F494652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1540 | 367 | 3080 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300024225|Ga0224572_1037013|Ga0224572_10370132 |
| Length | 172 |
| Sequence | MIYPIVKFGNPVLEKPAEPVTVFDDELKKLVEDMFESMYEAHGVGLAAPQIGISQRLAVIDVTFKEDPDAKLVLANPEILHTEGKHTQPEGCLSIPEFREPVSRARKVTIRAQDVNGKWYEKTTKEGEELLARAFLHETEHLNGKLYISHISALKRDLMKRKIRKLMKAGEW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 133 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 134 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 135 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 202 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 203 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 238 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 268 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 269 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 270 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 271 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 272 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 278 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 351 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 352 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 353 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 354 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.06 |
| Nodule | 0 |
| Rhizoplane | 4.35 |
| Rhizosphere | 94.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0224572_1037013 | 3300024225 | Unclassified | 923 |
| 2 | MBSR1b_contig_11819402 | 2162886012 | Unclassified | 1532 |
| 3 | LJNas_1001454 | 3300000546 | Bacteria | 3381 |
| 4 | JGI24034J26672_10005869 | 3300002239 | Unclassified | 1766 |
| 5 | JGI24751J29686_10014259 | 3300002459 | Unclassified | 1641 |
| 6 | Ga0065712_10152185 | 3300005290 | Unclassified | 1361 |
| 7 | Ga0065712_10173172 | 3300005290 | Unclassified | 1232 |
| 8 | Ga0065715_10037980 | 3300005293 | Unclassified | 1581 |
| 9 | Ga0065715_10103000 | 3300005293 | Bacteria | 3068 |
| 10 | Ga0065715_10178575 | 3300005293 | Unclassified | 1493 |
| 11 | Ga0070658_10005929 | 3300005327 | Bacteria | 9915 |
| 12 | Ga0070658_10418706 | 3300005327 | Unclassified | 1152 |
| 13 | Ga0070658_10701949 | 3300005327 | Bacteria | 878 |
| 14 | Ga0070676_10016811 | 3300005328 | Bacteria | 4044 |
| 15 | Ga0070676_10151440 | 3300005328 | Bacteria | 1485 |
| 16 | Ga0070683_100000035 | 3300005329 | Bacteria | 122362 |
| 17 | Ga0070683_100012627 | 3300005329 | Bacteria | 7342 |
| 18 | Ga0070683_100026713 | 3300005329 | Bacteria | 5202 |
| 19 | Ga0070683_100290670 | 3300005329 | Bacteria | 1554 |
| 20 | Ga0070683_100546070 | 3300005329 | Bacteria | 1108 |
| 21 | Ga0070683_100554868 | 3300005329 | Unclassified | 1098 |
| 22 | Ga0070690_100224183 | 3300005330 | Bacteria | 1318 |
| 23 | Ga0070690_100585602 | 3300005330 | Bacteria | 845 |
| 24 | Ga0070670_100005429 | 3300005331 | Bacteria | 10749 |
| 25 | Ga0070670_100016074 | 3300005331 | Bacteria | 6423 |
| 26 | Ga0070670_100035001 | 3300005331 | Unclassified | 4323 |
| 27 | Ga0068869_100009378 | 3300005334 | Bacteria | 6350 |
| 28 | Ga0068869_100012141 | 3300005334 | Bacteria | 5680 |
| 29 | Ga0068869_100013081 | 3300005334 | Bacteria | 5508 |
| 30 | Ga0068869_101315843 | 3300005334 | Bacteria | 638 |
| 31 | Ga0070666_10008702 | 3300005335 | Bacteria | 6312 |
| 32 | Ga0070666_10104046 | 3300005335 | Bacteria | 1959 |
| 33 | Ga0070680_100135893 | 3300005336 | Bacteria | 2060 |
| 34 | Ga0070680_100443266 | 3300005336 | Bacteria | 1109 |
| 35 | Ga0070682_100011890 | 3300005337 | Bacteria | 4980 |
| 36 | Ga0070682_100025124 | 3300005337 | Unclassified | 3553 |
| 37 | Ga0070682_100383356 | 3300005337 | Bacteria | 1058 |
| 38 | Ga0068868_100002728 | 3300005338 | Bacteria | 12233 |
| 39 | Ga0068868_100002835 | 3300005338 | Bacteria | 12010 |
| 40 | Ga0068868_100022051 | 3300005338 | Bacteria | 4802 |
| 41 | Ga0068868_100036034 | 3300005338 | Bacteria | 3827 |
| 42 | Ga0068868_100125206 | 3300005338 | Bacteria | 2099 |
| 43 | Ga0068868_100155671 | 3300005338 | Unclassified | 1885 |
| 44 | Ga0068868_101028202 | 3300005338 | Bacteria | 755 |
| 45 | Ga0070660_100009702 | 3300005339 | Bacteria | 6782 |
| 46 | Ga0070660_100614258 | 3300005339 | Unclassified | 909 |
| 47 | Ga0070689_100068871 | 3300005340 | Bacteria | 2760 |
| 48 | Ga0070689_100069133 | 3300005340 | Unclassified | 2755 |
| 49 | Ga0070689_100185672 | 3300005340 | Bacteria | 1691 |
| 50 | Ga0070691_10054356 | 3300005341 | Unclassified | 1917 |
| 51 | Ga0070661_100007203 | 3300005344 | Bacteria | 7664 |
| 52 | Ga0070661_100025417 | 3300005344 | Bacteria | 4255 |
| 53 | Ga0070692_10077057 | 3300005345 | Unclassified | 1788 |
| 54 | Ga0070692_10099137 | 3300005345 | Unclassified | 1595 |
| 55 | Ga0070668_100002226 | 3300005347 | Bacteria | 14253 |
| 56 | Ga0070668_100007587 | 3300005347 | Bacteria | 8054 |
