F495162

General Info

Members Datasets Scaffolds Average Seq Length
1639 526 1603 336

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0132472|Ga0501072_0132472_28_1149
Length 373
Sequence MLPKESAFRPWSSVVTGGATKRFAERGPGRAENGAQSMAAVSSEGIEKLEDAIVRAAEATAASVRAAKSVIGTVIFGQEKVVEQALITVLCGGHALLVGLPGLAKTKLVDTMGVALGLDARRIQFTPDLMPSDIVGSEVLEEDQAGRRNFRFIPGPVFTQLLMADEINRASPRTQSALLQAMQELHVTVAGARHEVPRPFHVLATQNPIEQEGTYSLPEAQLDRFLMQIDVDYPDRDAERRIVFDTTGAEESKPKQAMTADDLLAAQRLVRRLPVGESVVEAILTLVRSARPGPDGGELAQPIAWGPSPRASQALMLAVRARALLDGRLAPSIDDVHEMAEPVLKHRMALSFAARAEGETIGSVVGRLKARIG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
7 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
8 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
9 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
10 2791355199
11 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
12 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
13 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
18 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
19 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
20 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
21 2902330777 Methylobacterium sp. 2A Isolate Unclassified
22 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
23 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
24 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
25 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
26 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
27 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
28 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
29 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
30 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
31 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
32 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
33 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
34 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
42 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
43 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
44 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
47 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
86 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
126 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
129 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
145 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
146 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
150 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
152 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
153 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
154 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
158 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
159 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
162 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
166 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
167 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
168 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
169 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
170 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
171 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
172 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
173 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
176 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
180 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
190 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
194 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
195 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
272 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
273 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
277 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
278 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
279 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
280 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
283 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
284 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
285 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
286 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
287 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
288 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
289 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
290 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
291 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
292 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
293 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
294 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
295 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
298 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
299 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
300 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
301 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
302 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
303 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
304 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
305 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
306 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
307 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
308 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
309 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
310 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
311 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
312 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
313 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
314 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
315 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
317 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
318 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
319 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
320 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
321 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
322 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
323 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
324 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
325 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
326 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
327 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
328 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
329 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
330 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
331 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
332 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
333 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
334 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
335 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
336 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
337 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
338 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
339 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
342 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
343 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
344 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
345 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
349 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
350 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
351 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
352 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
355 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
356 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
357 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
358 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
359 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
360 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
361 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
362 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
363 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
364 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
365 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
366 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
367 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
368 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
369 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
370 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
371 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
372 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
373 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
374 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
375 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
376 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
377 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
378 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
379 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
380 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
381 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
382 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
383 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
384 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
385 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
389 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
390 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
391 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
392 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
393 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
394 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
398 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
399 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
400 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
401 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
402 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
408 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
409 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
410 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
411 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
412 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
413 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
414 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
415 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
416 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
422 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
423 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
424 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
425 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
426 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
429 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
430 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
440 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
443 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
444 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
447 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
448 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
449 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
450 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
464 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
465 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
466 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
467 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
468 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
469 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
470 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
471 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
472 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
473 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
474 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
475 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
478 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
479 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
482 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
483 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
484 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
485 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
486 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
487 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
488 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
489 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
490 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
491 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
492 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
493 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
494 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
495 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
496 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
497 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
498 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
499 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
500 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
501 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
502 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
503 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
504 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
505 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
506 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
507 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
508 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
509 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
512 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
513 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
514 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
515 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
516 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
517 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
518 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
519 641522639 Methylobacterium sp. 4-46 Isolate Nodule
520 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
521 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
522 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
525 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
526 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0.43
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 1.04
Rhizoplane 7.57
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544914 2209111006 Bacteria 24470
2 ARcpr5oldR_c000055 3300000041 Bacteria 20973
3 ARSoilOldRDRAFT_c000092 3300000044 Bacteria 16845
4 ARCol0oldRDRAFT_c00958 3300000045 Bacteria 2223
5 ARCol0yngRDRAFT_1000049 3300000652 Bacteria 20970
6 JGI24746J21847_1000660 3300001977 Bacteria 5285
7 JGI24746J21847_1003668 3300001977 Bacteria 2422
8 JGI24739J22299_10005070 3300001989 Bacteria 5015
9 JGI24737J22298_10001725 3300001990 Bacteria 7790
10 JGI24737J22298_10006539 3300001990 Bacteria 3974
11 JGI24737J22298_10008869 3300001990 Bacteria 3357
12 JGI24750J21931_1000201 3300002070 Bacteria 10078
13 JGI24738J21930_10013666 3300002075 Bacteria 1751
14 JGI24749J21850_1003715 3300002076 Bacteria 2136
15 JGI24749J21850_1005688 3300002076 Bacteria 1741
16 JGI24744J21845_10002186 3300002077 Bacteria 3978
17 JGI24744J21845_10004285 3300002077 Bacteria 2944
18 JGI24035J26624_1000855 3300002126 Bacteria 2865
19 JGI24034J26672_10001663 3300002239 Bacteria 2983
20 JGI24742J22300_10000548 3300002244 Bacteria 5621
21 JGI25406J46586_10003809 3300003203 Bacteria 7048
22 JGI25406J46586_10007133 3300003203 Bacteria 5117
23 JGI25153J46596_10003847 3300003215 Bacteria 8260
24 JGI26129J50193_1002302 3300003349 Bacteria 1340
25 JGI25404J52841_10001785 3300003659 Bacteria 3898
26 JGI25405J52794_10006511 3300003911 Bacteria 2134
27 Ga0065712_10069289 3300005290 Bacteria 7569
28 Ga0065715_10000947 3300005293 Bacteria 9826
29 Ga0065715_10096595 3300005293 Bacteria 3846
30 Ga0070658_10065700 3300005327 Bacteria 2962
31 Ga0070658_10080543 3300005327 Bacteria 2675
32 Ga0070676_10004291 3300005328 Bacteria 7488
33 Ga0070676_10069735 3300005328 Bacteria 2107
34 Ga0070676_10267144 3300005328 Bacteria 1148
35 Ga0070683_100004677 3300005329 Bacteria 11310
36 Ga0070683_100080091 3300005329 Bacteria 3057
37 Ga0070683_100115011 3300005329 Bacteria 2539
38 Ga0070690_100008757 3300005330 Bacteria 5842
39 Ga0070690_100012125 3300005330 Bacteria 5066
40 Ga0070690_100032348 3300005330 Bacteria 3266
41 Ga0070690_100087661 3300005330 Bacteria 2044
42 Ga0070690_100173921 3300005330 Bacteria 1484
43 Ga0070670_100004378 3300005331 Bacteria 11820
44 Ga0070670_100006765 3300005331 Bacteria 9714
45 Ga0070670_100094117 3300005331 Bacteria 2577
46 Ga0070670_100179502 3300005331 Bacteria 1838
47 Ga0070677_10010687 3300005333 Bacteria 3145
48 Ga0070677_10022125 3300005333 Bacteria 2338
49 Ga0068869_100000546 3300005334 Bacteria 21018
50 Ga0070666_10016324 3300005335 Bacteria 4749
51 Ga0070680_100007445 3300005336 Bacteria 8352
52 Ga0070680_100009775 3300005336 Bacteria 7384
53 Ga0070680_100070058 3300005336 Bacteria 2880
54 Ga0070682_100003445 3300005337 Bacteria 8766
55 Ga0070682_100018516 3300005337 Bacteria 4073
56 Ga0070682_100023757 3300005337 Bacteria 3642
57 Ga0070682_100059999 3300005337 Bacteria 2404
58 Ga0070682_100115164 3300005337 Bacteria 1797
59 Ga0070682_100277844 3300005337 Bacteria 1219
60 Ga0068868_100013168 3300005338 Bacteria 6058
61 Ga0068868_100026486 3300005338 Bacteria 4420
62 Ga0068868_100029085 3300005338 Bacteria 4231
63 Ga0070660_100004111 3300005339 Bacteria 10041
64 Ga0070660_100024866 3300005339 Bacteria 4448
65 Ga0070660_100066748 3300005339 Bacteria 2802
66 Ga0070689_100002392 3300005340 Bacteria 12238
67 Ga0070689_100011343 3300005340 Bacteria 6380
68 Ga0070689_100023636 3300005340 Bacteria 4603
69 Ga0070689_100032975 3300005340 Bacteria 3943
70 Ga0070691_10003723 3300005341 Bacteria 6886
71 Ga0070691_10030403 3300005341 Bacteria 2530
72 Ga0070691_10059641 3300005341 Bacteria 1834
73 Ga0070691_10077486 3300005341 Bacteria 1623
74 Ga0070687_100001017 3300005343 Bacteria 9561
75 Ga0070687_100065224 3300005343 Bacteria 1937
76 Ga0070687_100081880 3300005343 Bacteria 1764
77 Ga0070661_100001763 3300005344 Bacteria 15010
78 Ga0070661_100036019 3300005344 Bacteria 3597
79 Ga0070661_100085189 3300005344 Bacteria 2335
80 Ga0070661_100180667 3300005344 Bacteria 1605
81 Ga0070661_100209699 3300005344 Bacteria 1491
82 Ga0070692_10074200 3300005345 Bacteria 1819
83 Ga0070692_10150731 3300005345 Bacteria 1324
84 Ga0070668_100049439 3300005347 Bacteria 3235
85 Ga0070668_100093478 3300005347 Bacteria 2373
86 Ga0070668_100230623 3300005347 Bacteria 1530
87 Ga0070669_100009976 3300005353 Bacteria 6754
88 Ga0070669_100033750 3300005353 Bacteria 3703
89 Ga0070669_100072827 3300005353 Bacteria 2544
90 Ga0070669_100074273 3300005353 Bacteria 2521
91 Ga0070669_100382860 3300005353 Bacteria 1147
92 Ga0070675_100029783 3300005354 Bacteria 4404
93 Ga0070675_100059157 3300005354 Bacteria 3160
94 Ga0070671_100007031 3300005355 Bacteria 9015
95 Ga0070671_100019747 3300005355 Bacteria 5488
96 Ga0070671_100033007 3300005355 Bacteria 4279
97 Ga0070671_100231059 3300005355 Bacteria 1569
98 Ga0070674_100018657 3300005356 Bacteria 4392
99 Ga0070674_100065444 3300005356 Bacteria 2551
100 Ga0070674_100107752 3300005356 Bacteria 2040
101 Ga0070674_100210462 3300005356 Bacteria 1507
102 Ga0070673_100000050 3300005364 Bacteria 49499
103 Ga0070673_100018483 3300005364 Bacteria 4981
104 Ga0070673_100074967 3300005364 Bacteria 2727
105 Ga0070673_100199892 3300005364 Bacteria 1721
106 Ga0070688_100005098 3300005365 Bacteria 6886
107 Ga0070688_100006605 3300005365 Bacteria 6209
108 Ga0070688_100019351 3300005365 Bacteria 3943
109 Ga0070688_100075812 3300005365 Bacteria 2163
110 Ga0070659_100014541 3300005366 Bacteria 5882
111 Ga0070659_100037328 3300005366 Bacteria 3787
112 Ga0070659_100078543 3300005366 Bacteria 2633
113 Ga0070659_100105397 3300005366 Bacteria 2272
114 Ga0070659_100120676 3300005366 Bacteria 2123
115 Ga0070659_100301430 3300005366 Bacteria 1336
116 Ga0070667_100036040 3300005367 Bacteria 4146
117 Ga0070667_100038413 3300005367 Bacteria 4013
118 Ga0070667_100040047 3300005367 Bacteria 3929
119 Ga0070667_100078274 3300005367 Bacteria 2824
120 Ga0070667_100329792 3300005367 Bacteria 1378
121 Ga0070667_100565331 3300005367 Bacteria 1046
122 Ga0070709_10021978 3300005434 Bacteria 3725
123 Ga0070709_10044047 3300005434 Bacteria 2762
124 Ga0070709_10076338 3300005434 Bacteria 2176
125 Ga0070709_10080285 3300005434 Bacteria 2126
126 Ga0070714_100004606 3300005435 Bacteria 10396
127 Ga0070714_100006031 3300005435 Bacteria 9304
128 Ga0070714_100014175 3300005435 Bacteria 6399
129 Ga0070714_100039953 3300005435 Bacteria 3953
130 Ga0070714_100063186 3300005435 Bacteria 3183
131 Ga0070714_100517564 3300005435 Bacteria 1139
132 Ga0070713_100005289 3300005436 Bacteria 8803
133 Ga0070713_100016906 3300005436 Bacteria 5497
134 Ga0070713_100035887 3300005436 Bacteria 3996
135 Ga0070713_100080357 3300005436 Bacteria 2780
136 Ga0070713_100175149 3300005436 Bacteria 1924
137 Ga0070713_100237268 3300005436 Bacteria 1659
138 Ga0070713_100268197 3300005436 Bacteria 1562
139 Ga0070710_10003313 3300005437 Bacteria 7639
140 Ga0070710_10012715 3300005437 Bacteria 4188
141 Ga0070710_10013665 3300005437 Bacteria 4073
142 Ga0070710_10071448 3300005437 Bacteria 2001
143 Ga0070701_10004186 3300005438 Bacteria 5806
144 Ga0070701_10011632 3300005438 Bacteria 3943
145 Ga0070711_100018457 3300005439 Bacteria 4455
146 Ga0070711_100030906 3300005439 Bacteria 3550
147 Ga0070711_100051890 3300005439 Bacteria 2820
148 Ga0070711_100152483 3300005439 Bacteria 1744
149 Ga0070705_100003118 3300005440 Bacteria 8153
150 Ga0070705_100081563 3300005440 Bacteria 1988
151 Ga0070705_100265069 3300005440 Bacteria 1214
152 Ga0070700_100002692 3300005441 Bacteria 9079
153 Ga0070700_100017552 3300005441 Bacteria 4096
154 Ga0070700_100048053 3300005441 Bacteria 2644
155 Ga0070700_100093787 3300005441 Bacteria 1964
156 Ga0070694_100008052 3300005444 Bacteria 6437
157 Ga0070694_100016432 3300005444 Bacteria 4658
158 Ga0070694_100086665 3300005444 Bacteria 2189
159 Ga0070708_100054884 3300005445 Bacteria 3541
160 Ga0070708_100198445 3300005445 Bacteria 1878
161 Ga0070663_100012871 3300005455 Bacteria 5311
162 Ga0070663_100017187 3300005455 Bacteria 4715
163 Ga0070663_100020225 3300005455 Bacteria 4404
164 Ga0070663_100026662 3300005455 Bacteria 3916
165 Ga0070663_100027275 3300005455 Bacteria 3877
166 Ga0070663_100071052 3300005455 Bacteria 2532
167 Ga0070678_100000518 3300005456 Bacteria 18676
168 Ga0070678_100034284 3300005456 Bacteria 3533
169 Ga0070678_100037451 3300005456 Bacteria 3406
170 Ga0070678_100048040 3300005456 Bacteria 3070
171 Ga0070678_100061509 3300005456 Bacteria 2768
172 Ga0070662_100021515 3300005457 Bacteria 4404
173 Ga0070662_100041959 3300005457 Bacteria 3266
174 Ga0070662_100045316 3300005457 Bacteria 3154
175 Ga0070662_100067761 3300005457 Bacteria 2622
176 Ga0070662_100133529 3300005457 Bacteria 1917
177 Ga0070662_100166872 3300005457 Bacteria 1726
178 Ga0070662_100250256 3300005457 Bacteria 1424
179 Ga0070681_10004661 3300005458 Bacteria 13105
180 Ga0070681_10010419 3300005458 Bacteria 9183
181 Ga0070681_10022966 3300005458 Bacteria 6268
182 Ga0070681_10027987 3300005458 Bacteria 5666
183 Ga0068867_100009022 3300005459 Bacteria 7035
184 Ga0068867_100018958 3300005459 Bacteria 4897
185 Ga0070685_10003674 3300005466 Bacteria 7777
186 Ga0070685_10007039 3300005466 Bacteria 5742
187 Ga0070707_100068310 3300005468 Bacteria 3420
188 Ga0070698_100201019 3300005471 Bacteria 1929
189 Ga0070699_100019495 3300005518 Bacteria 5841
190 Ga0070699_100174679 3300005518 Bacteria 1904
191 Ga0070679_100007667 3300005530 Bacteria 10102
192 Ga0070679_100030975 3300005530 Bacteria 5284
193 Ga0070679_100031240 3300005530 Bacteria 5260
194 Ga0070679_100047919 3300005530 Bacteria 4258
195 Ga0070679_100120399 3300005530 Bacteria 2610
196 Ga0070679_100155979 3300005530 Bacteria 2258
197 Ga0070679_100174109 3300005530 Bacteria 2125
198 Ga0070684_100004205 3300005535 Bacteria 10907
199 Ga0070684_100079903 3300005535 Bacteria 2892
200 Ga0070684_100105562 3300005535 Bacteria 2521
201 Ga0070684_100247283 3300005535 Bacteria 1630
202 Ga0068853_100015280 3300005539 Bacteria 6309
203 Ga0068853_100015701 3300005539 Bacteria 6221
204 Ga0068853_100030067 3300005539 Bacteria 4585
205 Ga0068853_100109958 3300005539 Bacteria 2447
206 Ga0068853_100299184 3300005539 Bacteria 1487
207 Ga0070672_100000643 3300005543 Bacteria 20456
208 Ga0070672_100040098 3300005543 Bacteria 3591
209 Ga0070672_100052229 3300005543 Bacteria 3191
210 Ga0070672_100128143 3300005543 Bacteria 2084
211 Ga0070686_100001304 3300005544 Bacteria 14085
212 Ga0070686_100065299 3300005544 Bacteria 2364
213 Ga0070695_100006337 3300005545 Bacteria 6992
214 Ga0070695_100015500 3300005545 Bacteria 4603
215 Ga0070695_100091458 3300005545 Bacteria 2032
216 Ga0070696_100018798 3300005546 Bacteria 4677
217 Ga0070696_100042306 3300005546 Bacteria 3150
218 Ga0070696_100139500 3300005546 Bacteria 1770
219 Ga0070693_100003235 3300005547 Bacteria 7563
220 Ga0070693_100008992 3300005547 Bacteria 4957
221 Ga0070693_100031899 3300005547 Bacteria 2892
222 Ga0070665_100021396 3300005548 Bacteria 6505
223 Ga0070665_100048596 3300005548 Bacteria 4258
224 Ga0070665_100085466 3300005548 Bacteria 3160
225 Ga0070665_100089171 3300005548 Bacteria 3090
226 Ga0070665_100219998 3300005548 Bacteria 1899
227 Ga0070665_100376162 3300005548 Bacteria 1427
228 Ga0070665_100436574 3300005548 Bacteria 1318
229 Ga0070704_100008125 3300005549 Bacteria 6273
230 Ga0070704_100240733 3300005549 Bacteria 1481
231 Ga0068855_100018496 3300005563 Bacteria 8376
232 Ga0068855_100021441 3300005563 Bacteria 7748
233 Ga0068855_100022276 3300005563 Bacteria 7592
234 Ga0068855_100089123 3300005563 Bacteria 3563
235 Ga0068855_100111695 3300005563 Bacteria 3137
236 Ga0068855_100293033 3300005563 Bacteria 1803
237 Ga0068855_100698323 3300005563 Bacteria 1086
238 Ga0070664_100026948 3300005564 Bacteria 4773
239 Ga0070664_100107252 3300005564 Bacteria 2435
240 Ga0070664_100198361 3300005564 Bacteria 1790
241 Ga0068857_100001038 3300005577 Bacteria 21487
242 Ga0068857_100015943 3300005577 Bacteria 6581
243 Ga0068854_100014606 3300005578 Bacteria 5181
244 Ga0068854_100020860 3300005578 Bacteria 4439
245 Ga0068854_100147355 3300005578 Bacteria 1812
246 Ga0068854_100257987 3300005578 Bacteria 1395
247 Ga0068856_100009104 3300005614 Bacteria 9654
248 Ga0068856_100038924 3300005614 Bacteria 4668
249 Ga0068856_100348432 3300005614 Bacteria 1499
250 Ga0070702_100004502 3300005615 Bacteria 6373
251 Ga0070702_100013098 3300005615 Bacteria 4178
252 Ga0070702_100035132 3300005615 Bacteria 2767
253 Ga0068852_100005996 3300005616 Bacteria 8755
254 Ga0068852_100168942 3300005616 Bacteria 2048
255 Ga0068859_100006706 3300005617 Bacteria 11694
256 Ga0068859_100135022 3300005617 Bacteria 2540
257 Ga0068859_100155044 3300005617 Bacteria 2367
258 Ga0068859_100390827 3300005617 Bacteria 1487
259 Ga0068864_100004096 3300005618 Bacteria 11968
260 Ga0068864_100006391 3300005618 Bacteria 9654
261 Ga0068864_100022271 3300005618 Bacteria 5312
262 Ga0068864_100054797 3300005618 Bacteria 3442
263 Ga0068866_10000791 3300005718 Bacteria 14174
264 Ga0068866_10079221 3300005718 Bacteria 1759
265 Ga0068866_10120115 3300005718 Bacteria 1480
266 Ga0068861_100002491 3300005719 Bacteria 12008
267 Ga0068861_100029004 3300005719 Bacteria 4042
268 Ga0068861_100049835 3300005719 Bacteria 3172
269 Ga0068861_100057052 3300005719 Bacteria 2982
270 Ga0068870_10001431 3300005840 Bacteria 9645
271 Ga0068870_10002318 3300005840 Bacteria 7910
272 Ga0068870_10043749 3300005840 Bacteria 2337
273 Ga0068870_10121272 3300005840 Bacteria 1506
274 Ga0068863_100016752 3300005841 Bacteria 7031
275 Ga0068863_100025687 3300005841 Bacteria 5618
276 Ga0068863_100051180 3300005841 Bacteria 3915
277 Ga0068858_100010247 3300005842 Bacteria 8893
278 Ga0068858_100017836 3300005842 Bacteria 6647
279 Ga0068858_100026083 3300005842 Bacteria 5433
280 Ga0068858_100192934 3300005842 Bacteria 1925
281 Ga0068860_100002530 3300005843 Bacteria 19153
282 Ga0068860_100047790 3300005843 Bacteria 4078
283 Ga0068860_100070139 3300005843 Bacteria 3332
284 Ga0068860_100156188 3300005843 Bacteria 2198
285 Ga0068862_100006671 3300005844 Bacteria 9577
286 Ga0068862_100040884 3300005844 Bacteria 3943
287 Ga0068862_100135610 3300005844 Bacteria 2181
288 Ga0068862_100264977 3300005844 Bacteria 1570
289 Ga0081455_10000081 3300005937 Bacteria 103752
290 Ga0081455_10003729 3300005937 Bacteria 17413
291 Ga0081455_10005438 3300005937 Bacteria 13976
292 Ga0081455_10010814 3300005937 Bacteria 9222
293 Ga0081455_10033699 3300005937 Bacteria 4598
294 Ga0081538_10001580 3300005981 Bacteria 23375
295 Ga0081538_10010111 3300005981 Bacteria 7763
296 Ga0081538_10020370 3300005981 Bacteria 4883
297 Ga0081538_10021466 3300005981 Bacteria 4713
298 Ga0081540_1000027 3300005983 Bacteria 151880
299 Ga0081540_1002386 3300005983 Bacteria 15324
300 Ga0081540_1002765 3300005983 Bacteria 14238
301 Ga0081540_1003265 3300005983 Bacteria 12889
302 Ga0081540_1003527 3300005983 Bacteria 12331
303 Ga0081540_1005126 3300005983 Bacteria 9820
304 Ga0081540_1005516 3300005983 Bacteria 9433
305 Ga0081540_1010700 3300005983 Bacteria 6183
306 Ga0081540_1010849 3300005983 Bacteria 6124
307 Ga0081540_1020053 3300005983 Bacteria 4036
308 Ga0081540_1024836 3300005983 Bacteria 3467
309 Ga0081540_1026792 3300005983 Bacteria 3281
310 Ga0081539_10000306 3300005985 Bacteria 110402
311 Ga0081539_10001260 3300005985 Bacteria 44845
312 Ga0081539_10050522 3300005985 Bacteria 2352
313 Ga0070717_10000485 3300006028 Bacteria 25249
314 Ga0070717_10000980 3300006028 Bacteria 19102
315 Ga0070717_10023003 3300006028 Bacteria 4932
316 Ga0075365_10037037 3300006038 Bacteria 3165
317 Ga0075365_10051214 3300006038 Bacteria 2726
318 Ga0075365_10171024 3300006038 Bacteria 1516
319 Ga0075368_10011758 3300006042 Bacteria 3191
320 Ga0075368_10071075 3300006042 Bacteria 1405
321 Ga0075363_100004615 3300006048 Bacteria 6051
322 Ga0075363_100011319 3300006048 Bacteria 4268
323 Ga0075363_100041849 3300006048 Bacteria 2417
324 Ga0075364_10006344 3300006051 Bacteria 6948
325 Ga0075364_10074566 3300006051 Bacteria 2237
326 Ga0075432_10000954 3300006058 Bacteria 9136
327 Ga0070715_10000289 3300006163 Bacteria 12366
328 Ga0070715_10003295 3300006163 Bacteria 5105
329 Ga0070715_10032333 3300006163 Bacteria 2131
330 Ga0070715_10081041 3300006163 Bacteria 1473
331 Ga0070716_100004147 3300006173 Bacteria 6883
