011172 263
810 3300025256 Ga0209759_1000354 Ga0209759_10003543 263
811 3300025261 Ga0209233_1000118 Ga0209233_1000118186 263
812 3300025272 Ga0209455_1000206 Ga0209455_100020671 263
813 3300025284 Ga0209130_1009201 Ga0209130_10092013 263
814 3300025292 Ga0209676_1003603 Ga0209676_10036035 263
815 3300025297 Ga0209758_1000406 Ga0209758_100040644 263
816 3300025297 Ga0209758_1005846 Ga0209758_10058467 263
817 3300025298 Ga0209050_1002699 Ga0209050_10026994 263
818 3300025303 Ga0209051_1000822 Ga0209051_10008225 263
819 3300025304 Ga0209257_1003194 Ga0209257_10031949 263
820 3300025903 Ga0207680_10460929 Ga0207680_104609291 263
821 3300025904 Ga0207647_10005393 Ga0207647_100053935 263
822 3300025904 Ga0207647_10029967 Ga0207647_100299672 263
823 3300025904 Ga0207647_10232840 Ga0207647_102328402 263
824 3300026041 Ga0207639_10264026 Ga0207639_102640262 263
825 3300026142 Ga0207698_10158850 Ga0207698_101588502 263
826 3300026142 Ga0207698_10347438 Ga0207698_103474382 263
827 3300028379 Ga0268266_10020595 Ga0268266_100205953 263
828 3300028379 Ga0268266_10048156 Ga0268266_100481562 263
829 3300028379 Ga0268266_10107988 Ga0268266_101079882 263
830 3300037471 Ga0395905_0109772 Ga0395905_0109772_420_1217 263
831 3300037471 Ga0395905_0203194 Ga0395905_0203194_908_1705 263
832 3300041413 Ga0439465_0109789 Ga0439465_0109789_73_870 263
833 3300044735 Ga0466968_0085444 Ga0466968_0085444_107_904 263
834 3300044901 Ga0466960_0058815 Ga0466960_0058815_720_1517 263
835 3300046512 Ga0495610_0114438 Ga0495610_0114438_324_1121 263
836 3300046616 Ga0495668_0166161 Ga0495668_0166161_39_836 263
837 3300046660 Ga0495625_0036901 Ga0495625_0036901_114_911 263
838 3300046660 Ga0495625_0350247 Ga0495625_0350247_11_808 263
839 3300048905 Ga0496102_0231085 Ga0496102_0231085_319_1137 263
840 3300048907 Ga0496104_0572581 Ga0496104_0572581_43_840 263
841 3300048919 Ga0496116_0000057 Ga0496116_0000057_65175_65966 263
842 3300048920 Ga0496117_0025271 Ga0496117_0025271_3496_4287 263
843 3300048922 Ga0496119_0027187 Ga0496119_0027187_1766_2563 263
844 3300048922 Ga0496119_0058422 Ga0496119_0058422_126_923 263
845 3300048922 Ga0496119_0059282 Ga0496119_0059282_485_1276 263
846 3300048923 Ga0496120_0003353 Ga0496120_0003353_6316_7113 263
847 3300048923 Ga0496120_0031754 Ga0496120_0031754_1743_2534 263
848 3300048924 Ga0496121_0000034 Ga0496121_0000034_66846_67637 263
849 3300048925 Ga0496122_0001941 Ga0496122_0001941_3137_3928 263
850 3300048925 Ga0496122_0046997 Ga0496122_0046997_2415_3212 263
851 3300048925 Ga0496122_0179827 Ga0496122_0179827_317_1108 263
852 3300048926 Ga0496123_0091795 Ga0496123_0091795_473_1270 263
853 3300048926 Ga0496123_0143543 Ga0496123_0143543_93_884 263
854 3300048928 Ga0496125_0000030 Ga0496125_0000030_307302_308093 263
855 3300048928 Ga0496125_0051919 Ga0496125_0051919_767_1564 263
856 3300048928 Ga0496125_0122995 Ga0496125_0122995_888_1685 263
857 3300048928 Ga0496125_0124822 Ga0496125_0124822_213_1031 263
858 3300048929 Ga0496126_0000115 Ga0496126_0000115_65261_66052 263
859 3300048929 Ga0496126_0125055 Ga0496126_0125055_133_930 263
860 3300048929 Ga0496126_0281803 Ga0496126_0281803_448_1239 263
861 3300048929 Ga0496126_0519990 Ga0496126_0519990_61_852 263
862 3300049568 Ga0501031_0038311 Ga0501031_0038311_1659_2456 263
863 3300049568 Ga0501031_0109836 Ga0501031_0109836_516_1313 263
864 3300049569 Ga0501032_0004117 Ga0501032_0004117_3633_4430 263
865 3300049570 Ga0501033_0001913 Ga0501033_0001913_1594_2391 263
866 3300049570 Ga0501033_0015463 Ga0501033_0015463_4195_4992 263
867 3300049570 Ga0501033_0020825 Ga0501033_0020825_4029_4826 263
868 3300049570 Ga0501033_0041445 Ga0501033_0041445_2609_3406 263
869 3300049570 Ga0501033_0340796 Ga0501033_0340796_190_987 263
870 3300049571 Ga0501034_0048481 Ga0501034_0048481_2674_3471 263
871 3300049571 Ga0501034_0154163 Ga0501034_0154163_1355_2152 263
872 3300049573 Ga0501037_0000089 Ga0501037_0000089_33026_33823 263
873 3300049573 Ga0501037_0125928 Ga0501037_0125928_646_1443 263
874 3300049574 Ga0501038_0229756 Ga0501038_0229756_17_814 263
875 3300049579 Ga0501043_0000007 Ga0501043_0000007_177439_178236 263
876 3300049581 Ga0501047_0092127 Ga0501047_0092127_2061_2858 263
877 3300049581 Ga0501047_0214148 Ga0501047_0214148_823_1620 263
878 3300049583 Ga0501067_0152752 Ga0501067_0152752_192_989 263
879 3300049585 Ga0501069_0000001 Ga0501069_0000001_216950_217747 263
880 3300049585 Ga0501069_0095787 Ga0501069_0095787_16_885 263
881 3300049586 Ga0501070_0000071 Ga0501070_0000071_58750_59547 263
882 3300049586 Ga0501070_0000771 Ga0501070_0000771_21909_22706 263
883 3300049586 Ga0501070_0055100 Ga0501070_0055100_1556_2353 263
884 3300049586 Ga0501070_0144438 Ga0501070_0144438_1146_1943 263
885 3300049586 Ga0501070_0409529 Ga0501070_0409529_191_988 263
886 3300049587 Ga0501071_0004826 Ga0501071_0004826_2855_3652 263
887 3300049589 Ga0501073_0003390 Ga0501073_0003390_10853_11650 263
888 3300049590 Ga0501074_0000003 Ga0501074_0000003_52305_53102 263
889 3300049590 Ga0501074_0120102 Ga0501074_0120102_437_1234 263
890 3300049742 Ga0501080_0000090 Ga0501080_0000090_17872_18669 263
891 3300049742 Ga0501080_0243365 Ga0501080_0243365_77_874 263
892 3300049744 Ga0501083_0000012 Ga0501083_0000012_276_1073 263
893 3300049822 Ga0501035_0000037 Ga0501035_0000037_81683_82480 263
894 3300049822 Ga0501035_0000646 Ga0501035_0000646_9149_9946 263
895 3300049822 Ga0501035_0002118 Ga0501035_0002118_8264_9061 263
896 3300049823 Ga0501044_0000018 Ga0501044_0000018_142713_143510 263
897 3300049823 Ga0501044_0004660 Ga0501044_0004660_9998_10795 263
898 3300049823 Ga0501044_0116263 Ga0501044_0116263_873_1670 263
899 3300049823 Ga0501044_0557299 Ga0501044_0557299_152_949 263
900 3300050490 nmdc:mga03n38_71079_c1 nmdc:mga03n38_71079_c1_684_1502 263
901 3300050491 nmdc:mga00v17_125199_c1 nmdc:mga00v17_125199_c1_30_821 263
902 3300050491 nmdc:mga00v17_134185_c1 nmdc:mga00v17_134185_c1_333_1151 263
903 3300050491 nmdc:mga00v17_81892_c1 nmdc:mga00v17_81892_c1_381_1172 263
904 3300050492 nmdc:mga0yw44_1628_c1 nmdc:mga0yw44_1628_c1_4421_5212 263
905 3300050492 nmdc:mga0yw44_25626_c2 nmdc:mga0yw44_25626_c2_1297_2115 263
906 3300053079 Ga0500610_0011546 Ga0500610_0011546_1424_2221 263
907 3300053087 Ga0500643_004901 Ga0500643_004901_2025_2816 263
908 3300053087 Ga0500643_012816 Ga0500643_012816_1277_2074 263
909 3300053104 Ga0500556_0009403 Ga0500556_0009403_280_1071 263
910 3300053108 Ga0500562_048507 Ga0500562_048507_150_941 263
911 3300053125 Ga0500618_000513 Ga0500618_000513_18764_19555 263
912 3300053125 Ga0500618_008883 Ga0500618_008883_1893_2684 263
913 3300053125 Ga0500618_023169 Ga0500618_023169_35_826 263
914 3300053133 Ga0500655_000376 Ga0500655_000376_4081_4872 263
915 3300053139 Ga0500568_0000010 Ga0500568_0000010_196338_197135 263
916 3300053139 Ga0500568_0096891 Ga0500568_0096891_261_1052 263
917 3300053151 Ga0500604_0068900 Ga0500604_0068900_293_1090 263
918 3300053153 Ga0500616_0000448 Ga0500616_0000448_24372_25163 263
919 3300053155 Ga0500620_000306 Ga0500620_000306_941_1738 263
920 3300053158 Ga0500627_0018943 Ga0500627_0018943_626_1417 263
921 3300053177 Ga0500636_0000030 Ga0500636_0000030_12255_13046 263
922 3300053177 Ga0500636_0002620 Ga0500636_0002620_2499_3290 263
923 3300053730 Ga0500645_003289 Ga0500645_003289_1651_2442 263
924 3300060353 Ga0501082_0270955 Ga0501082_0270955_417_1214 263
925 iso_pu_bacteria 2513237090 2513613811 263
926 iso_pu_bacteria 2588253730 2588519776 263
927 iso_pu_bacteria 2894817345 2894821001 263
928 iso_pu_bacteria 2937813078 2937815538 263
929 iso_pu_bacteria 2937848649 2937852746 263
930 iso_pu_bacteria 2937891427 2937898369 263