| 57 | Ga0070668_100465366 | 3300005347 | Bacteria | 1089 |
| 58 | Ga0070669_100005043 | 3300005353 | Bacteria | 9542 |
| 59 | Ga0070669_100049122 | 3300005353 | Bacteria | 3080 |
| 60 | Ga0070675_100047761 | 3300005354 | Bacteria | 3508 |
| 61 | Ga0070675_100155371 | 3300005354 | Unclassified | 1964 |
| 62 | Ga0070675_100732877 | 3300005354 | Bacteria | 901 |
| 63 | Ga0070675_100737801 | 3300005354 | Unclassified | 898 |
| 64 | Ga0070675_100953992 | 3300005354 | Bacteria | 787 |
| 65 | Ga0070675_100962791 | 3300005354 | Bacteria | 783 |
| 66 | Ga0070675_101060470 | 3300005354 | Bacteria | 745 |
| 67 | Ga0070671_100976174 | 3300005355 | Unclassified | 742 |
| 68 | Ga0070671_101066372 | 3300005355 | Bacteria | 709 |
| 69 | Ga0070674_100221991 | 3300005356 | Unclassified | 1470 |
| 70 | Ga0070674_100462311 | 3300005356 | Unclassified | 1050 |
| 71 | Ga0070674_101026534 | 3300005356 | Bacteria | 725 |
| 72 | Ga0070673_100062580 | 3300005364 | Unclassified | 2957 |
| 73 | Ga0070673_100665248 | 3300005364 | Bacteria | 954 |
| 74 | Ga0070673_101074723 | 3300005364 | Bacteria | 751 |
| 75 | Ga0070688_100013826 | 3300005365 | Unclassified | 4564 |
| 76 | Ga0070688_100357010 | 3300005365 | Bacteria | 1071 |
| 77 | Ga0070659_100001203 | 3300005366 | Bacteria | 18844 |
| 78 | Ga0070659_100080397 | 3300005366 | Bacteria | 2602 |
| 79 | Ga0070667_100116848 | 3300005367 | Bacteria | 2317 |
| 80 | Ga0070709_10018837 | 3300005434 | Bacteria | 3983 |
| 81 | Ga0070709_10020338 | 3300005434 | Bacteria | 3849 |
| 82 | Ga0070709_10031911 | 3300005434 | Bacteria | 3173 |
| 83 | Ga0070709_10040735 | 3300005434 | Bacteria | 2858 |
| 84 | Ga0070709_10065352 | 3300005434 | Bacteria | 2329 |
| 85 | Ga0070709_10087970 | 3300005434 | Unclassified | 2042 |
| 86 | Ga0070709_10119214 | 3300005434 | Bacteria | 1786 |
| 87 | Ga0070709_10162923 | 3300005434 | Bacteria | 1552 |
| 88 | Ga0070709_10176908 | 3300005434 | Bacteria | 1495 |
| 89 | Ga0070709_10206445 | 3300005434 | Bacteria | 1394 |
| 90 | Ga0070709_10276903 | 3300005434 | Bacteria | 1218 |
| 91 | Ga0070709_10472435 | 3300005434 | Bacteria | 948 |
| 92 | Ga0070709_10751656 | 3300005434 | Bacteria | 762 |
| 93 | Ga0070714_100000169 | 3300005435 | Bacteria | 52788 |
| 94 | Ga0070714_100008519 | 3300005435 | Bacteria | 8016 |
| 95 | Ga0070714_100020608 | 3300005435 | Bacteria | 5388 |
| 96 | Ga0070714_100059174 | 3300005435 | Bacteria | 3284 |
| 97 | Ga0070714_100072893 | 3300005435 | Bacteria | 2974 |
| 98 | Ga0070714_100149551 | 3300005435 | Bacteria | 2103 |
| 99 | Ga0070714_100174919 | 3300005435 | Bacteria | 1950 |
| 100 | Ga0070714_100180387 | 3300005435 | Bacteria | 1921 |
| 101 | Ga0070714_100214185 | 3300005435 | Bacteria | 1767 |
| 102 | Ga0070714_100285751 | 3300005435 | Bacteria | 1534 |
| 103 | Ga0070714_100299439 | 3300005435 | Bacteria | 1499 |
| 104 | Ga0070714_100335812 | 3300005435 | Bacteria | 1416 |
| 105 | Ga0070714_100350431 | 3300005435 | Bacteria | 1386 |
| 106 | Ga0070714_100633047 | 3300005435 | Unclassified | 1029 |
| 107 | Ga0070714_100832475 | 3300005435 | Unclassified | 894 |
| 108 | Ga0070713_100000649 | 3300005436 | Bacteria | 22243 |
| 109 | Ga0070713_100002519 | 3300005436 | Bacteria | 11974 |
| 110 | Ga0070713_100005251 | 3300005436 | Bacteria | 8830 |
| 111 | Ga0070713_100012465 | 3300005436 | Bacteria | 6237 |
| 112 | Ga0070713_100020997 | 3300005436 | Bacteria | 5014 |
| 113 | Ga0070713_100061733 | 3300005436 | Bacteria | 3136 |
| 114 | Ga0070713_100068860 | 3300005436 | Bacteria | 2983 |
| 115 | Ga0070713_100084009 | 3300005436 | Unclassified | 2723 |
| 116 | Ga0070713_100086586 | 3300005436 | Unclassified | 2686 |
| 117 | Ga0070713_100101904 | 3300005436 | Bacteria | 2488 |
| 118 | Ga0070713_100136863 | 3300005436 | Bacteria | 2165 |
| 119 | Ga0070713_100228716 | 3300005436 | Bacteria | 1690 |
| 120 | Ga0070713_100272077 | 3300005436 | Bacteria | 1551 |
| 121 | Ga0070713_100308576 | 3300005436 | Bacteria | 1458 |
| 122 | Ga0070713_100425658 | 3300005436 | Bacteria | 1243 |
| 123 | Ga0070713_100551494 | 3300005436 | Bacteria | 1091 |
| 124 | Ga0070713_100559448 | 3300005436 | Bacteria | 1083 |
| 125 | Ga0070713_100652762 | 3300005436 | Bacteria | 1002 |
| 126 | Ga0070713_101459694 | 3300005436 | Bacteria | 664 |
| 127 | Ga0070713_101687081 | 3300005436 | Unclassified | 615 |
| 128 | Ga0070713_101754075 | 3300005436 | Bacteria | 602 |
| 129 | Ga0070710_10027644 | 3300005437 | Bacteria | 3027 |
| 130 | Ga0070710_10035124 | 3300005437 | Unclassified | 2732 |
| 131 | Ga0070710_10069378 | 3300005437 | Bacteria | 2028 |
| 132 | Ga0070710_10073573 | 3300005437 | Bacteria | 1976 |
| 133 | Ga0070710_10082954 | 3300005437 | Unclassified | 1875 |
| 134 | Ga0070710_10416500 | 3300005437 | Bacteria | 904 |
| 135 | Ga0070711_100000293 | 3300005439 | Bacteria | 26001 |
| 136 | Ga0070711_100001830 | 3300005439 | Bacteria | 11867 |
| 137 | Ga0070711_100007650 | 3300005439 | Bacteria | 6580 |