332 Ga0070716_100016874 3300006173 Bacteria 3776
333 Ga0070716_100047513 3300006173 Bacteria 2422
334 Ga0070712_100020910 3300006175 Bacteria 4289
335 Ga0070712_100030045 3300006175 Bacteria 3648
336 Ga0070712_100043123 3300006175 Bacteria 3104
337 Ga0070712_100044021 3300006175 Bacteria 3076
338 Ga0070712_100049815 3300006175 Bacteria 2910
339 Ga0075362_10044483 3300006177 Bacteria 1969
340 Ga0075367_10068408 3300006178 Bacteria 2130
341 Ga0075369_10001806 3300006186 Bacteria 7454
342 Ga0075369_10016448 3300006186 Bacteria 2985
343 Ga0075366_10028015 3300006195 Bacteria 3305
344 Ga0097621_100001425 3300006237 Bacteria 16408
345 Ga0097621_100010536 3300006237 Bacteria 6771
346 Ga0097621_100147348 3300006237 Bacteria 2016
347 Ga0075370_10001231 3300006353 Bacteria 10859
348 Ga0068871_100002394 3300006358 Bacteria 12790
349 Ga0068871_100022579 3300006358 Bacteria 4853
350 Ga0068871_100033578 3300006358 Bacteria 4065
351 Ga0068871_100036707 3300006358 Bacteria 3903
352 Ga0068871_100107955 3300006358 Bacteria 2338
353 Ga0068871_100191120 3300006358 Bacteria 1764
354 Ga0075428_100005241 3300006844 Bacteria 14417
355 Ga0075428_100005805 3300006844 Bacteria 13709
356 Ga0075428_100011791 3300006844 Bacteria 9730
357 Ga0075428_100057524 3300006844 Bacteria 4256
358 Ga0075428_100211000 3300006844 Bacteria 2098
359 Ga0075430_100000424 3300006846 Bacteria 31568
360 Ga0075430_100006792 3300006846 Bacteria 9643
361 Ga0075430_100010396 3300006846 Bacteria 7882
362 Ga0075430_100093633 3300006846 Bacteria 2512
363 Ga0075431_100000105 3300006847 Bacteria 53256
364 Ga0075431_100002258 3300006847 Bacteria 18482
365 Ga0075431_100033491 3300006847 Bacteria 5294
366 Ga0075431_100121846 3300006847 Bacteria 2691
367 Ga0075431_100178116 3300006847 Bacteria 2182
368 Ga0075431_100188585 3300006847 Bacteria 2113
369 Ga0075431_100275949 3300006847 Bacteria 1702
370 Ga0075433_10000012 3300006852 Bacteria 71065
371 Ga0075434_100000310 3300006871 Bacteria 34771
372 Ga0075434_100004560 3300006871 Bacteria 12511
373 Ga0075434_100043177 3300006871 Bacteria 4471
374 Ga0075434_100086930 3300006871 Bacteria 3127
375 Ga0075434_100112131 3300006871 Bacteria 2738
376 Ga0075434_100139878 3300006871 Bacteria 2440
377 Ga0075434_100198536 3300006871 Bacteria 2026
378 Ga0075434_100217751 3300006871 Bacteria 1929
379 Ga0075434_100339222 3300006871 Bacteria 1524
380 Ga0075429_100001610 3300006880 Bacteria 18632
381 Ga0075429_100005372 3300006880 Bacteria 11021
382 Ga0068865_100001097 3300006881 Bacteria 15622
383 Ga0068865_100052560 3300006881 Bacteria 2824
384 Ga0068865_100081222 3300006881 Bacteria 2327
385 Ga0068865_100134544 3300006881 Bacteria 1856
386 Ga0075436_100008403 3300006914 Bacteria 7059
387 Ga0097620_100006706 3300006931 Bacteria 11694
388 Ga0097620_100135019 3300006931 Bacteria 2540
389 Ga0097620_100155037 3300006931 Bacteria 2367
390 Ga0097620_100390819 3300006931 Bacteria 1487
391 Ga0099824_1002861 3300006942 Bacteria 25261
392 Ga0075435_100002697 3300007076 Bacteria 11855
393 Ga0075435_100087604 3300007076 Bacteria 2565
394 Ga0075435_100114450 3300007076 Bacteria 2245
395 Ga0099794_10024802 3300007265 Bacteria 2756
396 Ga0099794_10031739 3300007265 Bacteria 2475
397 Ga0105244_10023607 3300009036 Bacteria 3369
398 Ga0105240_10175140 3300009093 Bacteria 2537
399 Ga0105240_10202808 3300009093 Bacteria 2323
400 Ga0111539_10000792 3300009094 Bacteria 41176
401 Ga0111539_10000842 3300009094 Bacteria 39938
402 Ga0111539_10014117 3300009094 Bacteria 9982
403 Ga0111539_10034470 3300009094 Bacteria 6137
404 Ga0105245_10025559 3300009098 Bacteria 5194
405 Ga0105245_10029815 3300009098 Bacteria 4823
406 Ga0105245_10099722 3300009098 Bacteria 2686
407 Ga0105245_10183751 3300009098 Bacteria 1999
408 Ga0105247_10024258 3300009101 Bacteria 3653
409 Ga0105247_10025129 3300009101 Bacteria 3594
410 Ga0105247_10033339 3300009101 Bacteria 3132
411 Ga0105247_10041196 3300009101 Bacteria 2825
412 Ga0114129_10000803 3300009147 Bacteria 40282
413 Ga0114129_10001669 3300009147 Bacteria 30222
414 Ga0114129_10003927 3300009147 Bacteria 20989
415 Ga0114129_10006740 3300009147 Bacteria 16309
416 Ga0114129_10006854 3300009147 Bacteria 16194
417 Ga0114129_10027094 3300009147 Bacteria 8115
418 Ga0114129_10071921 3300009147 Bacteria 4822
419 Ga0105243_10002400 3300009148 Bacteria 15707
420 Ga0105243_10004402 3300009148 Bacteria 11139
421 Ga0105243_10035105 3300009148 Bacteria 3886
422 Ga0105243_10047415 3300009148 Bacteria 3382
423 Ga0105243_10087524 3300009148 Bacteria 2557
424 Ga0105243_10094329 3300009148 Bacteria 2471
425 Ga0105241_10008636 3300009174 Bacteria 7488
426 Ga0105241_10010427 3300009174 Bacteria 6819
427 Ga0105241_10028300 3300009174 Bacteria 4176
428 Ga0105241_10090184 3300009174 Bacteria 2417
429 Ga0105241_10100074 3300009174 Bacteria 2303
430 Ga0105241_10260979 3300009174 Bacteria 1472
431 Ga0105242_10007578 3300009176 Bacteria 8356
432 Ga0105242_10008734 3300009176 Bacteria 7775
433 Ga0105242_10025583 3300009176 Bacteria 4672
434 Ga0105248_10010839 3300009177 Bacteria 10064
435 Ga0105248_10014218 3300009177 Bacteria 8762
436 Ga0105248_10059364 3300009177 Bacteria 4296
437 Ga0105248_10062156 3300009177 Bacteria 4194
438 Ga0105248_10081366 3300009177 Bacteria 3640
439 Ga0105237_10030610 3300009545 Bacteria 5465
440 Ga0105237_10032300 3300009545 Bacteria 5300
441 Ga0105237_10121260 3300009545 Bacteria 2609
442 Ga0105238_10009678 3300009551 Bacteria 9647
443 Ga0105238_10066536 3300009551 Bacteria 3605
444 Ga0105238_10099304 3300009551 Bacteria 2894
445 Ga0105238_10115780 3300009551 Bacteria 2660
446 Ga0105249_10011450 3300009553 Bacteria 7790
447 Ga0105249_10153117 3300009553 Bacteria 2222
448 Ga0105249_10160851 3300009553 Bacteria 2170
449 Ga0099796_10011799 3300010159 Bacteria 2450
450 Ga0105239_10024088 3300010375 Bacteria 6704
451 Ga0105239_10040214 3300010375 Bacteria 5123
452 Ga0105239_10346225 3300010375 Bacteria 1678
453 Ga0105246_10051104 3300011119 Bacteria 2837
454 Ga0105246_10071651 3300011119 Bacteria 2441
455 Ga0105246_10110265 3300011119 Bacteria 2021
456 Ga0157342_1000436 3300012507 Bacteria 2516
457 Ga0157373_10110086 3300013100 Bacteria 1936
458 Ga0157371_10195899 3300013102 Bacteria 1447
459 Ga0157370_10035641 3300013104 Bacteria 4833
460 Ga0157370_10193977 3300013104 Bacteria 1885
461 Ga0157369_10281738 3300013105 Bacteria 1731
462 Ga0157374_10001167 3300013296 Bacteria 22404
463 Ga0157374_10003779 3300013296 Bacteria 12738
464 Ga0157374_10027828 3300013296 Bacteria 5103
465 Ga0157378_10008023 3300013297 Bacteria 9217
466 Ga0163162_10010853 3300013306 Bacteria 8866
467 Ga0163162_10051562 3300013306 Bacteria 4129
468 Ga0163162_10139260 3300013306 Bacteria 2539
469 Ga0163162_10293571 3300013306 Bacteria 1757
470 Ga0163162_10671224 3300013306 Bacteria 1159
471 Ga0157372_10141014 3300013307 Bacteria 2776
472 Ga0157372_10279647 3300013307 Bacteria 1940
473 Ga0163163_10007288 3300014325 Bacteria 9756
474 Ga0163163_10007753 3300014325 Bacteria 9488
475 Ga0163163_10109647 3300014325 Bacteria 2788
476 Ga0157380_10001551 3300014326 Bacteria 15111
477 Ga0157380_10093514 3300014326 Bacteria 2486
478 Ga0157380_10231041 3300014326 Bacteria 1661
479 Ga0157377_10009300 3300014745 Bacteria 4814
480 Ga0157379_10036937 3300014968 Bacteria 4356
481 Ga0157376_10012121 3300014969 Bacteria 6386
482 Ga0157376_10059766 3300014969 Bacteria 3197
483 Ga0157376_10065769 3300014969 Bacteria 3063
484 Ga0157376_10093163 3300014969 Bacteria 2615
485 Ga0163161_10011103 3300017792 Bacteria 6240
486 Ga0163161_10086928 3300017792 Bacteria 2308
487 Ga0163161_10166223 3300017792 Bacteria 1685
488 Ga0206356_11037165 3300020070 Bacteria 2624
489 Ga0206350_10300830 3300020080 Bacteria 1629
490 Ga0206354_10798601 3300020081 Bacteria 4257
491 Ga0206353_11208914 3300020082 Bacteria 5004
492 Ga0213874_10003167 3300021377 Bacteria 3626
493 Ga0213876_10000514 3300021384 Bacteria 29913
494 Ga0213876_10004037 3300021384 Bacteria 8258
495 Ga0213875_10000122 3300021388 Bacteria 87195
496 Ga0213875_10002043 3300021388 Bacteria 12397
497 Ga0213875_10047189 3300021388 Bacteria 2021
498 Ga0213875_10049374 3300021388 Bacteria 1972
499 Ga0224712_10047026 3300022467 Bacteria 1659
500 Ga0224572_1020299 3300024225 Bacteria 1276
501 Ga0228598_1010870 3300024227 Bacteria 1813
502 Ga0207666_1000153 3300025271 Bacteria 10663
503 Ga0207666_1005029 3300025271 Bacteria 1679
504 Ga0207673_1000206 3300025290 Bacteria 5940
505 Ga0209758_1007275 3300025297 Bacteria 7604
506 Ga0207697_10001059 3300025315 Bacteria 15198
507 Ga0207653_10009860 3300025885 Bacteria 2978
508 Ga0207653_10017060 3300025885 Bacteria 2283
509 Ga0207682_10002553 3300025893 Bacteria 8126
510 Ga0207682_10033509 3300025893 Bacteria 2069
511 Ga0207692_10000282 3300025898 Bacteria 17493
512 Ga0207642_10016582 3300025899 Bacteria 2779
513 Ga0207642_10034683 3300025899 Bacteria 2148
514 Ga0207710_10000382 3300025900 Bacteria 30360
515 Ga0207688_10001640 3300025901 Bacteria 11816
516 Ga0207688_10015245 3300025901 Bacteria 4171
517 Ga0207680_10008936 3300025903 Bacteria 4943
518 Ga0207680_10010916 3300025903 Bacteria 4566
519 Ga0207680_10018703 3300025903 Bacteria 3690
520 Ga0207680_10052411 3300025903 Bacteria 2445
521 Ga0207647_10009706 3300025904 Bacteria 6828
522 Ga0207647_10009987 3300025904 Bacteria 6722
523 Ga0207647_10012209 3300025904 Bacteria 5988
524 Ga0207685_10000164 3300025905 Bacteria 10037
525 Ga0207685_10005449 3300025905 Bacteria 3361
526 Ga0207685_10041022 3300025905 Bacteria 1729
527 Ga0207685_10068246 3300025905 Bacteria 1432
528 Ga0207699_10004201 3300025906 Bacteria 6891
529 Ga0207699_10006008 3300025906 Bacteria 5843
530 Ga0207699_10067023 3300025906 Bacteria 2181
531 Ga0207699_10081032 3300025906 Bacteria 2012
532 Ga0207645_10002745 3300025907 Bacteria 13711
533 Ga0207645_10063850 3300025907 Bacteria 2353
534 Ga0207645_10077131 3300025907 Bacteria 2135
535 Ga0207643_10000004 3300025908 Bacteria 187006
536 Ga0207643_10001769 3300025908 Bacteria 12048
537 Ga0207643_10176573 3300025908 Bacteria 1291
538 Ga0207643_10196526 3300025908 Bacteria 1226
539 Ga0207705_10073895 3300025909 Bacteria 2474
540 Ga0207705_10217915 3300025909 Bacteria 1449
541 Ga0207684_10009569 3300025910 Bacteria 8549
542 Ga0207654_10008032 3300025911 Bacteria 5318
543 Ga0207654_10173227 3300025911 Bacteria 1403
544 Ga0207707_10011019 3300025912 Bacteria 7866
545 Ga0207707_10014644 3300025912 Bacteria 6833
546 Ga0207707_10016719 3300025912 Bacteria 6393
547 Ga0207707_10336335 3300025912 Bacteria 1302
548 Ga0207695_10086365 3300025913 Bacteria 3164
549 Ga0207671_10082682 3300025914 Bacteria 2410
550 Ga0207671_10087943 3300025914 Bacteria 2337
551 Ga0207671_10088536 3300025914 Bacteria 2329
552 Ga0207671_10129201 3300025914 Bacteria 1938
553 Ga0207671_10154096 3300025914 Bacteria 1777
554 Ga0207671_10168615 3300025914 Bacteria 1699
555 Ga0207693_10001038 3300025915 Bacteria 24865
556 Ga0207693_10005387 3300025915 Bacteria 10692
557 Ga0207693_10016176 3300025915 Bacteria 5966
558 Ga0207693_10034641 3300025915 Bacteria 3983
559 Ga0207693_10084937 3300025915 Bacteria 2480
560 Ga0207693_10201344 3300025915 Bacteria 1566
561 Ga0207663_10004587 3300025916 Bacteria 6885
562 Ga0207663_10026312 3300025916 Bacteria 3375
563 Ga0207663_10092326 3300025916 Bacteria 2012
564 Ga0207663_10328751 3300025916 Bacteria 1151
565 Ga0207660_10007217 3300025917 Bacteria 7193
566 Ga0207660_10009992 3300025917 Bacteria 6148
567 Ga0207660_10020495 3300025917 Bacteria 4437
568 Ga0207660_10124432 3300025917 Bacteria 1957
569 Ga0207662_10000392 3300025918 Bacteria 19588
570 Ga0207662_10001199 3300025918 Bacteria 12365
571 Ga0207662_10026540 3300025918 Bacteria 3341
572 Ga0207657_10002007 3300025919 Bacteria 22003
573 Ga0207657_10007818 3300025919 Bacteria 10913
574 Ga0207657_10012563 3300025919 Bacteria 8349
575 Ga0207657_10017247 3300025919 Bacteria 6932
576 Ga0207657_10038806 3300025919 Bacteria 4236
577 Ga0207657_10039060 3300025919 Bacteria 4220
578 Ga0207657_10043860 3300025919 Bacteria 3936
579 Ga0207657_10050813 3300025919 Bacteria 3605
580 Ga0207649_10005404 3300025920 Bacteria 6918
581 Ga0207652_10014772 3300025921 Bacteria 6329
582 Ga0207652_10053069 3300025921 Bacteria 3482
583 Ga0207652_10058342 3300025921 Bacteria 3326
584 Ga0207652_10059011 3300025921 Bacteria 3307
585 Ga0207652_10059737 3300025921 Bacteria 3287
586 Ga0207652_10113505 3300025921 Bacteria 2405
587 Ga0207652_10133288 3300025921 Bacteria 2217
588 Ga0207652_10295507 3300025921 Bacteria 1462
589 Ga0207646_10258077 3300025922 Bacteria 1575
590 Ga0207681_10024530 3300025923 Bacteria 3871
591 Ga0207681_10025222 3300025923 Bacteria 3822
592 Ga0207681_10149905 3300025923 Bacteria 1746
593 Ga0207694_10082893 3300025924 Bacteria 2521
594 Ga0207694_10110698 3300025924 Bacteria 2185
595 Ga0207650_10004542 3300025925 Bacteria 9492
596 Ga0207650_10064045 3300025925 Bacteria 2751
597 Ga0207650_10143039 3300025925 Bacteria 1882
598 Ga0207659_10000374 3300025926 Bacteria 26976
599 Ga0207659_10066883 3300025926 Bacteria 2609
600 Ga0207687_10005411 3300025927 Bacteria 8442
601 Ga0207687_10009764 3300025927 Bacteria 6279
602 Ga0207687_10016412 3300025927 Bacteria 4864
603 Ga0207687_10041692 3300025927 Bacteria 3153
604 Ga0207687_10092929 3300025927 Bacteria 2204
605 Ga0207700_10003347 3300025928 Bacteria 9298
606 Ga0207700_10015515 3300025928 Bacteria 5028
607 Ga0207700_10037965 3300025928 Bacteria 3493
608 Ga0207700_10122533 3300025928 Bacteria 2110
609 Ga0207700_10143551 3300025928 Bacteria 1964
610 Ga0207700_10161996 3300025928 Bacteria 1858
611 Ga0207700_10196238 3300025928 Bacteria 1699
612 Ga0207664_10009763 3300025929 Bacteria 6751
613 Ga0207664_10023358 3300025929 Bacteria 4631
614 Ga0207664_10033414 3300025929 Bacteria 3951
615 Ga0207664_10067954 3300025929 Bacteria 2861
616 Ga0207664_10106776 3300025929 Bacteria 2322
617 Ga0207664_10108798 3300025929 Bacteria 2302
618 Ga0207664_10187014 3300025929 Bacteria 1781
619 Ga0207664_10202086 3300025929 Bacteria 1716
620 Ga0207644_10003380 3300025931 Bacteria 10298
621 Ga0207644_10004888 3300025931 Bacteria 8732
622 Ga0207644_10055390 3300025931 Bacteria 2858
623 Ga0207690_10010819 3300025932 Bacteria 5436
624 Ga0207690_10013825 3300025932 Bacteria 4862
625 Ga0207690_10180370 3300025932 Bacteria 1589
626 Ga0207690_10218354 3300025932 Bacteria 1457
627 Ga0207706_10002819 3300025933 Bacteria 16867
628 Ga0207706_10006974 3300025933 Bacteria 10444
629 Ga0207706_10010623 3300025933 Bacteria 8409
630 Ga0207706_10022546 3300025933 Bacteria 5651
631 Ga0207706_10041500 3300025933 Bacteria 4079
632 Ga0207706_10341120 3300025933 Bacteria 1303
633 Ga0207686_10007542 3300025934 Bacteria 5858
634 Ga0207686_10020413 3300025934 Bacteria 3785
635 Ga0207686_10025932 3300025934 Bacteria 3416
636 Ga0207686_10151512 3300025934 Bacteria 1615
637 Ga0207709_10003882 3300025935 Bacteria 8742
638 Ga0207709_10014845 3300025935 Bacteria 4308
639 Ga0207709_10071979 3300025935 Bacteria 2197
640 Ga0207709_10091098 3300025935 Bacteria 1993
641 Ga0207709_10100149 3300025935 Bacteria 1914
642 Ga0207670_10001845 3300025936 Bacteria 11059
643 Ga0207670_10004902 3300025936 Bacteria 7280
644 Ga0207670_10067403 3300025936 Bacteria 2462
645 Ga0207669_10022356 3300025937 Bacteria 3358
646 Ga0207669_10051158 3300025937 Bacteria 2473
647 Ga0207669_10092832 3300025937 Bacteria 1970
648 Ga0207669_10135589 3300025937 Bacteria 1699
649 Ga0207704_10002620 3300025938 Bacteria 8124
650 Ga0207704_10005816 3300025938 Bacteria 5705
651 Ga0207704_10265795 3300025938 Bacteria 1296
652 Ga0207665_10000541 3300025939 Bacteria 25458
653 Ga0207665_10007581 3300025939 Bacteria 7171
654 Ga0207665_10017261 3300025939 Bacteria 4742
655 Ga0207665_10055563 3300025939 Bacteria 2671
656 Ga0207691_10004396 3300025940 Bacteria 13666
657 Ga0207691_10009932 3300025940 Bacteria 9139
658 Ga0207691_10041812 3300025940 Bacteria 4228
659 Ga0207691_10314525 3300025940 Bacteria 1343
660 Ga0207711_10002645 3300025941 Bacteria 15844
661 Ga0207711_10005696 3300025941 Bacteria 10522
662 Ga0207711_10035642 3300025941 Bacteria 4219
663 Ga0207711_10145854 3300025941 Bacteria 2132
664 Ga0207711_10170653 3300025941 Bacteria 1974
665 Ga0207711_10232888 3300025941 Bacteria 1687
666 Ga0207711_10362901 3300025941 Bacteria 1342
667 Ga0207689_10002724 3300025942 Bacteria 16345
668 Ga0207689_10004730 3300025942 Bacteria 12274
669 Ga0207661_10015256 3300025944 Bacteria 5649
670 Ga0207661_10054406 3300025944 Bacteria 3206
671 Ga0207679_10001617 3300025945 Bacteria 14034
672 Ga0207679_10053172 3300025945 Bacteria 2974
673 Ga0207679_10141139 3300025945 Bacteria 1947
674 Ga0207667_10071955 3300025949 Bacteria 3594
675 Ga0207667_10321136 3300025949 Bacteria 1581
676 Ga0207667_10497494 3300025949 Bacteria 1237
677 Ga0207651_10003064 3300025960 Bacteria 8113
678 Ga0207651_10004195 3300025960 Bacteria 7218
679 Ga0207651_10016908 3300025960 Bacteria 4292
680 Ga0207651_10045351 3300025960 Bacteria 2948
681 Ga0207712_10003120 3300025961 Bacteria 10571
682 Ga0207712_10102162 3300025961 Bacteria 2134
683 Ga0207668_10005763 3300025972 Bacteria 7301
684 Ga0207668_10124678 3300025972 Bacteria 1956
685 Ga0207668_10182291 3300025972 Bacteria 1657
686 Ga0207668_10195487 3300025972 Bacteria 1607
687 Ga0207640_10015642 3300025981 Bacteria 4396
688 Ga0207640_10021910 3300025981 Bacteria 3816
689 Ga0207640_10146331 3300025981 Bacteria 1729
690 Ga0207640_10183600 3300025981 Bacteria 1570
691 Ga0207658_10014919 3300025986 Bacteria 5325
692 Ga0207658_10035286 3300025986 Bacteria 3580
693 Ga0207658_10082393 3300025986 Bacteria 2470
694 Ga0207658_10103806 3300025986 Bacteria 2232
695 Ga0207658_10264958 3300025986 Bacteria 1466
696 Ga0207677_10006418 3300026023 Bacteria 6450
697 Ga0207677_10016744 3300026023 Bacteria 4351
698 Ga0207677_10028083 3300026023 Bacteria 3554
699 Ga0207677_10064470 3300026023 Bacteria 2552
700 Ga0207703_10001822 3300026035 Bacteria 19007
701 Ga0207703_10021203 3300026035 Bacteria 5086
702 Ga0207703_10041983 3300026035 Bacteria 3666
703 Ga0207703_10126942 3300026035 Bacteria 2197
704 Ga0207639_10019446 3300026041 Bacteria 4844
705 Ga0207639_10023621 3300026041 Bacteria 4440
706 Ga0207639_10058770 3300026041 Bacteria 2959
707 Ga0207678_10000414 3300026067 Bacteria 38612
708 Ga0207678_10002471 3300026067 Bacteria 16791
709 Ga0207678_10019865 3300026067 Bacteria 5905
710 Ga0207678_10020641 3300026067 Bacteria 5775
711 Ga0207678_10035698 3300026067 Bacteria 4328
712 Ga0207678_10041442 3300026067 Bacteria 3993
713 Ga0207678_10092328 3300026067 Bacteria 2588
714 Ga0207708_10001992 3300026075 Bacteria 15035
715 Ga0207708_10002001 3300026075 Bacteria 15007
716 Ga0207708_10006744 3300026075 Bacteria 8497
717 Ga0207708_10038352 3300026075 Bacteria 3650
718 Ga0207702_10021444 3300026078 Bacteria 5349
719 Ga0207702_10039899 3300026078 Bacteria 3936
720 Ga0207702_10041530 3300026078 Bacteria 3857
721 Ga0207702_10067064 3300026078 Bacteria 3079
722 Ga0207702_10294721 3300026078 Bacteria 1538
723 Ga0207641_10009850 3300026088 Bacteria 7868
724 Ga0207641_10015249 3300026088 Bacteria 6297
725 Ga0207641_10019509 3300026088 Bacteria 5565
726 Ga0207648_10004767 3300026089 Bacteria 13850
727 Ga0207648_10010273 3300026089 Bacteria 8889
728 Ga0207648_10174941 3300026089 Bacteria 1898
729 Ga0207676_10001979 3300026095 Bacteria 14919
730 Ga0207676_10002246 3300026095 Bacteria 13878
731 Ga0207676_10013708 3300026095 Bacteria 5821
732 Ga0207676_10050786 3300026095 Bacteria 3235
733 Ga0207674_10007733 3300026116 Bacteria 12510
734 Ga0207674_10416934 3300026116 Bacteria 1297
735 Ga0207675_100003883 3300026118 Bacteria 14527
736 Ga0207675_100007986 3300026118 Bacteria 9973
737 Ga0207675_100057031 3300026118 Bacteria 3644
738 Ga0207683_10002044 3300026121 Bacteria 17862
739 Ga0207683_10009279 3300026121 Bacteria 8382
740 Ga0207683_10016334 3300026121 Bacteria 6319
741 Ga0207698_10031944 3300026142 Bacteria 3808
742 Ga0207698_10186189 3300026142 Bacteria 1844
743 Ga0209967_1003782 3300027364 Bacteria 1998
744 Ga0209179_1029109 3300027512 Bacteria 1122
745 Ga0209983_1007836 3300027665 Bacteria 2185
746 Ga0209971_1002807 3300027682 Bacteria 4163
747 Ga0209966_1001490 3300027695 Bacteria 4070
748 Ga0209998_10000888 3300027717 Bacteria 7667
749 Ga0209998_10001985 3300027717 Bacteria 4800
750 Ga0207428_10000137 3300027907 Bacteria 98535
751 Ga0207428_10000501 3300027907 Bacteria 46798
752 Ga0207428_10001016 3300027907 Bacteria 31079
753 Ga0207428_10006625 3300027907 Bacteria 10652
754 Ga0207428_10143993 3300027907 Bacteria 1817
755 Ga0207428_10165874 3300027907 Bacteria 1675
756 Ga0265357_1000343 3300028023 Bacteria 2536
757 Ga0268266_10000446 3300028379 Bacteria 61283
758 Ga0268266_10000670 3300028379 Bacteria 46181
759 Ga0268266_10001262 3300028379 Bacteria 30924
760 Ga0268266_10012528 3300028379 Bacteria 7328
761 Ga0268266_10029942 3300028379 Bacteria 4626
762 Ga0268266_10050610 3300028379 Bacteria 3565
763 Ga0268266_10157018 3300028379 Bacteria 2056
764 Ga0268265_10014556 3300028380 Bacteria 5361
765 Ga0268265_10022589 3300028380 Bacteria 4422
766 Ga0268265_10055116 3300028380 Bacteria 3019
767 Ga0268265_10072977 3300028380 Bacteria 2678
768 Ga0268264_10041889 3300028381 Bacteria 3788
769 Ga0268264_10112900 3300028381 Bacteria 2383
770 Ga0265337_1004042 3300028556 Bacteria 6193
771 Ga0265337_1026650 3300028556 Bacteria 1749
772 Ga0265318_10007102 3300028577 Bacteria 5094
773 Ga0307517_10000512 3300028786 Bacteria 66501
774 Ga0307517_10130606 3300028786 Bacteria 1810
775 Ga0265338_10065426 3300028800 Bacteria 3154
776 Ga0265338_10263042 3300028800 Bacteria 1267
777 Ga0265770_1006025 3300030878 Bacteria 1679
778 Ga0265760_10022505 3300031090 Bacteria 1826
779 Ga0265330_10015179 3300031235 Bacteria 3566
780 Ga0265332_10000839 3300031238 Bacteria 18678
781 Ga0265332_10067620 3300031238 Bacteria 1523
782 Ga0265328_10017174 3300031239 Bacteria 2805
783 Ga0265320_10006407 3300031240 Bacteria 7422
784 Ga0265325_10000073 3300031241 Bacteria 70109
785 Ga0265325_10001135 3300031241 Bacteria 19104
786 Ga0265325_10011811 3300031241 Bacteria 5010
787 Ga0265325_10030916 3300031241 Bacteria 2869
788 Ga0265329_10008929 3300031242 Bacteria 3772
789 Ga0265340_10000382 3300031247 Bacteria 23632
790 Ga0265340_10020821 3300031247 Bacteria 3365
791 Ga0265339_10001051 3300031249 Bacteria 20994
792 Ga0265339_10003487 3300031249 Bacteria 10996
793 Ga0265339_10043806 3300031249 Bacteria 2472
794 Ga0265339_10068642 3300031249 Bacteria 1893
795 Ga0265331_10015018 3300031250 Bacteria 4104
796 Ga0265331_10034057 3300031250 Bacteria 2515
797 Ga0265331_10038656 3300031250 Bacteria 2331
798 Ga0265316_10105375 3300031344 Bacteria 2139
799 Ga0265316_10123065 3300031344 Bacteria 1958
800 Ga0265313_10000716 3300031595 Bacteria 34149
801 Ga0265313_10038079 3300031595 Bacteria 2398
802 Ga0265313_10046363 3300031595 Bacteria 2110
803 Ga0265314_10002492 3300031711 Bacteria 18802
804 Ga0265314_10044370 3300031711 Bacteria 3152
805 Ga0265342_10000179 3300031712 Bacteria 70615
806 Ga0265342_10000308 3300031712 Bacteria 55378
807 Ga0265342_10007369 3300031712 Bacteria 8067
808 Ga0265342_10011726 3300031712 Bacteria 5980
809 Ga0265342_10030537 3300031712 Bacteria 3338
810 Ga0307516_10078953 3300031730 Bacteria 3136
811 Ga0307405_10283945 3300031731 Bacteria 1247
812 Ga0307409_100037914 3300031995 Bacteria 3558
813 Ga0307416_100224479 3300032002 Bacteria 1805
814 Ga0307415_100082198 3300032126 Bacteria 2304
815 Ga0307415_100327245 3300032126 Bacteria 1280
816 Ga0307510_10009215 3300033180 Bacteria 11759
817 Ga0307510_10009742 3300033180 Bacteria 11434
818 Ga0373948_0002227 3300034817 Bacteria 2832
819 Ga0373948_0015021 3300034817 Bacteria 1417
820 Ga0373950_0000796 3300034818 Bacteria 3944
821 Ga0373958_0000398 3300034819 Bacteria 5260
822 Ga0373958_0009846 3300034819 Bacteria 1582
823 Ga0373959_0009242 3300034820 Bacteria 1695
824 Ga0373938_0000726 3300034957 Bacteria 5330
825 Ga0373938_0002589 3300034957 Bacteria 2917
826 Ga0373926_0002344 3300035083 Bacteria 5996
827 Ga0373926_0009236 3300035083 Bacteria 3291
828 Ga0373926_0050832 3300035083 Bacteria 1494
829 Ga0373928_0000779 3300035084 Bacteria 6200
830 Ga0373928_0001267 3300035084 Bacteria 4972
831 Ga0373929_0000064 3300035085 Bacteria 18387
832 Ga0373929_0020662 3300035085 Bacteria 1329
833 Ga0373934_0007860 3300035086 Bacteria 3966
834 Ga0373934_0020314 3300035086 Bacteria 2552
835 Ga0373940_0000195 3300035088 Bacteria 8348
836 Ga0373944_0000648 3300035089 Bacteria 8271
837 Ga0373944_0001561 3300035089 Bacteria 5790
838 Ga0373944_0013726 3300035089 Bacteria 2252
839 Ga0373949_0000532 3300035090 Bacteria 12548
840 Ga0373949_0001783 3300035090 Bacteria 5906
841 Ga0373949_0005307 3300035090 Bacteria 2881
842 Ga0373951_0000849 3300035091 Bacteria 8284
843 Ga0373951_0009362 3300035091 Bacteria 2207
844 Ga0373952_0000213 3300035092 Bacteria 9154
845 Ga0373952_0004534 3300035092 Bacteria 2521
846 Ga0373952_0009378 3300035092 Bacteria 1872
847 Ga0373923_0000903 3300035111 Bacteria 7919
848 Ga0373923_0001215 3300035111 Bacteria 7223
849 Ga0373923_0004217 3300035111 Bacteria 4747
850 Ga0373923_0031169 3300035111 Bacteria 2148
851 Ga0373932_0002875 3300035112 Bacteria 4252
852 Ga0373932_0003090 3300035112 Bacteria 4057
853 Ga0373936_0001539 3300035113 Bacteria 8398
854 Ga0373936_0003882 3300035113 Bacteria 5634
855 Ga0373936_0010131 3300035113 Bacteria 3559
856 Ga0373939_0000619 3300035114 Bacteria 8812
857 Ga0373939_0007187 3300035114 Bacteria 2701
858 Ga0373939_0022601 3300035114 Bacteria 1734
859 Ga0373941_0000027 3300035115 Bacteria 22089
860 Ga0373941_0001078 3300035115 Bacteria 5676
861 Ga0373945_0000024 3300035116 Bacteria 30607
862 Ga0373945_0007150 3300035116 Bacteria 3614
863 Ga0373953_0002197 3300035117 Bacteria 5844
864 Ga0373953_0003448 3300035117 Bacteria 4928
865 Ga0373953_0012954 3300035117 Bacteria 2967
866 Ga0373953_0054980 3300035117 Bacteria 1615
867 Ga0373953_0072680 3300035117 Bacteria 1421
868 Ga0373954_0004597 3300035118 Bacteria 5947
869 Ga0373954_0004676 3300035118 Bacteria 5902
870 Ga0373954_0005155 3300035118 Bacteria 5642
871 Ga0373954_0021313 3300035118 Bacteria 2933
872 Ga0373954_0031272 3300035118 Bacteria 2457
873 Ga0373956_0001142 3300035119 Bacteria 10971
874 Ga0373956_0012890 3300035119 Bacteria 3472
875 Ga0373956_0020290 3300035119 Bacteria 2826
876 Ga0373956_0048050 3300035119 Bacteria 1910
877 Ga0373957_0004186 3300035120 Bacteria 4365
878 Ga0373957_0066681 3300035120 Bacteria 1402
879 Ga0373960_0000904 3300035121 Bacteria 6305
880 Ga0373960_0002618 3300035121 Bacteria 4069
881 Ga0373943_0013643 3300035170 Bacteria 3673
882 Ga0373943_0034830 3300035170 Bacteria 2403
883 Ga0373943_0042435 3300035170 Bacteria 2205
884 Ga0373943_0058552 3300035170 Bacteria 1918
885 Ga0373943_0087942 3300035170 Bacteria 1604
886 Ga0373943_0111838 3300035170 Bacteria 1441
887 Ga0373946_0005953 3300035171 Bacteria 4419
888 Ga0373946_0014935 3300035171 Bacteria 2936
889 Ga0373946_0015890 3300035171 Bacteria 2861
890 Ga0373946_0030578 3300035171 Bacteria 2150
891 Ga0373946_0044776 3300035171 Bacteria 1828
892 Ga0373946_0051134 3300035171 Bacteria 1728
893 Ga0373955_0000172 3300035172 Bacteria 26530
894 Ga0373955_0001767 3300035172 Bacteria 9270
895 Ga0373955_0003013 3300035172 Bacteria 7382
896 Ga0373955_0010601 3300035172 Bacteria 4359
897 Ga0373955_0023058 3300035172 Bacteria 3166
898 Ga0373955_0174344 3300035172 Bacteria 1274
899 Ga0373942_0000012 3300035207 Bacteria 34288
900 Ga0373942_0002310 3300035207 Bacteria 4661
901 Ga0373961_0000800 3300035241 Bacteria 10745
902 Ga0373961_0003565 3300035241 Bacteria 3831
903 Ga0373961_0006335 3300035241 Bacteria 2845
904 Ga0373961_0022769 3300035241 Bacteria 1679
905 Ga0373962_0000193 3300035242 Bacteria 12928
906 Ga0373962_0003472 3300035242 Bacteria 3785
907 Ga0373962_0011022 3300035242 Bacteria 2261
908 Ga0316574_0151975 3300035398 Bacteria 1492
909 Ga0373924_0001803 3300035410 Bacteria 7079
910 Ga0373924_0006937 3300035410 Bacteria 4077
911 Ga0373924_0045414 3300035410 Bacteria 1807
912 Ga0373931_0007554 3300035691 Bacteria 5120
913 Ga0373931_0008043 3300035691 Bacteria 4989
914 Ga0373931_0015883 3300035691 Bacteria 3697
915 Ga0373931_0035730 3300035691 Bacteria 2585
916 Ga0373931_0041914 3300035691 Bacteria 2406
917 Ga0373931_0066399 3300035691 Bacteria 1957
918 Ga0373931_0078912 3300035691 Bacteria 1812
919 Ga0373931_0096327 3300035691 Bacteria 1657
920 Ga0373931_0150578 3300035691 Bacteria 1356
921 Ga0373935_0000038 3300035692 Bacteria 51446
922 Ga0373935_0008124 3300035692 Bacteria 6291
923 Ga0373935_0008653 3300035692 Bacteria 6095
924 Ga0373935_0031453 3300035692 Bacteria 3294
925 Ga0373935_0044826 3300035692 Bacteria 2789
926 Ga0373935_0110469 3300035692 Bacteria 1824
927 Ga0373935_0165642 3300035692 Bacteria 1509
928 Ga0373927_0001618 3300035695 Bacteria 16878
929 Ga0373927_0003867 3300035695 Bacteria 10616
930 Ga0373927_0004343 3300035695 Bacteria 9943
931 Ga0373927_0017582 3300035695 Bacteria 4705
932 Ga0373927_0059755 3300035695 Bacteria 2466
933 Ga0373927_0098966 3300035695 Bacteria 1896
934 Ga0373927_0102646 3300035695 Bacteria 1860
935 Ga0373927_0119317 3300035695 Bacteria 1721
936 Ga0373927_0155327 3300035695 Bacteria 1498
937 Ga0373927_0246921 3300035695 Bacteria 1173
938 Ga0373933_0001050 3300035724 Bacteria 16724
939 Ga0373933_0009485 3300035724 Bacteria 5315
940 Ga0373933_0019818 3300035724 Bacteria 3806
941 Ga0373933_0043041 3300035724 Bacteria 2670
942 Ga0373933_0070438 3300035724 Bacteria 2127
943 Ga0373947_0000229 3300035725 Bacteria 31423
944 Ga0373947_0000581 3300035725 Bacteria 21444
945 Ga0373947_0001717 3300035725 Bacteria 13399
946 Ga0373947_0012283 3300035725 Bacteria 4906
947 Ga0373947_0014863 3300035725 Bacteria 4467
948 Ga0373947_0037899 3300035725 Bacteria 2861
949 Ga0373947_0042744 3300035725 Bacteria 2705
950 Ga0373947_0137024 3300035725 Bacteria 1567
951 Ga0373937_0000004 3300036401 Bacteria 212269
952 Ga0373937_0001194 3300036401 Bacteria 21805
953 Ga0373937_0004490 3300036401 Bacteria 11855
954 Ga0373937_0013915 3300036401 Bacteria 7093
955 Ga0373937_0051666 3300036401 Bacteria 3767
956 Ga0373937_0173638 3300036401 Bacteria 2022
957 Ga0373925_0000424 3300037068 Bacteria 42803
958 Ga0373925_0006642 3300037068 Bacteria 8493
959 Ga0373925_0011259 3300037068 Bacteria 6488
960 Ga0373925_0011691 3300037068 Bacteria 6348
961 Ga0373925_0029290 3300037068 Bacteria 4039
962 Ga0373925_0042290 3300037068 Bacteria 3380
963 Ga0373925_0094879 3300037068 Bacteria 2284
964 Ga0373925_0126885 3300037068 Bacteria 1986
965 Ga0373925_0162556 3300037068 Bacteria 1759
966 Ga0373925_0172627 3300037068 Bacteria 1707
967 Ga0373925_0317423 3300037068 Bacteria 1260
968 Ga0395898_0062352 3300037466 Bacteria 3621
969 Ga0395898_0166629 3300037466 Bacteria 2107
970 Ga0395898_0167403 3300037466 Bacteria 2101
971 Ga0395905_0070001 3300037471 Bacteria 3287
972 Ga0436364_0345988 3300037853 Bacteria 7115