931 iso_pu_bacteria 2937994558 2937997494 263
932 iso_pu_bacteria 2938014810 2938017198 263
933 iso_pu_bacteria 2958041894 2958049832 263
934 iso_pu_bacteria 2958100919 2958102905 263
935 iso_pu_bacteria 2958115193 2958120290 263
936 iso_pu_bacteria 2958130278 2958132903 263
937 iso_pu_bacteria 2958165035 2958167968 263
938 iso_pu_bacteria 2958179912 2958182605 263
939 iso_pu_bacteria 2961077736 2961080453 263
940 iso_pu_bacteria 2961114664 2961120955 263
941 iso_pu_bacteria 2961127735 2961131363 263
942 iso_pu_bacteria 2961163497 2961166436 263
943 iso_pu_bacteria 2961170736 2961171977 263
944 iso_pu_bacteria 2965018300 2965021255 263
945 iso_pu_bacteria 2965062239 2965065238 263
946 iso_pu_bacteria 2967996073 2967997449 263
947 iso_pu_bacteria 2968003550 2968006451 263
948 iso_pu_bacteria 2968091066 2968093401 263
949 iso_pu_bacteria 2968097103 2968098169 263
950 iso_pu_bacteria 2968110612 2968117105 263
951 iso_pu_bacteria 2968117919 2968122467 263
952 iso_pu_bacteria 2968128360 2968129525 263
953 iso_pu_bacteria 2968171901 2968174837 263
954 iso_pu_bacteria 2970503327 2970504574 263
955 iso_pu_bacteria 2970554993 2970557919 263
956 iso_pu_bacteria 2977821940 2977824003 263
957 iso_pu_bacteria 2977828996 2977835288 263
958 iso_pu_bacteria 2977843712 2977846697 263
959 iso_pu_bacteria 2977858184 2977858922 263
960 iso_pu_bacteria 2977922695 2977924715 263
961 iso_pu_bacteria 2977942078 2977945409 263
962 iso_pu_bacteria 2977971508 2977976125 263
963 iso_pu_bacteria 2977986579 2977988948 263
964 iso_pu_bacteria 2979710463 2979713116 263
965 iso_pu_bacteria 2979779861 2979783247 263
966 iso_pu_bacteria 2979808191 2979809212 263
967 iso_pu_bacteria 2987636660 2987641719 263
968 iso_pu_bacteria 2987652177 2987657627 263
969 iso_pu_bacteria 2987659509 2987662444 263
970 iso_pu_bacteria 2996341866 2996344890 263
971 iso_pu_bacteria 3004188549 3004191495 263
972 iso_pu_bacteria 3004203850 3004209469 263
973 iso_pu_bacteria 3004211236 3004218506 263
974 iso_pu_bacteria 3004218560 3004223648 263
975 iso_pu_bacteria 8004374579 8004376368 263
976 iso_pu_bacteria 8004387939 8004390470 263
977 iso_pu_bacteria 8004445564 8004452083 263
978 iso_pu_bacteria 8004640170 8004641891 263
979 iso_pu_bacteria 8004703790 8004706555 263
980 iso_pu_bacteria 8004714634 8004717162 263
981 3300002739 JGI25158J39367_1000191 JGI25158J39367_10001915 264
982 3300002773 JGI25152J39213_1000169 JGI25152J39213_100016917 264
983 3300002773 JGI25152J39213_1001739 JGI25152J39213_10017397 264
984 3300002773 JGI25152J39213_1002279 JGI25152J39213_10022794 264
985 3300002773 JGI25152J39213_1006926 JGI25152J39213_10069261 264
986 3300002773 JGI25152J39213_1014945 JGI25152J39213_10149452 264
987 3300002774 JGI25150J39212_1000018 JGI25150J39212_100001858 264
988 3300002774 JGI25150J39212_1001891 JGI25150J39212_10018913 264
989 3300002774 JGI25150J39212_1011092 JGI25150J39212_10110922 264
990 3300002987 JGI25159J45721_1000022 JGI25159J45721_100002224 264
991 3300002987 JGI25159J45721_1003195 JGI25159J45721_10031955 264
992 3300003187 JGI25151J46595_10000034 JGI25151J46595_10000034120 264
993 3300003187 JGI25151J46595_10000879 JGI25151J46595_1000087923 264
994 3300003187 JGI25151J46595_10003252 JGI25151J46595_100032522 264
995 3300003187 JGI25151J46595_10007778 JGI25151J46595_100077783 264
996 3300003187 JGI25151J46595_10049730 JGI25151J46595_100497302 264
997 3300003203 JGI25406J46586_10065927 JGI25406J46586_100659271 264
998 3300003215 JGI25153J46596_10000759 JGI25153J46596_100007599 264
999 3300003215 JGI25153J46596_10004655 JGI25153J46596_100046555 264
1000 3300003215 JGI25153J46596_10004904 JGI25153J46596_100049044 264
1001 3300003215 JGI25153J46596_10005257 JGI25153J46596_100052573 264
1002 3300003215 JGI25153J46596_10016210 JGI25153J46596_100162101 264
1003 3300003215 JGI25153J46596_10016213 JGI25153J46596_100162131 264
1004 3300003215 JGI25153J46596_10041591 JGI25153J46596_100415912 264
1005 3300003354 JGI25160J50197_1000056 JGI25160J50197_100005677 264
1006 3300003354 JGI25160J50197_1000317 JGI25160J50197_100031717 264
1007 3300003354 JGI25160J50197_1024851 JGI25160J50197_10248511 264
1008 3300003374 JGI25161J50226_1000214 JGI25161J50226_10002145 264
1009 3300003374 JGI25161J50226_1000451 JGI25161J50226_10004512 264
1010 3300003374 JGI25161J50226_1002111 JGI25161J50226_10021113 264
1011 3300003578 Ga0006562J51391_1044604 Ga0006562J51391_10446043 264
1012 3300003771 Ga0055526_1001496 Ga0055526_100149610 264
1013 3300003771 Ga0055526_1001864 Ga0055526_10018644 264
1014 3300003771 Ga0055526_1003195 Ga0055526_10031958 264
1015 3300003775 Ga0055524_1000962 Ga0055524_100096217 264
1016 3300003775 Ga0055524_1001781 Ga0055524_10017816 264
1017 3300003775 Ga0055524_1002678 Ga0055524_10026783 264
1018 3300003775 Ga0055524_1003666 Ga0055524_10036663 264
1019 3300003775 Ga0055524_1004018 Ga0055524_10040184 264
1020 3300003775 Ga0055524_1006695 Ga0055524_10066953 264
1021 3300003775 Ga0055524_1011005 Ga0055524_10110053 264
1022 3300003775 Ga0055524_1014485 Ga0055524_10144852 264
1023 3300003781 Ga0055536_1004102 Ga0055536_10041023 264
1024 3300003790 Ga0055528_1000452 Ga0055528_10004527 264
1025 3300003790 Ga0055528_1001257 Ga0055528_10012579 264
1026 3300003790 Ga0055528_1002057 Ga0055528_10020575 264
1027 3300003790 Ga0055528_1004002 Ga0055528_10040023 264
1028 3300003790 Ga0055528_1012948 Ga0055528_10129484 264
1029 3300003790 Ga0055528_1016826 Ga0055528_10168262 264
1030 3300003792 Ga0055540_1000597 Ga0055540_100059718 264
1031 3300003792 Ga0055540_1004729 Ga0055540_10047293 264
1032 3300003792 Ga0055540_1007895 Ga0055540_10078954 264
1033 3300003792 Ga0055540_1016975 Ga0055540_10169753 264
1034 3300003792 Ga0055540_1017617 Ga0055540_10176172 264
1035 3300003794 Ga0055531_10018670 Ga0055531_100186703 264
1036 3300003856 Ga0058692_1002316 Ga0058692_10023165 264
1037 3300004625 Ga0055543_1000330 Ga0055543_100033012 264
1038 3300004625 Ga0055543_1000682 Ga0055543_100068213 264
1039 3300004625 Ga0055543_1001229 Ga0055543_10012298 264
1040 3300005262 Ga0065165_1000155 Ga0065165_100015578 264
1041 3300005262 Ga0065165_1012660 Ga0065165_10126603 264
1042 3300005289 Ga0065704_10145387 Ga0065704_101453871 264
1043 3300005335 Ga0070666_10163594 Ga0070666_101635941 264
1044 3300005337 Ga0070682_100046169 Ga0070682_1000461693 264
1045 3300005353 Ga0070669_100052021 Ga0070669_1000520213 264
1046 3300005459 Ga0068867_100041403 Ga0068867_1000414033 264
1047 3300005548 Ga0070665_100001728 Ga0070665_10000172819 264
1048 3300005548 Ga0070665_100024473 Ga0070665_1000244733 264
1049 3300005548 Ga0070665_100027905 Ga0070665_1000279053 264
1050 3300005548 Ga0070665_100065392 Ga0070665_1000653923 264
1051 3300005843 Ga0068860_100214379 Ga0068860_1002143792 264
1052 3300005983 Ga0081540_1088199 Ga0081540_10881992 264
1053 3300005985 Ga0081539_10000690 Ga0081539_1000069025 264
1054 3300006038 Ga0075365_10015484 Ga0075365_100154845 264
1055 3300006038 Ga0075365_10035579 Ga0075365_100355793 264
1056 3300006038 Ga0075365_10065362 Ga0075365_100653622 264
1057 3300006038 Ga0075365_10169525 Ga0075365_101695252 264
1058 3300006038 Ga0075365_10247244 Ga0075365_102472442 264
1059 3300006042 Ga0075368_10000331 Ga0075368_100003318 264
1060 3300006042 Ga0075368_10013009 Ga0075368_100130093 264
1061 3300006051 Ga0075364_10207119 Ga0075364_102071192 264
1062 3300006051 Ga0075364_10376193 Ga0075364_103761932 264
1063 3300006177 Ga0075362_10003009 Ga0075362_100030093 264
1064 3300006178 Ga0075367_10001276 Ga0075367_100012766 264
1065 3300006178 Ga0075367_10008172 Ga0075367_100081723 264
1066 3300006178 Ga0075367_10012825 Ga0075367_100128254 264