| 138 | Ga0070711_100054373 | 3300005439 | Bacteria | 2763 |
| 139 | Ga0070711_100060645 | 3300005439 | Bacteria | 2630 |
| 140 | Ga0070711_100065489 | 3300005439 | Bacteria | 2542 |
| 141 | Ga0070711_100104622 | 3300005439 | Bacteria | 2065 |
| 142 | Ga0070711_100283720 | 3300005439 | Bacteria | 1311 |
| 143 | Ga0070711_100933380 | 3300005439 | Bacteria | 742 |
| 144 | Ga0070711_101500636 | 3300005439 | Unclassified | 588 |
| 145 | Ga0070705_100038418 | 3300005440 | Unclassified | 2708 |
| 146 | Ga0070705_100107033 | 3300005440 | Bacteria | 1779 |
| 147 | Ga0070705_100194634 | 3300005440 | Bacteria | 1385 |
| 148 | Ga0070700_100366056 | 3300005441 | Bacteria | 1073 |
| 149 | Ga0070694_100530115 | 3300005444 | Bacteria | 941 |
| 150 | Ga0070708_100000242 | 3300005445 | Bacteria | 40613 |
| 151 | Ga0070708_100001715 | 3300005445 | Bacteria | 16862 |
| 152 | Ga0070708_100003584 | 3300005445 | Bacteria | 12182 |
| 153 | Ga0070708_100006436 | 3300005445 | Bacteria | 9353 |
| 154 | Ga0070708_100020572 | 3300005445 | Bacteria | 5568 |
| 155 | Ga0070708_100086330 | 3300005445 | Bacteria | 2850 |
| 156 | Ga0070663_100043712 | 3300005455 | Bacteria | 3154 |
| 157 | Ga0070678_100071377 | 3300005456 | Bacteria | 2599 |
| 158 | Ga0070678_100188708 | 3300005456 | Bacteria | 1693 |
| 159 | Ga0070662_100004575 | 3300005457 | Bacteria | 8759 |
| 160 | Ga0070662_100011008 | 3300005457 | Bacteria | 5959 |
| 161 | Ga0070662_100268491 | 3300005457 | Unclassified | 1377 |
| 162 | Ga0070662_100646416 | 3300005457 | Bacteria | 892 |
| 163 | Ga0070681_10008506 | 3300005458 | Bacteria | 10048 |
| 164 | Ga0070681_10012341 | 3300005458 | Bacteria | 8472 |
| 165 | Ga0070681_10073861 | 3300005458 | Bacteria | 3372 |
| 166 | Ga0070681_10074017 | 3300005458 | Unclassified | 3368 |
| 167 | Ga0070681_10082353 | 3300005458 | Bacteria | 3173 |
| 168 | Ga0070681_10155758 | 3300005458 | Bacteria | 2210 |
| 169 | Ga0070681_10518012 | 3300005458 | Bacteria | 1106 |
| 170 | Ga0070681_10654872 | 3300005458 | Unclassified | 965 |
| 171 | Ga0068867_100001484 | 3300005459 | Bacteria | 16236 |
| 172 | Ga0068867_100013571 | 3300005459 | Bacteria | 5769 |
| 173 | Ga0068867_100024102 | 3300005459 | Bacteria | 4361 |
| 174 | Ga0070685_10031930 | 3300005466 | Bacteria | 2946 |
| 175 | Ga0070706_100001331 | 3300005467 | Bacteria | 26271 |
| 176 | Ga0070706_100001385 | 3300005467 | Bacteria | 25705 |
| 177 | Ga0070706_100002503 | 3300005467 | Bacteria | 18507 |
| 178 | Ga0070706_100013794 | 3300005467 | Bacteria | 7474 |
| 179 | Ga0070706_100044511 | 3300005467 | Bacteria | 4101 |
| 180 | Ga0070706_100233521 | 3300005467 | Unclassified | 1717 |
| 181 | Ga0070706_100280770 | 3300005467 | Bacteria | 1554 |
| 182 | Ga0070707_100002130 | 3300005468 | Bacteria | 18942 |
| 183 | Ga0070707_100002318 | 3300005468 | Bacteria | 18176 |
| 184 | Ga0070707_100012306 | 3300005468 | Bacteria | 7988 |
| 185 | Ga0070707_100137336 | 3300005468 | Bacteria | 2378 |
| 186 | Ga0070707_100384795 | 3300005468 | Bacteria | 1363 |
| 187 | Ga0070707_100400753 | 3300005468 | Bacteria | 1332 |
| 188 | Ga0070698_100000589 | 3300005471 | Bacteria | 39008 |
| 189 | Ga0070698_100000689 | 3300005471 | Bacteria | 36131 |
| 190 | Ga0070698_100040140 | 3300005471 | Bacteria | 4813 |
| 191 | Ga0070699_100000679 | 3300005518 | Bacteria | 31766 |
| 192 | Ga0070699_100000716 | 3300005518 | Bacteria | 30815 |
| 193 | Ga0070699_100025935 | 3300005518 | Bacteria | 5054 |
| 194 | Ga0070699_100027280 | 3300005518 | Bacteria | 4928 |
| 195 | Ga0070699_100639241 | 3300005518 | Bacteria | 971 |
| 196 | Ga0070679_100074471 | 3300005530 | Bacteria | 3386 |
| 197 | Ga0070679_100159877 | 3300005530 | Bacteria | 2227 |
| 198 | Ga0070679_100398877 | 3300005530 | Bacteria | 1321 |
| 199 | Ga0070679_100736401 | 3300005530 | Unclassified | 929 |
| 200 | Ga0070679_101177436 | 3300005530 | Bacteria | 711 |
| 201 | Ga0070684_100000037 | 3300005535 | Bacteria | 95058 |
| 202 | Ga0070684_100083944 | 3300005535 | Bacteria | 2823 |
| 203 | Ga0070684_100086086 | 3300005535 | Bacteria | 2788 |
| 204 | Ga0070684_100128722 | 3300005535 | Bacteria | 2283 |
| 205 | Ga0070684_100401329 | 3300005535 | Unclassified | 1264 |
| 206 | Ga0070697_100000053 | 3300005536 | Bacteria | 88025 |
| 207 | Ga0070697_100000280 | 3300005536 | Bacteria | 41171 |
| 208 | Ga0070697_100000694 | 3300005536 | Bacteria | 25190 |
| 209 | Ga0070697_100001256 | 3300005536 | Bacteria | 19162 |
| 210 | Ga0070697_100013559 | 3300005536 | Bacteria | 6393 |
| 211 | Ga0070697_100018478 | 3300005536 | Bacteria | 5496 |
| 212 | Ga0070697_100111046 | 3300005536 | Bacteria | 2285 |
| 213 | Ga0070697_100414907 | 3300005536 | Bacteria | 1169 |
| 214 | Ga0070697_100430598 | 3300005536 | Bacteria | 1147 |
| 215 | Ga0070697_101383730 | 3300005536 | Unclassified | 628 |
| 216 | Ga0068853_100004040 | 3300005539 | Bacteria | 11293 |