973 Ga0436364_0423755 3300037853 Bacteria 87339
974 Ga0436364_1276955 3300037853 Bacteria 2218
975 Ga0436364_1535918 3300037853 Bacteria 3968
976 Ga0395901_0246201 3300038443 Bacteria 1863
977 Ga0395901_0477365 3300038443 Bacteria 1272
978 Ga0395901_0488820 3300038443 Bacteria 1254
979 Ga0436365_0076921 3300039437 Bacteria 40502
980 Ga0436365_0412636 3300039437 Bacteria 56608
981 Ga0436365_0444168 3300039437 Bacteria 22362
982 Ga0436365_0579618 3300039437 Bacteria 2875
983 Ga0436365_0842200 3300039437 Bacteria 6262
984 Ga0436365_1149508 3300039437 Bacteria 1345
985 Ga0436365_1209982 3300039437 Bacteria 1327
986 Ga0436365_1517019 3300039437 Bacteria 1289
987 Ga0436365_1582991 3300039437 Bacteria 3489
988 Ga0436365_1807266 3300039437 Bacteria 2762
989 Ga0436361_0601490 3300039447 Bacteria 1978
990 Ga0436361_1055020 3300039447 Bacteria 6935
991 Ga0436361_1192122 3300039447 Bacteria 3932
992 Ga0436363_0271626 3300039450 Bacteria 2497
993 Ga0436363_0548238 3300039450 Bacteria 7729
994 Ga0436363_1101874 3300039450 Bacteria 38864
995 Ga0436363_1268862 3300039450 Bacteria 1888
996 Ga0436363_1691760 3300039450 Bacteria 1300
997 Ga0439448_0026459 3300042005 Bacteria 1824
998 Ga0439455_0013241 3300042012 Bacteria 1865
999 Ga0466961_0061021 3300044693 Bacteria 2397
1000 Ga0466961_0130400 3300044693 Bacteria 1576
1001 Ga0466963_0153274 3300044694 Bacteria 1601
1002 Ga0466957_0047540 3300044842 Bacteria 2607
1003 Ga0451576_0020422 3300045051 Bacteria 7215
1004 Ga0466967_0004180 3300045976 Bacteria 9663
1005 Ga0466967_0050355 3300045976 Bacteria 3647
1006 Ga0495617_017934 3300046452 Bacteria 2393
1007 Ga0495592_0000032 3300046454 Bacteria 128274
1008 Ga0495592_0009020 3300046454 Bacteria 7494
1009 Ga0495592_0016478 3300046454 Bacteria 5607
1010 Ga0495592_0016847 3300046454 Bacteria 5549
1011 Ga0495603_0005155 3300046455 Bacteria 7806
1012 Ga0495603_0013983 3300046455 Bacteria 4854
1013 Ga0495603_0037151 3300046455 Bacteria 2922
1014 Ga0495603_0061058 3300046455 Bacteria 2226
1015 Ga0495603_0095239 3300046455 Bacteria 1739
1016 Ga0495590_0040082 3300046457 Bacteria 1634
1017 Ga0495629_0001232 3300046459 Bacteria 20103
1018 Ga0495629_0001465 3300046459 Bacteria 18592
1019 Ga0495629_0002050 3300046459 Bacteria 15663
1020 Ga0495638_0008231 3300046460 Bacteria 7410
1021 Ga0495638_0077106 3300046460 Bacteria 2030
1022 Ga0495641_0006019 3300046461 Bacteria 7983
1023 Ga0495641_0014796 3300046461 Bacteria 4204
1024 Ga0495641_0026036 3300046461 Bacteria 2861
1025 Ga0495641_0060393 3300046461 Bacteria 1713
1026 Ga0495641_0075574 3300046461 Bacteria 1510
1027 Ga0495651_0000799 3300046462 Bacteria 24378
1028 Ga0495651_0001360 3300046462 Bacteria 18929
1029 Ga0495651_0007731 3300046462 Bacteria 8226
1030 Ga0495651_0013259 3300046462 Bacteria 6374
1031 Ga0495653_0000012 3300046463 Bacteria 266880
1032 Ga0495653_0001069 3300046463 Bacteria 21100
1033 Ga0495653_0003134 3300046463 Bacteria 13253
1034 Ga0495653_0018668 3300046463 Bacteria 5630
1035 Ga0495580_0005009 3300046472 Bacteria 11048
1036 Ga0495580_0017623 3300046472 Bacteria 5335
1037 Ga0495580_0058785 3300046472 Bacteria 2703
1038 Ga0495580_0302495 3300046472 Bacteria 1089
1039 Ga0495582_0000570 3300046473 Bacteria 20403
1040 Ga0495582_0004754 3300046473 Bacteria 7634
1041 Ga0495582_0028921 3300046473 Bacteria 3043
1042 Ga0495582_0034833 3300046473 Bacteria 2768
1043 Ga0495582_0044708 3300046473 Bacteria 2439
1044 Ga0495582_0102076 3300046473 Bacteria 1606
1045 Ga0495639_0002103 3300046475 Bacteria 8793
1046 Ga0495639_0014886 3300046475 Bacteria 3371
1047 Ga0495639_0027206 3300046475 Bacteria 2530
1048 Ga0495639_0050994 3300046475 Bacteria 1881
1049 Ga0495639_0077878 3300046475 Bacteria 1540
1050 Ga0495662_0000879 3300046476 Bacteria 14679
1051 Ga0495662_0001012 3300046476 Bacteria 13797
1052 Ga0495662_0002431 3300046476 Bacteria 9362
1053 Ga0495662_0016111 3300046476 Bacteria 3625
1054 Ga0495662_0025150 3300046476 Bacteria 2874
1055 Ga0495664_0000004 3300046477 Bacteria 489411
1056 Ga0495664_0000146 3300046477 Bacteria 35506
1057 Ga0495664_0000563 3300046477 Bacteria 18692
1058 Ga0495664_0126142 3300046477 Bacteria 1548
1059 Ga0495584_0010718 3300046491 Bacteria 4708
1060 Ga0495585_0002912 3300046492 Bacteria 11854
1061 Ga0495585_0174701 3300046492 Bacteria 1107
1062 Ga0495594_0026229 3300046499 Bacteria 3134
1063 Ga0495594_0056365 3300046499 Bacteria 2168
1064 Ga0495594_0101385 3300046499 Bacteria 1619
1065 Ga0495607_0042874 3300046501 Bacteria 2679
1066 Ga0495583_0087074 3300046506 Bacteria 1350
1067 Ga0495608_0000017 3300046511 Bacteria 192929
1068 Ga0495608_0002512 3300046511 Bacteria 13163
1069 Ga0495608_0003432 3300046511 Bacteria 11348
1070 Ga0495608_0015292 3300046511 Bacteria 5324
1071 Ga0495608_0095690 3300046511 Bacteria 1918
1072 Ga0495608_0099976 3300046511 Bacteria 1870
1073 Ga0495608_0234590 3300046511 Bacteria 1148
1074 Ga0495616_0067680 3300046513 Bacteria 1735
1075 Ga0495618_0000006 3300046514 Bacteria 229906
1076 Ga0495618_0000473 3300046514 Bacteria 28654
1077 Ga0495618_0035358 3300046514 Bacteria 3135
1078 Ga0495618_0091228 3300046514 Bacteria 1947
1079 Ga0495628_0000001 3300046516 Bacteria 917742
1080 Ga0495628_0004103 3300046516 Bacteria 12959
1081 Ga0495628_0005499 3300046516 Bacteria 11090
1082 Ga0495628_0011495 3300046516 Bacteria 7483
1083 Ga0495630_0000422 3300046517 Bacteria 32636
1084 Ga0495630_0007807 3300046517 Bacteria 7660
1085 Ga0495630_0068325 3300046517 Bacteria 2672
1086 Ga0495630_0139263 3300046517 Bacteria 1845
1087 Ga0495630_0157466 3300046517 Bacteria 1729
1088 Ga0495631_0113702 3300046518 Bacteria 1164
1089 Ga0495637_0063129 3300046520 Bacteria 1514
1090 Ga0495643_0052199 3300046522 Bacteria 2196
1091 Ga0495644_0024172 3300046523 Bacteria 2311
1092 Ga0495644_0043960 3300046523 Bacteria 1680
1093 Ga0495648_0075844 3300046524 Bacteria 1932
1094 Ga0495666_0010597 3300046526 Bacteria 4595
1095 Ga0495666_0014995 3300046526 Bacteria 3857
1096 Ga0495652_0000002 3300046529 Bacteria 946606
1097 Ga0495652_0003864 3300046529 Bacteria 14606
1098 Ga0495652_0047192 3300046529 Bacteria 3694
1099 Ga0495652_0070621 3300046529 Bacteria 2918
1100 Ga0495652_0330327 3300046529 Bacteria 1099
1101 Ga0495665_0000227 3300046531 Bacteria 28192
1102 Ga0495665_0084309 3300046531 Bacteria 1670
1103 Ga0495640_0000001 3300046533 Bacteria 853827
1104 Ga0495640_0001488 3300046533 Bacteria 18447
1105 Ga0495640_0002833 3300046533 Bacteria 13941
1106 Ga0495640_0024233 3300046533 Bacteria 4415
1107 Ga0495640_0034413 3300046533 Bacteria 3592
1108 Ga0495640_0059161 3300046533 Bacteria 2611
1109 Ga0495640_0075095 3300046533 Bacteria 2258
1110 Ga0495586_0012979 3300046535 Bacteria 4415
1111 Ga0495587_0000008 3300046536 Bacteria 271097
1112 Ga0495587_0003639 3300046536 Bacteria 10260
1113 Ga0495587_0008368 3300046536 Bacteria 6655
1114 Ga0495587_0012855 3300046536 Bacteria 5264
1115 Ga0495598_0041403 3300046537 Bacteria 1347
1116 Ga0495609_0065627 3300046538 Bacteria 1600
1117 Ga0495609_0081439 3300046538 Bacteria 1415
1118 Ga0495609_0100173 3300046538 Bacteria 1256
1119 Ga0495621_0055834 3300046539 Bacteria 1422
1120 Ga0495645_0000002 3300046543 Bacteria 651644
1121 Ga0495645_0009348 3300046543 Bacteria 6854
1122 Ga0495645_0023181 3300046543 Bacteria 4495
1123 Ga0495645_0097739 3300046543 Bacteria 2090
1124 Ga0495622_0000406 3300046557 Bacteria 28954
1125 Ga0495633_0005373 3300046558 Bacteria 7855
1126 Ga0495667_0000124 3300046559 Bacteria 55660
1127 Ga0495667_0001092 3300046559 Bacteria 17609
1128 Ga0495667_0011961 3300046559 Bacteria 5881
1129 Ga0495667_0034171 3300046559 Bacteria 3399
1130 Ga0495667_0037745 3300046559 Bacteria 3219
1131 Ga0495667_0067913 3300046559 Bacteria 2329
1132 Ga0495667_0082616 3300046559 Bacteria 2087
1133 Ga0495667_0090432 3300046559 Bacteria 1983
1134 Ga0495667_0090541 3300046559 Bacteria 1982
1135 Ga0495656_0000554 3300046615 Bacteria 12229
1136 Ga0495668_0077490 3300046616 Bacteria 1825
1137 Ga0495668_0149001 3300046616 Bacteria 1281
1138 Ga0495668_0157654 3300046616 Bacteria 1243
1139 Ga0495634_0000003 3300046642 Bacteria 206222
1140 Ga0495634_0004424 3300046642 Bacteria 11039
1141 Ga0495634_0046635 3300046642 Bacteria 2924
1142 Ga0495634_0109540 3300046642 Bacteria 1777
1143 Ga0495634_0117121 3300046642 Bacteria 1708
1144 Ga0495611_0034086 3300046648 Bacteria 2249
1145 Ga0495635_0000002 3300046663 Bacteria 490490
1146 Ga0495635_0002104 3300046663 Bacteria 13505
1147 Ga0495635_0016723 3300046663 Bacteria 5125
1148 Ga0495635_0022896 3300046663 Bacteria 4354
1149 Ga0495635_0024301 3300046663 Bacteria 4224
1150 Ga0495635_0031658 3300046663 Bacteria 3670
1151 Ga0495635_0040864 3300046663 Bacteria 3204
1152 Ga0495635_0128331 3300046663 Bacteria 1729
1153 Ga0495635_0261668 3300046663 Bacteria 1165
1154 Ga0495659_0016170 3300046664 Bacteria 2459
1155 Ga0495659_0023703 3300046664 Bacteria 2087
1156 Ga0495659_0035644 3300046664 Bacteria 1754
1157 Ga0495588_0004978 3300046674 Bacteria 5900
1158 Ga0495588_0127124 3300046674 Bacteria 1344
1159 Ga0495657_0000054 3300046675 Bacteria 99620
1160 Ga0495657_0008729 3300046675 Bacteria 7737
1161 Ga0495657_0096183 3300046675 Bacteria 1892
1162 Ga0495657_0158481 3300046675 Bacteria 1401
1163 Ga0495599_0000005 3300046678 Bacteria 300169
1164 Ga0495599_0020724 3300046678 Bacteria 4097
1165 Ga0495599_0022366 3300046678 Bacteria 3946
1166 Ga0495599_0035696 3300046678 Bacteria 3121
1167 Ga0495599_0076139 3300046678 Bacteria 2095
1168 Ga0495623_0000148 3300046679 Bacteria 43192
1169 Ga0495623_0002021 3300046679 Bacteria 13614
1170 Ga0495623_0027550 3300046679 Bacteria 3656
1171 Ga0495623_0097234 3300046679 Bacteria 1798
1172 Ga0495646_0000002 3300046680 Bacteria 310568
1173 Ga0495646_0016750 3300046680 Bacteria 4653
1174 Ga0495646_0035451 3300046680 Bacteria 3095
1175 Ga0495646_0112055 3300046680 Bacteria 1552
1176 Ga0495646_0155292 3300046680 Bacteria 1270
1177 Ga0495647_0009539 3300046681 Bacteria 3290
1178 Ga0495658_0000543 3300046683 Bacteria 20578
1179 Ga0495658_0002466 3300046683 Bacteria 9317
1180 Ga0495658_0034649 3300046683 Bacteria 2771
1181 Ga0495658_0050889 3300046683 Bacteria 2345
1182 Ga0495658_0135987 3300046683 Bacteria 1499
1183 Ga0495613_0002489 3300046689 Bacteria 13900
1184 Ga0495613_0168083 3300046689 Bacteria 1557
1185 Ga0495613_0188279 3300046689 Bacteria 1459
1186 Ga0495624_0001896 3300046690 Bacteria 15925
1187 Ga0495624_0013382 3300046690 Bacteria 5595
1188 Ga0495624_0027306 3300046690 Bacteria 3737
1189 Ga0495624_0129200 3300046690 Bacteria 1550
1190 Ga0495624_0168611 3300046690 Bacteria 1336
1191 Ga0495670_0009745 3300046691 Bacteria 4721
1192 Ga0495600_0000012 3300046809 Bacteria 119798
1193 Ga0495600_0004562 3300046809 Bacteria 8305
1194 Ga0495600_0006388 3300046809 Bacteria 7175
1195 Ga0495600_0016042 3300046809 Bacteria 4749
1196 Ga0495660_0114681 3300046810 Bacteria 1371
1197 Ga0495660_0145528 3300046810 Bacteria 1175
1198 Ga0495581_0003432 3300047315 Bacteria 9101
1199 Ga0495581_0027818 3300047315 Bacteria 3279
1200 Ga0495581_0058614 3300047315 Bacteria 2224
1201 Ga0495581_0070554 3300047315 Bacteria 2021
1202 Ga0495604_0000009 3300047317 Bacteria 326341
1203 Ga0495604_0000422 3300047317 Bacteria 38179
1204 Ga0495604_0013474 3300047317 Bacteria 6513
1205 Ga0495604_0015408 3300047317 Bacteria 6101
1206 Ga0495604_0057176 3300047317 Bacteria 2999
1207 Ga0495674_0000002 3300047319 Bacteria 642785
1208 Ga0495674_0000641 3300047319 Bacteria 32747
1209 Ga0495674_0001683 3300047319 Bacteria 21746
1210 Ga0495674_0026343 3300047319 Bacteria 5320
1211 Ga0495674_0175444 3300047319 Bacteria 1786
1212 Ga0495672_0030618 3300047320 Bacteria 3373
1213 Ga0495676_0013899 3300047321 Bacteria 7217
1214 Ga0495676_0014569 3300047321 Bacteria 7034
1215 Ga0495676_0080098 3300047321 Bacteria 2481
1216 Ga0495676_0115141 3300047321 Bacteria 1966
1217 Ga0495676_0151994 3300047321 Bacteria 1646
1218 Ga0495676_0265329 3300047321 Bacteria 1167
1219 Ga0495680_0001385 3300047322 Bacteria 26203
1220 Ga0495680_0002139 3300047322 Bacteria 20514
1221 Ga0495680_0012328 3300047322 Bacteria 7529
1222 Ga0495680_0031291 3300047322 Bacteria 4333
1223 Ga0495680_0033026 3300047322 Bacteria 4194
1224 Ga0495680_0059613 3300047322 Bacteria 2946
1225 Ga0495680_0121345 3300047322 Bacteria 1929
1226 Ga0495680_0133161 3300047322 Bacteria 1824
1227 Ga0495680_0256882 3300047322 Bacteria 1237
1228 Ga0495675_0000028 3300047444 Bacteria 105848
1229 Ga0495675_0001398 3300047444 Bacteria 14624
1230 Ga0495675_0002936 3300047444 Bacteria 10246
1231 Ga0495675_0020224 3300047444 Bacteria 4232
1232 Ga0495675_0173041 3300047444 Bacteria 1325
1233 Ga0495685_021999 3300047447 Bacteria 2194
1234 Ga0495684_0000006 3300047471 Bacteria 247568
1235 Ga0495684_0003544 3300047471 Bacteria 12202
1236 Ga0495684_0096843 3300047471 Bacteria 2233
1237 Ga0495684_0173043 3300047471 Bacteria 1604
1238 Ga0495684_0186828 3300047471 Bacteria 1534
1239 Ga0495684_0246095 3300047471 Bacteria 1302
1240 Ga0495593_0000140 3300047673 Bacteria 35205
1241 Ga0495593_0003620 3300047673 Bacteria 9229
1242 Ga0495593_0017662 3300047673 Bacteria 4016
1243 Ga0495593_0019980 3300047673 Bacteria 3751
1244 Ga0495593_0029930 3300047673 Bacteria 2982
1245 Ga0495593_0058615 3300047673 Bacteria 2019
1246 Ga0495593_0141588 3300047673 Bacteria 1218
1247 Ga0495602_0000005 3300048088 Bacteria 325957
1248 Ga0495602_0012613 3300048088 Bacteria 8673
1249 Ga0495602_0013847 3300048088 Bacteria 8223
1250 Ga0495602_0023728 3300048088 Bacteria 5969
1251 Ga0495602_0028153 3300048088 Bacteria 5383
1252 Ga0495602_0192161 3300048088 Bacteria 1564
1253 Ga0495602_0224592 3300048088 Bacteria 1415
1254 Ga0495602_0229125 3300048088 Bacteria 1397
1255 Ga0495602_0318915 3300048088 Bacteria 1131
1256 Ga0495614_0018609 3300048089 Bacteria 3009
1257 Ga0495614_0050054 3300048089 Bacteria 1791
1258 Ga0496100_0003363 3300048903 Bacteria 8326
1259 Ga0496100_0010707 3300048903 Bacteria 5202
1260 Ga0496100_0022979 3300048903 Bacteria 3780
1261 Ga0496100_0126935 3300048903 Bacteria 1791
1262 Ga0496101_0001983 3300048904 Bacteria 12419
1263 Ga0496101_0004451 3300048904 Bacteria 8825
1264 Ga0496101_0029082 3300048904 Bacteria 3863
1265 Ga0496101_0038116 3300048904 Bacteria 3412
1266 Ga0496101_0110681 3300048904 Bacteria 2067
1267 Ga0496101_0162285 3300048904 Bacteria 1714
1268 Ga0496101_0179948 3300048904 Bacteria 1628
1269 Ga0496101_0228615 3300048904 Bacteria 1445
1270 Ga0496102_0002793 3300048905 Bacteria 14888
1271 Ga0496102_0006263 3300048905 Bacteria 10146
1272 Ga0496102_0018288 3300048905 Bacteria 6157
1273 Ga0496102_0031173 3300048905 Bacteria 4780
1274 Ga0496102_0115925 3300048905 Bacteria 2499
1275 Ga0496102_0120566 3300048905 Bacteria 2449
1276 Ga0496102_0136784 3300048905 Bacteria 2296
1277 Ga0496102_0158177 3300048905 Bacteria 2131
1278 Ga0496102_0211868 3300048905 Bacteria 1826
1279 Ga0496103_0002369 3300048906 Bacteria 11883
1280 Ga0496103_0018805 3300048906 Bacteria 4147
1281 Ga0496103_0025729 3300048906 Bacteria 3559
1282 Ga0496103_0032986 3300048906 Bacteria 3162
1283 Ga0496104_0000092 3300048907 Bacteria 87232
1284 Ga0496104_0001496 3300048907 Bacteria 20148
1285 Ga0496104_0002184 3300048907 Bacteria 16947
1286 Ga0496104_0003070 3300048907 Bacteria 14395
1287 Ga0496104_0004660 3300048907 Bacteria 11929
1288 Ga0496104_0008945 3300048907 Bacteria 8901
1289 Ga0496104_0095919 3300048907 Bacteria 2837
1290 Ga0496104_0115235 3300048907 Bacteria 2578
1291 Ga0496104_0199419 3300048907 Bacteria 1913
1292 Ga0496104_0381273 3300048907 Bacteria 1322
1293 Ga0496105_0002505 3300048908 Bacteria 13315
1294 Ga0496105_0017751 3300048908 Bacteria 5708
1295 Ga0496105_0032314 3300048908 Bacteria 4293
1296 Ga0496105_0038039 3300048908 Bacteria 3963
1297 Ga0496105_0044916 3300048908 Bacteria 3644
1298 Ga0496105_0056308 3300048908 Bacteria 3245
1299 Ga0496105_0083712 3300048908 Bacteria 2634
1300 Ga0496105_0147889 3300048908 Bacteria 1932
1301 Ga0496105_0257332 3300048908 Bacteria 1413
1302 Ga0496106_0001556 3300048909 Bacteria 17284
1303 Ga0496106_0006513 3300048909 Bacteria 8641
1304 Ga0496106_0007123 3300048909 Bacteria 8258
1305 Ga0496106_0010646 3300048909 Bacteria 6795
1306 Ga0496106_0011495 3300048909 Bacteria 6547
1307 Ga0496106_0025653 3300048909 Bacteria 4387
1308 Ga0496106_0053802 3300048909 Bacteria 3041
1309 Ga0496106_0143715 3300048909 Bacteria 1878
1310 Ga0496106_0215676 3300048909 Bacteria 1529
1311 Ga0496107_0002095 3300048910 Bacteria 12782
1312 Ga0496107_0006823 3300048910 Bacteria 7864
1313 Ga0496107_0009309 3300048910 Bacteria 6810
1314 Ga0496107_0011605 3300048910 Bacteria 6141
1315 Ga0496107_0011996 3300048910 Bacteria 6047
1316 Ga0496107_0034987 3300048910 Bacteria 3600
1317 Ga0496107_0037902 3300048910 Bacteria 3460
1318 Ga0496107_0129269 3300048910 Bacteria 1864
1319 Ga0496107_0301825 3300048910 Bacteria 1192
1320 Ga0496108_0044354 3300048911 Bacteria 3712
1321 Ga0496108_0061493 3300048911 Bacteria 3160
1322 Ga0496108_0126233 3300048911 Bacteria 2196
1323 Ga0496108_0270335 3300048911 Bacteria 1479
1324 Ga0496108_0423472 3300048911 Bacteria 1163
1325 Ga0496109_0004575 3300048912 Bacteria 11545
1326 Ga0496109_0004879 3300048912 Bacteria 11202
1327 Ga0496109_0024900 3300048912 Bacteria 5327
1328 Ga0496109_0066090 3300048912 Bacteria 3310
1329 Ga0496109_0074738 3300048912 Bacteria 3115
1330 Ga0496110_0008731 3300048913 Bacteria 8160
1331 Ga0496110_0033011 3300048913 Bacteria 4475
1332 Ga0496110_0045663 3300048913 Bacteria 3830
1333 Ga0496110_0074244 3300048913 Bacteria 3019
1334 Ga0496110_0297043 3300048913 Bacteria 1471
1335 Ga0496110_0310766 3300048913 Bacteria 1435
1336 Ga0496111_0002467 3300048914 Bacteria 11163
1337 Ga0496111_0005664 3300048914 Bacteria 8043
1338 Ga0496111_0033708 3300048914 Bacteria 3653
1339 Ga0496111_0071923 3300048914 Bacteria 2517
1340 Ga0496111_0072960 3300048914 Bacteria 2499
1341 Ga0496111_0118903 3300048914 Bacteria 1951
1342 Ga0496112_0012109 3300048915 Bacteria 7913
1343 Ga0496112_0013195 3300048915 Bacteria 7621
1344 Ga0496112_0026113 3300048915 Bacteria 5615
1345 Ga0496112_0058511 3300048915 Bacteria 3795
1346 Ga0496112_0063132 3300048915 Bacteria 3653
1347 Ga0496112_0070420 3300048915 Bacteria 3456
1348 Ga0496112_0122868 3300048915 Bacteria 2567
1349 Ga0496112_0138807 3300048915 Bacteria 2400
1350 Ga0496112_0210891 3300048915 Bacteria 1900
1351 Ga0496112_0221768 3300048915 Bacteria 1847
1352 Ga0496112_0269770 3300048915 Bacteria 1650
1353 Ga0496112_0377595 3300048915 Bacteria 1359
1354 Ga0496113_0004559 3300048916 Bacteria 8532
1355 Ga0496113_0030266 3300048916 Bacteria 3918
1356 Ga0496113_0203544 3300048916 Bacteria 1574
1357 Ga0496113_0427901 3300048916 Bacteria 1063
1358 Ga0496114_0007468 3300048917 Bacteria 8642
1359 Ga0496114_0014545 3300048917 Bacteria 6321
1360 Ga0496114_0045150 3300048917 Bacteria 3659
1361 Ga0496114_0065969 3300048917 Bacteria 3034
1362 Ga0496114_0070232 3300048917 Bacteria 2941
1363 Ga0496114_0076177 3300048917 Bacteria 2826
1364 Ga0496114_0157252 3300048917 Bacteria 1974
1365 Ga0496114_0191758 3300048917 Bacteria 1788
1366 Ga0496115_0002647 3300048918 Bacteria 12855
1367 Ga0496115_0003701 3300048918 Bacteria 11002
1368 Ga0496115_0008444 3300048918 Bacteria 7619
1369 Ga0496115_0014579 3300048918 Bacteria 5950
1370 Ga0496115_0015732 3300048918 Bacteria 5746
1371 Ga0496115_0023426 3300048918 Bacteria 4792
1372 Ga0496115_0023859 3300048918 Bacteria 4750
1373 Ga0496115_0029485 3300048918 Bacteria 4310
1374 Ga0496115_0031985 3300048918 Bacteria 4149
1375 Ga0496115_0044951 3300048918 Bacteria 3524
1376 Ga0496115_0086975 3300048918 Bacteria 2550
1377 Ga0496115_0100489 3300048918 Bacteria 2371
1378 Ga0496115_0152473 3300048918 Bacteria 1908
1379 Ga0496115_0158786 3300048918 Bacteria 1868
1380 Ga0496115_0377670 3300048918 Bacteria 1153
1381 Ga0496115_0405039 3300048918 Bacteria 1106
1382 Ga0496119_0004791 3300048922 Bacteria 13278
1383 Ga0496120_0058817 3300048923 Bacteria 2157
1384 Ga0496121_0000221 3300048924 Bacteria 123829
1385 Ga0496121_0002376 3300048924 Bacteria 28938
1386 Ga0496122_0004715 3300048925 Bacteria 16745
1387 Ga0496122_0038130 3300048925 Bacteria 3856
1388 Ga0496122_0067923 3300048925 Bacteria 2563
1389 Ga0496123_0000896 3300048926 Bacteria 47149
1390 Ga0496125_0089726 3300048928 Bacteria 2310
1391 Ga0496126_0001612 3300048929 Bacteria 34184
1392 Ga0496126_0010859 3300048929 Bacteria 9493
1393 Ga0496126_0058390 3300048929 Bacteria 3478
1394 Ga0496126_0131925 3300048929 Bacteria 2158
1395 Ga0501032_0010289 3300049569 Bacteria 6750
1396 Ga0501032_0012972 3300049569 Bacteria 5935
1397 Ga0501032_0068072 3300049569 Bacteria 2378
1398 Ga0501032_0082357 3300049569 Bacteria 2141
1399 Ga0501032_0183670 3300049569 Bacteria 1368
1400 Ga0501033_0007661 3300049570 Bacteria 8383
1401 Ga0501033_0012963 3300049570 Bacteria 6359
1402 Ga0501033_0037850 3300049570 Bacteria 3609
1403 Ga0501034_0001958 3300049571 Bacteria 26075
1404 Ga0501034_0005332 3300049571 Bacteria 14085
1405 Ga0501034_0022013 3300049571 Bacteria 6494
1406 Ga0501034_0120311 3300049571 Bacteria 2612
1407 Ga0501034_0149038 3300049571 Bacteria 2316
1408 Ga0501034_0287018 3300049571 Bacteria 1584
1409 Ga0501034_0362491 3300049571 Bacteria 1376
1410 Ga0501036_0000177 3300049572 Bacteria 41942
1411 Ga0501036_0025279 3300049572 Bacteria 5010
1412 Ga0501036_0190859 3300049572 Bacteria 1724
1413 Ga0501037_0044129 3300049573 Bacteria 3275
1414 Ga0501037_0060809 3300049573 Bacteria 2755
1415 Ga0501037_0147000 3300049573 Bacteria 1685
1416 Ga0501037_0246760 3300049573 Bacteria 1250
1417 Ga0501038_0060423 3300049574 Bacteria 3244
1418 Ga0501038_0152036 3300049574 Bacteria 1886
1419 Ga0501038_0261202 3300049574 Bacteria 1368
1420 Ga0501038_0297497 3300049574 Bacteria 1267
1421 Ga0501039_0071256 3300049575 Bacteria 2700
1422 Ga0501040_0036906 3300049576 Bacteria 3318
1423 Ga0501041_0012173 3300049577 Bacteria 5095
1424 Ga0501041_0201472 3300049577 Bacteria 1248
1425 Ga0501043_0001480 3300049579 Bacteria 20550
1426 Ga0501043_0027137 3300049579 Bacteria 4495
1427 Ga0501043_0071087 3300049579 Bacteria 2734
1428 Ga0501043_0293721 3300049579 Bacteria 1243
1429 Ga0501046_0080311 3300049580 Bacteria 2520
1430 Ga0501047_0000756 3300049581 Bacteria 33738
1431 Ga0501047_0063953 3300049581 Bacteria 3549
1432 Ga0501047_0236407 3300049581 Bacteria 1679
1433 Ga0501047_0301515 3300049581 Bacteria 1444
1434 Ga0501048_0000115 3300049582 Bacteria 45729
1435 Ga0501048_0000357 3300049582 Bacteria 31694
1436 Ga0501068_0007338 3300049584 Bacteria 6105
1437 Ga0501070_0000711 3300049586 Bacteria 30493
1438 Ga0501070_0022959 3300049586 Bacteria 5222
1439 Ga0501070_0041057 3300049586 Bacteria 3855
1440 Ga0501070_0213232 3300049586 Bacteria 1584
1441 Ga0501071_0129021 3300049587 Bacteria 1878
1442 Ga0501072_0052570 3300049588 Bacteria 3208
1443 Ga0501072_0132472 3300049588 Bacteria 1987
1444 Ga0501073_0013709 3300049589 Bacteria 5896
1445 Ga0501073_0027800 3300049589 Bacteria 4042
1446 Ga0501074_0063526 3300049590 Bacteria 2659
1447 Ga0501076_0004238 3300049592 Bacteria 10148
1448 Ga0501077_0061193 3300049593 Bacteria 2389
1449 Ga0501077_0063025 3300049593 Bacteria 2352
1450 Ga0501079_0012618 3300049741 Bacteria 6453
1451 Ga0501079_0043632 3300049741 Bacteria 3462
1452 Ga0501079_0126174 3300049741 Bacteria 1991
1453 Ga0501080_0003552 3300049742 Bacteria 13734
1454 Ga0501080_0053896 3300049742 Bacteria 3745
1455 Ga0501080_0132077 3300049742 Bacteria 2312
1456 Ga0501081_0249931 3300049743 Bacteria 1294
1457 Ga0501083_0007330 3300049744 Bacteria 7822
1458 Ga0501083_0014091 3300049744 Bacteria 5590
1459 Ga0501083_0033341 3300049744 Bacteria 3527
1460 Ga0501083_0046358 3300049744 Bacteria 2939
1461 Ga0501035_0014773 3300049822 Bacteria 7210
1462 Ga0501035_0032539 3300049822 Bacteria 4743
1463 Ga0501035_0085018 3300049822 Bacteria 2789
1464 Ga0501035_0174786 3300049822 Bacteria 1853
1465 Ga0501044_0035047 3300049823 Bacteria 5257
1466 Ga0501044_0163665 3300049823 Bacteria 2200
1467 Ga0501044_0236190 3300049823 Bacteria 1773
1468 Ga0501044_0249294 3300049823 Bacteria 1717
1469 Ga0501045_0035685 3300049824 Bacteria 3610
1470 Ga0501045_0105199 3300049824 Bacteria 2091
1471 nmdc:mga03683_37233_c1 3300050489 Bacteria 1982
1472 nmdc:mga03n38_16516_c1 3300050490 Bacteria 2872
1473 nmdc:mga03n38_6050_c1 3300050490 Bacteria 4175
1474 nmdc:mga03n38_65129_c1 3300050490 Bacteria 1670
1475 nmdc:mga00v17_38731_c1 3300050491 Bacteria 2852
1476 nmdc:mga00v17_41217_c1 3300050491 Bacteria 2773
1477 nmdc:mga00v17_87003_c1 3300050491 Bacteria 1959
1478 nmdc:mga0yw44_114654_c1 3300050492 Bacteria 1730
1479 nmdc:mga0yw44_124287_c1 3300050492 Bacteria 1665
1480 nmdc:mga0yw44_31228_c1 3300050492 Bacteria 3096
1481 nmdc:mga0yw44_813_c1 3300050492 Bacteria 11629
1482 nmdc:mga0k408_100398_c1 3300050493 Bacteria 1706
1483 nmdc:mga0k408_106249_c1 3300050493 Bacteria 1658
1484 nmdc:mga0k408_110273_c1 3300050493 Bacteria 1627
1485 nmdc:mga0k408_274669_c1 3300050493 Bacteria 1006
1486 nmdc:mga0k408_56850_c1 3300050493 Bacteria 2270
1487 nmdc:mga06z11_2739_c1 3300050494 Bacteria 6760
1488 nmdc:mga06z11_36637_c1 3300050494 Bacteria 2423
1489 nmdc:mga07m45_130278_c1 3300050496 Bacteria 1455
1490 nmdc:mga07m45_29681_c1 3300050496 Bacteria 3026
1491 nmdc:mga07m45_96803_c1 3300050496 Bacteria 1694
1492 nmdc:mga05p37_109457_c1 3300050507 Bacteria 3399
1493 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
1494 nmdc:mga05p37_6119_c1 3300050507 Bacteria 14175
1495 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
1496 nmdc:mga05p37_71061_c1 3300050507 Bacteria 4281
1497 nmdc:mga05p37_7273_c1 3300050507 Bacteria 13063
1498 nmdc:mga05p37_82393_c1 3300050507 Bacteria 3964
1499 nmdc:mga09592_1649_c1 3300050508 Bacteria 17953
1500 nmdc:mga09592_672_c1 3300050508 Bacteria 26131
1501 nmdc:mga09592_72071_c1 3300050508 Bacteria 2933
1502 nmdc:mga0qj67_234885_c1 3300050509 Bacteria 1488
1503 nmdc:mga0qj67_24846_c1 3300050509 Bacteria 4623
1504 nmdc:mga0qj67_341_c1 3300050509 Bacteria 32144
1505 nmdc:mga0qj67_36670_c1 3300050509 Bacteria 3837
1506 nmdc:mga0qj67_58518_c1 3300050509 Bacteria 3055
1507 nmdc:mga06r32_171978_c1 3300050510 Bacteria 2150
1508 nmdc:mga06r32_206794_c1 3300050510 Bacteria 1951
1509 nmdc:mga06r32_35478_c1 3300050510 Bacteria 4705
1510 nmdc:mga06r32_404_c1 3300050510 Bacteria 36414
1511 nmdc:mga06r32_47137_c1 3300050510 Bacteria 4115
1512 nmdc:mga06r32_671_c1 3300050510 Bacteria 29849
1513 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
1514 nmdc:mga08y16_122720_c1 3300050511 Bacteria 2703
1515 nmdc:mga08y16_193762_c1 3300050511 Bacteria 2107
1516 nmdc:mga08y16_275652_c1 3300050511 Bacteria 1736
1517 nmdc:mga08y16_615_c1 3300050511 Bacteria 33272
1518 nmdc:mga08y16_865_c1 3300050511 Bacteria 29154
1519 nmdc:mga0n895_125715_c1 3300050512 Bacteria 2588
1520 nmdc:mga0n895_181670_c1 3300050512 Bacteria 2135
1521 nmdc:mga0n895_19802_c1 3300050512 Bacteria 6261
1522 nmdc:mga0n895_207416_c1 3300050512 Bacteria 1990
1523 nmdc:mga0n895_258606_c1 3300050512 Bacteria 1767
1524 nmdc:mga0n895_266281_c1 3300050512 Bacteria 1739
1525 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
1526 nmdc:mga0rr50_187906_c1 3300050513 Bacteria 1692
1527 nmdc:mga0rr50_5102_c1 3300050513 Bacteria 7792
1528 nmdc:mga0rr50_85379_c1 3300050513 Bacteria 2446
1529 nmdc:mga08x19_127599_c1 3300050514 Bacteria 1709
1530 nmdc:mga08x19_4943_c1 3300050514 Bacteria 7874
1531 nmdc:mga08x19_9575_c1 3300050514 Bacteria 5798
1532 nmdc:mga0a205_11361_c1 3300050515 Bacteria 8196
1533 nmdc:mga0a205_19073_c1 3300050515 Bacteria 6463
1534 nmdc:mga0a205_268_c1 3300050515 Bacteria 37661
1535 nmdc:mga0a205_289522_c1 3300050515 Bacteria 1512
1536 nmdc:mga0a205_86437_c1 3300050515 Bacteria 3028
1537 nmdc:mga0sz30_8011_c1 3300050516 Bacteria 1971
1538 Ga0495601_0000002 3300053077 Bacteria 528704
1539 Ga0495601_0000860 3300053077 Bacteria 16549
1540 Ga0495601_0001376 3300053077 Bacteria 13385
1541 Ga0495601_0002635 3300053077 Bacteria 10183
1542 Ga0495601_0008009 3300053077 Bacteria 6225
1543 Ga0495601_0014329 3300053077 Bacteria 4775
1544 Ga0495601_0042558 3300053077 Bacteria 2850
1545 Ga0495601_0082542 3300053077 Bacteria 2063
1546 Ga0495601_0105887 3300053077 Bacteria 1819
1547 Ga0495601_0252910 3300053077 Bacteria 1150
1548 Ga0495612_0000010 3300053078 Bacteria 227618
1549 Ga0495612_0000075 3300053078 Bacteria 45362
1550 Ga0495612_0000562 3300053078 Bacteria 14913
1551 Ga0495612_0001712 3300053078 Bacteria 8999
1552 Ga0495612_0002201 3300053078 Bacteria 8017
1553 Ga0495612_0013643 3300053078 Bacteria 3273
1554 Ga0495612_0040405 3300053078 Bacteria 1900
1555 Ga0495612_0058465 3300053078 Bacteria 1593
1556 Ga0495595_0000026 3300053084 Bacteria 99949
1557 Ga0495595_0000168 3300053084 Bacteria 25725
1558 Ga0495595_0000589 3300053084 Bacteria 13861
1559 Ga0495595_0003174 3300053084 Bacteria 6518
1560 Ga0495595_0008606 3300053084 Bacteria 4196
1561 Ga0495595_0013688 3300053084 Bacteria 3429
1562 Ga0495595_0046146 3300053084 Bacteria 2006
1563 Ga0495595_0070190 3300053084 Bacteria 1655
1564 Ga0495619_0000019 3300053085 Bacteria 209518
1565 Ga0495619_0000045 3300053085 Bacteria 108543
1566 Ga0495619_0000388 3300053085 Bacteria 30051
1567 Ga0495619_0003526 3300053085 Bacteria 10092
1568 Ga0495619_0008861 3300053085 Bacteria 6358
1569 Ga0495619_0013999 3300053085 Bacteria 5061
1570 Ga0495619_0016140 3300053085 Bacteria 4727
1571 Ga0495619_0027612 3300053085 Bacteria 3657
1572 Ga0495619_0032806 3300053085 Bacteria 3370
1573 Ga0495619_0109834 3300053085 Bacteria 1883
1574 Ga0500643_001251 3300053087 Bacteria 15060
1575 Ga0500566_0001887 3300053094 Bacteria 12333
1576 Ga0500566_0019309 3300053094 Bacteria 4002
1577 Ga0500641_0016442 3300053096 Bacteria 2755
1578 Ga0500556_0000290 3300053104 Bacteria 39103
1579 Ga0500593_000029 3300053117 Bacteria 51244
1580 Ga0500595_000002 3300053119 Bacteria 1074388
1581 Ga0500595_001597 3300053119 Bacteria 11940
1582 Ga0500652_000005 3300053131 Bacteria 171538
1583 Ga0500652_005131 3300053131 Bacteria 4099
1584 Ga0500559_0006649 3300053136 Bacteria 5199
1585 Ga0500559_0025572 3300053136 Bacteria 2512
1586 Ga0500568_0000004 3300053139 Bacteria 621666
1587 Ga0500589_025042 3300053147 Bacteria 2761
1588 Ga0500589_035423 3300053147 Bacteria 2330
1589 Ga0500590_011273 3300053148 Bacteria 4526
1590 Ga0500616_0000002 3300053153 Bacteria 1611257
1591 Ga0500616_0006754 3300053153 Bacteria 7439
1592 Ga0500638_000120 3300053162 Bacteria 15133
1593 Ga0500637_0000070 3300053178 Bacteria 36880
1594 Ga0500611_027050 3300053727 Bacteria 1152
1595 Ga0500645_000156 3300053730 Bacteria 53110
1596 Ga0500645_038386 3300053730 Bacteria 1421
1597 Ga0501084_0160775 3300054114 Bacteria 1895
1598 Ga0500661_000547 3300055283 Bacteria 7008
1599 Ga0501082_0007283 3300060353 Bacteria 9543
1600 Ga0501082_0169542 3300060353 Bacteria 1897
1601 Ga0501082_0254320 3300060353 Bacteria 1528
1602 Ga0530510_0107136 3300061734 Bacteria 2045
1603 Ga0530510_0110402 3300061734 Bacteria 2014