1067 3300006186 Ga0075369_10000313 Ga0075369_100003137 264
1068 3300006186 Ga0075369_10000392 Ga0075369_1000039213 264
1069 3300006186 Ga0075369_10000984 Ga0075369_100009847 264
1070 3300006186 Ga0075369_10059281 Ga0075369_100592812 264
1071 3300006195 Ga0075366_10010073 Ga0075366_100100733 264
1072 3300006195 Ga0075366_10018892 Ga0075366_100188922 264
1073 3300006195 Ga0075366_10059537 Ga0075366_100595372 264
1074 3300006195 Ga0075366_10169644 Ga0075366_101696442 264
1075 3300006353 Ga0075370_10003473 Ga0075370_100034737 264
1076 3300006946 Ga0079104_1000310 Ga0079104_100031031 264
1077 3300006946 Ga0079104_1002619 Ga0079104_10026192 264
1078 3300006948 Ga0099826_10000813 Ga0099826_100008134 264
1079 3300009011 Ga0105251_10005877 Ga0105251_100058773 264
1080 3300009036 Ga0105244_10148610 Ga0105244_101486102 264
1081 3300009036 Ga0105244_10151217 Ga0105244_101512172 264
1082 3300009092 Ga0105250_10005594 Ga0105250_100055945 264
1083 3300009101 Ga0105247_10027296 Ga0105247_100272963 264
1084 3300009148 Ga0105243_10013389 Ga0105243_100133894 264
1085 3300009148 Ga0105243_10065194 Ga0105243_100651942 264
1086 3300009174 Ga0105241_10094484 Ga0105241_100944842 264
1087 3300009177 Ga0105248_10015451 Ga0105248_100154517 264
1088 3300009553 Ga0105249_10076570 Ga0105249_100765701 264
1089 3300009553 Ga0105249_10164867 Ga0105249_101648672 264
1090 3300009765 Ga0123341_1011001 Ga0123341_10110017 264
1091 3300009766 Ga0123342_1006148 Ga0123342_10061487 264
1092 3300010375 Ga0105239_10145918 Ga0105239_101459182 264
1093 3300011119 Ga0105246_10125589 Ga0105246_101255892 264
1094 3300013100 Ga0157373_10017981 Ga0157373_100179815 264
1095 3300013102 Ga0157371_10000071 Ga0157371_1000007192 264
1096 3300013102 Ga0157371_10208933 Ga0157371_102089332 264
1097 3300013104 Ga0157370_10000079 Ga0157370_1000007940 264
1098 3300013249 Ga0171463_1004 Ga0171463_1004316 264
1099 3300013296 Ga0157374_10515719 Ga0157374_105157192 264
1100 3300013306 Ga0163162_10240203 Ga0163162_102402032 264
1101 3300013306 Ga0163162_10264290 Ga0163162_102642903 264
1102 3300014325 Ga0163163_10667340 Ga0163163_106673402 264
1103 3300015690 Ga0183363_1129 Ga0183363_112910 264
1104 3300021321 Ga0214542_1000064 Ga0214542_100006474 264
1105 3300021321 Ga0214542_1012059 Ga0214542_10120592 264
1106 3300021327 Ga0214543_1000015 Ga0214543_1000015189 264
1107 3300021327 Ga0214543_1000063 Ga0214543_100006338 264
1108 3300022740 Ga0228710_1000002 Ga0228710_1000002181 264
1109 3300025208 Ga0209436_100013 Ga0209436_10001356 264
1110 3300025208 Ga0209436_100428 Ga0209436_10042818 264
1111 3300025245 Ga0207425_1000035 Ga0207425_1000035143 264
1112 3300025245 Ga0207425_1000818 Ga0207425_10008185 264
1113 3300025245 Ga0207425_1003762 Ga0207425_10037623 264
1114 3300025245 Ga0207425_1006981 Ga0207425_10069814 264
1115 3300025245 Ga0207425_1016727 Ga0207425_10167272 264
1116 3300025245 Ga0207425_1017715 Ga0207425_10177152 264
1117 3300025258 Ga0209129_1000029 Ga0209129_1000029143 264
1118 3300025258 Ga0209129_1000050 Ga0209129_100005066 264
1119 3300025258 Ga0209129_1000826 Ga0209129_10008267 264
1120 3300025258 Ga0209129_1002308 Ga0209129_10023084 264
1121 3300025258 Ga0209129_1003458 Ga0209129_10034585 264
1122 3300025258 Ga0209129_1003466 Ga0209129_10034664 264
1123 3300025261 Ga0209233_1002000 Ga0209233_10020004 264
1124 3300025273 Ga0209673_1000033 Ga0209673_100003364 264
1125 3300025273 Ga0209673_1000050 Ga0209673_1000050195 264
1126 3300025273 Ga0209673_1000370 Ga0209673_100037010 264
1127 3300025273 Ga0209673_1001845 Ga0209673_100184510 264
1128 3300025273 Ga0209673_1002753 Ga0209673_10027533 264
1129 3300025273 Ga0209673_1004411 Ga0209673_10044115 264
1130 3300025273 Ga0209673_1009772 Ga0209673_10097723 264
1131 3300025273 Ga0209673_1012920 Ga0209673_10129202 264
1132 3300025273 Ga0209673_1017809 Ga0209673_10178092 264
1133 3300025284 Ga0209130_1000009 Ga0209130_100000967 264
1134 3300025284 Ga0209130_1000133 Ga0209130_100013377 264
1135 3300025284 Ga0209130_1003685 Ga0209130_10036854 264
1136 3300025292 Ga0209676_1017298 Ga0209676_10172982 264
1137 3300025294 Ga0209025_1000042 Ga0209025_100004293 264
1138 3300025294 Ga0209025_1000132 Ga0209025_100013263 264
1139 3300025294 Ga0209025_1000453 Ga0209025_10004533 264
1140 3300025294 Ga0209025_1000536 Ga0209025_100053637 264
1141 3300025294 Ga0209025_1000815 Ga0209025_100081513 264
1142 3300025294 Ga0209025_1003984 Ga0209025_10039847 264
1143 3300025294 Ga0209025_1008993 Ga0209025_10089935 264
1144 3300025294 Ga0209025_1009137 Ga0209025_10091374 264
1145 3300025294 Ga0209025_1023470 Ga0209025_10234703 264
1146 3300025294 Ga0209025_1044776 Ga0209025_10447762 264
1147 3300025294 Ga0209025_1082425 Ga0209025_10824252 264
1148 3300025295 Ga0209564_1000193 Ga0209564_100019377 264
1149 3300025295 Ga0209564_1000227 Ga0209564_100022761 264
1150 3300025295 Ga0209564_1000284 Ga0209564_10002847 264
1151 3300025295 Ga0209564_1002592 Ga0209564_10025924 264
1152 3300025295 Ga0209564_1007808 Ga0209564_10078085 264
1153 3300025295 Ga0209564_1010209 Ga0209564_10102093 264
1154 3300025295 Ga0209564_1010789 Ga0209564_10107894 264
1155 3300025295 Ga0209564_1021755 Ga0209564_10217552 264
1156 3300025297 Ga0209758_1000299 Ga0209758_100029942 264
1157 3300025297 Ga0209758_1000864 Ga0209758_100086423 264
1158 3300025297 Ga0209758_1001412 Ga0209758_100141223 264
1159 3300025297 Ga0209758_1001462 Ga0209758_100146226 264
1160 3300025297 Ga0209758_1003168 Ga0209758_100316811 264
1161 3300025297 Ga0209758_1003902 Ga0209758_10039025 264
1162 3300025297 Ga0209758_1007065 Ga0209758_10070655 264
1163 3300025297 Ga0209758_1022438 Ga0209758_10224383 264
1164 3300025297 Ga0209758_1028206 Ga0209758_10282063 264
1165 3300025298 Ga0209050_1004678 Ga0209050_10046783 264
1166 3300025298 Ga0209050_1004888 Ga0209050_10048883 264
1167 3300025299 Ga0209256_1000286 Ga0209256_10002865 264
1168 3300025299 Ga0209256_1001479 Ga0209256_100147925 264
1169 3300025299 Ga0209256_1001610 Ga0209256_10016109 264
1170 3300025299 Ga0209256_1001820 Ga0209256_100182020 264
1171 3300025299 Ga0209256_1002679 Ga0209256_10026794 264
1172 3300025299 Ga0209256_1003742 Ga0209256_10037425 264
1173 3300025299 Ga0209256_1005463 Ga0209256_10054633 264
1174 3300025299 Ga0209256_1013906 Ga0209256_10139063 264
1175 3300025299 Ga0209256_1015132 Ga0209256_10151322 264
1176 3300025302 Ga0207426_1000041 Ga0207426_10000415 264
1177 3300025302 Ga0207426_1000214 Ga0207426_100021467 264
1178 3300025302 Ga0207426_1000248 Ga0207426_100024877 264
1179 3300025302 Ga0207426_1000682 Ga0207426_100068229 264
1180 3300025303 Ga0209051_1000118 Ga0209051_100011819 264
1181 3300025303 Ga0209051_1001039 Ga0209051_100103924 264
1182 3300025303 Ga0209051_1011245 Ga0209051_10112454 264
1183 3300025303 Ga0209051_1012570 Ga0209051_10125703 264
1184 3300025304 Ga0209257_1003966 Ga0209257_10039664 264
1185 3300025304 Ga0209257_1008273 Ga0209257_10082733 264
1186 3300025304 Ga0209257_1021432 Ga0209257_10214323 264
1187 3300025304 Ga0209257_1031374 Ga0209257_10313742 264
1188 3300025304 Ga0209257_1032740 Ga0209257_10327402 264
1189 3300025735 Ga0207713_1039001 Ga0207713_10390012 264
1190 3300025923 Ga0207681_10044364 Ga0207681_100443643 264
1191 3300025935 Ga0207709_10041550 Ga0207709_100415503 264
1192 3300025935 Ga0207709_10130227 Ga0207709_101302272 264
1193 3300025941 Ga0207711_10015450 Ga0207711_100154503 264
1194 3300026067 Ga0207678_10040358 Ga0207678_100403583 264
1195 3300026089 Ga0207648_10017029 Ga0207648_100170295 264
1196 3300026121 Ga0207683_10204603 Ga0207683_102046032 264
1197 3300027111 Ga0209281_1000028 Ga0209281_1000028250 264