| 217 | Ga0070672_100003042 | 3300005543 | Bacteria | 10803 |
| 218 | Ga0070672_100366589 | 3300005543 | Bacteria | 1230 |
| 219 | Ga0070672_100462223 | 3300005543 | Bacteria | 1094 |
| 220 | Ga0070686_100008692 | 3300005544 | Bacteria | 5690 |
| 221 | Ga0070695_100032361 | 3300005545 | Unclassified | 3269 |
| 222 | Ga0070695_100088098 | 3300005545 | Bacteria | 2066 |
| 223 | Ga0070695_100192023 | 3300005545 | Unclassified | 1454 |
| 224 | Ga0070696_100142696 | 3300005546 | Bacteria | 1752 |
| 225 | Ga0070696_100164097 | 3300005546 | Bacteria | 1638 |
| 226 | Ga0070696_100196285 | 3300005546 | Bacteria | 1504 |
| 227 | Ga0070696_100441270 | 3300005546 | Bacteria | 1025 |
| 228 | Ga0070693_100004450 | 3300005547 | Bacteria | 6626 |
| 229 | Ga0070693_100034556 | 3300005547 | Bacteria | 2798 |
| 230 | Ga0070693_100261979 | 3300005547 | Unclassified | 1150 |
| 231 | Ga0070693_100702313 | 3300005547 | Bacteria | 741 |
| 232 | Ga0070693_101079393 | 3300005547 | Bacteria | 611 |
| 233 | Ga0070665_100023323 | 3300005548 | Bacteria | 6229 |
| 234 | Ga0070704_100120474 | 3300005549 | Bacteria | 2015 |
| 235 | Ga0068855_100010022 | 3300005563 | Bacteria | 11420 |
| 236 | Ga0068855_100011722 | 3300005563 | Bacteria | 10595 |
| 237 | Ga0068855_100012992 | 3300005563 | Bacteria | 10049 |
| 238 | Ga0068855_100074528 | 3300005563 | Bacteria | 3941 |
| 239 | Ga0068855_100080699 | 3300005563 | Unclassified | 3772 |
| 240 | Ga0068855_100151046 | 3300005563 | Bacteria | 2641 |
| 241 | Ga0068855_100248520 | 3300005563 | Unclassified | 1984 |
| 242 | Ga0068855_100347599 | 3300005563 | Bacteria | 1634 |
| 243 | Ga0068855_100449358 | 3300005563 | Unclassified | 1406 |
| 244 | Ga0068855_100487674 | 3300005563 | Bacteria | 1341 |
| 245 | Ga0068855_100972414 | 3300005563 | Unclassified | 893 |
| 246 | Ga0070664_100000972 | 3300005564 | Bacteria | 22427 |
| 247 | Ga0070664_100008272 | 3300005564 | Bacteria | 8414 |
| 248 | Ga0070664_100019355 | 3300005564 | Bacteria | 5602 |
| 249 | Ga0068857_100000259 | 3300005577 | Bacteria | 35729 |
| 250 | Ga0068857_100000335 | 3300005577 | Bacteria | 32411 |
| 251 | Ga0068857_100199313 | 3300005577 | Unclassified | 1825 |
| 252 | Ga0068857_100314612 | 3300005577 | Bacteria | 1445 |
| 253 | Ga0068857_100475411 | 3300005577 | Bacteria | 1171 |
| 254 | Ga0068857_100580462 | 3300005577 | Bacteria | 1058 |
| 255 | Ga0068857_100995258 | 3300005577 | Bacteria | 807 |
| 256 | Ga0068854_100011053 | 3300005578 | Bacteria | 5860 |
| 257 | Ga0068854_100023615 | 3300005578 | Bacteria | 4202 |
| 258 | Ga0068854_100028231 | 3300005578 | Unclassified | 3875 |
| 259 | Ga0068854_100033635 | 3300005578 | Unclassified | 3575 |
| 260 | Ga0068854_100096525 | 3300005578 | Unclassified | 2209 |
| 261 | Ga0068856_100000995 | 3300005614 | Bacteria | 30196 |
| 262 | Ga0068856_100002426 | 3300005614 | Bacteria | 19184 |
| 263 | Ga0068856_100003097 | 3300005614 | Bacteria | 16972 |
| 264 | Ga0068856_100005963 | 3300005614 | Bacteria | 11992 |
| 265 | Ga0068856_100006696 | 3300005614 | Bacteria | 11296 |
| 266 | Ga0068856_100023013 | 3300005614 | Bacteria | 6058 |
| 267 | Ga0068856_100035413 | 3300005614 | Bacteria | 4892 |
| 268 | Ga0068856_100387787 | 3300005614 | Bacteria | 1417 |
| 269 | Ga0068856_100551276 | 3300005614 | Unclassified | 1174 |
| 270 | Ga0068856_100634798 | 3300005614 | Bacteria | 1089 |
| 271 | Ga0068856_100646876 | 3300005614 | Unclassified | 1078 |
| 272 | Ga0068856_100907641 | 3300005614 | Bacteria | 900 |
| 273 | Ga0068856_102109757 | 3300005614 | Bacteria | 573 |
| 274 | Ga0070702_100000387 | 3300005615 | Bacteria | 15639 |
| 275 | Ga0070702_100070013 | 3300005615 | Bacteria | 2069 |
| 276 | Ga0070702_100267006 | 3300005615 | Bacteria | 1168 |
| 277 | Ga0068852_100009501 | 3300005616 | Bacteria | 7227 |
| 278 | Ga0068852_100050228 | 3300005616 | Bacteria | 3572 |
| 279 | Ga0068852_100145329 | 3300005616 | Bacteria | 2199 |
| 280 | Ga0068852_100206105 | 3300005616 | Bacteria | 1863 |
| 281 | Ga0068852_101254597 | 3300005616 | Bacteria | 762 |
| 282 | Ga0068859_100014831 | 3300005617 | Bacteria | 7825 |
| 283 | Ga0068859_100015248 | 3300005617 | Bacteria | 7717 |
| 284 | Ga0068859_100094432 | 3300005617 | Unclassified | 3043 |
| 285 | Ga0068859_100253500 | 3300005617 | Bacteria | 1850 |
| 286 | Ga0068859_100298463 | 3300005617 | Unclassified | 1704 |
| 287 | Ga0068859_100344748 | 3300005617 | Bacteria | 1584 |
| 288 | Ga0068859_101027082 | 3300005617 | Bacteria | 906 |
| 289 | Ga0068864_100003998 | 3300005618 | Bacteria | 12141 |
| 290 | Ga0068864_100034805 | 3300005618 | Bacteria | 4286 |
| 291 | Ga0068866_10000735 | 3300005718 | Bacteria | 14853 |
| 292 | Ga0068866_10003232 | 3300005718 | Bacteria | 6714 |
| 293 | Ga0068866_10008403 | 3300005718 | Bacteria | 4351 |
| 294 | Ga0068866_10036584 | 3300005718 | Bacteria | 2406 |
| 295 | Ga0068866_10044217 | 3300005718 | Bacteria | 2227 |