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1209982 Ga0436365_1209982_14_892 271
2 3300046663 Ga0495635_0261668 Ga0495635_0261668_25_927 300
3 iso_pu_bacteria 2824714736 2824723110 307
4 3300035117 Ga0373953_0072680 Ga0373953_0072680_17_949 310
5 3300006871 Ga0075434_100086930 Ga0075434_1000869303 315
6 3300027512 Ga0209179_1029109 Ga0209179_10291091 315
7 3300050512 nmdc:mga0n895_19802_c1 nmdc:mga0n895_19802_c1_1396_2448 316
8 3300005563 Ga0068855_100018496 Ga0068855_1000184965 319
9 3300025909 Ga0207705_10073895 Ga0207705_100738953 319
10 3300025949 Ga0207667_10071955 Ga0207667_100719553 319
11 3300026078 Ga0207702_10294721 Ga0207702_102947211 319
12 3300005327 Ga0070658_10080543 Ga0070658_100805431 321
13 3300005458 Ga0070681_10010419 Ga0070681_100104197 321
14 3300005530 Ga0070679_100047919 Ga0070679_1000479193 321
15 3300022467 Ga0224712_10047026 Ga0224712_100470261 321
16 3300026067 Ga0207678_10035698 Ga0207678_100356983 321
17 3300049571 Ga0501034_0362491 Ga0501034_0362491_365_1330 321
18 3300035692 Ga0373935_0031453 Ga0373935_0031453_17_985 322
19 3300037068 Ga0373925_0006642 Ga0373925_0006642_7511_8479 322
20 3300037068 Ga0373925_0162556 Ga0373925_0162556_777_1745 322
21 3300046690 Ga0495624_0001896 Ga0495624_0001896_15_983 322
22 3300048088 Ga0495602_0229125 Ga0495602_0229125_10_978 322
23 3300048908 Ga0496105_0017751 Ga0496105_0017751_4726_5694 322
24 3300048910 Ga0496107_0034987 Ga0496107_0034987_39_1007 322
25 3300048924 Ga0496121_0002376 Ga0496121_0002376_1657_2706 322
26 3300049571 Ga0501034_0287018 Ga0501034_0287018_605_1573 322
27 3300049574 Ga0501038_0152036 Ga0501038_0152036_12_980 322
28 3300049579 Ga0501043_0293721 Ga0501043_0293721_261_1229 322
29 3300049586 Ga0501070_0213232 Ga0501070_0213232_12_980 322
30 3300050493 nmdc:mga0k408_274669_c1 nmdc:mga0k408_274669_c1_10_978 322
31 3300050494 nmdc:mga06z11_36637_c1 nmdc:mga06z11_36637_c1_1427_2395 322
32 3300053084 Ga0495595_0008606 Ga0495595_0008606_10_978 322
33 3300006028 Ga0070717_10023003 Ga0070717_100230032 323
34 3300006844 Ga0075428_100011791 Ga0075428_1000117913 323
35 3300035691 Ga0373931_0015883 Ga0373931_0015883_300_1301 323
36 3300046511 Ga0495608_0003432 Ga0495608_0003432_6258_7256 323
37 3300046559 Ga0495667_0037745 Ga0495667_0037745_697_1695 323
38 3300046559 Ga0495667_0090432 Ga0495667_0090432_944_1942 323
39 3300048915 Ga0496112_0377595 Ga0496112_0377595_260_1261 323
40 3300048916 Ga0496113_0203544 Ga0496113_0203544_78_1079 323
41 3300053085 Ga0495619_0027612 Ga0495619_0027612_42_1040 323
42 iso_pu_bacteria 2899259804 2899260375 323
43 3300025914 Ga0207671_10154096 Ga0207671_101540962 324
44 3300025934 Ga0207686_10151512 Ga0207686_101515122 324
45 3300035695 Ga0373927_0155327 Ga0373927_0155327_195_1196 324
46 3300039450 Ga0436363_1101874 Ga0436363_1101874_35791_36765 324
47 3300048905 Ga0496102_0120566 Ga0496102_0120566_278_1279 324
48 3300048907 Ga0496104_0115235 Ga0496104_0115235_552_1553 324
49 3300048908 Ga0496105_0032314 Ga0496105_0032314_604_1605 324
50 3300048913 Ga0496110_0074244 Ga0496110_0074244_501_1502 324
51 3300048914 Ga0496111_0118903 Ga0496111_0118903_939_1940 324
52 3300048915 Ga0496112_0138807 Ga0496112_0138807_307_1308 324
53 3300048917 Ga0496114_0065969 Ga0496114_0065969_1478_2479 324
54 3300048918 Ga0496115_0086975 Ga0496115_0086975_194_1195 324
55 3300046455 Ga0495603_0005155 Ga0495603_0005155_5851_6855 325
56 3300049577 Ga0501041_0201472 Ga0501041_0201472_111_1112 325
57 3300035398 Ga0316574_0151975 Ga0316574_0151975_60_1067 327
58 iso_pu_bacteria 2513237098 2513677761 327
59 iso_pu_bacteria 2524023210 2524467746 327
60 iso_pu_bacteria 2885383462 2885390477 327
61 iso_pu_bacteria 2903768456 2903774279 327
62 iso_pu_bacteria 8056681323 8056682175 327
63 3300005338 Ga0068868_100029085 Ga0068868_1000290853 328
64 3300005455 Ga0070663_100027275 Ga0070663_1000272753 328
65 3300006358 Ga0068871_100191120 Ga0068871_1001911201 328
66 3300009098 Ga0105245_10029815 Ga0105245_100298152 328
67 3300013296 Ga0157374_10003779 Ga0157374_100037794 328
68 3300013306 Ga0163162_10139260 Ga0163162_101392602 328
69 3300014969 Ga0157376_10012121 Ga0157376_100121217 328
70 3300025908 Ga0207643_10196526 Ga0207643_101965262 328
71 3300025927 Ga0207687_10009764 Ga0207687_100097646 328
72 3300026023 Ga0207677_10064470 Ga0207677_100644703 328
73 3300026067 Ga0207678_10041442 Ga0207678_100414423 328
74 3300033180 Ga0307510_10009215 Ga0307510_100092155 328
75 3300035695 Ga0373927_0017582 Ga0373927_0017582_2746_3747 328
76 3300035695 Ga0373927_0119317 Ga0373927_0119317_259_1260 328
77 3300046473 Ga0495582_0028921 Ga0495582_0028921_1749_2750 328
78 3300048907 Ga0496104_0008945 Ga0496104_0008945_5964_6965 328
79 3300048911 Ga0496108_0061493 Ga0496108_0061493_1542_2543 328
80 3300048916 Ga0496113_0427901 Ga0496113_0427901_22_1023 328
81 iso_pu_bacteria 8006994254 8006998562 328
82 iso_pu_bacteria 2513237101 2513693277 329
83 iso_pu_bacteria 2721755755 2723848187 329
84 iso_pu_bacteria 2791355199 2793078104 329
85 iso_pu_bacteria 2828305725 2828308332 329
86 iso_pu_bacteria 2874604998 2874608825 329
87 iso_pu_bacteria 2879110137 2879115446 329
88 iso_pu_bacteria 2889033259 2889037297 329
89 iso_pu_bacteria 2922361189 2922361428 329
90 iso_pu_bacteria 2922386360 2922388851 329
91 iso_pu_bacteria 8006964411 8006968877 329
92 iso_pu_bacteria 8006984368 8006985241 329
93 iso_pu_bacteria 8056673599 8056675906 329
94 3300014325 Ga0163163_10007753 Ga0163163_100077537 330
95 3300044693 Ga0466961_0061021 Ga0466961_0061021_1115_2119 330
96 3300048903 Ga0496100_0010707 Ga0496100_0010707_957_2006 330
97 3300048905 Ga0496102_0006263 Ga0496102_0006263_2715_3764 330
98 3300048906 Ga0496103_0025729 Ga0496103_0025729_790_1839 330
99 3300048908 Ga0496105_0083712 Ga0496105_0083712_1534_2583 330
100 3300048910 Ga0496107_0002095 Ga0496107_0002095_232_1281 330
101 3300048912 Ga0496109_0024900 Ga0496109_0024900_3920_4969 330
102 3300048913 Ga0496110_0045663 Ga0496110_0045663_611_1660 330
103 3300048915 Ga0496112_0070420 Ga0496112_0070420_471_1520 330
104 3300048917 Ga0496114_0014545 Ga0496114_0014545_5097_6146 330
105 3300048918 Ga0496115_0008444 Ga0496115_0008444_456_1505 330
106 iso_pu_bacteria 2513237087 2513591490 330
107 iso_pu_bacteria 2595698237 2596372627 330
108 iso_pu_bacteria 2857524615 2857527140 330
109 iso_pu_bacteria 2889306138 2889308376 330
110 iso_pu_bacteria 2893066018 2893068082 330
111 iso_pu_bacteria 2902330777 2902331308 330
112 iso_pu_bacteria 2902405164 2902410753 330
113 iso_pu_bacteria 2919073203 2919078255 330
114 iso_pu_bacteria 2928125067 2928127578 330
115 3300003203 JGI25406J46586_10003809 JGI25406J46586_100038097 331
116 3300003203 JGI25406J46586_10007133 JGI25406J46586_100071334 331
117 3300005339 Ga0070660_100024866 Ga0070660_1000248663 331
118 3300005344 Ga0070661_100180667 Ga0070661_1001806672 331
119 3300005345 Ga0070692_10150731 Ga0070692_101507311 331
120 3300005356 Ga0070674_100210462 Ga0070674_1002104621 331
121 3300005366 Ga0070659_100037328 Ga0070659_1000373283 331
122 3300005367 Ga0070667_100565331 Ga0070667_1005653311 331
123 3300005455 Ga0070663_100017187 Ga0070663_1000171873 331
124 3300005457 Ga0070662_100250256 Ga0070662_1002502561 331
125 3300005458 Ga0070681_10004661 Ga0070681_100046614 331
126 3300005539 Ga0068853_100015701 Ga0068853_1000157013 331
127 3300005545 Ga0070695_100015500 Ga0070695_1000155003 331
128 3300005547 Ga0070693_100003235 Ga0070693_1000032352 331
129 3300005564 Ga0070664_100107252 Ga0070664_1001072523 331
130 3300005578 Ga0068854_100147355 Ga0068854_1001473552 331
131 3300005840 Ga0068870_10043749 Ga0068870_100437493 331
132 3300005843 Ga0068860_100156188 Ga0068860_1001561882 331
133 3300005983 Ga0081540_1002386 Ga0081540_10023869 331
134 3300005983 Ga0081540_1002765 Ga0081540_10027652 331
135 3300005983 Ga0081540_1005516 Ga0081540_10055164 331
136 3300005983 Ga0081540_1020053 Ga0081540_10200533 331
137 3300005983 Ga0081540_1024836 Ga0081540_10248362 331
138 3300005985 Ga0081539_10000306 Ga0081539_1000030618 331
139 3300006042 Ga0075368_10071075 Ga0075368_100710751 331
140 3300009098 Ga0105245_10099722 Ga0105245_100997223 331
141 3300009148 Ga0105243_10087524 Ga0105243_100875243 331
142 3300009174 Ga0105241_10100074 Ga0105241_101000742 331
143 3300009545 Ga0105237_10032300 Ga0105237_100323003 331
144 3300013105 Ga0157369_10281738 Ga0157369_102817381 331
145 3300014969 Ga0157376_10093163 Ga0157376_100931632 331
146 3300025904 Ga0207647_10009706 Ga0207647_100097063 331
147 3300025908 Ga0207643_10176573 Ga0207643_101765732 331
148 3300025912 Ga0207707_10011019 Ga0207707_100110192 331
149 3300025914 Ga0207671_10082682 Ga0207671_100826821 331
150 3300025915 Ga0207693_10034641 Ga0207693_100346412 331
151 3300025916 Ga0207663_10026312 Ga0207663_100263121 331
152 3300025919 Ga0207657_10050813 Ga0207657_100508133 331
153 3300025921 Ga0207652_10053069 Ga0207652_100530692 331
154 3300025933 Ga0207706_10341120 Ga0207706_103411201 331
155 3300025981 Ga0207640_10146331 Ga0207640_101463312 331
156 3300026067 Ga0207678_10000414 Ga0207678_100004142 331
157 3300026078 Ga0207702_10067064 Ga0207702_100670644 331
158 3300026089 Ga0207648_10174941 Ga0207648_101749412 331
159 3300028379 Ga0268266_10157018 Ga0268266_101570182 331
160 3300035116 Ga0373945_0007150 Ga0373945_0007150_477_1472 331
161 3300035170 Ga0373943_0058552 Ga0373943_0058552_342_1337 331
162 3300035691 Ga0373931_0041914 Ga0373931_0041914_377_1372 331
163 3300037466 Ga0395898_0166629 Ga0395898_0166629_772_1770 331
164 3300046455 Ga0495603_0095239 Ga0495603_0095239_457_1452 331
165 3300046616 Ga0495668_0077490 Ga0495668_0077490_460_1455 331
166 3300046616 Ga0495668_0157654 Ga0495668_0157654_181_1176 331
167 3300046690 Ga0495624_0129200 Ga0495624_0129200_338_1333 331
168 3300047444 Ga0495675_0173041 Ga0495675_0173041_119_1117 331
169 3300048088 Ga0495602_0224592 Ga0495602_0224592_318_1316 331
170 3300048903 Ga0496100_0126935 Ga0496100_0126935_120_1118 331
171 3300048904 Ga0496101_0004451 Ga0496101_0004451_5756_6754 331
172 3300048904 Ga0496101_0179948 Ga0496101_0179948_501_1496 331
173 3300048905 Ga0496102_0158177 Ga0496102_0158177_578_1573 331
174 3300048909 Ga0496106_0011495 Ga0496106_0011495_3647_4645 331
175 3300048909 Ga0496106_0053802 Ga0496106_0053802_1700_2695 331
176 3300048910 Ga0496107_0009309 Ga0496107_0009309_1884_2882 331
177 3300048917 Ga0496114_0070232 Ga0496114_0070232_171_1169 331
178 3300048918 Ga0496115_0031985 Ga0496115_0031985_1163_2161 331
179 3300048918 Ga0496115_0100489 Ga0496115_0100489_1131_2126 331
180 3300048925 Ga0496122_0038130 Ga0496122_0038130_1298_2293 331
181 3300048929 Ga0496126_0010859 Ga0496126_0010859_4696_5691 331
182 3300049571 Ga0501034_0149038 Ga0501034_0149038_588_1595 331
183 3300049574 Ga0501038_0297497 Ga0501038_0297497_211_1218 331
184 3300049581 Ga0501047_0236407 Ga0501047_0236407_649_1647 331
185 3300049582 Ga0501048_0000115 Ga0501048_0000115_36124_37122 331
186 3300049586 Ga0501070_0041057 Ga0501070_0041057_808_1815 331
187 3300053077 Ga0495601_0002635 Ga0495601_0002635_5223_6221 331
188 3300053078 Ga0495612_0040405 Ga0495612_0040405_515_1513 331
189 3300053084 Ga0495595_0070190 Ga0495595_0070190_354_1352 331
190 3300053153 Ga0500616_0006754 Ga0500616_0006754_3389_4387 331
191 3300005344 Ga0070661_100036019 Ga0070661_1000360192 332
192 3300005353 Ga0070669_100072827 Ga0070669_1000728272 332
193 3300005353 Ga0070669_100382860 Ga0070669_1003828601 332
194 3300005356 Ga0070674_100065444 Ga0070674_1000654442 332
195 3300005367 Ga0070667_100329792 Ga0070667_1003297921 332
196 3300005441 Ga0070700_100093787 Ga0070700_1000937872 332
197 3300005455 Ga0070663_100012871 Ga0070663_1000128713 332
198 3300005456 Ga0070678_100034284 Ga0070678_1000342841 332
199 3300005471 Ga0070698_100201019 Ga0070698_1002010192 332
200 3300005518 Ga0070699_100174679 Ga0070699_1001746792 332
201 3300005539 Ga0068853_100015280 Ga0068853_1000152803 332
202 3300005543 Ga0070672_100040098 Ga0070672_1000400983 332
203 3300005548 Ga0070665_100219998 Ga0070665_1002199982 332
204 3300005548 Ga0070665_100436574 Ga0070665_1004365741 332
205 3300005718 Ga0068866_10079221 Ga0068866_100792212 332
206 3300005840 Ga0068870_10121272 Ga0068870_101212722 332
207 3300006038 Ga0075365_10051214 Ga0075365_100512142 332
208 3300006038 Ga0075365_10171024 Ga0075365_101710242 332
209 3300006175 Ga0070712_100049815 Ga0070712_1000498153 332
210 3300006881 Ga0068865_100052560 Ga0068865_1000525602 332
211 3300009148 Ga0105243_10035105 Ga0105243_100351051 332
212 3300010375 Ga0105239_10346225 Ga0105239_103462251 332
213 3300014326 Ga0157380_10231041 Ga0157380_102310412 332
214 3300017792 Ga0163161_10086928 Ga0163161_100869282 332
215 3300021384 Ga0213876_10000514 Ga0213876_100005146 332
216 3300021384 Ga0213876_10004037 Ga0213876_100040373 332
217 3300021388 Ga0213875_10002043 Ga0213875_1000204313 332
218 3300025885 Ga0207653_10017060 Ga0207653_100170602 332
219 3300025893 Ga0207682_10033509 Ga0207682_100335092 332
220 3300025899 Ga0207642_10034683 Ga0207642_100346832 332
221 3300025903 Ga0207680_10052411 Ga0207680_100524112 332
222 3300025927 Ga0207687_10041692 Ga0207687_100416922 332
223 3300025934 Ga0207686_10020413 Ga0207686_100204133 332
224 3300025935 Ga0207709_10071979 Ga0207709_100719791 332
225 3300025937 Ga0207669_10135589 Ga0207669_101355892 332
226 3300025939 Ga0207665_10055563 Ga0207665_100555631 332
227 3300025940 Ga0207691_10314525 Ga0207691_103145251 332
228 3300025960 Ga0207651_10045351 Ga0207651_100453512 332
229 3300025961 Ga0207712_10102162 Ga0207712_101021622 332
230 3300025972 Ga0207668_10182291 Ga0207668_101822911 332
231 3300025986 Ga0207658_10082393 Ga0207658_100823932 332
232 3300026041 Ga0207639_10058770 Ga0207639_100587701 332
233 3300026075 Ga0207708_10038352 Ga0207708_100383522 332
234 3300027907 Ga0207428_10143993 Ga0207428_101439932 332
235 3300028379 Ga0268266_10000446 Ga0268266_100004464 332
236 3300028380 Ga0268265_10072977 Ga0268265_100729773 332
237 3300028786 Ga0307517_10130606 Ga0307517_101306062 332
238 3300031249 Ga0265339_10003487 Ga0265339_1000348712 332
239 3300031730 Ga0307516_10078953 Ga0307516_100789532 332
240 3300031731 Ga0307405_10283945 Ga0307405_102839452 332
241 3300031995 Ga0307409_100037914 Ga0307409_1000379145 332
242 3300032002 Ga0307416_100224479 Ga0307416_1002244792 332
243 3300032126 Ga0307415_100082198 Ga0307415_1000821982 332
244 3300032126 Ga0307415_100327245 Ga0307415_1003272452 332
245 3300033180 Ga0307510_10009742 Ga0307510_1000974214 332
246 3300035170 Ga0373943_0042435 Ga0373943_0042435_602_1600 332
247 3300035695 Ga0373927_0059755 Ga0373927_0059755_710_1708 332
248 3300037853 Ga0436364_0345988 Ga0436364_0345988_2135_3139 332
249 3300039437 Ga0436365_0412636 Ga0436365_0412636_47280_48284 332
250 3300039437 Ga0436365_0444168 Ga0436365_0444168_12552_13589 332
251 3300039437 Ga0436365_1517019 Ga0436365_1517019_90_1088 332
252 3300039437 Ga0436365_1807266 Ga0436365_1807266_384_1382 332
253 3300039447 Ga0436361_0601490 Ga0436361_0601490_171_1169 332
254 3300039450 Ga0436363_0271626 Ga0436363_0271626_1116_2120 332
255 3300046461 Ga0495641_0060393 Ga0495641_0060393_314_1312 332
256 3300046472 Ga0495580_0302495 Ga0495580_0302495_32_1030 332
257 3300046492 Ga0495585_0174701 Ga0495585_0174701_78_1076 332
258 3300046513 Ga0495616_0067680 Ga0495616_0067680_657_1655 332
259 3300046517 Ga0495630_0139263 Ga0495630_0139263_756_1754 332
260 3300046518 Ga0495631_0113702 Ga0495631_0113702_131_1129 332
261 3300046522 Ga0495643_0052199 Ga0495643_0052199_547_1545 332
262 3300046529 Ga0495652_0330327 Ga0495652_0330327_31_1029 332
263 3300046533 Ga0495640_0075095 Ga0495640_0075095_79_1077 332
264 3300046538 Ga0495609_0081439 Ga0495609_0081439_26_1024 332
265 3300046616 Ga0495668_0149001 Ga0495668_0149001_32_1030 332
266 3300046664 Ga0495659_0035644 Ga0495659_0035644_161_1159 332
267 3300046810 Ga0495660_0145528 Ga0495660_0145528_31_1029 332
268 3300047321 Ga0495676_0080098 Ga0495676_0080098_402_1400 332
269 3300047322 Ga0495680_0059613 Ga0495680_0059613_1614_2612 332
270 3300048904 Ga0496101_0110681 Ga0496101_0110681_293_1291 332
271 3300048907 Ga0496104_0095919 Ga0496104_0095919_835_1833 332
272 3300048908 Ga0496105_0147889 Ga0496105_0147889_380_1378 332
273 3300048909 Ga0496106_0143715 Ga0496106_0143715_127_1125 332
274 3300048910 Ga0496107_0301825 Ga0496107_0301825_174_1172 332
275 3300048911 Ga0496108_0423472 Ga0496108_0423472_59_1057 332
276 3300048915 Ga0496112_0012109 Ga0496112_0012109_3638_4636 332
277 3300048917 Ga0496114_0157252 Ga0496114_0157252_197_1195 332
278 3300048929 Ga0496126_0001612 Ga0496126_0001612_9775_10773 332
279 3300049572 Ga0501036_0190859 Ga0501036_0190859_87_1085 332
280 3300050493 nmdc:mga0k408_106249_c1 nmdc:mga0k408_106249_c1_479_1477 332
281 3300053077 Ga0495601_0252910 Ga0495601_0252910_78_1076 332
282 3300053147 Ga0500589_035423 Ga0500589_035423_1223_2221 332
283 iso_pu_bacteria 2545555834 2545679291 332
284 iso_pu_bacteria 2643221547 2643757308 332
285 iso_pu_bacteria 2919450847 2919451909 332
286 iso_pu_bacteria 3003665799 3003671439 332
287 iso_pu_bacteria 641522639 641644620 332
288 iso_pu_bacteria 643348564 643602802 332
289 iso_pu_bacteria 8001845381 8001849999 332
290 3300003215 JGI25153J46596_10003847 JGI25153J46596_1000384710 333
291 3300005328 Ga0070676_10267144 Ga0070676_102671441 333
292 3300005331 Ga0070670_100094117 Ga0070670_1000941172 333
293 3300005337 Ga0070682_100277844 Ga0070682_1002778441 333
294 3300005338 Ga0068868_100026486 Ga0068868_1000264863 333
295 3300005343 Ga0070687_100081880 Ga0070687_1000818801 333
296 3300005355 Ga0070671_100231059 Ga0070671_1002310592 333
297 3300005356 Ga0070674_100107752 Ga0070674_1001077522 333
298 3300005365 Ga0070688_100075812 Ga0070688_1000758122 333
299 3300005366 Ga0070659_100301430 Ga0070659_1003014302 333
300 3300005456 Ga0070678_100037451 Ga0070678_1000374512 333
301 3300005457 Ga0070662_100133529 Ga0070662_1001335292 333
302 3300005539 Ga0068853_100109958 Ga0068853_1001099581 333
303 3300005548 Ga0070665_100085466 Ga0070665_1000854661 333
304 3300005548 Ga0070665_100089171 Ga0070665_1000891712 333
305 3300005548 Ga0070665_100376162 Ga0070665_1003761621 333
306 3300005564 Ga0070664_100198361 Ga0070664_1001983612 333
307 3300005614 Ga0068856_100348432 Ga0068856_1003484321 333
308 3300005616 Ga0068852_100168942 Ga0068852_1001689422 333
309 3300005719 Ga0068861_100049835 Ga0068861_1000498352 333
310 3300005981 Ga0081538_10021466 Ga0081538_100214665 333
311 3300005983 Ga0081540_1003527 Ga0081540_10035274 333
312 3300005983 Ga0081540_1005126 Ga0081540_10051263 333
313 3300005985 Ga0081539_10001260 Ga0081539_1000126033 333
314 3300006038 Ga0075365_10037037 Ga0075365_100370373 333
315 3300006048 Ga0075363_100011319 Ga0075363_1000113192 333
316 3300006051 Ga0075364_10074566 Ga0075364_100745662 333
317 3300006358 Ga0068871_100107955 Ga0068871_1001079552 333
318 3300007076 Ga0075435_100087604 Ga0075435_1000876042 333
319 3300020080 Ga0206350_10300830 Ga0206350_103008302 333
320 3300025297 Ga0209758_1007275 Ga0209758_10072753 333
321 3300025914 Ga0207671_10087943 Ga0207671_100879432 333
322 3300025916 Ga0207663_10328751 Ga0207663_103287511 333
323 3300025933 Ga0207706_10022546 Ga0207706_100225464 333
324 3300025937 Ga0207669_10092832 Ga0207669_100928322 333
325 3300025941 Ga0207711_10170653 Ga0207711_101706532 333
326 3300025941 Ga0207711_10232888 Ga0207711_102328881 333
327 3300025945 Ga0207679_10141139 Ga0207679_101411392 333
328 3300027907 Ga0207428_10165874 Ga0207428_101658742 333
329 3300028379 Ga0268266_10000670 Ga0268266_1000067041 333
330 3300028379 Ga0268266_10012528 Ga0268266_100125289 333
331 3300037471 Ga0395905_0070001 Ga0395905_0070001_83_1084 333
332 3300039437 Ga0436365_1582991 Ga0436365_1582991_670_1671 333
333 3300047321 Ga0495676_0265329 Ga0495676_0265329_139_1140 333
334 3300049588 Ga0501072_0052570 Ga0501072_0052570_1278_2279 333
335 3300050490 nmdc:mga03n38_6050_c1 nmdc:mga03n38_6050_c1_3080_4081 333
336 3300050492 nmdc:mga0yw44_114654_c1 nmdc:mga0yw44_114654_c1_696_1697 333
337 3300050496 nmdc:mga07m45_29681_c1 nmdc:mga07m45_29681_c1_408_1409 333
338 3300050515 nmdc:mga0a205_86437_c1 nmdc:mga0a205_86437_c1_1463_2464 333
339 3300050516 nmdc:mga0sz30_8011_c1 nmdc:mga0sz30_8011_c1_527_1528 333
340 3300053077 Ga0495601_0042558 Ga0495601_0042558_1747_2748 333
341 3300053077 Ga0495601_0105887 Ga0495601_0105887_248_1249 333
342 3300053084 Ga0495595_0046146 Ga0495595_0046146_521_1522 333
343 3300053094 Ga0500566_0019309 Ga0500566_0019309_2176_3177 333
344 3300053119 Ga0500595_001597 Ga0500595_001597_10024_11025 333
345 3300053136 Ga0500559_0025572 Ga0500559_0025572_520_1521 333
346 3300053147 Ga0500589_025042 Ga0500589_025042_552_1553 333
347 3300053162 Ga0500638_000120 Ga0500638_000120_1470_2471 333
348 3300053178 Ga0500637_0000070 Ga0500637_0000070_31566_32567 333
349 3300053727 Ga0500611_027050 Ga0500611_027050_135_1136 333
350 3300055283 Ga0500661_000547 Ga0500661_000547_3861_4862 333
351 3300060353 Ga0501082_0169542 Ga0501082_0169542_140_1141 333
352 3300005457 Ga0070662_100045316 Ga0070662_1000453162 334
353 3300005937 Ga0081455_10005438 Ga0081455_100054388 334
354 3300005983 Ga0081540_1026792 Ga0081540_10267922 334
355 3300006048 Ga0075363_100041849 Ga0075363_1000418493 334
356 3300006058 Ga0075432_10000954 Ga0075432_100009547 334
357 3300006844 Ga0075428_100005805 Ga0075428_1000058053 334
358 3300006846 Ga0075430_100000424 Ga0075430_10000042412 334
359 3300006847 Ga0075431_100002258 Ga0075431_1000022587 334
360 3300006852 Ga0075433_10000012 Ga0075433_1000001238 334
361 3300006871 Ga0075434_100000310 Ga0075434_1000003103 334
362 3300006871 Ga0075434_100112131 Ga0075434_1001121313 334
363 3300006871 Ga0075434_100217751 Ga0075434_1002177512 334
364 3300006880 Ga0075429_100001610 Ga0075429_10000161012 334
365 3300006942 Ga0099824_1002861 Ga0099824_100286114 334
366 3300007076 Ga0075435_100002697 Ga0075435_1000026979 334
367 3300009094 Ga0111539_10000842 Ga0111539_100008428 334
368 3300009147 Ga0114129_10000803 Ga0114129_1000080329 334
369 3300009147 Ga0114129_10006740 Ga0114129_100067408 334
370 3300009553 Ga0105249_10153117 Ga0105249_101531173 334
371 3300025915 Ga0207693_10201344 Ga0207693_102013442 334
372 3300027907 Ga0207428_10000137 Ga0207428_1000013766 334
373 3300028577 Ga0265318_10007102 Ga0265318_100071023 334
374 3300031238 Ga0265332_10067620 Ga0265332_100676202 334
375 3300031239 Ga0265328_10017174 Ga0265328_100171742 334
376 3300031240 Ga0265320_10006407 Ga0265320_100064074 334
377 3300031241 Ga0265325_10011811 Ga0265325_100118113 334
378 3300031241 Ga0265325_10030916 Ga0265325_100309161 334
379 3300031242 Ga0265329_10008929 Ga0265329_100089293 334
380 3300031247 Ga0265340_10020821 Ga0265340_100208211 334
381 3300031249 Ga0265339_10043806 Ga0265339_100438063 334
382 3300031250 Ga0265331_10038656 Ga0265331_100386562 334
383 3300031344 Ga0265316_10105375 Ga0265316_101053752 334
384 3300031711 Ga0265314_10002492 Ga0265314_100024927 334
385 3300031711 Ga0265314_10044370 Ga0265314_100443702 334
386 3300031712 Ga0265342_10007369 Ga0265342_100073692 334
387 3300031712 Ga0265342_10030537 Ga0265342_100305373 334
388 3300039437 Ga0436365_0076921 Ga0436365_0076921_14425_15429 334
389 3300039450 Ga0436363_1691760 Ga0436363_1691760_93_1127 334
390 3300048910 Ga0496107_0037902 Ga0496107_0037902_2050_3054 334
391 3300048918 Ga0496115_0023426 Ga0496115_0023426_2445_3449 334
392 3300048924 Ga0496121_0000221 Ga0496121_0000221_36479_37483 334
393 3300048929 Ga0496126_0131925 Ga0496126_0131925_290_1294 334
394 3300049577 Ga0501041_0012173 Ga0501041_0012173_161_1165 334
395 3300050507 nmdc:mga05p37_66_c1 nmdc:mga05p37_66_c1_59160_60164 334
396 3300050507 nmdc:mga05p37_7273_c1 nmdc:mga05p37_7273_c1_10579_11583 334
397 3300050508 nmdc:mga09592_672_c1 nmdc:mga09592_672_c1_8023_9027 334
398 3300050509 nmdc:mga0qj67_341_c1 nmdc:mga0qj67_341_c1_9906_10910 334
399 3300050510 nmdc:mga06r32_404_c1 nmdc:mga06r32_404_c1_29824_30828 334
400 3300050511 nmdc:mga08y16_615_c1 nmdc:mga08y16_615_c1_9906_10910 334
401 3300050512 nmdc:mga0n895_125715_c1 nmdc:mga0n895_125715_c1_429_1433 334
402 3300050512 nmdc:mga0n895_43_c1 nmdc:mga0n895_43_c1_14223_15227 334
403 3300050513 nmdc:mga0rr50_5102_c1 nmdc:mga0rr50_5102_c1_5012_6016 334
404 3300050514 nmdc:mga08x19_127599_c1 nmdc:mga08x19_127599_c1_566_1570 334
405 3300050515 nmdc:mga0a205_19073_c1 nmdc:mga0a205_19073_c1_5343_6347 334
406 3300050515 nmdc:mga0a205_268_c1 nmdc:mga0a205_268_c1_6311_7315 334
407 3300053131 Ga0500652_000005 Ga0500652_000005_98932_99936 334
408 3300001977 JGI24746J21847_1003668 JGI24746J21847_10036683 335
409 3300001990 JGI24737J22298_10008869 JGI24737J22298_100088691 335
410 3300002076 JGI24749J21850_1003715 JGI24749J21850_10037152 335
411 3300002077 JGI24744J21845_10002186 JGI24744J21845_100021863 335
412 3300003659 JGI25404J52841_10001785 JGI25404J52841_100017851 335
413 3300003911 JGI25405J52794_10006511 JGI25405J52794_100065112 335
414 3300005329 Ga0070683_100080091 Ga0070683_1000800913 335
415 3300005330 Ga0070690_100032348 Ga0070690_1000323483 335
416 3300005331 Ga0070670_100006765 Ga0070670_1000067653 335
417 3300005333 Ga0070677_10022125 Ga0070677_100221252 335
418 3300005337 Ga0070682_100023757 Ga0070682_1000237573 335
419 3300005338 Ga0068868_100013168 Ga0068868_1000131682 335
420 3300005340 Ga0070689_100011343 Ga0070689_1000113431 335
421 3300005341 Ga0070691_10077486 Ga0070691_100774861 335
422 3300005345 Ga0070692_10074200 Ga0070692_100742002 335
423 3300005347 Ga0070668_100230623 Ga0070668_1002306232 335