1198 3300027111 Ga0209281_1000030 Ga0209281_100003077 264
1199 3300027111 Ga0209281_1000144 Ga0209281_100014437 264
1200 3300027312 Ga0209371_1000037 Ga0209371_1000037269 264
1201 3300027312 Ga0209371_1001411 Ga0209371_10014112 264
1202 3300027666 Ga0209282_1000004 Ga0209282_100000477 264
1203 3300027666 Ga0209282_1000695 Ga0209282_100069516 264
1204 3300027866 Ga0209813_10000656 Ga0209813_100006564 264
1205 3300027866 Ga0209813_10005578 Ga0209813_100055783 264
1206 3300028379 Ga0268266_10022456 Ga0268266_100224563 264
1207 3300028379 Ga0268266_10024962 Ga0268266_100249622 264
1208 3300028379 Ga0268266_10036055 Ga0268266_100360553 264
1209 3300028379 Ga0268266_10084479 Ga0268266_100844793 264
1210 3300028794 Ga0307515_10001049 Ga0307515_1000104920 264
1211 3300028794 Ga0307515_10001099 Ga0307515_1000109928 264
1212 3300028794 Ga0307515_10003215 Ga0307515_100032154 264
1213 3300028794 Ga0307515_10012908 Ga0307515_100129083 264
1214 3300028794 Ga0307515_10166092 Ga0307515_101660922 264
1215 3300030500 Ga0268256_1000039 Ga0268256_100003939 264
1216 3300030500 Ga0268256_1001490 Ga0268256_10014906 264
1217 3300031456 Ga0307513_10001726 Ga0307513_100017266 264
1218 3300031456 Ga0307513_10293864 Ga0307513_102938642 264
1219 3300031456 Ga0307513_10322135 Ga0307513_103221352 264
1220 3300031548 Ga0307408_100174389 Ga0307408_1001743892 264
1221 3300031548 Ga0307408_100214882 Ga0307408_1002148822 264
1222 3300031731 Ga0307405_10000700 Ga0307405_100007004 264
1223 3300031731 Ga0307405_10105294 Ga0307405_101052942 264
1224 3300031731 Ga0307405_10107309 Ga0307405_101073092 264
1225 3300031901 Ga0307406_10025694 Ga0307406_100256942 264
1226 3300031911 Ga0307412_10000412 Ga0307412_100004128 264
1227 3300031911 Ga0307412_10180321 Ga0307412_101803212 264
1228 3300031967 Ga0315914_1000001 Ga0315914_1000001305 264
1229 3300031995 Ga0307409_100057973 Ga0307409_1000579733 264
1230 3300032002 Ga0307416_100117991 Ga0307416_1001179913 264
1231 3300033430 Ga0315913_1000022 Ga0315913_10000227 264
1232 3300033464 Ga0315915_1000002 Ga0315915_100000278 264
1233 3300037312 Ga0395899_0000114 Ga0395899_0000114_83997_84818 264
1234 3300037418 Ga0395900_0000154 Ga0395900_0000154_63133_63954 264
1235 3300037466 Ga0395898_0000308 Ga0395898_0000308_49804_50625 264
1236 3300037471 Ga0395905_0000153 Ga0395905_0000153_63133_63954 264
1237 3300038443 Ga0395901_0000107 Ga0395901_0000107_49804_50625 264
1238 3300041404 Ga0439436_0020168 Ga0439436_0020168_396_1190 264
1239 3300041405 Ga0439438_022143 Ga0439438_022143_628_1422 264
1240 3300041413 Ga0439465_0002941 Ga0439465_0002941_1694_2488 264
1241 3300041413 Ga0439465_0008560 Ga0439465_0008560_1973_2767 264
1242 3300041413 Ga0439465_0087910 Ga0439465_0087910_76_870 264
1243 3300041413 Ga0439465_0109951 Ga0439465_0109951_44_838 264
1244 3300041441 Ga0451787_786302 Ga0451787_786302_2109_2903 264
1245 3300041451 Ga0451791_1084156 Ga0451791_1084156_1004_1798 264
1246 3300041456 Ga0451795_0936408 Ga0451795_0936408_747_1541 264
1247 3300041492 Ga0451835_0541352 Ga0451835_0541352_80_874 264
1248 3300041494 Ga0451837_1266342 Ga0451837_1266342_80_874 264
1249 3300041496 Ga0451839_0960768 Ga0451839_0960768_90_884 264
1250 3300041496 Ga0451839_1362450 Ga0451839_1362450_42_836 264
1251 3300041501 Ga0451845_0818217 Ga0451845_0818217_371_1165 264
1252 3300041502 Ga0451846_16062 Ga0451846_16062_3222_4016 264
1253 3300041503 Ga0451847_0888644 Ga0451847_0888644_266_1060 264
1254 3300041504 Ga0451848_00496 Ga0451848_00496_129_923 264
1255 3300041505 Ga0451849_0622848 Ga0451849_0622848_778_1572 264
1256 3300041505 Ga0451849_1184580 Ga0451849_1184580_81_875 264
1257 3300041506 Ga0451850_52452 Ga0451850_52452_17_811 264
1258 3300041507 Ga0451851_0296208 Ga0451851_0296208_1053_1847 264
1259 3300041507 Ga0451851_1301903 Ga0451851_1301903_65_859 264
1260 3300041509 Ga0451843_0006262 Ga0451843_0006262_129_923 264
1261 3300041509 Ga0451843_0102315 Ga0451843_0102315_69_863 264
1262 3300041510 Ga0451854_25229 Ga0451854_25229_702_1496 264
1263 3300041511 Ga0451855_1956298 Ga0451855_1956298_371_1165 264
1264 3300041916 Ga0452271_63898 Ga0452271_63898_305_1099 264
1265 3300042007 Ga0439449_0016640 Ga0439449_0016640_1393_2187 264
1266 3300042007 Ga0439449_0082256 Ga0439449_0082256_281_1075 264
1267 3300042015 Ga0439462_0050030 Ga0439462_0050030_261_1055 264
1268 3300042531 Ga0450918_001271 Ga0450918_001271_2968_3762 264
1269 3300046457 Ga0495590_0096483 Ga0495590_0096483_121_915 264
1270 3300046460 Ga0495638_0000110 Ga0495638_0000110_63338_64132 264
1271 3300046460 Ga0495638_0009542 Ga0495638_0009542_1844_2644 264
1272 3300046460 Ga0495638_0023446 Ga0495638_0023446_2414_3208 264
1273 3300046460 Ga0495638_0072445 Ga0495638_0072445_465_1259 264
1274 3300046474 Ga0495605_0018627 Ga0495605_0018627_361_1155 264
1275 3300046474 Ga0495605_0018645 Ga0495605_0018645_1039_1833 264
1276 3300046492 Ga0495585_0025166 Ga0495585_0025166_1065_1859 264
1277 3300046492 Ga0495585_0273670 Ga0495585_0273670_26_820 264
1278 3300046501 Ga0495607_0009290 Ga0495607_0009290_3909_4703 264
1279 3300046506 Ga0495583_0002526 Ga0495583_0002526_5334_6128 264
1280 3300046506 Ga0495583_0030411 Ga0495583_0030411_1523_2317 264
1281 3300046506 Ga0495583_0036690 Ga0495583_0036690_503_1297 264
1282 3300046506 Ga0495583_0038784 Ga0495583_0038784_342_1136 264
1283 3300046507 Ga0495606_0008486 Ga0495606_0008486_4817_5611 264
1284 3300046512 Ga0495610_0000363 Ga0495610_0000363_21135_21929 264
1285 3300046515 Ga0495620_0026048 Ga0495620_0026048_1539_2333 264
1286 3300046515 Ga0495620_0032808 Ga0495620_0032808_655_1449 264
1287 3300046515 Ga0495620_0124812 Ga0495620_0124812_119_913 264
1288 3300046518 Ga0495631_0009141 Ga0495631_0009141_3364_4158 264
1289 3300046518 Ga0495631_0062843 Ga0495631_0062843_342_1136 264
1290 3300046519 Ga0495632_0002260 Ga0495632_0002260_4090_4884 264
1291 3300046519 Ga0495632_0004424 Ga0495632_0004424_4942_5736 264
1292 3300046519 Ga0495632_0031879 Ga0495632_0031879_527_1321 264
1293 3300046519 Ga0495632_0043756 Ga0495632_0043756_970_1764 264
1294 3300046522 Ga0495643_0014831 Ga0495643_0014831_3469_4263 264
1295 3300046522 Ga0495643_0083550 Ga0495643_0083550_209_1003 264
1296 3300046524 Ga0495648_0023661 Ga0495648_0023661_86_880 264
1297 3300046524 Ga0495648_0033988 Ga0495648_0033988_2129_2923 264
1298 3300046530 Ga0495654_0000143 Ga0495654_0000143_49817_50611 264
1299 3300046530 Ga0495654_0029808 Ga0495654_0029808_643_1437 264
1300 3300046530 Ga0495654_0102439 Ga0495654_0102439_153_947 264
1301 3300046538 Ga0495609_0047715 Ga0495609_0047715_750_1544 264
1302 3300046542 Ga0495597_0003665 Ga0495597_0003665_3205_3999 264
1303 3300046558 Ga0495633_0017760 Ga0495633_0017760_2377_3171 264
1304 3300046616 Ga0495668_0013032 Ga0495668_0013032_3224_4018 264
1305 3300046616 Ga0495668_0028753 Ga0495668_0028753_2214_3014 264
1306 3300046616 Ga0495668_0044115 Ga0495668_0044115_1275_2069 264
1307 3300046616 Ga0495668_0078372 Ga0495668_0078372_634_1428 264
1308 3300046648 Ga0495611_0066298 Ga0495611_0066298_550_1344 264
1309 3300046660 Ga0495625_0018152 Ga0495625_0018152_4331_5125 264
1310 3300046660 Ga0495625_0025839 Ga0495625_0025839_1045_1839 264
1311 3300046660 Ga0495625_0032212 Ga0495625_0032212_3030_3824 264
1312 3300046660 Ga0495625_0032944 Ga0495625_0032944_2265_3059 264
1313 3300046660 Ga0495625_0060171 Ga0495625_0060171_1238_2032 264
1314 3300046660 Ga0495625_0114829 Ga0495625_0114829_838_1632 264
1315 3300046660 Ga0495625_0153453 Ga0495625_0153453_96_890 264
1316 3300046694 Ga0495649_0028221 Ga0495649_0028221_1737_2531 264
1317 3300047320 Ga0495672_0037794 Ga0495672_0037794_2007_2801 264