| 296 | Ga0068866_10367819 | 3300005718 | Unclassified | 918 |
| 297 | Ga0068861_100013572 | 3300005719 | Bacteria | 5702 |
| 298 | Ga0068861_100086221 | 3300005719 | Unclassified | 2468 |
| 299 | Ga0068861_100242727 | 3300005719 | Bacteria | 1533 |
| 300 | Ga0068851_10004069 | 3300005834 | Bacteria | 6566 |
| 301 | Ga0068851_10006547 | 3300005834 | Bacteria | 5322 |
| 302 | Ga0068851_10010242 | 3300005834 | Unclassified | 4372 |
| 303 | Ga0068851_10099054 | 3300005834 | Bacteria | 1544 |
| 304 | Ga0068870_10026876 | 3300005840 | Bacteria | 2873 |
| 305 | Ga0068870_10319471 | 3300005840 | Bacteria | 986 |
| 306 | Ga0068863_100031255 | 3300005841 | Bacteria | 5083 |
| 307 | Ga0068863_100058799 | 3300005841 | Unclassified | 3638 |
| 308 | Ga0068863_100085787 | 3300005841 | Unclassified | 2983 |
| 309 | Ga0068863_100301358 | 3300005841 | Bacteria | 1555 |
| 310 | Ga0068863_100338804 | 3300005841 | Unclassified | 1463 |
| 311 | Ga0068863_101176067 | 3300005841 | Bacteria | 772 |
| 312 | Ga0068858_100000404 | 3300005842 | Bacteria | 44997 |
| 313 | Ga0068858_100004032 | 3300005842 | Bacteria | 14492 |
| 314 | Ga0068858_100274148 | 3300005842 | Bacteria | 1606 |
| 315 | Ga0068858_100473751 | 3300005842 | Bacteria | 1208 |
| 316 | Ga0068860_100012091 | 3300005843 | Bacteria | 8501 |
| 317 | Ga0068860_100038625 | 3300005843 | Unclassified | 4567 |
| 318 | Ga0068860_100405138 | 3300005843 | Bacteria | 1350 |
| 319 | Ga0068862_100151271 | 3300005844 | Bacteria | 2066 |
| 320 | Ga0081540_1093264 | 3300005983 | Bacteria | 1319 |
| 321 | Ga0070717_10001683 | 3300006028 | Bacteria | 15379 |
| 322 | Ga0070717_10004512 | 3300006028 | Bacteria | 10057 |
| 323 | Ga0070717_10005108 | 3300006028 | Bacteria | 9573 |
| 324 | Ga0070717_10005704 | 3300006028 | Bacteria | 9102 |
| 325 | Ga0070717_10011319 | 3300006028 | Bacteria | 6771 |
| 326 | Ga0070717_10032487 | 3300006028 | Bacteria | 4206 |
| 327 | Ga0070717_10051470 | 3300006028 | Unclassified | 3390 |
| 328 | Ga0070717_10064277 | 3300006028 | Bacteria | 3047 |
| 329 | Ga0070717_10111341 | 3300006028 | Unclassified | 2336 |
| 330 | Ga0070717_10148095 | 3300006028 | Bacteria | 2029 |
| 331 | Ga0070717_10207105 | 3300006028 | Bacteria | 1720 |
| 332 | Ga0070717_10221443 | 3300006028 | Unclassified | 1663 |
| 333 | Ga0070717_10237926 | 3300006028 | Bacteria | 1605 |
| 334 | Ga0070717_10255225 | 3300006028 | Bacteria | 1550 |
| 335 | Ga0070717_10262381 | 3300006028 | Bacteria | 1528 |
| 336 | Ga0070717_10315890 | 3300006028 | Bacteria | 1391 |
| 337 | Ga0070717_10342052 | 3300006028 | Bacteria | 1336 |
| 338 | Ga0070717_10423608 | 3300006028 | Bacteria | 1197 |
| 339 | Ga0070717_10752709 | 3300006028 | Unclassified | 886 |
| 340 | Ga0070717_11288950 | 3300006028 | Bacteria | 664 |
| 341 | Ga0070717_11341997 | 3300006028 | Bacteria | 650 |
| 342 | Ga0070715_10002128 | 3300006163 | Bacteria | 5989 |
| 343 | Ga0070715_10013154 | 3300006163 | Bacteria | 3032 |
| 344 | Ga0070715_10094090 | 3300006163 | Bacteria | 1385 |
| 345 | Ga0070715_10099475 | 3300006163 | Unclassified | 1354 |
| 346 | Ga0070715_10112816 | 3300006163 | Bacteria | 1285 |
| 347 | Ga0070715_10178923 | 3300006163 | Bacteria | 1062 |
| 348 | Ga0070715_10320858 | 3300006163 | Bacteria | 836 |
| 349 | Ga0070715_10480664 | 3300006163 | Unclassified | 707 |
| 350 | Ga0070715_10802027 | 3300006163 | Unclassified | 571 |
| 351 | Ga0070716_100013165 | 3300006173 | Bacteria | 4212 |
| 352 | Ga0070716_100015752 | 3300006173 | Bacteria | 3890 |
| 353 | Ga0070716_100026282 | 3300006173 | Unclassified | 3116 |
| 354 | Ga0070716_100034551 | 3300006173 | Unclassified | 2773 |
| 355 | Ga0070716_100039117 | 3300006173 | Bacteria | 2630 |
| 356 | Ga0070716_100155544 | 3300006173 | Bacteria | 1476 |
| 357 | Ga0070716_100181495 | 3300006173 | Bacteria | 1382 |
| 358 | Ga0070716_100215542 | 3300006173 | Bacteria | 1286 |
| 359 | Ga0070716_100228980 | 3300006173 | Bacteria | 1253 |
| 360 | Ga0070716_100252626 | 3300006173 | Bacteria | 1202 |
| 361 | Ga0070716_100272120 | 3300006173 | Bacteria | 1164 |
| 362 | Ga0070716_100319623 | 3300006173 | Bacteria | 1087 |
| 363 | Ga0070716_100913697 | 3300006173 | Bacteria | 688 |
| 364 | Ga0070712_100000188 | 3300006175 | Bacteria | 34294 |
| 365 | Ga0070712_100000723 | 3300006175 | Bacteria | 19476 |
| 366 | Ga0070712_100026038 | 3300006175 | Bacteria | 3892 |
| 367 | Ga0070712_100026743 | 3300006175 | Bacteria | 3847 |
| 368 | Ga0070712_100027377 | 3300006175 | Bacteria | 3807 |
| 369 | Ga0070712_100027607 | 3300006175 | Bacteria | 3791 |
| 370 | Ga0070712_100040986 | 3300006175 | Unclassified | 3177 |
| 371 | Ga0070712_100072539 | 3300006175 | Bacteria | 2466 |
| 372 | Ga0070712_100103103 | 3300006175 | Bacteria | 2114 |
| 373 | Ga0070712_100260476 | 3300006175 | Unclassified | 1389 |
| 374 | Ga0070712_100288502 | 3300006175 | Bacteria | 1324 |
| 375 | Ga0070712_100496834 | 3300006175 | Bacteria | 1022 |