424 3300005353 Ga0070669_100033750 Ga0070669_1000337503 335
425 3300005355 Ga0070671_100019747 Ga0070671_1000197472 335
426 3300005364 Ga0070673_100074967 Ga0070673_1000749673 335
427 3300005367 Ga0070667_100078274 Ga0070667_1000782743 335
428 3300005434 Ga0070709_10044047 Ga0070709_100440472 335
429 3300005434 Ga0070709_10080285 Ga0070709_100802852 335
430 3300005435 Ga0070714_100004606 Ga0070714_1000046063 335
431 3300005435 Ga0070714_100039953 Ga0070714_1000399533 335
432 3300005436 Ga0070713_100035887 Ga0070713_1000358873 335
433 3300005436 Ga0070713_100175149 Ga0070713_1001751492 335
434 3300005436 Ga0070713_100237268 Ga0070713_1002372681 335
435 3300005436 Ga0070713_100268197 Ga0070713_1002681971 335
436 3300005437 Ga0070710_10013665 Ga0070710_100136652 335
437 3300005437 Ga0070710_10071448 Ga0070710_100714481 335
438 3300005438 Ga0070701_10004186 Ga0070701_100041862 335
439 3300005439 Ga0070711_100018457 Ga0070711_1000184573 335
440 3300005441 Ga0070700_100017552 Ga0070700_1000175522 335
441 3300005444 Ga0070694_100086665 Ga0070694_1000866652 335
442 3300005445 Ga0070708_100054884 Ga0070708_1000548842 335
443 3300005455 Ga0070663_100026662 Ga0070663_1000266621 335
444 3300005456 Ga0070678_100061509 Ga0070678_1000615093 335
445 3300005459 Ga0068867_100018958 Ga0068867_1000189583 335
446 3300005468 Ga0070707_100068310 Ga0070707_1000683102 335
447 3300005518 Ga0070699_100019495 Ga0070699_1000194953 335
448 3300005530 Ga0070679_100120399 Ga0070679_1001203992 335
449 3300005535 Ga0070684_100105562 Ga0070684_1001055622 335
450 3300005535 Ga0070684_100247283 Ga0070684_1002472831 335
451 3300005546 Ga0070696_100139500 Ga0070696_1001395002 335
452 3300005548 Ga0070665_100048596 Ga0070665_1000485962 335
453 3300005549 Ga0070704_100240733 Ga0070704_1002407332 335
454 3300005563 Ga0068855_100293033 Ga0068855_1002930332 335
455 3300005577 Ga0068857_100015943 Ga0068857_1000159433 335
456 3300005578 Ga0068854_100020860 Ga0068854_1000208603 335
457 3300005615 Ga0070702_100013098 Ga0070702_1000130983 335
458 3300005617 Ga0068859_100155044 Ga0068859_1001550441 335
459 3300005618 Ga0068864_100006391 Ga0068864_1000063913 335
460 3300005719 Ga0068861_100029004 Ga0068861_1000290041 335
461 3300005840 Ga0068870_10002318 Ga0068870_100023183 335
462 3300005841 Ga0068863_100016752 Ga0068863_1000167522 335
463 3300005842 Ga0068858_100026083 Ga0068858_1000260833 335
464 3300005844 Ga0068862_100264977 Ga0068862_1002649772 335
465 3300005937 Ga0081455_10003729 Ga0081455_100037295 335
466 3300005937 Ga0081455_10010814 Ga0081455_100108142 335
467 3300005937 Ga0081455_10033699 Ga0081455_100336991 335
468 3300005981 Ga0081538_10010111 Ga0081538_100101112 335
469 3300005983 Ga0081540_1000027 Ga0081540_100002742 335
470 3300005983 Ga0081540_1003265 Ga0081540_10032653 335
471 3300005985 Ga0081539_10050522 Ga0081539_100505222 335
472 3300006028 Ga0070717_10000485 Ga0070717_1000048522 335
473 3300006042 Ga0075368_10011758 Ga0075368_100117581 335
474 3300006051 Ga0075364_10006344 Ga0075364_100063443 335
475 3300006163 Ga0070715_10003295 Ga0070715_100032954 335
476 3300006163 Ga0070715_10032333 Ga0070715_100323332 335
477 3300006173 Ga0070716_100016874 Ga0070716_1000168741 335
478 3300006175 Ga0070712_100030045 Ga0070712_1000300453 335
479 3300006175 Ga0070712_100043123 Ga0070712_1000431233 335
480 3300006175 Ga0070712_100044021 Ga0070712_1000440213 335
481 3300006177 Ga0075362_10044483 Ga0075362_100444831 335
482 3300006186 Ga0075369_10001806 Ga0075369_100018065 335
483 3300006195 Ga0075366_10028015 Ga0075366_100280152 335
484 3300006237 Ga0097621_100147348 Ga0097621_1001473482 335
485 3300006358 Ga0068871_100022579 Ga0068871_1000225791 335
486 3300006844 Ga0075428_100057524 Ga0075428_1000575243 335
487 3300006847 Ga0075431_100033491 Ga0075431_1000334913 335
488 3300006847 Ga0075431_100121846 Ga0075431_1001218463 335
489 3300006847 Ga0075431_100275949 Ga0075431_1002759491 335
490 3300006871 Ga0075434_100043177 Ga0075434_1000431773 335
491 3300006914 Ga0075436_100008403 Ga0075436_1000084033 335
492 3300006931 Ga0097620_100155037 Ga0097620_1001550371 335
493 3300007265 Ga0099794_10031739 Ga0099794_100317392 335
494 3300009093 Ga0105240_10175140 Ga0105240_101751402 335
495 3300009094 Ga0111539_10014117 Ga0111539_100141172 335
496 3300009147 Ga0114129_10006854 Ga0114129_1000685411 335
497 3300009147 Ga0114129_10071921 Ga0114129_100719213 335
498 3300009148 Ga0105243_10047415 Ga0105243_100474153 335
499 3300009174 Ga0105241_10090184 Ga0105241_100901841 335
500 3300009174 Ga0105241_10260979 Ga0105241_102609791 335
501 3300009176 Ga0105242_10025583 Ga0105242_100255832 335
502 3300009177 Ga0105248_10059364 Ga0105248_100593642 335
503 3300009551 Ga0105238_10099304 Ga0105238_100993043 335
504 3300011119 Ga0105246_10051104 Ga0105246_100511042 335
505 3300011119 Ga0105246_10071651 Ga0105246_100716512 335
506 3300013296 Ga0157374_10027828 Ga0157374_100278283 335
507 3300013306 Ga0163162_10051562 Ga0163162_100515623 335
508 3300013307 Ga0157372_10141014 Ga0157372_101410141 335
509 3300014325 Ga0163163_10109647 Ga0163163_101096473 335
510 3300014326 Ga0157380_10093514 Ga0157380_100935141 335
511 3300020070 Ga0206356_11037165 Ga0206356_110371652 335
512 3300021388 Ga0213875_10000122 Ga0213875_1000012254 335
513 3300025898 Ga0207692_10000282 Ga0207692_1000028216 335
514 3300025901 Ga0207688_10001640 Ga0207688_100016401 335
515 3300025903 Ga0207680_10010916 Ga0207680_100109163 335
516 3300025904 Ga0207647_10012209 Ga0207647_100122094 335
517 3300025905 Ga0207685_10041022 Ga0207685_100410222 335
518 3300025906 Ga0207699_10006008 Ga0207699_100060083 335
519 3300025906 Ga0207699_10067023 Ga0207699_100670232 335
520 3300025907 Ga0207645_10063850 Ga0207645_100638501 335
521 3300025908 Ga0207643_10001769 Ga0207643_100017696 335
522 3300025910 Ga0207684_10009569 Ga0207684_1000956910 335
523 3300025911 Ga0207654_10173227 Ga0207654_101732271 335
524 3300025915 Ga0207693_10005387 Ga0207693_100053874 335
525 3300025915 Ga0207693_10084937 Ga0207693_100849372 335
526 3300025916 Ga0207663_10004587 Ga0207663_100045872 335
527 3300025917 Ga0207660_10124432 Ga0207660_101244321 335
528 3300025918 Ga0207662_10001199 Ga0207662_100011995 335
529 3300025919 Ga0207657_10038806 Ga0207657_100388062 335
530 3300025921 Ga0207652_10133288 Ga0207652_101332882 335
531 3300025921 Ga0207652_10295507 Ga0207652_102955071 335
532 3300025922 Ga0207646_10258077 Ga0207646_102580771 335
533 3300025923 Ga0207681_10025222 Ga0207681_100252221 335
534 3300025925 Ga0207650_10004542 Ga0207650_100045428 335
535 3300025927 Ga0207687_10016412 Ga0207687_100164121 335
536 3300025928 Ga0207700_10003347 Ga0207700_100033473 335
537 3300025928 Ga0207700_10037965 Ga0207700_100379653 335
538 3300025929 Ga0207664_10009763 Ga0207664_100097633 335
539 3300025929 Ga0207664_10067954 Ga0207664_100679543 335
540 3300025929 Ga0207664_10106776 Ga0207664_101067762 335
541 3300025929 Ga0207664_10108798 Ga0207664_101087982 335
542 3300025929 Ga0207664_10202086 Ga0207664_102020862 335
543 3300025933 Ga0207706_10002819 Ga0207706_100028194 335
544 3300025935 Ga0207709_10014845 Ga0207709_100148452 335
545 3300025936 Ga0207670_10067403 Ga0207670_100674033 335
546 3300025937 Ga0207669_10051158 Ga0207669_100511582 335
547 3300025938 Ga0207704_10005816 Ga0207704_100058161 335
548 3300025939 Ga0207665_10017261 Ga0207665_100172613 335
549 3300025940 Ga0207691_10009932 Ga0207691_100099325 335
550 3300025941 Ga0207711_10362901 Ga0207711_103629011 335
551 3300025942 Ga0207689_10004730 Ga0207689_100047305 335
552 3300025960 Ga0207651_10016908 Ga0207651_100169083 335
553 3300025972 Ga0207668_10195487 Ga0207668_101954872 335
554 3300025981 Ga0207640_10021910 Ga0207640_100219103 335
555 3300025986 Ga0207658_10014919 Ga0207658_100149193 335
556 3300026023 Ga0207677_10006418 Ga0207677_100064184 335
557 3300026035 Ga0207703_10021203 Ga0207703_100212032 335
558 3300026075 Ga0207708_10002001 Ga0207708_100020015 335
559 3300026078 Ga0207702_10039899 Ga0207702_100398991 335
560 3300026088 Ga0207641_10009850 Ga0207641_100098504 335
561 3300026089 Ga0207648_10004767 Ga0207648_1000476712 335
562 3300026095 Ga0207676_10013708 Ga0207676_100137084 335
563 3300026118 Ga0207675_100003883 Ga0207675_10000388311 335
564 3300026121 Ga0207683_10016334 Ga0207683_100163343 335
565 3300028379 Ga0268266_10029942 Ga0268266_100299421 335
566 3300028380 Ga0268265_10014556 Ga0268265_100145563 335
567 3300028786 Ga0307517_10000512 Ga0307517_1000051215 335
568 3300035111 Ga0373923_0031169 Ga0373923_0031169_600_1607 335
569 3300035170 Ga0373943_0034830 Ga0373943_0034830_38_1045 335
570 3300035171 Ga0373946_0014935 Ga0373946_0014935_671_1678 335
571 3300035691 Ga0373931_0078912 Ga0373931_0078912_371_1378 335
572 3300035695 Ga0373927_0246921 Ga0373927_0246921_80_1087 335
573 3300035725 Ga0373947_0037899 Ga0373947_0037899_1178_2185 335
574 3300037068 Ga0373925_0317423 Ga0373925_0317423_50_1057 335
575 3300037466 Ga0395898_0062352 Ga0395898_0062352_809_1816 335
576 3300037466 Ga0395898_0167403 Ga0395898_0167403_193_1200 335
577 3300037853 Ga0436364_0423755 Ga0436364_0423755_41552_42559 335
578 3300038443 Ga0395901_0246201 Ga0395901_0246201_175_1182 335
579 3300038443 Ga0395901_0477365 Ga0395901_0477365_159_1166 335
580 3300038443 Ga0395901_0488820 Ga0395901_0488820_176_1183 335
581 3300039437 Ga0436365_0842200 Ga0436365_0842200_3970_4977 335
582 3300039437 Ga0436365_1149508 Ga0436365_1149508_155_1162 335
583 3300039447 Ga0436361_1055020 Ga0436361_1055020_1375_2382 335
584 3300039450 Ga0436363_1268862 Ga0436363_1268862_655_1662 335
585 3300046455 Ga0495603_0037151 Ga0495603_0037151_488_1495 335
586 3300046457 Ga0495590_0040082 Ga0495590_0040082_464_1471 335
587 3300046460 Ga0495638_0008231 Ga0495638_0008231_962_1969 335
588 3300046461 Ga0495641_0075574 Ga0495641_0075574_386_1393 335
589 3300046472 Ga0495580_0058785 Ga0495580_0058785_1110_2117 335
590 3300046473 Ga0495582_0034833 Ga0495582_0034833_1191_2198 335
591 3300046473 Ga0495582_0102076 Ga0495582_0102076_223_1230 335
592 3300046475 Ga0495639_0050994 Ga0495639_0050994_612_1619 335
593 3300046476 Ga0495662_0016111 Ga0495662_0016111_87_1094 335
594 3300046499 Ga0495594_0056365 Ga0495594_0056365_35_1042 335
595 3300046511 Ga0495608_0234590 Ga0495608_0234590_18_1025 335
596 3300046517 Ga0495630_0157466 Ga0495630_0157466_559_1566 335
597 3300046523 Ga0495644_0024172 Ga0495644_0024172_395_1402 335
598 3300046537 Ga0495598_0041403 Ga0495598_0041403_135_1142 335
599 3300046538 Ga0495609_0100173 Ga0495609_0100173_158_1165 335
600 3300046539 Ga0495621_0055834 Ga0495621_0055834_224_1231 335
601 3300046559 Ga0495667_0067913 Ga0495667_0067913_990_1997 335
602 3300046642 Ga0495634_0046635 Ga0495634_0046635_1114_2121 335
603 3300046648 Ga0495611_0034086 Ga0495611_0034086_863_1879 335
604 3300046663 Ga0495635_0128331 Ga0495635_0128331_576_1583 335
605 3300046664 Ga0495659_0023703 Ga0495659_0023703_10_1017 335
606 3300046683 Ga0495658_0135987 Ga0495658_0135987_455_1462 335
607 3300046810 Ga0495660_0114681 Ga0495660_0114681_107_1114 335
608 3300047320 Ga0495672_0030618 Ga0495672_0030618_1420_2427 335
609 3300047322 Ga0495680_0256882 Ga0495680_0256882_20_1027 335
610 3300047447 Ga0495685_021999 Ga0495685_021999_1120_2127 335
611 3300047673 Ga0495593_0058615 Ga0495593_0058615_334_1341 335
612 3300048903 Ga0496100_0022979 Ga0496100_0022979_2708_3715 335
613 3300048904 Ga0496101_0001983 Ga0496101_0001983_8705_9712 335
614 3300048904 Ga0496101_0162285 Ga0496101_0162285_683_1690 335
615 3300048904 Ga0496101_0228615 Ga0496101_0228615_375_1382 335
616 3300048905 Ga0496102_0136784 Ga0496102_0136784_40_1047 335
617 3300048905 Ga0496102_0211868 Ga0496102_0211868_342_1349 335
618 3300048906 Ga0496103_0018805 Ga0496103_0018805_1566_2573 335
619 3300048906 Ga0496103_0032986 Ga0496103_0032986_407_1414 335
620 3300048907 Ga0496104_0001496 Ga0496104_0001496_18307_19314 335
621 3300048907 Ga0496104_0003070 Ga0496104_0003070_6773_7780 335
622 3300048907 Ga0496104_0004660 Ga0496104_0004660_3522_4529 335
623 3300048908 Ga0496105_0038039 Ga0496105_0038039_158_1165 335
624 3300048908 Ga0496105_0044916 Ga0496105_0044916_1277_2284 335
625 3300048908 Ga0496105_0056308 Ga0496105_0056308_1069_2076 335
626 3300048909 Ga0496106_0006513 Ga0496106_0006513_5541_6548 335
627 3300048909 Ga0496106_0025653 Ga0496106_0025653_1961_2968 335
628 3300048910 Ga0496107_0011605 Ga0496107_0011605_2960_3967 335
629 3300048911 Ga0496108_0270335 Ga0496108_0270335_427_1434 335
630 3300048912 Ga0496109_0066090 Ga0496109_0066090_1549_2556 335
631 3300048913 Ga0496110_0008731 Ga0496110_0008731_6320_7327 335
632 3300048913 Ga0496110_0297043 Ga0496110_0297043_232_1239 335
633 3300048914 Ga0496111_0002467 Ga0496111_0002467_1734_2741 335
634 3300048914 Ga0496111_0005664 Ga0496111_0005664_2357_3364 335
635 3300048915 Ga0496112_0013195 Ga0496112_0013195_4532_5539 335
636 3300048915 Ga0496112_0026113 Ga0496112_0026113_239_1246 335
637 3300048915 Ga0496112_0210891 Ga0496112_0210891_399_1406 335
638 3300048917 Ga0496114_0007468 Ga0496114_0007468_2527_3534 335
639 3300048917 Ga0496114_0191758 Ga0496114_0191758_438_1445 335
640 3300048918 Ga0496115_0014579 Ga0496115_0014579_4768_5775 335
641 3300048918 Ga0496115_0015732 Ga0496115_0015732_2075_3082 335
642 3300048918 Ga0496115_0029485 Ga0496115_0029485_1498_2505 335
643 3300048918 Ga0496115_0158786 Ga0496115_0158786_126_1133 335
644 3300048918 Ga0496115_0377670 Ga0496115_0377670_116_1123 335
645 3300049593 Ga0501077_0063025 Ga0501077_0063025_17_1024 335
646 3300049741 Ga0501079_0043632 Ga0501079_0043632_671_1678 335
647 3300050489 nmdc:mga03683_37233_c1 nmdc:mga03683_37233_c1_227_1234 335
648 3300050490 nmdc:mga03n38_65129_c1 nmdc:mga03n38_65129_c1_317_1324 335
649 3300050491 nmdc:mga00v17_38731_c1 nmdc:mga00v17_38731_c1_893_1900 335
650 3300050491 nmdc:mga00v17_41217_c1 nmdc:mga00v17_41217_c1_1724_2731 335
651 3300050491 nmdc:mga00v17_87003_c1 nmdc:mga00v17_87003_c1_51_1067 335
652 3300050492 nmdc:mga0yw44_124287_c1 nmdc:mga0yw44_124287_c1_541_1548 335
653 3300050492 nmdc:mga0yw44_31228_c1 nmdc:mga0yw44_31228_c1_1322_2329 335
654 3300050492 nmdc:mga0yw44_813_c1 nmdc:mga0yw44_813_c1_1812_2819 335
655 3300050493 nmdc:mga0k408_110273_c1 nmdc:mga0k408_110273_c1_153_1160 335
656 3300050494 nmdc:mga06z11_2739_c1 nmdc:mga06z11_2739_c1_2328_3335 335
657 3300050496 nmdc:mga07m45_96803_c1 nmdc:mga07m45_96803_c1_281_1297 335
658 3300050507 nmdc:mga05p37_82393_c1 nmdc:mga05p37_82393_c1_713_1720 335
659 3300050509 nmdc:mga0qj67_24846_c1 nmdc:mga0qj67_24846_c1_1183_2190 335
660 3300050510 nmdc:mga06r32_35478_c1 nmdc:mga06r32_35478_c1_1990_2997 335
661 3300050510 nmdc:mga06r32_47137_c1 nmdc:mga06r32_47137_c1_2597_3604 335
662 3300050511 nmdc:mga08y16_122720_c1 nmdc:mga08y16_122720_c1_1520_2527 335
663 3300050511 nmdc:mga08y16_275652_c1 nmdc:mga08y16_275652_c1_182_1189 335
664 3300050512 nmdc:mga0n895_207416_c1 nmdc:mga0n895_207416_c1_229_1236 335
665 3300050513 nmdc:mga0rr50_85379_c1 nmdc:mga0rr50_85379_c1_1315_2322 335
666 3300050514 nmdc:mga08x19_4943_c1 nmdc:mga08x19_4943_c1_1829_2836 335
667 3300050515 nmdc:mga0a205_289522_c1 nmdc:mga0a205_289522_c1_492_1499 335
668 3300053096 Ga0500641_0016442 Ga0500641_0016442_293_1300 335
669 3300053117 Ga0500593_000029 Ga0500593_000029_17003_18010 335
670 3300053139 Ga0500568_0000004 Ga0500568_0000004_456611_457618 335
671 3300053730 Ga0500645_038386 Ga0500645_038386_216_1232 335
672 3300060353 Ga0501082_0007283 Ga0501082_0007283_2141_3148 335
673 2209111006 2214544914 2213593261 336
674 3300000041 ARcpr5oldR_c000055 ARcpr5oldR_00005521 336
675 3300000044 ARSoilOldRDRAFT_c000092 ARSoilOldRDRAFT_0000923 336
676 3300000045 ARCol0oldRDRAFT_c00958 ARCol0oldRDRAFT_009581 336
677 3300000652 ARCol0yngRDRAFT_1000049 ARCol0yngRDRAFT_100004921 336
678 3300001977 JGI24746J21847_1000660 JGI24746J21847_10006607 336
679 3300001989 JGI24739J22299_10005070 JGI24739J22299_100050706 336
680 3300001990 JGI24737J22298_10001725 JGI24737J22298_100017258 336
681 3300001990 JGI24737J22298_10006539 JGI24737J22298_100065395 336
682 3300002070 JGI24750J21931_1000201 JGI24750J21931_10002014 336
683 3300002075 JGI24738J21930_10013666 JGI24738J21930_100136662 336
684 3300002076 JGI24749J21850_1005688 JGI24749J21850_10056881 336
685 3300002077 JGI24744J21845_10004285 JGI24744J21845_100042852 336
686 3300002126 JGI24035J26624_1000855 JGI24035J26624_10008553 336
687 3300002239 JGI24034J26672_10001663 JGI24034J26672_100016632 336
688 3300002244 JGI24742J22300_10000548 JGI24742J22300_100005486 336
689 3300003349 JGI26129J50193_1002302 JGI26129J50193_10023021 336
690 3300005290 Ga0065712_10069289 Ga0065712_100692897 336
691 3300005293 Ga0065715_10000947 Ga0065715_100009477 336
692 3300005293 Ga0065715_10096595 Ga0065715_100965955 336
693 3300005327 Ga0070658_10065700 Ga0070658_100657003 336
694 3300005328 Ga0070676_10004291 Ga0070676_100042912 336
695 3300005328 Ga0070676_10069735 Ga0070676_100697352 336
696 3300005329 Ga0070683_100004677 Ga0070683_1000046773 336
697 3300005329 Ga0070683_100115011 Ga0070683_1001150112 336
698 3300005330 Ga0070690_100008757 Ga0070690_1000087572 336
699 3300005330 Ga0070690_100012125 Ga0070690_1000121255 336
700 3300005330 Ga0070690_100087661 Ga0070690_1000876612 336
701 3300005330 Ga0070690_100173921 Ga0070690_1001739212 336
702 3300005331 Ga0070670_100004378 Ga0070670_1000043788 336
703 3300005331 Ga0070670_100179502 Ga0070670_1001795022 336
704 3300005333 Ga0070677_10010687 Ga0070677_100106872 336
705 3300005334 Ga0068869_100000546 Ga0068869_1000005469 336
706 3300005335 Ga0070666_10016324 Ga0070666_100163246 336
707 3300005336 Ga0070680_100007445 Ga0070680_1000074453 336
708 3300005336 Ga0070680_100009775 Ga0070680_1000097752 336
709 3300005336 Ga0070680_100070058 Ga0070680_1000700582 336
710 3300005337 Ga0070682_100003445 Ga0070682_1000034453 336
711 3300005337 Ga0070682_100018516 Ga0070682_1000185162 336
712 3300005337 Ga0070682_100059999 Ga0070682_1000599992 336
713 3300005337 Ga0070682_100115164 Ga0070682_1001151642 336
714 3300005339 Ga0070660_100004111 Ga0070660_1000041118 336
715 3300005339 Ga0070660_100066748 Ga0070660_1000667482 336
716 3300005340 Ga0070689_100002392 Ga0070689_1000023923 336
717 3300005340 Ga0070689_100023636 Ga0070689_1000236363 336
718 3300005340 Ga0070689_100032975 Ga0070689_1000329753 336
719 3300005341 Ga0070691_10003723 Ga0070691_100037233 336
720 3300005341 Ga0070691_10030403 Ga0070691_100304032 336
721 3300005341 Ga0070691_10059641 Ga0070691_100596412 336
722 3300005343 Ga0070687_100001017 Ga0070687_1000010179 336
723 3300005343 Ga0070687_100065224 Ga0070687_1000652242 336
724 3300005344 Ga0070661_100001763 Ga0070661_10000176312 336
725 3300005344 Ga0070661_100085189 Ga0070661_1000851893 336
726 3300005344 Ga0070661_100209699 Ga0070661_1002096991 336
727 3300005347 Ga0070668_100049439 Ga0070668_1000494392 336
728 3300005347 Ga0070668_100093478 Ga0070668_1000934782 336
729 3300005353 Ga0070669_100009976 Ga0070669_1000099768 336
730 3300005353 Ga0070669_100074273 Ga0070669_1000742732 336
731 3300005354 Ga0070675_100029783 Ga0070675_1000297835 336
732 3300005354 Ga0070675_100059157 Ga0070675_1000591572 336
733 3300005355 Ga0070671_100007031 Ga0070671_1000070314 336
734 3300005355 Ga0070671_100033007 Ga0070671_1000330075 336
735 3300005356 Ga0070674_100018657 Ga0070674_1000186572 336
736 3300005364 Ga0070673_100000050 Ga0070673_1000000505 336
737 3300005364 Ga0070673_100018483 Ga0070673_1000184833 336
738 3300005364 Ga0070673_100199892 Ga0070673_1001998922 336
739 3300005365 Ga0070688_100005098 Ga0070688_1000050984 336
740 3300005365 Ga0070688_100006605 Ga0070688_1000066053 336
741 3300005365 Ga0070688_100019351 Ga0070688_1000193513 336
742 3300005366 Ga0070659_100014541 Ga0070659_1000145413 336
743 3300005366 Ga0070659_100078543 Ga0070659_1000785432 336
744 3300005366 Ga0070659_100105397 Ga0070659_1001053971 336
745 3300005366 Ga0070659_100120676 Ga0070659_1001206762 336
746 3300005367 Ga0070667_100036040 Ga0070667_1000360403 336
747 3300005367 Ga0070667_100038413 Ga0070667_1000384133 336
748 3300005367 Ga0070667_100040047 Ga0070667_1000400475 336
749 3300005434 Ga0070709_10021978 Ga0070709_100219781 336
750 3300005434 Ga0070709_10076338 Ga0070709_100763382 336
751 3300005435 Ga0070714_100006031 Ga0070714_1000060314 336
752 3300005435 Ga0070714_100014175 Ga0070714_1000141754 336
753 3300005435 Ga0070714_100063186 Ga0070714_1000631865 336
754 3300005435 Ga0070714_100517564 Ga0070714_1005175641 336
755 3300005436 Ga0070713_100005289 Ga0070713_1000052895 336
756 3300005436 Ga0070713_100016906 Ga0070713_1000169063 336
757 3300005436 Ga0070713_100080357 Ga0070713_1000803573 336
758 3300005437 Ga0070710_10003313 Ga0070710_100033139 336
759 3300005437 Ga0070710_10012715 Ga0070710_100127152 336
760 3300005438 Ga0070701_10011632 Ga0070701_100116322 336
761 3300005439 Ga0070711_100030906 Ga0070711_1000309063 336
762 3300005439 Ga0070711_100051890 Ga0070711_1000518902 336
763 3300005439 Ga0070711_100152483 Ga0070711_1001524831 336
764 3300005440 Ga0070705_100003118 Ga0070705_1000031183 336
765 3300005440 Ga0070705_100081563 Ga0070705_1000815632 336
766 3300005440 Ga0070705_100265069 Ga0070705_1002650692 336
767 3300005441 Ga0070700_100002692 Ga0070700_1000026923 336
768 3300005441 Ga0070700_100048053 Ga0070700_1000480532 336
769 3300005444 Ga0070694_100008052 Ga0070694_1000080523 336
770 3300005444 Ga0070694_100016432 Ga0070694_1000164323 336
771 3300005445 Ga0070708_100198445 Ga0070708_1001984452 336
772 3300005455 Ga0070663_100020225 Ga0070663_1000202252 336
773 3300005455 Ga0070663_100071052 Ga0070663_1000710522 336
774 3300005456 Ga0070678_100000518 Ga0070678_1000005187 336
775 3300005456 Ga0070678_100048040 Ga0070678_1000480402 336
776 3300005457 Ga0070662_100021515 Ga0070662_1000215155 336
777 3300005457 Ga0070662_100041959 Ga0070662_1000419593 336
778 3300005457 Ga0070662_100067761 Ga0070662_1000677612 336
779 3300005457 Ga0070662_100166872 Ga0070662_1001668722 336
780 3300005458 Ga0070681_10022966 Ga0070681_100229662 336
781 3300005458 Ga0070681_10027987 Ga0070681_100279872 336
782 3300005459 Ga0068867_100009022 Ga0068867_1000090223 336
783 3300005466 Ga0070685_10003674 Ga0070685_100036747 336
784 3300005466 Ga0070685_10007039 Ga0070685_100070393 336
785 3300005530 Ga0070679_100007667 Ga0070679_1000076673 336
786 3300005530 Ga0070679_100030975 Ga0070679_1000309753 336
787 3300005530 Ga0070679_100031240 Ga0070679_1000312402 336
788 3300005530 Ga0070679_100155979 Ga0070679_1001559792 336
789 3300005530 Ga0070679_100174109 Ga0070679_1001741092 336
790 3300005535 Ga0070684_100004205 Ga0070684_10000420511 336
791 3300005535 Ga0070684_100079903 Ga0070684_1000799033 336
792 3300005539 Ga0068853_100030067 Ga0068853_1000300673 336
793 3300005539 Ga0068853_100299184 Ga0068853_1002991842 336
794 3300005543 Ga0070672_100000643 Ga0070672_10000064312 336
795 3300005543 Ga0070672_100052229 Ga0070672_1000522295 336
796 3300005543 Ga0070672_100128143 Ga0070672_1001281432 336
797 3300005544 Ga0070686_100001304 Ga0070686_1000013045 336
798 3300005544 Ga0070686_100065299 Ga0070686_1000652992 336
799 3300005545 Ga0070695_100006337 Ga0070695_1000063378 336
800 3300005545 Ga0070695_100091458 Ga0070695_1000914582 336
801 3300005546 Ga0070696_100018798 Ga0070696_1000187983 336
802 3300005546 Ga0070696_100042306 Ga0070696_1000423063 336
803 3300005547 Ga0070693_100008992 Ga0070693_1000089925 336
804 3300005547 Ga0070693_100031899 Ga0070693_1000318993 336
805 3300005548 Ga0070665_100021396 Ga0070665_1000213963 336
806 3300005549 Ga0070704_100008125 Ga0070704_1000081254 336
807 3300005563 Ga0068855_100021441 Ga0068855_1000214414 336
808 3300005563 Ga0068855_100022276 Ga0068855_1000222763 336
809 3300005563 Ga0068855_100089123 Ga0068855_1000891233 336
810 3300005563 Ga0068855_100111695 Ga0068855_1001116954 336
811 3300005563 Ga0068855_100698323 Ga0068855_1006983231 336
812 3300005564 Ga0070664_100026948 Ga0070664_1000269483 336
813 3300005577 Ga0068857_100001038 Ga0068857_1000010383 336
814 3300005578 Ga0068854_100014606 Ga0068854_1000146065 336
815 3300005578 Ga0068854_100257987 Ga0068854_1002579872 336
816 3300005614 Ga0068856_100009104 Ga0068856_1000091042 336
817 3300005614 Ga0068856_100038924 Ga0068856_1000389243 336
818 3300005615 Ga0070702_100004502 Ga0070702_1000045025 336
819 3300005615 Ga0070702_100035132 Ga0070702_1000351323 336
820 3300005616 Ga0068852_100005996 Ga0068852_1000059965 336
821 3300005617 Ga0068859_100006706 Ga0068859_1000067069 336
822 3300005617 Ga0068859_100135022 Ga0068859_1001350222 336
823 3300005617 Ga0068859_100390827 Ga0068859_1003908272 336
824 3300005618 Ga0068864_100004096 Ga0068864_1000040969 336
825 3300005618 Ga0068864_100022271 Ga0068864_1000222714 336
826 3300005618 Ga0068864_100054797 Ga0068864_1000547973 336
827 3300005718 Ga0068866_10000791 Ga0068866_100007912 336
828 3300005718 Ga0068866_10120115 Ga0068866_101201151 336
829 3300005719 Ga0068861_100002491 Ga0068861_1000024913 336
830 3300005719 Ga0068861_100057052 Ga0068861_1000570522 336
831 3300005840 Ga0068870_10001431 Ga0068870_100014317 336
832 3300005841 Ga0068863_100025687 Ga0068863_1000256873 336
833 3300005841 Ga0068863_100051180 Ga0068863_1000511802 336
834 3300005842 Ga0068858_100010247 Ga0068858_1000102474 336
835 3300005842 Ga0068858_100017836 Ga0068858_1000178362 336
836 3300005842 Ga0068858_100192934 Ga0068858_1001929342 336
837 3300005843 Ga0068860_100002530 Ga0068860_10000253019 336
838 3300005843 Ga0068860_100047790 Ga0068860_1000477902 336
839 3300005843 Ga0068860_100070139 Ga0068860_1000701393 336