1318 3300047470 Ga0495681_0006015 Ga0495681_0006015_5800_6594 264
1319 3300047470 Ga0495681_0016034 Ga0495681_0016034_300_1094 264
1320 3300047472 Ga0495686_0002138 Ga0495686_0002138_6831_7625 264
1321 3300047472 Ga0495686_0029027 Ga0495686_0029027_1399_2193 264
1322 3300047472 Ga0495686_0034137 Ga0495686_0034137_2132_2926 264
1323 3300048905 Ga0496102_0027633 Ga0496102_0027633_3006_3800 264
1324 3300048905 Ga0496102_0664044 Ga0496102_0664044_80_901 264
1325 3300048907 Ga0496104_0019186 Ga0496104_0019186_1029_1823 264
1326 3300048908 Ga0496105_0106434 Ga0496105_0106434_1496_2290 264
1327 3300048909 Ga0496106_0000209 Ga0496106_0000209_34479_35273 264
1328 3300048913 Ga0496110_0034043 Ga0496110_0034043_1079_1873 264
1329 3300048913 Ga0496110_0037462 Ga0496110_0037462_1131_1925 264
1330 3300048914 Ga0496111_0000529 Ga0496111_0000529_4669_5463 264
1331 3300048915 Ga0496112_0059923 Ga0496112_0059923_936_1757 264
1332 3300048916 Ga0496113_0182693 Ga0496113_0182693_808_1629 264
1333 3300048918 Ga0496115_0559841 Ga0496115_0559841_70_870 264
1334 3300048919 Ga0496116_0002951 Ga0496116_0002951_11686_12480 264
1335 3300048919 Ga0496116_0004307 Ga0496116_0004307_6993_7787 264
1336 3300048919 Ga0496116_0007377 Ga0496116_0007377_6582_7376 264
1337 3300048919 Ga0496116_0012871 Ga0496116_0012871_4055_4849 264
1338 3300048919 Ga0496116_0027111 Ga0496116_0027111_3134_3928 264
1339 3300048919 Ga0496116_0049893 Ga0496116_0049893_63_857 264
1340 3300048919 Ga0496116_0089513 Ga0496116_0089513_920_1717 264
1341 3300048920 Ga0496117_0000031 Ga0496117_0000031_316102_316896 264
1342 3300048920 Ga0496117_0005859 Ga0496117_0005859_4730_5524 264
1343 3300048920 Ga0496117_0008418 Ga0496117_0008418_4290_5084 264
1344 3300048920 Ga0496117_0008839 Ga0496117_0008839_3693_4487 264
1345 3300048920 Ga0496117_0057733 Ga0496117_0057733_763_1557 264
1346 3300048920 Ga0496117_0062376 Ga0496117_0062376_1648_2442 264
1347 3300048921 Ga0496118_0000208 Ga0496118_0000208_60503_61297 264
1348 3300048921 Ga0496118_0009542 Ga0496118_0009542_2970_3764 264
1349 3300048921 Ga0496118_0010424 Ga0496118_0010424_4505_5299 264
1350 3300048921 Ga0496118_0018069 Ga0496118_0018069_2049_2843 264
1351 3300048921 Ga0496118_0026041 Ga0496118_0026041_3623_4417 264
1352 3300048921 Ga0496118_0117856 Ga0496118_0117856_869_1663 264
1353 3300048922 Ga0496119_0028420 Ga0496119_0028420_1204_1998 264
1354 3300048922 Ga0496119_0057969 Ga0496119_0057969_1395_2189 264
1355 3300048922 Ga0496119_0098164 Ga0496119_0098164_229_1023 264
1356 3300048923 Ga0496120_0000387 Ga0496120_0000387_56938_57732 264
1357 3300048924 Ga0496121_0006665 Ga0496121_0006665_1948_2742 264
1358 3300048924 Ga0496121_0011216 Ga0496121_0011216_7244_8038 264
1359 3300048924 Ga0496121_0017687 Ga0496121_0017687_4927_5721 264
1360 3300048924 Ga0496121_0026581 Ga0496121_0026581_1701_2495 264
1361 3300048924 Ga0496121_0062440 Ga0496121_0062440_947_1741 264
1362 3300048924 Ga0496121_0099186 Ga0496121_0099186_1131_1925 264
1363 3300048924 Ga0496121_0368692 Ga0496121_0368692_123_917 264
1364 3300048925 Ga0496122_0000023 Ga0496122_0000023_316090_316884 264
1365 3300048925 Ga0496122_0000308 Ga0496122_0000308_74311_75105 264
1366 3300048925 Ga0496122_0009040 Ga0496122_0009040_5155_5949 264
1367 3300048925 Ga0496122_0009440 Ga0496122_0009440_4582_5376 264
1368 3300048925 Ga0496122_0016216 Ga0496122_0016216_3219_4013 264
1369 3300048925 Ga0496122_0056321 Ga0496122_0056321_1948_2742 264
1370 3300048925 Ga0496122_0069421 Ga0496122_0069421_453_1247 264
1371 3300048925 Ga0496122_0188034 Ga0496122_0188034_99_893 264
1372 3300048926 Ga0496123_0000027 Ga0496123_0000027_64152_64946 264
1373 3300048926 Ga0496123_0000066 Ga0496123_0000066_74078_74872 264
1374 3300048926 Ga0496123_0004280 Ga0496123_0004280_12466_13260 264
1375 3300048926 Ga0496123_0014489 Ga0496123_0014489_1425_2219 264
1376 3300048926 Ga0496123_0014788 Ga0496123_0014788_3077_3871 264
1377 3300048926 Ga0496123_0017159 Ga0496123_0017159_4676_5470 264
1378 3300048926 Ga0496123_0032615 Ga0496123_0032615_2142_2936 264
1379 3300048926 Ga0496123_0147973 Ga0496123_0147973_173_967 264
1380 3300048927 Ga0496124_0000294 Ga0496124_0000294_28387_29181 264
1381 3300048927 Ga0496124_0001215 Ga0496124_0001215_27236_28030 264
1382 3300048927 Ga0496124_0003574 Ga0496124_0003574_10866_11660 264
1383 3300048927 Ga0496124_0004183 Ga0496124_0004183_5343_6137 264
1384 3300048927 Ga0496124_0008477 Ga0496124_0008477_6782_7576 264
1385 3300048927 Ga0496124_0021552 Ga0496124_0021552_3982_4776 264
1386 3300048927 Ga0496124_0041507 Ga0496124_0041507_2095_2889 264
1387 3300048927 Ga0496124_0066054 Ga0496124_0066054_860_1654 264
1388 3300048927 Ga0496124_0071829 Ga0496124_0071829_409_1203 264
1389 3300048927 Ga0496124_0132601 Ga0496124_0132601_404_1198 264
1390 3300048927 Ga0496124_0138206 Ga0496124_0138206_625_1419 264
1391 3300048927 Ga0496124_0196553 Ga0496124_0196553_226_1020 264
1392 3300048928 Ga0496125_0000288 Ga0496125_0000288_67783_68577 264
1393 3300048928 Ga0496125_0004702 Ga0496125_0004702_2991_3785 264
1394 3300048928 Ga0496125_0005090 Ga0496125_0005090_9481_10275 264
1395 3300048928 Ga0496125_0006385 Ga0496125_0006385_2531_3325 264
1396 3300048928 Ga0496125_0225126 Ga0496125_0225126_182_976 264
1397 3300048929 Ga0496126_0000258 Ga0496126_0000258_73308_74102 264
1398 3300048929 Ga0496126_0266582 Ga0496126_0266582_66_860 264
1399 3300048929 Ga0496126_0447962 Ga0496126_0447962_175_969 264
1400 3300049459 Ga0495678_051307 Ga0495678_051307_209_1003 264
1401 3300049568 Ga0501031_0000009 Ga0501031_0000009_52611_53411 264
1402 3300049568 Ga0501031_0153985 Ga0501031_0153985_545_1393 264
1403 3300049568 Ga0501031_0160215 Ga0501031_0160215_605_1399 264
1404 3300049569 Ga0501032_0000017 Ga0501032_0000017_52612_53412 264
1405 3300049569 Ga0501032_0161419 Ga0501032_0161419_349_1152 264
1406 3300049569 Ga0501032_0164065 Ga0501032_0164065_438_1232 264
1407 3300049569 Ga0501032_0209990 Ga0501032_0209990_384_1256 264
1408 3300049570 Ga0501033_0000029 Ga0501033_0000029_52603_53403 264
1409 3300049570 Ga0501033_0000741 Ga0501033_0000741_4992_5798 264
1410 3300049570 Ga0501033_0048357 Ga0501033_0048357_1922_2770 264
1411 3300049570 Ga0501033_0142767 Ga0501033_0142767_583_1386 264
1412 3300049571 Ga0501034_0000102 Ga0501034_0000102_52611_53411 264
1413 3300049571 Ga0501034_0379969 Ga0501034_0379969_100_948 264
1414 3300049572 Ga0501036_0000011 Ga0501036_0000011_104892_105692 264
1415 3300049573 Ga0501037_0000015 Ga0501037_0000015_107901_108701 264
1416 3300049573 Ga0501037_0060985 Ga0501037_0060985_1408_2202 264
1417 3300049574 Ga0501038_0000016 Ga0501038_0000016_52611_53411 264
1418 3300049575 Ga0501039_0000023 Ga0501039_0000023_52611_53411 264
1419 3300049576 Ga0501040_0029026 Ga0501040_0029026_864_1664 264
1420 3300049578 Ga0501042_0026781 Ga0501042_0026781_2608_3456 264
1421 3300049579 Ga0501043_0000372 Ga0501043_0000372_35933_36733 264
1422 3300049579 Ga0501043_0064351 Ga0501043_0064351_110_958 264
1423 3300049579 Ga0501043_0092471 Ga0501043_0092471_1077_1871 264
1424 3300049580 Ga0501046_0012425 Ga0501046_0012425_5749_6597 264
1425 3300049580 Ga0501046_0148875 Ga0501046_0148875_203_997 264
1426 3300049581 Ga0501047_0001169 Ga0501047_0001169_18747_19547 264
1427 3300049582 Ga0501048_0146250 Ga0501048_0146250_93_941 264
1428 3300049582 Ga0501048_0460991 Ga0501048_0460991_59_853 264
1429 3300049584 Ga0501068_0006869 Ga0501068_0006869_4268_5116 264
1430 3300049584 Ga0501068_0114354 Ga0501068_0114354_368_1162 264
1431 3300049586 Ga0501070_0017382 Ga0501070_0017382_2799_3647 264
1432 3300049586 Ga0501070_0183253 Ga0501070_0183253_727_1527 264