| 376 | Ga0070712_100624568 | 3300006175 | Unclassified | 914 |
| 377 | Ga0070712_101013852 | 3300006175 | Bacteria | 719 |
| 378 | Ga0097621_100013631 | 3300006237 | Bacteria | 6066 |
| 379 | Ga0097621_100024654 | 3300006237 | Bacteria | 4700 |
| 380 | Ga0097621_100039766 | 3300006237 | Bacteria | 3779 |
| 381 | Ga0097621_100076590 | 3300006237 | Unclassified | 2775 |
| 382 | Ga0097621_100121598 | 3300006237 | Bacteria | 2214 |
| 383 | Ga0097621_100139551 | 3300006237 | Bacteria | 2070 |
| 384 | Ga0097621_100158187 | 3300006237 | Bacteria | 1946 |
| 385 | Ga0097621_100459508 | 3300006237 | Unclassified | 1148 |
| 386 | Ga0097621_100565154 | 3300006237 | Unclassified | 1036 |
| 387 | Ga0097621_100567341 | 3300006237 | Bacteria | 1034 |
| 388 | Ga0097621_101100404 | 3300006237 | Unclassified | 746 |
| 389 | Ga0068871_100000389 | 3300006358 | Bacteria | 30917 |
| 390 | Ga0068871_100007884 | 3300006358 | Bacteria | 7635 |
| 391 | Ga0068871_100034094 | 3300006358 | Bacteria | 4037 |
| 392 | Ga0068871_100043390 | 3300006358 | Bacteria | 3612 |
| 393 | Ga0068871_100049645 | 3300006358 | Bacteria | 3392 |
| 394 | Ga0068871_100049912 | 3300006358 | Bacteria | 3383 |
| 395 | Ga0068871_100091844 | 3300006358 | Bacteria | 2531 |
| 396 | Ga0068871_100314305 | 3300006358 | Bacteria | 1378 |
| 397 | Ga0068871_100541172 | 3300006358 | Bacteria | 1054 |
| 398 | Ga0075431_100508146 | 3300006847 | Bacteria | 1196 |
| 399 | Ga0075433_10000636 | 3300006852 | Bacteria | 23485 |
| 400 | Ga0075433_10777035 | 3300006852 | Bacteria | 837 |
| 401 | Ga0075434_100001288 | 3300006871 | Bacteria | 20919 |
| 402 | Ga0075434_100001829 | 3300006871 | Bacteria | 18360 |
| 403 | Ga0075434_100035785 | 3300006871 | Unclassified | 4909 |
| 404 | Ga0068865_100044263 | 3300006881 | Bacteria | 3046 |
| 405 | Ga0068865_100235879 | 3300006881 | Bacteria | 1437 |
| 406 | Ga0068865_100441121 | 3300006881 | Unclassified | 1074 |
| 407 | Ga0075436_100003222 | 3300006914 | Bacteria | 11191 |
| 408 | Ga0075436_100006615 | 3300006914 | Bacteria | 7943 |
| 409 | Ga0075436_100007751 | 3300006914 | Bacteria | 7342 |
| 410 | Ga0075436_100013183 | 3300006914 | Bacteria | 5668 |
| 411 | Ga0075436_100046263 | 3300006914 | Bacteria | 3001 |
| 412 | Ga0075436_100088486 | 3300006914 | Bacteria | 2151 |
| 413 | Ga0075436_100139706 | 3300006914 | Bacteria | 1702 |
| 414 | Ga0075436_100362595 | 3300006914 | Bacteria | 1046 |
| 415 | Ga0075436_100448902 | 3300006914 | Bacteria | 939 |
| 416 | Ga0075436_100526995 | 3300006914 | Bacteria | 866 |
| 417 | Ga0097620_100014831 | 3300006931 | Bacteria | 7825 |
| 418 | Ga0097620_100015253 | 3300006931 | Bacteria | 7717 |
| 419 | Ga0097620_100094426 | 3300006931 | Unclassified | 3043 |
| 420 | Ga0097620_100253503 | 3300006931 | Bacteria | 1850 |
| 421 | Ga0097620_100298470 | 3300006931 | Unclassified | 1704 |
| 422 | Ga0097620_100344743 | 3300006931 | Bacteria | 1584 |
| 423 | Ga0097620_101026981 | 3300006931 | Bacteria | 906 |
| 424 | Ga0097620_101680699 | 3300006931 | Bacteria | 701 |
| 425 | Ga0075435_100002192 | 3300007076 | Bacteria | 12887 |
| 426 | Ga0075435_100016802 | 3300007076 | Bacteria | 5522 |
| 427 | Ga0075435_100101237 | 3300007076 | Unclassified | 2387 |
| 428 | Ga0075435_100427608 | 3300007076 | Bacteria | 1141 |
| 429 | Ga0075435_101252867 | 3300007076 | Bacteria | 649 |
| 430 | Ga0099794_10044594 | 3300007265 | Bacteria | 2120 |
| 431 | Ga0099794_10074135 | 3300007265 | Bacteria | 1671 |
| 432 | Ga0099794_10402595 | 3300007265 | Unclassified | 715 |
| 433 | Ga0099795_10030520 | 3300007788 | Unclassified | 1851 |
| 434 | Ga0105240_10055750 | 3300009093 | Bacteria | 4948 |
| 435 | Ga0105240_10061239 | 3300009093 | Bacteria | 4690 |
| 436 | Ga0105240_10098841 | 3300009093 | Bacteria | 3553 |
| 437 | Ga0105240_10147828 | 3300009093 | Bacteria | 2802 |
| 438 | Ga0105240_10197359 | 3300009093 | Bacteria | 2361 |
| 439 | Ga0105240_10205854 | 3300009093 | Bacteria | 2303 |
| 440 | Ga0105240_10259198 | 3300009093 | Bacteria | 2007 |
| 441 | Ga0105240_10519746 | 3300009093 | Bacteria | 1321 |
| 442 | Ga0105240_10580303 | 3300009093 | Bacteria | 1237 |
| 443 | Ga0105240_10581698 | 3300009093 | Bacteria | 1235 |
| 444 | Ga0105240_10775099 | 3300009093 | Bacteria | 1041 |
| 445 | Ga0105240_10819970 | 3300009093 | Unclassified | 1006 |
| 446 | Ga0105240_11018321 | 3300009093 | Bacteria | 885 |
| 447 | Ga0105240_11148092 | 3300009093 | Bacteria | 825 |
| 448 | Ga0105240_11780744 | 3300009093 | Bacteria | 642 |
| 449 | Ga0111539_10407355 | 3300009094 | Bacteria | 1584 |
| 450 | Ga0111539_11498579 | 3300009094 | Bacteria | 782 |
| 451 | Ga0105245_10003248 | 3300009098 | Bacteria | 14574 |
| 452 | Ga0105245_10007752 | 3300009098 | Bacteria | 9401 |
| 453 | Ga0105245_10007882 | 3300009098 | Bacteria | 9316 |
| 454 | Ga0105245_10018174 | 3300009098 | Bacteria | 6148 |
| 455 | Ga0105245_10052722 | 3300009098 | Bacteria | 3648 |