840 3300005844 Ga0068862_100006671 Ga0068862_1000066713 336
841 3300005844 Ga0068862_100040884 Ga0068862_1000408842 336
842 3300005844 Ga0068862_100135610 Ga0068862_1001356102 336
843 3300005937 Ga0081455_10000081 Ga0081455_1000008160 336
844 3300005981 Ga0081538_10001580 Ga0081538_1000158013 336
845 3300005981 Ga0081538_10020370 Ga0081538_100203705 336
846 3300005983 Ga0081540_1010700 Ga0081540_10107002 336
847 3300005983 Ga0081540_1010849 Ga0081540_10108493 336
848 3300006028 Ga0070717_10000980 Ga0070717_1000098012 336
849 3300006048 Ga0075363_100004615 Ga0075363_1000046153 336
850 3300006163 Ga0070715_10000289 Ga0070715_1000028910 336
851 3300006163 Ga0070715_10081041 Ga0070715_100810411 336
852 3300006173 Ga0070716_100004147 Ga0070716_1000041474 336
853 3300006173 Ga0070716_100047513 Ga0070716_1000475132 336
854 3300006175 Ga0070712_100020910 Ga0070712_1000209103 336
855 3300006178 Ga0075367_10068408 Ga0075367_100684082 336
856 3300006186 Ga0075369_10016448 Ga0075369_100164481 336
857 3300006237 Ga0097621_100001425 Ga0097621_1000014257 336
858 3300006237 Ga0097621_100010536 Ga0097621_1000105365 336
859 3300006353 Ga0075370_10001231 Ga0075370_100012313 336
860 3300006358 Ga0068871_100002394 Ga0068871_1000023949 336
861 3300006358 Ga0068871_100033578 Ga0068871_1000335782 336
862 3300006358 Ga0068871_100036707 Ga0068871_1000367073 336
863 3300006844 Ga0075428_100005241 Ga0075428_1000052419 336
864 3300006844 Ga0075428_100211000 Ga0075428_1002110002 336
865 3300006846 Ga0075430_100006792 Ga0075430_1000067925 336
866 3300006846 Ga0075430_100010396 Ga0075430_1000103963 336
867 3300006846 Ga0075430_100093633 Ga0075430_1000936332 336
868 3300006847 Ga0075431_100000105 Ga0075431_10000010521 336
869 3300006847 Ga0075431_100178116 Ga0075431_1001781162 336
870 3300006847 Ga0075431_100188585 Ga0075431_1001885852 336
871 3300006871 Ga0075434_100004560 Ga0075434_1000045606 336
872 3300006871 Ga0075434_100139878 Ga0075434_1001398783 336
873 3300006871 Ga0075434_100198536 Ga0075434_1001985362 336
874 3300006871 Ga0075434_100339222 Ga0075434_1003392221 336
875 3300006880 Ga0075429_100005372 Ga0075429_1000053725 336
876 3300006881 Ga0068865_100001097 Ga0068865_1000010979 336
877 3300006881 Ga0068865_100081222 Ga0068865_1000812222 336
878 3300006881 Ga0068865_100134544 Ga0068865_1001345442 336
879 3300006931 Ga0097620_100006706 Ga0097620_1000067069 336
880 3300006931 Ga0097620_100135019 Ga0097620_1001350192 336
881 3300006931 Ga0097620_100390819 Ga0097620_1003908191 336
882 3300007076 Ga0075435_100114450 Ga0075435_1001144502 336
883 3300007265 Ga0099794_10024802 Ga0099794_100248022 336
884 3300009036 Ga0105244_10023607 Ga0105244_100236075 336
885 3300009093 Ga0105240_10202808 Ga0105240_102028082 336
886 3300009094 Ga0111539_10000792 Ga0111539_100007928 336
887 3300009094 Ga0111539_10034470 Ga0111539_100344703 336
888 3300009098 Ga0105245_10025559 Ga0105245_100255596 336
889 3300009098 Ga0105245_10183751 Ga0105245_101837512 336
890 3300009101 Ga0105247_10024258 Ga0105247_100242585 336
891 3300009101 Ga0105247_10025129 Ga0105247_100251295 336
892 3300009101 Ga0105247_10033339 Ga0105247_100333393 336
893 3300009101 Ga0105247_10041196 Ga0105247_100411962 336
894 3300009147 Ga0114129_10001669 Ga0114129_1000166919 336
895 3300009147 Ga0114129_10003927 Ga0114129_1000392716 336
896 3300009147 Ga0114129_10027094 Ga0114129_100270942 336
897 3300009148 Ga0105243_10002400 Ga0105243_1000240016 336
898 3300009148 Ga0105243_10004402 Ga0105243_1000440210 336
899 3300009148 Ga0105243_10094329 Ga0105243_100943292 336
900 3300009174 Ga0105241_10008636 Ga0105241_100086363 336
901 3300009174 Ga0105241_10010427 Ga0105241_100104274 336
902 3300009174 Ga0105241_10028300 Ga0105241_100283003 336
903 3300009176 Ga0105242_10007578 Ga0105242_100075783 336
904 3300009176 Ga0105242_10008734 Ga0105242_100087344 336
905 3300009177 Ga0105248_10010839 Ga0105248_100108398 336
906 3300009177 Ga0105248_10014218 Ga0105248_100142183 336
907 3300009177 Ga0105248_10062156 Ga0105248_100621562 336
908 3300009177 Ga0105248_10081366 Ga0105248_100813665 336
909 3300009545 Ga0105237_10030610 Ga0105237_100306105 336
910 3300009545 Ga0105237_10121260 Ga0105237_101212602 336
911 3300009551 Ga0105238_10009678 Ga0105238_100096785 336
912 3300009551 Ga0105238_10066536 Ga0105238_100665363 336
913 3300009551 Ga0105238_10115780 Ga0105238_101157803 336
914 3300009553 Ga0105249_10011450 Ga0105249_100114506 336
915 3300009553 Ga0105249_10160851 Ga0105249_101608512 336
916 3300010159 Ga0099796_10011799 Ga0099796_100117992 336
917 3300010375 Ga0105239_10024088 Ga0105239_100240883 336
918 3300010375 Ga0105239_10040214 Ga0105239_100402143 336
919 3300011119 Ga0105246_10110265 Ga0105246_101102652 336
920 3300012507 Ga0157342_1000436 Ga0157342_10004362 336
921 3300013100 Ga0157373_10110086 Ga0157373_101100863 336
922 3300013102 Ga0157371_10195899 Ga0157371_101958991 336
923 3300013104 Ga0157370_10035641 Ga0157370_100356413 336
924 3300013104 Ga0157370_10193977 Ga0157370_101939771 336
925 3300013296 Ga0157374_10001167 Ga0157374_100011677 336
926 3300013297 Ga0157378_10008023 Ga0157378_100080237 336
927 3300013306 Ga0163162_10010853 Ga0163162_100108537 336
928 3300013306 Ga0163162_10293571 Ga0163162_102935712 336
929 3300013306 Ga0163162_10671224 Ga0163162_106712241 336
930 3300013307 Ga0157372_10279647 Ga0157372_102796472 336
931 3300014325 Ga0163163_10007288 Ga0163163_1000728810 336
932 3300014326 Ga0157380_10001551 Ga0157380_1000155111 336
933 3300014745 Ga0157377_10009300 Ga0157377_100093002 336
934 3300014968 Ga0157379_10036937 Ga0157379_100369374 336
935 3300014969 Ga0157376_10059766 Ga0157376_100597662 336
936 3300014969 Ga0157376_10065769 Ga0157376_100657692 336
937 3300017792 Ga0163161_10011103 Ga0163161_100111033 336
938 3300017792 Ga0163161_10166223 Ga0163161_101662232 336
939 3300020081 Ga0206354_10798601 Ga0206354_107986011 336
940 3300020082 Ga0206353_11208914 Ga0206353_112089143 336
941 3300021377 Ga0213874_10003167 Ga0213874_100031672 336
942 3300021388 Ga0213875_10047189 Ga0213875_100471892 336
943 3300021388 Ga0213875_10049374 Ga0213875_100493742 336
944 3300024225 Ga0224572_1020299 Ga0224572_10202992 336
945 3300024227 Ga0228598_1010870 Ga0228598_10108702 336
946 3300025271 Ga0207666_1000153 Ga0207666_10001533 336
947 3300025271 Ga0207666_1005029 Ga0207666_10050291 336
948 3300025290 Ga0207673_1000206 Ga0207673_10002063 336
949 3300025315 Ga0207697_10001059 Ga0207697_1000105911 336
950 3300025885 Ga0207653_10009860 Ga0207653_100098604 336
951 3300025893 Ga0207682_10002553 Ga0207682_100025532 336
952 3300025899 Ga0207642_10016582 Ga0207642_100165821 336
953 3300025900 Ga0207710_10000382 Ga0207710_1000038212 336
954 3300025901 Ga0207688_10015245 Ga0207688_100152453 336
955 3300025903 Ga0207680_10008936 Ga0207680_100089362 336
956 3300025903 Ga0207680_10018703 Ga0207680_100187035 336
957 3300025904 Ga0207647_10009987 Ga0207647_100099874 336
958 3300025905 Ga0207685_10000164 Ga0207685_100001645 336
959 3300025905 Ga0207685_10005449 Ga0207685_100054493 336
960 3300025905 Ga0207685_10068246 Ga0207685_100682462 336
961 3300025906 Ga0207699_10004201 Ga0207699_100042014 336
962 3300025906 Ga0207699_10081032 Ga0207699_100810321 336
963 3300025907 Ga0207645_10002745 Ga0207645_100027459 336
964 3300025907 Ga0207645_10077131 Ga0207645_100771312 336
965 3300025908 Ga0207643_10000004 Ga0207643_1000000482 336
966 3300025909 Ga0207705_10217915 Ga0207705_102179151 336
967 3300025911 Ga0207654_10008032 Ga0207654_100080322 336
968 3300025912 Ga0207707_10014644 Ga0207707_100146447 336
969 3300025912 Ga0207707_10016719 Ga0207707_100167194 336
970 3300025912 Ga0207707_10336335 Ga0207707_103363352 336
971 3300025913 Ga0207695_10086365 Ga0207695_100863653 336
972 3300025914 Ga0207671_10088536 Ga0207671_100885362 336
973 3300025914 Ga0207671_10129201 Ga0207671_101292012 336
974 3300025914 Ga0207671_10168615 Ga0207671_101686152 336
975 3300025915 Ga0207693_10001038 Ga0207693_100010387 336
976 3300025915 Ga0207693_10016176 Ga0207693_100161766 336
977 3300025916 Ga0207663_10092326 Ga0207663_100923262 336
978 3300025917 Ga0207660_10007217 Ga0207660_100072178 336
979 3300025917 Ga0207660_10009992 Ga0207660_100099926 336
980 3300025917 Ga0207660_10020495 Ga0207660_100204953 336
981 3300025918 Ga0207662_10000392 Ga0207662_1000039210 336
982 3300025918 Ga0207662_10026540 Ga0207662_100265405 336
983 3300025919 Ga0207657_10002007 Ga0207657_1000200712 336
984 3300025919 Ga0207657_10007818 Ga0207657_100078183 336
985 3300025919 Ga0207657_10012563 Ga0207657_100125636 336
986 3300025919 Ga0207657_10017247 Ga0207657_100172473 336
987 3300025919 Ga0207657_10039060 Ga0207657_100390602 336
988 3300025919 Ga0207657_10043860 Ga0207657_100438602 336
989 3300025920 Ga0207649_10005404 Ga0207649_100054046 336
990 3300025921 Ga0207652_10014772 Ga0207652_100147723 336
991 3300025921 Ga0207652_10058342 Ga0207652_100583425 336
992 3300025921 Ga0207652_10059011 Ga0207652_100590112 336
993 3300025921 Ga0207652_10059737 Ga0207652_100597372 336
994 3300025921 Ga0207652_10113505 Ga0207652_101135053 336
995 3300025923 Ga0207681_10024530 Ga0207681_100245305 336
996 3300025923 Ga0207681_10149905 Ga0207681_101499051 336
997 3300025924 Ga0207694_10082893 Ga0207694_100828932 336
998 3300025924 Ga0207694_10110698 Ga0207694_101106981 336
999 3300025925 Ga0207650_10064045 Ga0207650_100640452 336
1000 3300025925 Ga0207650_10143039 Ga0207650_101430392 336
1001 3300025926 Ga0207659_10000374 Ga0207659_1000037421 336
1002 3300025926 Ga0207659_10066883 Ga0207659_100668832 336
1003 3300025927 Ga0207687_10005411 Ga0207687_100054114 336
1004 3300025927 Ga0207687_10092929 Ga0207687_100929292 336
1005 3300025928 Ga0207700_10015515 Ga0207700_100155152 336
1006 3300025928 Ga0207700_10122533 Ga0207700_101225332 336
1007 3300025928 Ga0207700_10143551 Ga0207700_101435511 336
1008 3300025928 Ga0207700_10161996 Ga0207700_101619961 336
1009 3300025928 Ga0207700_10196238 Ga0207700_101962383 336
1010 3300025929 Ga0207664_10023358 Ga0207664_100233583 336
1011 3300025929 Ga0207664_10033414 Ga0207664_100334142 336
1012 3300025929 Ga0207664_10187014 Ga0207664_101870142 336
1013 3300025931 Ga0207644_10003380 Ga0207644_100033808 336
1014 3300025931 Ga0207644_10004888 Ga0207644_100048887 336
1015 3300025931 Ga0207644_10055390 Ga0207644_100553903 336
1016 3300025932 Ga0207690_10010819 Ga0207690_100108195 336
1017 3300025932 Ga0207690_10013825 Ga0207690_100138253 336
1018 3300025932 Ga0207690_10180370 Ga0207690_101803702 336
1019 3300025932 Ga0207690_10218354 Ga0207690_102183542 336
1020 3300025933 Ga0207706_10006974 Ga0207706_100069748 336
1021 3300025933 Ga0207706_10010623 Ga0207706_100106235 336
1022 3300025933 Ga0207706_10041500 Ga0207706_100415003 336
1023 3300025934 Ga0207686_10007542 Ga0207686_100075423 336
1024 3300025934 Ga0207686_10025932 Ga0207686_100259322 336
1025 3300025935 Ga0207709_10003882 Ga0207709_100038825 336
1026 3300025935 Ga0207709_10091098 Ga0207709_100910982 336
1027 3300025935 Ga0207709_10100149 Ga0207709_101001492 336
1028 3300025936 Ga0207670_10001845 Ga0207670_100018458 336
1029 3300025936 Ga0207670_10004902 Ga0207670_100049023 336
1030 3300025937 Ga0207669_10022356 Ga0207669_100223562 336
1031 3300025938 Ga0207704_10002620 Ga0207704_100026204 336
1032 3300025938 Ga0207704_10265795 Ga0207704_102657952 336
1033 3300025939 Ga0207665_10000541 Ga0207665_1000054110 336
1034 3300025939 Ga0207665_10007581 Ga0207665_100075813 336
1035 3300025940 Ga0207691_10004396 Ga0207691_1000439610 336
1036 3300025940 Ga0207691_10041812 Ga0207691_100418122 336
1037 3300025941 Ga0207711_10002645 Ga0207711_100026455 336
1038 3300025941 Ga0207711_10005696 Ga0207711_100056965 336
1039 3300025941 Ga0207711_10035642 Ga0207711_100356422 336
1040 3300025941 Ga0207711_10145854 Ga0207711_101458542 336
1041 3300025942 Ga0207689_10002724 Ga0207689_1000272412 336
1042 3300025944 Ga0207661_10015256 Ga0207661_100152565 336
1043 3300025944 Ga0207661_10054406 Ga0207661_100544062 336
1044 3300025945 Ga0207679_10001617 Ga0207679_100016174 336
1045 3300025945 Ga0207679_10053172 Ga0207679_100531723 336
1046 3300025949 Ga0207667_10321136 Ga0207667_103211361 336
1047 3300025949 Ga0207667_10497494 Ga0207667_104974941 336
1048 3300025960 Ga0207651_10003064 Ga0207651_100030643 336
1049 3300025960 Ga0207651_10004195 Ga0207651_100041953 336
1050 3300025961 Ga0207712_10003120 Ga0207712_100031209 336
1051 3300025972 Ga0207668_10005763 Ga0207668_100057635 336
1052 3300025972 Ga0207668_10124678 Ga0207668_101246782 336
1053 3300025981 Ga0207640_10015642 Ga0207640_100156422 336
1054 3300025981 Ga0207640_10183600 Ga0207640_101836002 336
1055 3300025986 Ga0207658_10035286 Ga0207658_100352862 336
1056 3300025986 Ga0207658_10103806 Ga0207658_101038061 336
1057 3300025986 Ga0207658_10264958 Ga0207658_102649582 336
1058 3300026023 Ga0207677_10016744 Ga0207677_100167443 336
1059 3300026023 Ga0207677_10028083 Ga0207677_100280833 336
1060 3300026035 Ga0207703_10001822 Ga0207703_1000182210 336
1061 3300026035 Ga0207703_10041983 Ga0207703_100419835 336
1062 3300026035 Ga0207703_10126942 Ga0207703_101269421 336
1063 3300026041 Ga0207639_10019446 Ga0207639_100194463 336
1064 3300026041 Ga0207639_10023621 Ga0207639_100236212 336
1065 3300026067 Ga0207678_10002471 Ga0207678_100024718 336
1066 3300026067 Ga0207678_10019865 Ga0207678_100198655 336
1067 3300026067 Ga0207678_10020641 Ga0207678_100206412 336
1068 3300026067 Ga0207678_10092328 Ga0207678_100923283 336
1069 3300026075 Ga0207708_10001992 Ga0207708_1000199210 336
1070 3300026075 Ga0207708_10006744 Ga0207708_100067448 336
1071 3300026078 Ga0207702_10021444 Ga0207702_100214445 336
1072 3300026078 Ga0207702_10041530 Ga0207702_100415303 336
1073 3300026088 Ga0207641_10015249 Ga0207641_100152494 336
1074 3300026088 Ga0207641_10019509 Ga0207641_100195095 336
1075 3300026089 Ga0207648_10010273 Ga0207648_100102736 336
1076 3300026095 Ga0207676_10001979 Ga0207676_1000197911 336
1077 3300026095 Ga0207676_10002246 Ga0207676_1000224610 336
1078 3300026095 Ga0207676_10050786 Ga0207676_100507863 336
1079 3300026116 Ga0207674_10007733 Ga0207674_100077334 336
1080 3300026116 Ga0207674_10416934 Ga0207674_104169341 336
1081 3300026118 Ga0207675_100007986 Ga0207675_1000079863 336
1082 3300026118 Ga0207675_100057031 Ga0207675_1000570313 336
1083 3300026121 Ga0207683_10002044 Ga0207683_100020446 336
1084 3300026121 Ga0207683_10009279 Ga0207683_100092796 336
1085 3300026142 Ga0207698_10031944 Ga0207698_100319442 336
1086 3300026142 Ga0207698_10186189 Ga0207698_101861892 336
1087 3300027364 Ga0209967_1003782 Ga0209967_10037822 336
1088 3300027665 Ga0209983_1007836 Ga0209983_10078362 336
1089 3300027682 Ga0209971_1002807 Ga0209971_10028075 336
1090 3300027695 Ga0209966_1001490 Ga0209966_10014903 336
1091 3300027717 Ga0209998_10000888 Ga0209998_100008883 336
1092 3300027717 Ga0209998_10001985 Ga0209998_100019856 336
1093 3300027907 Ga0207428_10000501 Ga0207428_1000050143 336
1094 3300027907 Ga0207428_10001016 Ga0207428_100010162 336
1095 3300027907 Ga0207428_10006625 Ga0207428_100066255 336
1096 3300028023 Ga0265357_1000343 Ga0265357_10003432 336
1097 3300028379 Ga0268266_10001262 Ga0268266_1000126228 336
1098 3300028379 Ga0268266_10050610 Ga0268266_100506105 336
1099 3300028380 Ga0268265_10022589 Ga0268265_100225893 336
1100 3300028380 Ga0268265_10055116 Ga0268265_100551162 336
1101 3300028381 Ga0268264_10041889 Ga0268264_100418892 336
1102 3300028381 Ga0268264_10112900 Ga0268264_101129002 336
1103 3300028556 Ga0265337_1004042 Ga0265337_10040423 336
1104 3300028556 Ga0265337_1026650 Ga0265337_10266501 336
1105 3300028800 Ga0265338_10065426 Ga0265338_100654262 336
1106 3300028800 Ga0265338_10263042 Ga0265338_102630422 336
1107 3300030878 Ga0265770_1006025 Ga0265770_10060252 336
1108 3300031090 Ga0265760_10022505 Ga0265760_100225052 336
1109 3300031235 Ga0265330_10015179 Ga0265330_100151792 336
1110 3300031238 Ga0265332_10000839 Ga0265332_100008399 336
1111 3300031241 Ga0265325_10000073 Ga0265325_1000007329 336
1112 3300031241 Ga0265325_10001135 Ga0265325_1000113510 336
1113 3300031247 Ga0265340_10000382 Ga0265340_1000038221 336
1114 3300031249 Ga0265339_10001051 Ga0265339_1000105120 336
1115 3300031249 Ga0265339_10068642 Ga0265339_100686421 336
1116 3300031250 Ga0265331_10015018 Ga0265331_100150185 336
1117 3300031250 Ga0265331_10034057 Ga0265331_100340573 336
1118 3300031344 Ga0265316_10123065 Ga0265316_101230652 336
1119 3300031595 Ga0265313_10000716 Ga0265313_1000071629 336
1120 3300031595 Ga0265313_10038079 Ga0265313_100380792 336
1121 3300031595 Ga0265313_10046363 Ga0265313_100463632 336
1122 3300031712 Ga0265342_10000179 Ga0265342_1000017938 336
1123 3300031712 Ga0265342_10000308 Ga0265342_1000030810 336
1124 3300031712 Ga0265342_10011726 Ga0265342_100117263 336
1125 3300034817 Ga0373948_0002227 Ga0373948_0002227_410_1420 336
1126 3300034817 Ga0373948_0015021 Ga0373948_0015021_267_1331 336
1127 3300034818 Ga0373950_0000796 Ga0373950_0000796_1239_2249 336
1128 3300034819 Ga0373958_0000398 Ga0373958_0000398_3925_4935 336
1129 3300034819 Ga0373958_0009846 Ga0373958_0009846_64_1074 336
1130 3300034820 Ga0373959_0009242 Ga0373959_0009242_530_1540 336
1131 3300034957 Ga0373938_0000726 Ga0373938_0000726_4105_5115 336
1132 3300034957 Ga0373938_0002589 Ga0373938_0002589_1138_2202 336
1133 3300035083 Ga0373926_0002344 Ga0373926_0002344_1016_2026 336
1134 3300035083 Ga0373926_0009236 Ga0373926_0009236_757_1767 336
1135 3300035083 Ga0373926_0050832 Ga0373926_0050832_20_1030 336
1136 3300035084 Ga0373928_0000779 Ga0373928_0000779_2117_3127 336
1137 3300035084 Ga0373928_0001267 Ga0373928_0001267_3187_4197 336
1138 3300035085 Ga0373929_0000064 Ga0373929_0000064_17028_18038 336
1139 3300035085 Ga0373929_0020662 Ga0373929_0020662_77_1087 336
1140 3300035086 Ga0373934_0007860 Ga0373934_0007860_346_1356 336
1141 3300035086 Ga0373934_0020314 Ga0373934_0020314_1518_2528 336
1142 3300035088 Ga0373940_0000195 Ga0373940_0000195_5071_6081 336
1143 3300035089 Ga0373944_0000648 Ga0373944_0000648_4230_5240 336
1144 3300035089 Ga0373944_0001561 Ga0373944_0001561_747_1757 336
1145 3300035089 Ga0373944_0013726 Ga0373944_0013726_273_1283 336
1146 3300035090 Ga0373949_0000532 Ga0373949_0000532_2237_3247 336
1147 3300035090 Ga0373949_0001783 Ga0373949_0001783_4267_5277 336
1148 3300035090 Ga0373949_0005307 Ga0373949_0005307_711_1775 336
1149 3300035091 Ga0373951_0000849 Ga0373951_0000849_783_1793 336
1150 3300035091 Ga0373951_0009362 Ga0373951_0009362_50_1060 336
1151 3300035092 Ga0373952_0000213 Ga0373952_0000213_2490_3500 336
1152 3300035092 Ga0373952_0004534 Ga0373952_0004534_1058_2122 336
1153 3300035092 Ga0373952_0009378 Ga0373952_0009378_76_1086 336
1154 3300035111 Ga0373923_0000903 Ga0373923_0000903_4154_5164 336
1155 3300035111 Ga0373923_0001215 Ga0373923_0001215_4577_5587 336
1156 3300035111 Ga0373923_0004217 Ga0373923_0004217_99_1109 336
1157 3300035112 Ga0373932_0002875 Ga0373932_0002875_1651_2715 336
1158 3300035112 Ga0373932_0003090 Ga0373932_0003090_660_1670 336
1159 3300035113 Ga0373936_0001539 Ga0373936_0001539_7361_8371 336
1160 3300035113 Ga0373936_0003882 Ga0373936_0003882_3971_4981 336
1161 3300035113 Ga0373936_0010131 Ga0373936_0010131_2498_3508 336
1162 3300035114 Ga0373939_0000619 Ga0373939_0000619_4781_5791 336
1163 3300035114 Ga0373939_0007187 Ga0373939_0007187_604_1614 336
1164 3300035114 Ga0373939_0022601 Ga0373939_0022601_82_1092 336
1165 3300035115 Ga0373941_0000027 Ga0373941_0000027_5155_6165 336
1166 3300035115 Ga0373941_0001078 Ga0373941_0001078_2923_3933 336
1167 3300035116 Ga0373945_0000024 Ga0373945_0000024_18889_19899 336
1168 3300035117 Ga0373953_0002197 Ga0373953_0002197_3031_4041 336
1169 3300035117 Ga0373953_0003448 Ga0373953_0003448_2394_3404 336
1170 3300035117 Ga0373953_0012954 Ga0373953_0012954_1802_2839 336
1171 3300035117 Ga0373953_0054980 Ga0373953_0054980_148_1158 336
1172 3300035118 Ga0373954_0004597 Ga0373954_0004597_1420_2430 336
1173 3300035118 Ga0373954_0004676 Ga0373954_0004676_1573_2583 336
1174 3300035118 Ga0373954_0005155 Ga0373954_0005155_1258_2295 336
1175 3300035118 Ga0373954_0021313 Ga0373954_0021313_1346_2356 336
1176 3300035118 Ga0373954_0031272 Ga0373954_0031272_1280_2290 336
1177 3300035119 Ga0373956_0001142 Ga0373956_0001142_9184_10194 336
1178 3300035119 Ga0373956_0012890 Ga0373956_0012890_663_1673 336
1179 3300035119 Ga0373956_0020290 Ga0373956_0020290_563_1573 336
1180 3300035119 Ga0373956_0048050 Ga0373956_0048050_831_1841 336
1181 3300035120 Ga0373957_0004186 Ga0373957_0004186_1816_2826 336
1182 3300035120 Ga0373957_0066681 Ga0373957_0066681_84_1094 336
1183 3300035121 Ga0373960_0000904 Ga0373960_0000904_1096_2106 336
1184 3300035121 Ga0373960_0002618 Ga0373960_0002618_414_1478 336
1185 3300035170 Ga0373943_0013643 Ga0373943_0013643_833_1861 336
1186 3300035170 Ga0373943_0087942 Ga0373943_0087942_31_1041 336
1187 3300035170 Ga0373943_0111838 Ga0373943_0111838_417_1427 336
1188 3300035171 Ga0373946_0005953 Ga0373946_0005953_451_1461 336
1189 3300035171 Ga0373946_0015890 Ga0373946_0015890_439_1464 336
1190 3300035171 Ga0373946_0030578 Ga0373946_0030578_542_1552 336
1191 3300035171 Ga0373946_0044776 Ga0373946_0044776_505_1515 336
1192 3300035171 Ga0373946_0051134 Ga0373946_0051134_177_1187 336
1193 3300035172 Ga0373955_0000172 Ga0373955_0000172_2195_3205 336
1194 3300035172 Ga0373955_0001767 Ga0373955_0001767_3509_4519 336
1195 3300035172 Ga0373955_0003013 Ga0373955_0003013_4700_5710 336
1196 3300035172 Ga0373955_0010601 Ga0373955_0010601_1092_2102 336
1197 3300035172 Ga0373955_0023058 Ga0373955_0023058_1519_2529 336
1198 3300035172 Ga0373955_0174344 Ga0373955_0174344_53_1063 336
1199 3300035207 Ga0373942_0000012 Ga0373942_0000012_17740_18750 336
1200 3300035207 Ga0373942_0002310 Ga0373942_0002310_1844_2908 336
1201 3300035241 Ga0373961_0000800 Ga0373961_0000800_9116_10126 336
1202 3300035241 Ga0373961_0003565 Ga0373961_0003565_1294_2358 336
1203 3300035241 Ga0373961_0006335 Ga0373961_0006335_1502_2512 336
1204 3300035241 Ga0373961_0022769 Ga0373961_0022769_512_1522 336
1205 3300035242 Ga0373962_0000193 Ga0373962_0000193_11293_12303 336
1206 3300035242 Ga0373962_0003472 Ga0373962_0003472_484_1548 336
1207 3300035242 Ga0373962_0011022 Ga0373962_0011022_860_1870 336
1208 3300035410 Ga0373924_0001803 Ga0373924_0001803_2250_3260 336
1209 3300035410 Ga0373924_0006937 Ga0373924_0006937_1473_2483 336
1210 3300035410 Ga0373924_0045414 Ga0373924_0045414_577_1587 336
1211 3300035691 Ga0373931_0007554 Ga0373931_0007554_2678_3688 336
1212 3300035691 Ga0373931_0008043 Ga0373931_0008043_589_1653 336
1213 3300035691 Ga0373931_0035730 Ga0373931_0035730_1078_2088 336
1214 3300035691 Ga0373931_0066399 Ga0373931_0066399_872_1882 336
1215 3300035691 Ga0373931_0096327 Ga0373931_0096327_215_1225 336
1216 3300035691 Ga0373931_0150578 Ga0373931_0150578_276_1286 336
1217 3300035692 Ga0373935_0000038 Ga0373935_0000038_42025_43035 336
1218 3300035692 Ga0373935_0008124 Ga0373935_0008124_1763_2773 336
1219 3300035692 Ga0373935_0008653 Ga0373935_0008653_2279_3304 336
1220 3300035692 Ga0373935_0044826 Ga0373935_0044826_1363_2373 336
1221 3300035692 Ga0373935_0110469 Ga0373935_0110469_197_1225 336
1222 3300035692 Ga0373935_0165642 Ga0373935_0165642_408_1418 336
1223 3300035695 Ga0373927_0001618 Ga0373927_0001618_1366_2376 336
1224 3300035695 Ga0373927_0003867 Ga0373927_0003867_4197_5207 336
1225 3300035695 Ga0373927_0004343 Ga0373927_0004343_7239_8249 336
1226 3300035695 Ga0373927_0098966 Ga0373927_0098966_292_1320 336
1227 3300035695 Ga0373927_0102646 Ga0373927_0102646_47_1057 336
1228 3300035724 Ga0373933_0001050 Ga0373933_0001050_14765_15775 336
1229 3300035724 Ga0373933_0009485 Ga0373933_0009485_2900_3910 336
1230 3300035724 Ga0373933_0019818 Ga0373933_0019818_2583_3593 336
1231 3300035724 Ga0373933_0043041 Ga0373933_0043041_441_1478 336
1232 3300035724 Ga0373933_0070438 Ga0373933_0070438_807_1817 336
1233 3300035725 Ga0373947_0000229 Ga0373947_0000229_80_1090 336
1234 3300035725 Ga0373947_0000581 Ga0373947_0000581_9351_10361 336
1235 3300035725 Ga0373947_0001717 Ga0373947_0001717_1454_2479 336
1236 3300035725 Ga0373947_0012283 Ga0373947_0012283_2026_3036 336
1237 3300035725 Ga0373947_0014863 Ga0373947_0014863_2695_3705 336
1238 3300035725 Ga0373947_0042744 Ga0373947_0042744_1340_2350 336
1239 3300035725 Ga0373947_0137024 Ga0373947_0137024_211_1221 336
1240 3300036401 Ga0373937_0000004 Ga0373937_0000004_57858_58868 336
1241 3300036401 Ga0373937_0001194 Ga0373937_0001194_16995_18005 336
1242 3300036401 Ga0373937_0004490 Ga0373937_0004490_7439_8449 336
1243 3300036401 Ga0373937_0013915 Ga0373937_0013915_4948_5958 336
1244 3300036401 Ga0373937_0051666 Ga0373937_0051666_197_1207 336
1245 3300036401 Ga0373937_0173638 Ga0373937_0173638_885_1913 336
1246 3300037068 Ga0373925_0000424 Ga0373925_0000424_6105_7115 336
1247 3300037068 Ga0373925_0011259 Ga0373925_0011259_4231_5241 336
1248 3300037068 Ga0373925_0011691 Ga0373925_0011691_924_1952 336
1249 3300037068 Ga0373925_0029290 Ga0373925_0029290_2092_3102 336
1250 3300037068 Ga0373925_0042290 Ga0373925_0042290_50_1060 336
1251 3300037068 Ga0373925_0094879 Ga0373925_0094879_340_1350 336
1252 3300037068 Ga0373925_0126885 Ga0373925_0126885_510_1520 336
1253 3300037068 Ga0373925_0172627 Ga0373925_0172627_107_1132 336
1254 3300037853 Ga0436364_1276955 Ga0436364_1276955_1151_2203 336
1255 3300037853 Ga0436364_1535918 Ga0436364_1535918_1548_2558 336
1256 3300039437 Ga0436365_0579618 Ga0436365_0579618_966_1976 336
1257 3300039447 Ga0436361_1192122 Ga0436361_1192122_640_1650 336