1433 3300049590 Ga0501074_0092052 Ga0501074_0092052_246_1094 264
1434 3300049742 Ga0501080_0037802 Ga0501080_0037802_2031_2879 264
1435 3300049822 Ga0501035_0000038 Ga0501035_0000038_105408_106208 264
1436 3300049822 Ga0501035_0003768 Ga0501035_0003768_8712_9518 264
1437 3300049822 Ga0501035_0056753 Ga0501035_0056753_1922_2770 264
1438 3300049822 Ga0501035_0144586 Ga0501035_0144586_957_1757 264
1439 3300049822 Ga0501035_0473060 Ga0501035_0473060_145_948 264
1440 3300049823 Ga0501044_0000046 Ga0501044_0000046_93402_94202 264
1441 3300049823 Ga0501044_0080832 Ga0501044_0080832_2005_2799 264
1442 3300049823 Ga0501044_0375518 Ga0501044_0375518_100_948 264
1443 3300049824 Ga0501045_0073807 Ga0501045_0073807_100_948 264
1444 3300050489 nmdc:mga03683_2458_c1 nmdc:mga03683_2458_c1_3875_4669 264
1445 3300050490 nmdc:mga03n38_17445_c1 nmdc:mga03n38_17445_c1_28_822 264
1446 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_64173_64967 264
1447 3300050491 nmdc:mga00v17_75770_c1 nmdc:mga00v17_75770_c1_905_1699 264
1448 3300050492 nmdc:mga0yw44_119249_c1 nmdc:mga0yw44_119249_c1_90_884 264
1449 3300050492 nmdc:mga0yw44_1587_c2 nmdc:mga0yw44_1587_c2_6607_7407 264
1450 3300050492 nmdc:mga0yw44_164075_c1 nmdc:mga0yw44_164075_c1_249_1097 264
1451 3300050492 nmdc:mga0yw44_29246_c1 nmdc:mga0yw44_29246_c1_487_1281 264
1452 3300050492 nmdc:mga0yw44_86646_c1 nmdc:mga0yw44_86646_c1_369_1163 264
1453 3300050493 nmdc:mga0k408_157793_c1 nmdc:mga0k408_157793_c1_382_1176 264
1454 3300050493 nmdc:mga0k408_3676_c1 nmdc:mga0k408_3676_c1_4887_5690 264
1455 3300050494 nmdc:mga06z11_104916_c1 nmdc:mga06z11_104916_c1_585_1379 264
1456 3300050494 nmdc:mga06z11_114220_c1 nmdc:mga06z11_114220_c1_250_1071 264
1457 3300050494 nmdc:mga06z11_2118_c1 nmdc:mga06z11_2118_c1_6361_7155 264
1458 3300050494 nmdc:mga06z11_28056_c1 nmdc:mga06z11_28056_c1_905_1699 264
1459 3300050494 nmdc:mga06z11_332165_c1 nmdc:mga06z11_332165_c1_88_882 264
1460 3300050494 nmdc:mga06z11_5062_c1 nmdc:mga06z11_5062_c1_3180_3974 264
1461 3300050495 nmdc:mga04h51_39041_c1 nmdc:mga04h51_39041_c1_376_1170 264
1462 3300050495 nmdc:mga04h51_6294_c1 nmdc:mga04h51_6294_c1_1744_2538 264
1463 3300050496 nmdc:mga07m45_10477_c1 nmdc:mga07m45_10477_c1_2859_3653 264
1464 3300050516 nmdc:mga0sz30_13711_c1 nmdc:mga0sz30_13711_c1_1591_2385 264
1465 3300050516 nmdc:mga0sz30_2924_c1 nmdc:mga0sz30_2924_c1_2135_2929 264
1466 3300050516 nmdc:mga0sz30_55500_c1 nmdc:mga0sz30_55500_c1_139_933 264
1467 3300053086 Ga0500578_0019247 Ga0500578_0019247_3008_3802 264
1468 3300053086 Ga0500578_0050156 Ga0500578_0050156_519_1313 264
1469 3300053087 Ga0500643_004409 Ga0500643_004409_2060_2857 264
1470 3300053087 Ga0500643_023987 Ga0500643_023987_846_1640 264
1471 3300053090 Ga0500646_0006695 Ga0500646_0006695_1355_2152 264
1472 3300053090 Ga0500646_0046538 Ga0500646_0046538_315_1109 264
1473 3300053093 Ga0500651_0011997 Ga0500651_0011997_674_1468 264
1474 3300053103 Ga0500555_005686 Ga0500555_005686_1521_2315 264
1475 3300053103 Ga0500555_008223 Ga0500555_008223_604_1401 264
1476 3300053104 Ga0500556_0100341 Ga0500556_0100341_305_1099 264
1477 3300053105 Ga0500557_000398 Ga0500557_000398_1235_2029 264
1478 3300053107 Ga0500560_001605 Ga0500560_001605_46_840 264
1479 3300053107 Ga0500560_018919 Ga0500560_018919_658_1452 264
1480 3300053108 Ga0500562_000876 Ga0500562_000876_4045_4839 264
1481 3300053109 Ga0500569_011445 Ga0500569_011445_1061_1855 264
1482 3300053118 Ga0500594_0003502 Ga0500594_0003502_1102_1896 264
1483 3300053125 Ga0500618_001619 Ga0500618_001619_4726_5520 264
1484 3300053126 Ga0500621_007448 Ga0500621_007448_1476_2270 264
1485 3300053126 Ga0500621_081022 Ga0500621_081022_367_1161 264
1486 3300053131 Ga0500652_117154 Ga0500652_117154_149_946 264
1487 3300053133 Ga0500655_001263 Ga0500655_001263_85_879 264
1488 3300053133 Ga0500655_024401 Ga0500655_024401_151_945 264
1489 3300053134 Ga0500658_0001925 Ga0500658_0001925_4240_5034 264
1490 3300053136 Ga0500559_0074872 Ga0500559_0074872_150_944 264
1491 3300053137 Ga0500561_0000122 Ga0500561_0000122_13444_14238 264
1492 3300053139 Ga0500568_0000247 Ga0500568_0000247_21242_22036 264
1493 3300053139 Ga0500568_0001724 Ga0500568_0001724_7884_8678 264
1494 3300053139 Ga0500568_0017640 Ga0500568_0017640_1531_2325 264
1495 3300053139 Ga0500568_0022137 Ga0500568_0022137_478_1272 264
1496 3300053140 Ga0500573_0002132 Ga0500573_0002132_4957_5751 264
1497 3300053140 Ga0500573_0002450 Ga0500573_0002450_2116_2910 264
1498 3300053151 Ga0500604_0002160 Ga0500604_0002160_2051_2845 264
1499 3300053151 Ga0500604_0003631 Ga0500604_0003631_996_1790 264
1500 3300053153 Ga0500616_0001820 Ga0500616_0001820_17695_18489 264
1501 3300053153 Ga0500616_0007147 Ga0500616_0007147_2266_3066 264
1502 3300053153 Ga0500616_0010751 Ga0500616_0010751_304_1155 264
1503 3300053156 Ga0500622_0000169 Ga0500622_0000169_28512_29306 264
1504 3300053156 Ga0500622_0000441 Ga0500622_0000441_8699_9493 264
1505 3300053156 Ga0500622_0003398 Ga0500622_0003398_5537_6331 264
1506 3300053158 Ga0500627_0001834 Ga0500627_0001834_657_1451 264
1507 3300053158 Ga0500627_0002598 Ga0500627_0002598_2916_3713 264
1508 3300053158 Ga0500627_0128084 Ga0500627_0128084_219_1013 264
1509 3300053158 Ga0500627_0163919 Ga0500627_0163919_102_947 264
1510 3300053160 Ga0500633_0000081 Ga0500633_0000081_4289_5083 264
1511 3300053160 Ga0500633_0099159 Ga0500633_0099159_96_890 264
1512 3300053161 Ga0500634_0000956 Ga0500634_0000956_7201_7995 264
1513 3300053161 Ga0500634_0001545 Ga0500634_0001545_4262_5056 264
1514 3300053730 Ga0500645_004116 Ga0500645_004116_1374_2168 264
1515 3300053730 Ga0500645_017926 Ga0500645_017926_960_1754 264
1516 3300053730 Ga0500645_018238 Ga0500645_018238_1361_2158 264
1517 3300059643 Ga0587072_005168 Ga0587072_005168_124_918 264
1518 iso_pu_bacteria 2503198000 2503198912 264
1519 iso_pu_bacteria 2508501123 2509117935 264
1520 iso_pu_bacteria 2509276018 2509371521 264
1521 iso_pu_bacteria 2509276022 2509393785 264
1522 iso_pu_bacteria 2510065059 2510318462 264
1523 iso_pu_bacteria 2513237164 2514035473 264
1524 iso_pu_bacteria 2643221550 2643771707 264
1525 iso_pu_bacteria 2643221564 2643838023 264
1526 iso_pu_bacteria 2643221689 2644501240 264
1527 iso_pu_bacteria 2791355123 2792747393 264
1528 iso_pu_bacteria 2818991461 2819688363 264
1529 iso_pu_bacteria 2841846520 2841850393 264
1530 iso_pu_bacteria 2842402390 2842408184 264
1531 iso_pu_bacteria 2842409023 2842414946 264
1532 iso_pu_bacteria 2842415677 2842421545 264
1533 iso_pu_bacteria 2856320880 2856324040 264
1534 iso_pu_bacteria 2857367948 2857374291 264
1535 iso_pu_bacteria 2869242130 2869244963 264
1536 iso_pu_bacteria 2869278585 2869283076 264
1537 iso_pu_bacteria 2871435913 2871436374 264
1538 iso_pu_bacteria 2874109183 2874114024 264
1539 iso_pu_bacteria 2874131515 2874135323 264
1540 iso_pu_bacteria 2874139085 2874142735 264
1541 iso_pu_bacteria 2888337043 2888343571 264
1542 iso_pu_bacteria 2899845264 2899849429 264
1543 iso_pu_bacteria 2903513507 2903519002 264
1544 iso_pu_bacteria 2906363423 2906370169 264
1545 iso_pu_bacteria 2906370794 2906377833 264
1546 iso_pu_bacteria 2906393657 2906395778 264
1547 iso_pu_bacteria 2921201388 2921205068 264
1548 iso_pu_bacteria 2937049772 2937055206 264
1549 iso_pu_bacteria 2937877337 2937880413 264
1550 iso_pu_bacteria 2937972304 2937976135 264
1551 iso_pu_bacteria 2957443900 2957447639 264
1552 iso_pu_bacteria 2958034702 2958039060 264
1553 iso_pu_bacteria 2958041894 2958052131 264
1554 iso_pu_bacteria 2958064165 2958070965 264
1555 iso_pu_bacteria 2958084443 2958087548 264
1556 iso_pu_bacteria 2958092219 2958095834 264
1557 iso_pu_bacteria 2958122699 2958123358 264