| 456 | Ga0105245_10064552 | 3300009098 | Bacteria | 3309 |
| 457 | Ga0105245_10093343 | 3300009098 | Unclassified | 2773 |
| 458 | Ga0105245_10179724 | 3300009098 | Bacteria | 2020 |
| 459 | Ga0105245_10423149 | 3300009098 | Bacteria | 1335 |
| 460 | Ga0105245_10481162 | 3300009098 | Bacteria | 1255 |
| 461 | Ga0105245_10778165 | 3300009098 | Bacteria | 994 |
| 462 | Ga0105247_10001594 | 3300009101 | Bacteria | 16066 |
| 463 | Ga0105247_10017504 | 3300009101 | Bacteria | 4299 |
| 464 | Ga0114129_10061374 | 3300009147 | Bacteria | 5253 |
| 465 | Ga0114129_10165885 | 3300009147 | Bacteria | 3014 |
| 466 | Ga0105243_10626305 | 3300009148 | Unclassified | 1039 |
| 467 | Ga0105243_11377270 | 3300009148 | Bacteria | 725 |
| 468 | Ga0105241_10004558 | 3300009174 | Bacteria | 10250 |
| 469 | Ga0105241_10024348 | 3300009174 | Bacteria | 4495 |
| 470 | Ga0105241_10043109 | 3300009174 | Bacteria | 3416 |
| 471 | Ga0105241_10049184 | 3300009174 | Bacteria | 3210 |
| 472 | Ga0105241_10070311 | 3300009174 | Bacteria | 2716 |
| 473 | Ga0105241_10094522 | 3300009174 | Bacteria | 2364 |
| 474 | Ga0105241_10258229 | 3300009174 | Bacteria | 1480 |
| 475 | Ga0105241_10397954 | 3300009174 | Unclassified | 1207 |
| 476 | Ga0105241_10407320 | 3300009174 | Bacteria | 1194 |
| 477 | Ga0105241_11769001 | 3300009174 | Unclassified | 602 |
| 478 | Ga0105242_10006980 | 3300009176 | Bacteria | 8717 |
| 479 | Ga0105242_10171301 | 3300009176 | Bacteria | 1908 |
| 480 | Ga0105242_10274578 | 3300009176 | Bacteria | 1528 |
| 481 | Ga0105242_10449797 | 3300009176 | Unclassified | 1214 |
| 482 | Ga0105242_11373422 | 3300009176 | Unclassified | 733 |
| 483 | Ga0105248_10011433 | 3300009177 | Bacteria | 9783 |
| 484 | Ga0105248_10026687 | 3300009177 | Bacteria | 6422 |
| 485 | Ga0105248_10086566 | 3300009177 | Unclassified | 3525 |
| 486 | Ga0105248_10099247 | 3300009177 | Bacteria | 3281 |
| 487 | Ga0105248_10283297 | 3300009177 | Bacteria | 1866 |
| 488 | Ga0105248_10570011 | 3300009177 | Bacteria | 1277 |
| 489 | Ga0105248_10872668 | 3300009177 | Bacteria | 1016 |
| 490 | Ga0105237_10006364 | 3300009545 | Bacteria | 13118 |
| 491 | Ga0105237_10013796 | 3300009545 | Bacteria | 8457 |
| 492 | Ga0105237_10045567 | 3300009545 | Bacteria | 4412 |
| 493 | Ga0105237_10072667 | 3300009545 | Bacteria | 3433 |
| 494 | Ga0105237_10075837 | 3300009545 | Bacteria | 3353 |
| 495 | Ga0105237_10216179 | 3300009545 | Unclassified | 1917 |
| 496 | Ga0105237_10273158 | 3300009545 | Bacteria | 1693 |
| 497 | Ga0105237_10285608 | 3300009545 | Bacteria | 1653 |
| 498 | Ga0105237_10321170 | 3300009545 | Unclassified | 1552 |
| 499 | Ga0105237_10410467 | 3300009545 | Bacteria | 1359 |
| 500 | Ga0105237_10653280 | 3300009545 | Bacteria | 1058 |
| 501 | Ga0105237_10691100 | 3300009545 | Bacteria | 1027 |
| 502 | Ga0105237_10723015 | 3300009545 | Unclassified | 1002 |
| 503 | Ga0105237_10899599 | 3300009545 | Unclassified | 892 |
| 504 | Ga0105237_11092496 | 3300009545 | Bacteria | 804 |
| 505 | Ga0105237_11725016 | 3300009545 | Bacteria | 634 |
| 506 | Ga0105238_10025430 | 3300009551 | Bacteria | 6035 |
| 507 | Ga0105238_10138524 | 3300009551 | Unclassified | 2411 |
| 508 | Ga0105238_10157265 | 3300009551 | Bacteria | 2248 |
| 509 | Ga0105238_10206998 | 3300009551 | Bacteria | 1938 |
| 510 | Ga0105238_10235107 | 3300009551 | Bacteria | 1810 |
| 511 | Ga0105238_10249507 | 3300009551 | Bacteria | 1753 |
| 512 | Ga0105249_10041603 | 3300009553 | Bacteria | 4178 |
| 513 | Ga0105249_10290290 | 3300009553 | Bacteria | 1637 |
| 514 | Ga0105249_10308379 | 3300009553 | Unclassified | 1590 |
| 515 | Ga0099796_10028145 | 3300010159 | Bacteria | 1801 |
| 516 | Ga0105239_10003652 | 3300010375 | Bacteria | 18811 |
| 517 | Ga0105239_10066583 | 3300010375 | Bacteria | 3957 |
| 518 | Ga0105239_10070525 | 3300010375 | Unclassified | 3839 |
| 519 | Ga0105239_10087659 | 3300010375 | Bacteria | 3431 |
| 520 | Ga0105239_10095971 | 3300010375 | Unclassified | 3275 |
| 521 | Ga0105239_10370397 | 3300010375 | Bacteria | 1619 |
| 522 | Ga0105239_10713671 | 3300010375 | Bacteria | 1147 |
| 523 | Ga0105239_11270780 | 3300010375 | Bacteria | 849 |
| 524 | Ga0105239_12512498 | 3300010375 | Unclassified | 600 |
| 525 | Ga0105246_10004431 | 3300011119 | Bacteria | 8546 |
| 526 | Ga0105246_10251252 | 3300011119 | Unclassified | 1403 |
| 527 | Ga0105246_10487443 | 3300011119 | Bacteria | 1044 |
| 528 | Ga0105246_10726030 | 3300011119 | Unclassified | 873 |
| 529 | Ga0105246_10810470 | 3300011119 | Bacteria | 831 |
| 530 | Ga0157324_1004648 | 3300012506 | Unclassified | 959 |
| 531 | Ga0157373_10002519 | 3300013100 | Bacteria | 13955 |
| 532 | Ga0157373_10007083 | 3300013100 | Bacteria | 8360 |
| 533 | Ga0157373_10030097 | 3300013100 | Unclassified | 3907 |
| 534 | Ga0157373_10108259 | 3300013100 | Bacteria | 1954 |
| 535 | Ga0157373_10116116 | 3300013100 | Bacteria | 1881 |