1258 3300039450 Ga0436363_0548238 Ga0436363_0548238_6618_7631 336
1259 3300042005 Ga0439448_0026459 Ga0439448_0026459_624_1697 336
1260 3300042012 Ga0439455_0013241 Ga0439455_0013241_107_1180 336
1261 3300044693 Ga0466961_0130400 Ga0466961_0130400_362_1372 336
1262 3300044694 Ga0466963_0153274 Ga0466963_0153274_467_1477 336
1263 3300044842 Ga0466957_0047540 Ga0466957_0047540_823_1833 336
1264 3300045051 Ga0451576_0020422 Ga0451576_0020422_5600_6610 336
1265 3300045976 Ga0466967_0004180 Ga0466967_0004180_1729_2739 336
1266 3300045976 Ga0466967_0050355 Ga0466967_0050355_1567_2577 336
1267 3300046452 Ga0495617_017934 Ga0495617_017934_159_1169 336
1268 3300046454 Ga0495592_0000032 Ga0495592_0000032_120998_122008 336
1269 3300046454 Ga0495592_0009020 Ga0495592_0009020_6302_7312 336
1270 3300046454 Ga0495592_0016478 Ga0495592_0016478_2691_3701 336
1271 3300046454 Ga0495592_0016847 Ga0495592_0016847_2654_3664 336
1272 3300046455 Ga0495603_0013983 Ga0495603_0013983_285_1310 336
1273 3300046455 Ga0495603_0061058 Ga0495603_0061058_819_1829 336
1274 3300046459 Ga0495629_0001232 Ga0495629_0001232_16189_17199 336
1275 3300046459 Ga0495629_0001465 Ga0495629_0001465_15822_16847 336
1276 3300046459 Ga0495629_0002050 Ga0495629_0002050_6379_7389 336
1277 3300046460 Ga0495638_0077106 Ga0495638_0077106_942_1952 336
1278 3300046461 Ga0495641_0006019 Ga0495641_0006019_2709_3719 336
1279 3300046461 Ga0495641_0014796 Ga0495641_0014796_2414_3439 336
1280 3300046461 Ga0495641_0026036 Ga0495641_0026036_376_1386 336
1281 3300046462 Ga0495651_0000799 Ga0495651_0000799_21338_22348 336
1282 3300046462 Ga0495651_0001360 Ga0495651_0001360_14772_15782 336
1283 3300046462 Ga0495651_0007731 Ga0495651_0007731_1397_2425 336
1284 3300046462 Ga0495651_0013259 Ga0495651_0013259_1879_2889 336
1285 3300046463 Ga0495653_0000012 Ga0495653_0000012_195642_196652 336
1286 3300046463 Ga0495653_0001069 Ga0495653_0001069_10726_11736 336
1287 3300046463 Ga0495653_0003134 Ga0495653_0003134_3486_4496 336
1288 3300046463 Ga0495653_0018668 Ga0495653_0018668_2730_3740 336
1289 3300046472 Ga0495580_0005009 Ga0495580_0005009_1515_2525 336
1290 3300046472 Ga0495580_0017623 Ga0495580_0017623_887_1897 336
1291 3300046473 Ga0495582_0000570 Ga0495582_0000570_7081_8106 336
1292 3300046473 Ga0495582_0004754 Ga0495582_0004754_2354_3364 336
1293 3300046473 Ga0495582_0044708 Ga0495582_0044708_155_1165 336
1294 3300046475 Ga0495639_0002103 Ga0495639_0002103_6138_7148 336
1295 3300046475 Ga0495639_0014886 Ga0495639_0014886_1386_2396 336
1296 3300046475 Ga0495639_0027206 Ga0495639_0027206_75_1085 336
1297 3300046475 Ga0495639_0077878 Ga0495639_0077878_86_1096 336
1298 3300046476 Ga0495662_0000879 Ga0495662_0000879_10519_11529 336
1299 3300046476 Ga0495662_0001012 Ga0495662_0001012_4233_5243 336
1300 3300046476 Ga0495662_0002431 Ga0495662_0002431_2026_3036 336
1301 3300046476 Ga0495662_0025150 Ga0495662_0025150_391_1401 336
1302 3300046477 Ga0495664_0000004 Ga0495664_0000004_185665_186675 336
1303 3300046477 Ga0495664_0000146 Ga0495664_0000146_535_1545 336
1304 3300046477 Ga0495664_0000563 Ga0495664_0000563_14456_15466 336
1305 3300046477 Ga0495664_0126142 Ga0495664_0126142_50_1060 336
1306 3300046491 Ga0495584_0010718 Ga0495584_0010718_2161_3171 336
1307 3300046492 Ga0495585_0002912 Ga0495585_0002912_6571_7581 336
1308 3300046499 Ga0495594_0026229 Ga0495594_0026229_1261_2286 336
1309 3300046499 Ga0495594_0101385 Ga0495594_0101385_174_1184 336
1310 3300046501 Ga0495607_0042874 Ga0495607_0042874_1263_2273 336
1311 3300046506 Ga0495583_0087074 Ga0495583_0087074_168_1178 336
1312 3300046511 Ga0495608_0000017 Ga0495608_0000017_185652_186662 336
1313 3300046511 Ga0495608_0002512 Ga0495608_0002512_235_1245 336
1314 3300046511 Ga0495608_0015292 Ga0495608_0015292_3397_4407 336
1315 3300046511 Ga0495608_0095690 Ga0495608_0095690_741_1778 336
1316 3300046511 Ga0495608_0099976 Ga0495608_0099976_155_1165 336
1317 3300046514 Ga0495618_0000006 Ga0495618_0000006_144758_145768 336
1318 3300046514 Ga0495618_0000473 Ga0495618_0000473_24405_25415 336
1319 3300046514 Ga0495618_0035358 Ga0495618_0035358_483_1493 336
1320 3300046514 Ga0495618_0091228 Ga0495618_0091228_195_1205 336
1321 3300046516 Ga0495628_0000001 Ga0495628_0000001_185654_186664 336
1322 3300046516 Ga0495628_0004103 Ga0495628_0004103_6756_7766 336
1323 3300046516 Ga0495628_0005499 Ga0495628_0005499_5647_6675 336
1324 3300046516 Ga0495628_0011495 Ga0495628_0011495_2493_3503 336
1325 3300046517 Ga0495630_0000422 Ga0495630_0000422_1592_2602 336
1326 3300046517 Ga0495630_0007807 Ga0495630_0007807_5989_6999 336
1327 3300046517 Ga0495630_0068325 Ga0495630_0068325_1116_2126 336
1328 3300046520 Ga0495637_0063129 Ga0495637_0063129_241_1251 336
1329 3300046523 Ga0495644_0043960 Ga0495644_0043960_253_1263 336
1330 3300046524 Ga0495648_0075844 Ga0495648_0075844_668_1717 336
1331 3300046526 Ga0495666_0010597 Ga0495666_0010597_649_1659 336
1332 3300046526 Ga0495666_0014995 Ga0495666_0014995_622_1632 336
1333 3300046529 Ga0495652_0000002 Ga0495652_0000002_400188_401198 336
1334 3300046529 Ga0495652_0003864 Ga0495652_0003864_4841_5851 336
1335 3300046529 Ga0495652_0047192 Ga0495652_0047192_1707_2735 336
1336 3300046529 Ga0495652_0070621 Ga0495652_0070621_1435_2472 336
1337 3300046531 Ga0495665_0000227 Ga0495665_0000227_25909_26919 336
1338 3300046531 Ga0495665_0084309 Ga0495665_0084309_413_1423 336
1339 3300046533 Ga0495640_0000001 Ga0495640_0000001_494192_495202 336
1340 3300046533 Ga0495640_0001488 Ga0495640_0001488_7938_8948 336
1341 3300046533 Ga0495640_0002833 Ga0495640_0002833_9537_10547 336
1342 3300046533 Ga0495640_0024233 Ga0495640_0024233_2750_3760 336
1343 3300046533 Ga0495640_0034413 Ga0495640_0034413_1553_2563 336
1344 3300046533 Ga0495640_0059161 Ga0495640_0059161_1412_2440 336
1345 3300046535 Ga0495586_0012979 Ga0495586_0012979_774_1784 336
1346 3300046536 Ga0495587_0000008 Ga0495587_0000008_185872_186882 336
1347 3300046536 Ga0495587_0003639 Ga0495587_0003639_3344_4354 336
1348 3300046536 Ga0495587_0008368 Ga0495587_0008368_1239_2264 336
1349 3300046536 Ga0495587_0012855 Ga0495587_0012855_935_1945 336
1350 3300046538 Ga0495609_0065627 Ga0495609_0065627_57_1067 336
1351 3300046543 Ga0495645_0000002 Ga0495645_0000002_185667_186677 336
1352 3300046543 Ga0495645_0009348 Ga0495645_0009348_2000_3028 336
1353 3300046543 Ga0495645_0023181 Ga0495645_0023181_1308_2318 336
1354 3300046543 Ga0495645_0097739 Ga0495645_0097739_93_1103 336
1355 3300046557 Ga0495622_0000406 Ga0495622_0000406_25244_26254 336
1356 3300046558 Ga0495633_0005373 Ga0495633_0005373_3935_4945 336
1357 3300046559 Ga0495667_0000124 Ga0495667_0000124_34088_35098 336
1358 3300046559 Ga0495667_0001092 Ga0495667_0001092_7818_8828 336
1359 3300046559 Ga0495667_0011961 Ga0495667_0011961_1408_2436 336
1360 3300046559 Ga0495667_0034171 Ga0495667_0034171_2225_3235 336
1361 3300046559 Ga0495667_0082616 Ga0495667_0082616_387_1397 336
1362 3300046559 Ga0495667_0090541 Ga0495667_0090541_697_1707 336
1363 3300046615 Ga0495656_0000554 Ga0495656_0000554_4022_5032 336
1364 3300046642 Ga0495634_0000003 Ga0495634_0000003_171101_172111 336
1365 3300046642 Ga0495634_0004424 Ga0495634_0004424_4273_5283 336
1366 3300046642 Ga0495634_0109540 Ga0495634_0109540_450_1460 336
1367 3300046642 Ga0495634_0117121 Ga0495634_0117121_487_1497 336
1368 3300046663 Ga0495635_0000002 Ga0495635_0000002_300260_301270 336
1369 3300046663 Ga0495635_0002104 Ga0495635_0002104_5402_6412 336
1370 3300046663 Ga0495635_0016723 Ga0495635_0016723_1790_2818 336
1371 3300046663 Ga0495635_0022896 Ga0495635_0022896_1344_2354 336
1372 3300046663 Ga0495635_0024301 Ga0495635_0024301_912_1922 336
1373 3300046663 Ga0495635_0031658 Ga0495635_0031658_298_1308 336
1374 3300046663 Ga0495635_0040864 Ga0495635_0040864_710_1738 336
1375 3300046664 Ga0495659_0016170 Ga0495659_0016170_752_1762 336
1376 3300046674 Ga0495588_0004978 Ga0495588_0004978_74_1084 336
1377 3300046674 Ga0495588_0127124 Ga0495588_0127124_302_1327 336
1378 3300046675 Ga0495657_0000054 Ga0495657_0000054_32086_33096 336
1379 3300046675 Ga0495657_0008729 Ga0495657_0008729_3577_4614 336
1380 3300046675 Ga0495657_0096183 Ga0495657_0096183_461_1471 336
1381 3300046675 Ga0495657_0158481 Ga0495657_0158481_70_1080 336
1382 3300046678 Ga0495599_0000005 Ga0495599_0000005_13889_14899 336
1383 3300046678 Ga0495599_0020724 Ga0495599_0020724_730_1740 336
1384 3300046678 Ga0495599_0022366 Ga0495599_0022366_2913_3923 336
1385 3300046678 Ga0495599_0035696 Ga0495599_0035696_1022_2050 336
1386 3300046678 Ga0495599_0076139 Ga0495599_0076139_934_1944 336
1387 3300046679 Ga0495623_0000148 Ga0495623_0000148_20039_21049 336
1388 3300046679 Ga0495623_0002021 Ga0495623_0002021_3552_4562 336
1389 3300046679 Ga0495623_0027550 Ga0495623_0027550_2225_3235 336
1390 3300046679 Ga0495623_0097234 Ga0495623_0097234_143_1171 336
1391 3300046680 Ga0495646_0000002 Ga0495646_0000002_285212_286222 336
1392 3300046680 Ga0495646_0016750 Ga0495646_0016750_845_1855 336
1393 3300046680 Ga0495646_0035451 Ga0495646_0035451_874_1884 336
1394 3300046680 Ga0495646_0112055 Ga0495646_0112055_516_1526 336
1395 3300046680 Ga0495646_0155292 Ga0495646_0155292_70_1080 336
1396 3300046681 Ga0495647_0009539 Ga0495647_0009539_96_1106 336
1397 3300046683 Ga0495658_0000543 Ga0495658_0000543_17601_18626 336
1398 3300046683 Ga0495658_0002466 Ga0495658_0002466_3345_4373 336
1399 3300046683 Ga0495658_0034649 Ga0495658_0034649_1252_2262 336
1400 3300046683 Ga0495658_0050889 Ga0495658_0050889_473_1483 336
1401 3300046689 Ga0495613_0002489 Ga0495613_0002489_1645_2655 336
1402 3300046689 Ga0495613_0168083 Ga0495613_0168083_251_1261 336
1403 3300046689 Ga0495613_0188279 Ga0495613_0188279_158_1183 336
1404 3300046690 Ga0495624_0013382 Ga0495624_0013382_241_1251 336
1405 3300046690 Ga0495624_0027306 Ga0495624_0027306_374_1384 336
1406 3300046690 Ga0495624_0168611 Ga0495624_0168611_91_1101 336
1407 3300046691 Ga0495670_0009745 Ga0495670_0009745_3199_4209 336
1408 3300046809 Ga0495600_0000012 Ga0495600_0000012_36797_37807 336
1409 3300046809 Ga0495600_0004562 Ga0495600_0004562_1410_2420 336
1410 3300046809 Ga0495600_0006388 Ga0495600_0006388_1247_2257 336
1411 3300046809 Ga0495600_0016042 Ga0495600_0016042_2645_3673 336
1412 3300047315 Ga0495581_0003432 Ga0495581_0003432_2682_3692 336
1413 3300047315 Ga0495581_0027818 Ga0495581_0027818_703_1713 336
1414 3300047315 Ga0495581_0058614 Ga0495581_0058614_497_1507 336
1415 3300047315 Ga0495581_0070554 Ga0495581_0070554_974_1984 336
1416 3300047317 Ga0495604_0000009 Ga0495604_0000009_139628_140638 336
1417 3300047317 Ga0495604_0000422 Ga0495604_0000422_11792_12802 336
1418 3300047317 Ga0495604_0013474 Ga0495604_0013474_2880_3890 336
1419 3300047317 Ga0495604_0015408 Ga0495604_0015408_1499_2527 336
1420 3300047317 Ga0495604_0057176 Ga0495604_0057176_1793_2803 336
1421 3300047319 Ga0495674_0000002 Ga0495674_0000002_185655_186665 336
1422 3300047319 Ga0495674_0000641 Ga0495674_0000641_26797_27807 336
1423 3300047319 Ga0495674_0001683 Ga0495674_0001683_3195_4205 336
1424 3300047319 Ga0495674_0026343 Ga0495674_0026343_2461_3489 336
1425 3300047319 Ga0495674_0175444 Ga0495674_0175444_83_1093 336
1426 3300047321 Ga0495676_0013899 Ga0495676_0013899_2509_3519 336
1427 3300047321 Ga0495676_0014569 Ga0495676_0014569_1349_2374 336
1428 3300047321 Ga0495676_0115141 Ga0495676_0115141_210_1220 336
1429 3300047321 Ga0495676_0151994 Ga0495676_0151994_584_1594 336
1430 3300047322 Ga0495680_0001385 Ga0495680_0001385_5082_6092 336
1431 3300047322 Ga0495680_0002139 Ga0495680_0002139_13407_14417 336
1432 3300047322 Ga0495680_0012328 Ga0495680_0012328_5392_6417 336
1433 3300047322 Ga0495680_0031291 Ga0495680_0031291_1691_2719 336
1434 3300047322 Ga0495680_0033026 Ga0495680_0033026_1287_2315 336
1435 3300047322 Ga0495680_0121345 Ga0495680_0121345_339_1349 336
1436 3300047322 Ga0495680_0133161 Ga0495680_0133161_485_1495 336
1437 3300047444 Ga0495675_0000028 Ga0495675_0000028_51277_52287 336
1438 3300047444 Ga0495675_0001398 Ga0495675_0001398_10001_11011 336
1439 3300047444 Ga0495675_0002936 Ga0495675_0002936_2950_3960 336
1440 3300047444 Ga0495675_0020224 Ga0495675_0020224_1838_2875 336
1441 3300047471 Ga0495684_0000006 Ga0495684_0000006_185614_186624 336
1442 3300047471 Ga0495684_0003544 Ga0495684_0003544_11097_12107 336
1443 3300047471 Ga0495684_0096843 Ga0495684_0096843_954_1982 336
1444 3300047471 Ga0495684_0173043 Ga0495684_0173043_571_1581 336
1445 3300047471 Ga0495684_0186828 Ga0495684_0186828_169_1197 336
1446 3300047471 Ga0495684_0246095 Ga0495684_0246095_191_1201 336
1447 3300047673 Ga0495593_0000140 Ga0495593_0000140_25770_26780 336
1448 3300047673 Ga0495593_0003620 Ga0495593_0003620_3251_4276 336
1449 3300047673 Ga0495593_0017662 Ga0495593_0017662_911_1921 336
1450 3300047673 Ga0495593_0019980 Ga0495593_0019980_1696_2706 336
1451 3300047673 Ga0495593_0029930 Ga0495593_0029930_774_1784 336
1452 3300047673 Ga0495593_0141588 Ga0495593_0141588_34_1044 336
1453 3300048088 Ga0495602_0000005 Ga0495602_0000005_159009_160019 336
1454 3300048088 Ga0495602_0012613 Ga0495602_0012613_7199_8227 336
1455 3300048088 Ga0495602_0013847 Ga0495602_0013847_6502_7512 336
1456 3300048088 Ga0495602_0023728 Ga0495602_0023728_2644_3654 336
1457 3300048088 Ga0495602_0028153 Ga0495602_0028153_252_1262 336
1458 3300048088 Ga0495602_0192161 Ga0495602_0192161_462_1499 336
1459 3300048088 Ga0495602_0318915 Ga0495602_0318915_45_1055 336
1460 3300048089 Ga0495614_0018609 Ga0495614_0018609_1059_2084 336
1461 3300048089 Ga0495614_0050054 Ga0495614_0050054_669_1679 336
1462 3300048903 Ga0496100_0003363 Ga0496100_0003363_5548_6612 336
1463 3300048904 Ga0496101_0029082 Ga0496101_0029082_653_1663 336
1464 3300048904 Ga0496101_0038116 Ga0496101_0038116_2265_3329 336
1465 3300048905 Ga0496102_0002793 Ga0496102_0002793_7234_8244 336
1466 3300048905 Ga0496102_0018288 Ga0496102_0018288_4148_5158 336
1467 3300048905 Ga0496102_0031173 Ga0496102_0031173_2327_3391 336
1468 3300048905 Ga0496102_0115925 Ga0496102_0115925_709_1719 336
1469 3300048906 Ga0496103_0002369 Ga0496103_0002369_1912_2922 336
1470 3300048907 Ga0496104_0000092 Ga0496104_0000092_3586_4614 336
1471 3300048907 Ga0496104_0002184 Ga0496104_0002184_14818_15828 336
1472 3300048907 Ga0496104_0199419 Ga0496104_0199419_502_1512 336
1473 3300048907 Ga0496104_0381273 Ga0496104_0381273_96_1106 336
1474 3300048908 Ga0496105_0002505 Ga0496105_0002505_10531_11559 336
1475 3300048908 Ga0496105_0257332 Ga0496105_0257332_180_1190 336
1476 3300048909 Ga0496106_0001556 Ga0496106_0001556_6448_7458 336
1477 3300048909 Ga0496106_0007123 Ga0496106_0007123_5983_7047 336
1478 3300048909 Ga0496106_0010646 Ga0496106_0010646_96_1106 336
1479 3300048909 Ga0496106_0215676 Ga0496106_0215676_428_1438 336
1480 3300048910 Ga0496107_0006823 Ga0496107_0006823_4654_5664 336
1481 3300048910 Ga0496107_0011996 Ga0496107_0011996_2250_3260 336
1482 3300048910 Ga0496107_0129269 Ga0496107_0129269_33_1043 336
1483 3300048911 Ga0496108_0044354 Ga0496108_0044354_144_1154 336
1484 3300048911 Ga0496108_0126233 Ga0496108_0126233_217_1227 336
1485 3300048912 Ga0496109_0004575 Ga0496109_0004575_9847_10911 336
1486 3300048912 Ga0496109_0004879 Ga0496109_0004879_2721_3731 336
1487 3300048912 Ga0496109_0074738 Ga0496109_0074738_1116_2126 336
1488 3300048913 Ga0496110_0033011 Ga0496110_0033011_3335_4399 336
1489 3300048913 Ga0496110_0310766 Ga0496110_0310766_258_1268 336
1490 3300048914 Ga0496111_0033708 Ga0496111_0033708_653_1663 336
1491 3300048914 Ga0496111_0071923 Ga0496111_0071923_439_1449 336
1492 3300048914 Ga0496111_0072960 Ga0496111_0072960_1108_2172 336
1493 3300048915 Ga0496112_0058511 Ga0496112_0058511_2519_3529 336
1494 3300048915 Ga0496112_0063132 Ga0496112_0063132_313_1323 336
1495 3300048915 Ga0496112_0122868 Ga0496112_0122868_487_1497 336
1496 3300048915 Ga0496112_0221768 Ga0496112_0221768_401_1429 336
1497 3300048915 Ga0496112_0269770 Ga0496112_0269770_54_1064 336
1498 3300048916 Ga0496113_0004559 Ga0496113_0004559_2294_3304 336
1499 3300048916 Ga0496113_0030266 Ga0496113_0030266_657_1667 336
1500 3300048917 Ga0496114_0045150 Ga0496114_0045150_724_1788 336
1501 3300048917 Ga0496114_0076177 Ga0496114_0076177_1164_2174 336
1502 3300048918 Ga0496115_0002647 Ga0496115_0002647_2354_3364 336
1503 3300048918 Ga0496115_0003701 Ga0496115_0003701_5339_6349 336
1504 3300048918 Ga0496115_0023859 Ga0496115_0023859_351_1415 336
1505 3300048918 Ga0496115_0044951 Ga0496115_0044951_421_1431 336
1506 3300048918 Ga0496115_0152473 Ga0496115_0152473_529_1557 336
1507 3300048918 Ga0496115_0405039 Ga0496115_0405039_46_1056 336
1508 3300048922 Ga0496119_0004791 Ga0496119_0004791_6959_7969 336
1509 3300048923 Ga0496120_0058817 Ga0496120_0058817_559_1608 336
1510 3300048925 Ga0496122_0004715 Ga0496122_0004715_10711_11721 336
1511 3300048925 Ga0496122_0067923 Ga0496122_0067923_110_1159 336
1512 3300048926 Ga0496123_0000896 Ga0496123_0000896_22324_23334 336
1513 3300048928 Ga0496125_0089726 Ga0496125_0089726_982_2031 336
1514 3300048929 Ga0496126_0058390 Ga0496126_0058390_1472_2482 336
1515 3300049569 Ga0501032_0010289 Ga0501032_0010289_2850_3860 336
1516 3300049569 Ga0501032_0012972 Ga0501032_0012972_4537_5547 336
1517 3300049569 Ga0501032_0068072 Ga0501032_0068072_577_1587 336
1518 3300049569 Ga0501032_0082357 Ga0501032_0082357_408_1475 336
1519 3300049569 Ga0501032_0183670 Ga0501032_0183670_337_1347 336
1520 3300049570 Ga0501033_0007661 Ga0501033_0007661_4801_5811 336
1521 3300049570 Ga0501033_0012963 Ga0501033_0012963_4614_5681 336
1522 3300049570 Ga0501033_0037850 Ga0501033_0037850_2045_3055 336
1523 3300049571 Ga0501034_0001958 Ga0501034_0001958_852_1862 336
1524 3300049571 Ga0501034_0005332 Ga0501034_0005332_1717_2727 336
1525 3300049571 Ga0501034_0022013 Ga0501034_0022013_699_1709 336
1526 3300049571 Ga0501034_0120311 Ga0501034_0120311_876_1886 336
1527 3300049572 Ga0501036_0000177 Ga0501036_0000177_33874_34884 336
1528 3300049572 Ga0501036_0025279 Ga0501036_0025279_3719_4729 336
1529 3300049573 Ga0501037_0044129 Ga0501037_0044129_808_1818 336
1530 3300049573 Ga0501037_0060809 Ga0501037_0060809_1536_2546 336
1531 3300049573 Ga0501037_0147000 Ga0501037_0147000_548_1558 336
1532 3300049573 Ga0501037_0246760 Ga0501037_0246760_137_1147 336
1533 3300049574 Ga0501038_0060423 Ga0501038_0060423_1724_2734 336
1534 3300049574 Ga0501038_0261202 Ga0501038_0261202_337_1347 336
1535 3300049575 Ga0501039_0071256 Ga0501039_0071256_219_1229 336
1536 3300049576 Ga0501040_0036906 Ga0501040_0036906_1600_2610 336
1537 3300049579 Ga0501043_0001480 Ga0501043_0001480_436_1446 336
1538 3300049579 Ga0501043_0027137 Ga0501043_0027137_1507_2517 336
1539 3300049579 Ga0501043_0071087 Ga0501043_0071087_38_1105 336
1540 3300049580 Ga0501046_0080311 Ga0501046_0080311_1227_2237 336
1541 3300049581 Ga0501047_0000756 Ga0501047_0000756_7662_8672 336
1542 3300049581 Ga0501047_0063953 Ga0501047_0063953_1727_2794 336
1543 3300049581 Ga0501047_0301515 Ga0501047_0301515_337_1347 336
1544 3300049582 Ga0501048_0000357 Ga0501048_0000357_7634_8644 336
1545 3300049584 Ga0501068_0007338 Ga0501068_0007338_4364_5374 336
1546 3300049586 Ga0501070_0000711 Ga0501070_0000711_12416_13426 336
1547 3300049586 Ga0501070_0022959 Ga0501070_0022959_2829_3860 336
1548 3300049587 Ga0501071_0129021 Ga0501071_0129021_174_1184 336
1549 3300049588 Ga0501072_0132472 Ga0501072_0132472_28_1149 336
1550 3300049589 Ga0501073_0013709 Ga0501073_0013709_3398_4429 336
1551 3300049589 Ga0501073_0027800 Ga0501073_0027800_2183_3193 336
1552 3300049590 Ga0501074_0063526 Ga0501074_0063526_246_1256 336
1553 3300049592 Ga0501076_0004238 Ga0501076_0004238_3105_4115 336
1554 3300049593 Ga0501077_0061193 Ga0501077_0061193_560_1570 336
1555 3300049741 Ga0501079_0012618 Ga0501079_0012618_271_1281 336
1556 3300049741 Ga0501079_0126174 Ga0501079_0126174_629_1639 336
1557 3300049742 Ga0501080_0003552 Ga0501080_0003552_9482_10492 336
1558 3300049742 Ga0501080_0053896 Ga0501080_0053896_1903_2913 336
1559 3300049742 Ga0501080_0132077 Ga0501080_0132077_844_1854 336
1560 3300049743 Ga0501081_0249931 Ga0501081_0249931_241_1251 336
1561 3300049744 Ga0501083_0007330 Ga0501083_0007330_183_1193 336
1562 3300049744 Ga0501083_0014091 Ga0501083_0014091_3462_4472 336
1563 3300049744 Ga0501083_0033341 Ga0501083_0033341_225_1235 336
1564 3300049744 Ga0501083_0046358 Ga0501083_0046358_589_1599 336
1565 3300049822 Ga0501035_0014773 Ga0501035_0014773_4517_5527 336
1566 3300049822 Ga0501035_0032539 Ga0501035_0032539_429_1439 336
1567 3300049822 Ga0501035_0085018 Ga0501035_0085018_859_1869 336
1568 3300049822 Ga0501035_0174786 Ga0501035_0174786_764_1831 336
1569 3300049823 Ga0501044_0035047 Ga0501044_0035047_2488_3498 336
1570 3300049823 Ga0501044_0163665 Ga0501044_0163665_1017_2027 336
1571 3300049823 Ga0501044_0236190 Ga0501044_0236190_30_1040 336
1572 3300049823 Ga0501044_0249294 Ga0501044_0249294_379_1389 336
1573 3300049824 Ga0501045_0035685 Ga0501045_0035685_264_1274 336
1574 3300049824 Ga0501045_0105199 Ga0501045_0105199_911_2032 336
1575 3300050490 nmdc:mga03n38_16516_c1 nmdc:mga03n38_16516_c1_164_1174 336
1576 3300050493 nmdc:mga0k408_100398_c1 nmdc:mga0k408_100398_c1_645_1655 336
1577 3300050493 nmdc:mga0k408_56850_c1 nmdc:mga0k408_56850_c1_610_1674 336
1578 3300050496 nmdc:mga07m45_130278_c1 nmdc:mga07m45_130278_c1_40_1053 336
1579 3300050507 nmdc:mga05p37_109457_c1 nmdc:mga05p37_109457_c1_802_1812 336
1580 3300050507 nmdc:mga05p37_140_c1 nmdc:mga05p37_140_c1_14571_15581 336
1581 3300050507 nmdc:mga05p37_6119_c1 nmdc:mga05p37_6119_c1_12029_13039 336
1582 3300050507 nmdc:mga05p37_71061_c1 nmdc:mga05p37_71061_c1_1591_2601 336
1583 3300050508 nmdc:mga09592_1649_c1 nmdc:mga09592_1649_c1_6316_7326 336
1584 3300050508 nmdc:mga09592_72071_c1 nmdc:mga09592_72071_c1_545_1555 336
1585 3300050509 nmdc:mga0qj67_234885_c1 nmdc:mga0qj67_234885_c1_293_1303 336
1586 3300050509 nmdc:mga0qj67_36670_c1 nmdc:mga0qj67_36670_c1_675_1685 336
1587 3300050509 nmdc:mga0qj67_58518_c1 nmdc:mga0qj67_58518_c1_1515_2525 336
1588 3300050510 nmdc:mga06r32_171978_c1 nmdc:mga06r32_171978_c1_929_1939 336
1589 3300050510 nmdc:mga06r32_206794_c1 nmdc:mga06r32_206794_c1_162_1172 336
1590 3300050510 nmdc:mga06r32_671_c1 nmdc:mga06r32_671_c1_4901_5911 336
1591 3300050511 nmdc:mga08y16_104_c1 nmdc:mga08y16_104_c1_35912_36922 336
1592 3300050511 nmdc:mga08y16_193762_c1 nmdc:mga08y16_193762_c1_286_1296 336
1593 3300050511 nmdc:mga08y16_865_c1 nmdc:mga08y16_865_c1_22439_23449 336
1594 3300050512 nmdc:mga0n895_181670_c1 nmdc:mga0n895_181670_c1_37_1047 336
1595 3300050512 nmdc:mga0n895_258606_c1 nmdc:mga0n895_258606_c1_173_1222 336
1596 3300050512 nmdc:mga0n895_266281_c1 nmdc:mga0n895_266281_c1_382_1392 336
1597 3300050513 nmdc:mga0rr50_187906_c1 nmdc:mga0rr50_187906_c1_76_1086 336
1598 3300050514 nmdc:mga08x19_9575_c1 nmdc:mga08x19_9575_c1_805_1815 336
1599 3300050515 nmdc:mga0a205_11361_c1 nmdc:mga0a205_11361_c1_5373_6437 336
1600 3300053077 Ga0495601_0000002 Ga0495601_0000002_124797_125807 336
1601 3300053077 Ga0495601_0000860 Ga0495601_0000860_3922_4932 336
1602 3300053077 Ga0495601_0001376 Ga0495601_0001376_5911_6939 336
1603 3300053077 Ga0495601_0008009 Ga0495601_0008009_90_1100 336
1604 3300053077 Ga0495601_0014329 Ga0495601_0014329_2167_3177 336
1605 3300053077 Ga0495601_0082542 Ga0495601_0082542_543_1571 336
1606 3300053078 Ga0495612_0000010 Ga0495612_0000010_60685_61695 336
1607 3300053078 Ga0495612_0000075 Ga0495612_0000075_14410_15420 336
1608 3300053078 Ga0495612_0000562 Ga0495612_0000562_9981_10991 336
1609 3300053078 Ga0495612_0001712 Ga0495612_0001712_6992_8002 336
1610 3300053078 Ga0495612_0002201 Ga0495612_0002201_5582_6610 336
1611 3300053078 Ga0495612_0013643 Ga0495612_0013643_368_1405 336
1612 3300053078 Ga0495612_0058465 Ga0495612_0058465_281_1309 336
1613 3300053084 Ga0495595_0000026 Ga0495595_0000026_11762_12772 336
1614 3300053084 Ga0495595_0000168 Ga0495595_0000168_17397_18407 336
1615 3300053084 Ga0495595_0000589 Ga0495595_0000589_3266_4294 336
1616 3300053084 Ga0495595_0003174 Ga0495595_0003174_2093_3121 336
1617 3300053084 Ga0495595_0013688 Ga0495595_0013688_1630_2640 336
1618 3300053085 Ga0495619_0000019 Ga0495619_0000019_84133_85143 336
1619 3300053085 Ga0495619_0000045 Ga0495619_0000045_29802_30830 336
1620 3300053085 Ga0495619_0000388 Ga0495619_0000388_27805_28830 336
1621 3300053085 Ga0495619_0003526 Ga0495619_0003526_4220_5230 336
1622 3300053085 Ga0495619_0008861 Ga0495619_0008861_2842_3870 336
1623 3300053085 Ga0495619_0013999 Ga0495619_0013999_3859_4869 336
1624 3300053085 Ga0495619_0016140 Ga0495619_0016140_2604_3614 336
1625 3300053085 Ga0495619_0032806 Ga0495619_0032806_2155_3165 336
1626 3300053085 Ga0495619_0109834 Ga0495619_0109834_624_1661 336
1627 3300053087 Ga0500643_001251 Ga0500643_001251_6725_7735 336
1628 3300053094 Ga0500566_0001887 Ga0500566_0001887_7339_8388 336
1629 3300053104 Ga0500556_0000290 Ga0500556_0000290_35071_36081 336
1630 3300053119 Ga0500595_000002 Ga0500595_000002_986633_987643 336
1631 3300053131 Ga0500652_005131 Ga0500652_005131_427_1437 336
1632 3300053136 Ga0500559_0006649 Ga0500559_0006649_422_1471 336
1633 3300053148 Ga0500590_011273 Ga0500590_011273_3222_4271 336
1634 3300053153 Ga0500616_0000002 Ga0500616_0000002_1097270_1098280 336
1635 3300053730 Ga0500645_000156 Ga0500645_000156_18170_19180 336
1636 3300054114 Ga0501084_0160775 Ga0501084_0160775_97_1107 336
1637 3300060353 Ga0501082_0254320 Ga0501082_0254320_319_1329 336
1638 3300061734 Ga0530510_0107136 Ga0530510_0107136_584_1594 336
1639 3300061734 Ga0530510_0110402 Ga0530510_0110402_539_1549 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