1558 iso_pu_bacteria 2958144490 2958150778 264
1559 iso_pu_bacteria 2960617483 2960619091 264
1560 iso_pu_bacteria 2960660292 2960663980 264
1561 iso_pu_bacteria 2964649959 2964655212 264
1562 iso_pu_bacteria 2964656573 2964659979 264
1563 iso_pu_bacteria 2965040258 2965047368 264
1564 iso_pu_bacteria 2965089291 2965096248 264
1565 iso_pu_bacteria 2965102966 2965107381 264
1566 iso_pu_bacteria 2967664464 2967668258 264
1567 iso_pu_bacteria 2967735183 2967738463 264
1568 iso_pu_bacteria 2968016561 2968017435 264
1569 iso_pu_bacteria 2968083720 2968085160 264
1570 iso_pu_bacteria 2970040964 2970046599 264
1571 iso_pu_bacteria 2970116247 2970118374 264
1572 iso_pu_bacteria 2970129317 2970133522 264
1573 iso_pu_bacteria 2970184632 2970189139 264
1574 iso_pu_bacteria 2970469710 2970472481 264
1575 iso_pu_bacteria 2970593180 2970597695 264
1576 iso_pu_bacteria 2970627176 2970628819 264
1577 iso_pu_bacteria 2977851361 2977853268 264
1578 iso_pu_bacteria 2977907340 2977912327 264
1579 iso_pu_bacteria 2977915119 2977921128 264
1580 iso_pu_bacteria 2977957713 2977958292 264
1581 iso_pu_bacteria 2979089926 2979092665 264
1582 iso_pu_bacteria 2979095461 2979099944 264
1583 iso_pu_bacteria 2996348954 2996349887 264
1584 iso_pu_bacteria 3004195979 3004203125 264
1585 iso_pu_bacteria 3004232784 3004234223 264
1586 iso_pu_bacteria 3004275668 3004276589 264
1587 iso_pu_bacteria 3004289098 3004290168 264
1588 iso_pu_bacteria 3004334049 3004337044 264
1589 iso_pu_bacteria 8004312739 8004314547 264
1590 iso_pu_bacteria 8004361976 8004366000 264
1591 iso_pu_bacteria 8005382845 8005387600 264
1592 3300001979 JGI24740J21852_10008046 JGI24740J21852_100080462 265
1593 3300002704 JGI25155J39150_1000018 JGI25155J39150_100001878 265
1594 3300002705 JGI25156J39149_1000055 JGI25156J39149_100005563 265
1595 3300002737 JGI25162J39368_1000524 JGI25162J39368_10005246 265
1596 3300002737 JGI25162J39368_1001321 JGI25162J39368_10013218 265
1597 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006947 265
1598 3300002741 JGI25157J39369_1000076 JGI25157J39369_100007663 265
1599 3300002987 JGI25159J45721_1000486 JGI25159J45721_10004869 265
1600 3300003214 JGI25165J46597_1000723 JGI25165J46597_100072316 265
1601 3300003214 JGI25165J46597_1001341 JGI25165J46597_10013415 265
1602 3300003214 JGI25165J46597_1001646 JGI25165J46597_10016466 265
1603 3300003214 JGI25165J46597_1002217 JGI25165J46597_10022173 265
1604 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005166 265
1605 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011128 265
1606 3300003752 Ga0055539_1003028 Ga0055539_10030281 265
1607 3300004625 Ga0055543_1000041 Ga0055543_100004139 265
1608 3300005262 Ga0065165_1000303 Ga0065165_10003038 265
1609 3300005331 Ga0070670_100000711 Ga0070670_10000071112 265
1610 3300005539 Ga0068853_100312445 Ga0068853_1003124452 265
1611 3300005548 Ga0070665_100081432 Ga0070665_1000814322 265
1612 3300005563 Ga0068855_100209256 Ga0068855_1002092562 265
1613 3300005578 Ga0068854_100043122 Ga0068854_1000431222 265
1614 3300005614 Ga0068856_100009588 Ga0068856_1000095885 265
1615 3300005614 Ga0068856_100107833 Ga0068856_1001078332 265
1616 3300005834 Ga0068851_10023620 Ga0068851_100236203 265
1617 3300006353 Ga0075370_10030140 Ga0075370_100301403 265
1618 3300009036 Ga0105244_10061279 Ga0105244_100612792 265
1619 3300009093 Ga0105240_10000142 Ga0105240_1000014271 265
1620 3300009545 Ga0105237_10073189 Ga0105237_100731893 265
1621 3300009551 Ga0105238_10241903 Ga0105238_102419032 265
1622 3300010375 Ga0105239_10040928 Ga0105239_100409285 265
1623 3300010375 Ga0105239_10222728 Ga0105239_102227282 265
1624 3300013100 Ga0157373_10052766 Ga0157373_100527663 265
1625 3300013105 Ga0157369_10301116 Ga0157369_103011162 265
1626 3300015262 Ga0182007_10009040 Ga0182007_100090405 265
1627 3300015265 Ga0182005_1011399 Ga0182005_10113993 265
1628 3300025206 Ga0209435_100031 Ga0209435_10003180 265
1629 3300025208 Ga0209436_106719 Ga0209436_1067192 265
1630 3300025231 Ga0207427_108179 Ga0207427_1081791 265
1631 3300025233 Ga0209437_100179 Ga0209437_10017970 265
1632 3300025233 Ga0209437_100181 Ga0209437_10018167 265
1633 3300025246 Ga0209646_1000102 Ga0209646_100010280 265
1634 3300025250 Ga0209026_1000096 Ga0209026_100009680 265
1635 3300025253 Ga0209677_100353 Ga0209677_10035315 265
1636 3300025254 Ga0209148_1006902 Ga0209148_10069023 265
1637 3300025256 Ga0209759_1000090 Ga0209759_100009080 265
1638 3300025261 Ga0209233_1000185 Ga0209233_100018569 265
1639 3300025261 Ga0209233_1000212 Ga0209233_100021257 265
1640 3300025261 Ga0209233_1000263 Ga0209233_100026320 265
1641 3300025284 Ga0209130_1000058 Ga0209130_100005866 265
1642 3300025302 Ga0207426_1000131 Ga0207426_100013166 265
1643 3300025913 Ga0207695_10000234 Ga0207695_1000023472 265
1644 3300025914 Ga0207671_10000234 Ga0207671_100002346 265
1645 3300025925 Ga0207650_10001757 Ga0207650_1000175713 265
1646 3300025949 Ga0207667_10228498 Ga0207667_102284981 265
1647 3300025981 Ga0207640_10099697 Ga0207640_100996972 265
1648 3300026078 Ga0207702_10028158 Ga0207702_100281583 265
1649 3300026078 Ga0207702_10347382 Ga0207702_103473822 265
1650 3300028379 Ga0268266_10009948 Ga0268266_100099483 265
1651 3300028794 Ga0307515_10405949 Ga0307515_104059492 265
1652 3300035170 Ga0373943_0022408 Ga0373943_0022408_983_1780 265
1653 3300035695 Ga0373927_0000068 Ga0373927_0000068_5556_6353 265
1654 3300037068 Ga0373925_0009713 Ga0373925_0009713_3517_4314 265
1655 3300037471 Ga0395905_0006080 Ga0395905_0006080_5217_6023 265
1656 3300045976 Ga0466967_0122754 Ga0466967_0122754_1027_1833 265
1657 3300046459 Ga0495629_0228937 Ga0495629_0228937_256_1059 265
1658 3300046533 Ga0495640_0124115 Ga0495640_0124115_286_1089 265
1659 3300046557 Ga0495622_0003807 Ga0495622_0003807_1858_2661 265
1660 3300046660 Ga0495625_0087218 Ga0495625_0087218_786_1583 265
1661 3300047317 Ga0495604_0040845 Ga0495604_0040845_525_1328 265
1662 3300048903 Ga0496100_0041778 Ga0496100_0041778_1216_2013 265
1663 3300048905 Ga0496102_0095857 Ga0496102_0095857_1504_2301 265
1664 3300048906 Ga0496103_0035386 Ga0496103_0035386_1748_2545 265
1665 3300048916 Ga0496113_0125184 Ga0496113_0125184_1020_1817 265
1666 3300048919 Ga0496116_0013281 Ga0496116_0013281_3839_4636 265
1667 3300048920 Ga0496117_0004374 Ga0496117_0004374_6488_7285 265
1668 3300048921 Ga0496118_0008309 Ga0496118_0008309_3470_4267 265
1669 3300048922 Ga0496119_0010018 Ga0496119_0010018_4517_5314 265
1670 3300048922 Ga0496119_0173109 Ga0496119_0173109_145_951 265
1671 3300048923 Ga0496120_0009286 Ga0496120_0009286_551_1348 265
1672 3300048924 Ga0496121_0003956 Ga0496121_0003956_4947_5744 265
1673 3300048924 Ga0496121_0021103 Ga0496121_0021103_1753_2550 265
1674 3300048924 Ga0496121_0423096 Ga0496121_0423096_58_855 265
1675 3300048925 Ga0496122_0024313 Ga0496122_0024313_299_1096 265
1676 3300048925 Ga0496122_0099299 Ga0496122_0099299_280_1086 265
1677 3300048926 Ga0496123_0005944 Ga0496123_0005944_1746_2543 265
1678 3300048926 Ga0496123_0007760 Ga0496123_0007760_3585_4391 265
1679 3300048928 Ga0496125_0010417 Ga0496125_0010417_4867_5664 265
1680 3300049823 Ga0501044_0642147 Ga0501044_0642147_34_840 265
1681 3300053104 Ga0500556_0014812 Ga0500556_0014812_739_1545 265
1682 3300053125 Ga0500618_002829 Ga0500618_002829_3447_4244 265
1683 3300053148 Ga0500590_000271 Ga0500590_000271_11032_11835 265
1684 3300053153 Ga0500616_0172516 Ga0500616_0172516_50_856 265
1685 3300053730 Ga0500645_004791 Ga0500645_004791_4226_5023 265
1686 3300059640 Ga0587067_014834 Ga0587067_014834_313_1110 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13614

AAA_31

AAA domain

33

212

0.98

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

36

263

0.95

PF02374

ArsA_ATPase

Anion-transporting ATPase

34

245

0.9

PF00142

Fer4_NifH

4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family

34

100

0.84

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

32

284

0.83

PF09140

MipZ

ATPase MipZ

34

212

0.67

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

34

284

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ihp-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.944 6 258
2bek-assembly2.cif.gz_D structure of the bacterial chromosome segregation protein soj 0.9351 5 256
5if9-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound atp analog and magnesium 0.9347 6 255
2bej-assembly1.cif.gz_A structure of the bacterial chromosome segregation protein soj 0.9319 5 259
6iud-assembly1.cif.gz_A structure of helicobacter pylori soj-adp complex bound to dna 0.9285 5 255
ID Description Score Start End Superfamily
af_P9WLT1_58_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.957 6 256 3.40.50.300
af_Q1LVD4_80_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9443 5 256 3.40.50.300
5ihpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.944 6 258 3.40.50.300
2bekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9351 5 256 3.40.50.300
af_P9WLT1_58_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9213 6 256 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2P5VK06-F1-model_v4 Chromosome partitioning protein ParA 0.9671 5 209
AF-A0A7X8DMG3-F1-model_v4 ParA family protein 0.9653 6 258
AF-A0A6N4STV7-F1-model_v4 Chromosome segregation ATPase 0.964 6 257
AF-A0A519GL87-F1-model_v4 ParA family protein 0.964 6 221
AF-A0A2K3JD14-F1-model_v4 AAA domain-containing protein 0.9638 6 215

Feature Viewer

pLDDT pTM Quality
86.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map