94

227

0.99

PF17863

AAA_lid_2

AAA lid domain

300

368

0.93

PF07728

AAA_5

AAA domain (dynein-related subfamily)

94

225

0.89

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

62

269

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.902 6 331
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8785 6 331
4upb-assembly1.cif.gz_C electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.8168 20 330
4upb-assembly1.cif.gz_E electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.8054 20 335
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.7833 20 331
ID Description Score Start End Superfamily
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9652 25 219 3.40.50.300
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9515 233 334 1.10.8.80
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9365 25 219 3.40.50.300
af_O53314_205_312_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9334 224 334 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.914 221 331 1.10.8.80
ID Description Score Start End GO Terms
AF-A0A7S8EE60-F1-model_v4 AAA domain-containing protein 0.9902 13 336 GO:0005524
GO:0016887
AF-A0A439V4C5-F1-model_v4 AAA family ATPase 0.9902 76 146 GO:0005524
GO:0016887
AF-A0A529WXH1-F1-model_v4 MoxR family ATPase 0.9886 13 333 GO:0005524
GO:0016887
AF-X6D4F3-F1-model_v4 ATPase AAA 0.9882 16 333 GO:0005524
GO:0016887
AF-A0A1Q8ZQI2-F1-model_v4 AAA family ATPase 0.9881 13 334 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map