| 536 | Ga0157373_10182073 | 3300013100 | Bacteria | 1479 |
| 537 | Ga0157373_10338975 | 3300013100 | Unclassified | 1071 |
| 538 | Ga0157373_10470852 | 3300013100 | Bacteria | 906 |
| 539 | Ga0157371_10008414 | 3300013102 | Bacteria | 8219 |
| 540 | Ga0157371_10009414 | 3300013102 | Bacteria | 7689 |
| 541 | Ga0157371_10049901 | 3300013102 | Bacteria | 2972 |
| 542 | Ga0157370_10045645 | 3300013104 | Bacteria | 4202 |
| 543 | Ga0157370_10080214 | 3300013104 | Bacteria | 3072 |
| 544 | Ga0157370_10108342 | 3300013104 | Bacteria | 2598 |
| 545 | Ga0157370_10209613 | 3300013104 | Unclassified | 1806 |
| 546 | Ga0157370_10294890 | 3300013104 | Bacteria | 1497 |
| 547 | Ga0157370_10692587 | 3300013104 | Bacteria | 930 |
| 548 | Ga0157369_10017191 | 3300013105 | Bacteria | 8127 |
| 549 | Ga0157369_10060408 | 3300013105 | Unclassified | 4087 |
| 550 | Ga0157369_10122971 | 3300013105 | Bacteria | 2753 |
| 551 | Ga0157369_10127242 | 3300013105 | Bacteria | 2700 |
| 552 | Ga0157369_10258603 | 3300013105 | Bacteria | 1816 |
| 553 | Ga0157369_10363215 | 3300013105 | Bacteria | 1503 |
| 554 | Ga0157369_10515747 | 3300013105 | Bacteria | 1237 |
| 555 | Ga0157369_11047837 | 3300013105 | Bacteria | 834 |
| 556 | Ga0157374_10000634 | 3300013296 | Bacteria | 30935 |
| 557 | Ga0157374_10001978 | 3300013296 | Bacteria | 17189 |
| 558 | Ga0157374_10002353 | 3300013296 | Bacteria | 15957 |
| 559 | Ga0157374_10007704 | 3300013296 | Bacteria | 9195 |
| 560 | Ga0157374_10020608 | 3300013296 | Bacteria | 5854 |
| 561 | Ga0157374_10059771 | 3300013296 | Unclassified | 3565 |
| 562 | Ga0157374_10113865 | 3300013296 | Bacteria | 2603 |
| 563 | Ga0157374_10140007 | 3300013296 | Unclassified | 2348 |
| 564 | Ga0157374_10392430 | 3300013296 | Unclassified | 1383 |
| 565 | Ga0157374_10650860 | 3300013296 | Bacteria | 1066 |
| 566 | Ga0157374_11987540 | 3300013296 | Bacteria | 608 |
| 567 | Ga0157378_10000202 | 3300013297 | Bacteria | 58070 |
| 568 | Ga0157378_10000725 | 3300013297 | Bacteria | 30797 |
| 569 | Ga0157378_10001795 | 3300013297 | Bacteria | 19272 |
| 570 | Ga0157378_10012660 | 3300013297 | Bacteria | 7380 |
| 571 | Ga0157378_10072136 | 3300013297 | Bacteria | 3102 |
| 572 | Ga0157378_10090402 | 3300013297 | Bacteria | 2782 |
| 573 | Ga0157378_10340913 | 3300013297 | Unclassified | 1461 |
| 574 | Ga0157378_10543179 | 3300013297 | Bacteria | 1166 |
| 575 | Ga0157378_10717651 | 3300013297 | Bacteria | 1020 |
| 576 | Ga0157378_10754322 | 3300013297 | Unclassified | 996 |
| 577 | Ga0157378_11058524 | 3300013297 | Bacteria | 847 |
| 578 | Ga0157378_11443155 | 3300013297 | Bacteria | 732 |
| 579 | Ga0163162_10009643 | 3300013306 | Bacteria | 9392 |
| 580 | Ga0163162_10040280 | 3300013306 | Bacteria | 4671 |
| 581 | Ga0163162_10055031 | 3300013306 | Bacteria | 4004 |
| 582 | Ga0163162_10070409 | 3300013306 | Bacteria | 3549 |
| 583 | Ga0163162_10112681 | 3300013306 | Unclassified | 2819 |
| 584 | Ga0163162_10152829 | 3300013306 | Bacteria | 2426 |
| 585 | Ga0163162_10191003 | 3300013306 | Bacteria | 2176 |
| 586 | Ga0163162_10314703 | 3300013306 | Unclassified | 1698 |
| 587 | Ga0163162_10759984 | 3300013306 | Bacteria | 1088 |
| 588 | Ga0163162_11004324 | 3300013306 | Bacteria | 943 |
| 589 | Ga0163162_11046858 | 3300013306 | Bacteria | 923 |
| 590 | Ga0163162_11072492 | 3300013306 | Bacteria | 912 |
| 591 | Ga0163162_11162495 | 3300013306 | Bacteria | 875 |
| 592 | Ga0163162_12053660 | 3300013306 | Bacteria | 655 |
| 593 | Ga0157372_10000565 | 3300013307 | Bacteria | 40736 |
| 594 | Ga0157372_10002050 | 3300013307 | Bacteria | 21927 |
| 595 | Ga0157372_10003078 | 3300013307 | Bacteria | 17961 |
| 596 | Ga0157372_10015430 | 3300013307 | Bacteria | 8187 |
| 597 | Ga0157372_10016466 | 3300013307 | Bacteria | 7935 |
| 598 | Ga0157372_10022661 | 3300013307 | Bacteria | 6798 |
| 599 | Ga0157372_10030069 | 3300013307 | Bacteria | 5939 |
| 600 | Ga0157372_10053833 | 3300013307 | Bacteria | 4487 |
| 601 | Ga0157372_10054469 | 3300013307 | Bacteria | 4462 |
| 602 | Ga0157372_10059528 | 3300013307 | Bacteria | 4272 |
| 603 | Ga0157372_10188739 | 3300013307 | Bacteria | 2387 |
| 604 | Ga0157372_10352323 | 3300013307 | Bacteria | 1715 |
| 605 | Ga0157372_10390444 | 3300013307 | Bacteria | 1622 |
| 606 | Ga0157372_11356269 | 3300013307 | Bacteria | 820 |
| 607 | Ga0157375_10073401 | 3300013308 | Bacteria | 3440 |
| 608 | Ga0157375_10248755 | 3300013308 | Unclassified | 1938 |
| 609 | Ga0157375_10335458 | 3300013308 | Unclassified | 1677 |
| 610 | Ga0157375_10657732 | 3300013308 | Bacteria | 1204 |
| 611 | Ga0157375_11383542 | 3300013308 | Bacteria | 829 |
| 612 | Ga0157375_11644918 | 3300013308 | Bacteria | 760 |
| 613 | Ga0163163_10003044 | 3300014325 | Bacteria | 14194 |
| 614 | Ga0163163_10040832 | 3300014325 | Bacteria | 4533 |
| 615 | Ga0163163_10051769 | 3300014325 | Bacteria | 4048 |
| 616 | Ga0163163_10192569 | 3300014325 | Bacteria | 2087 |
| 617 | Ga0163163_10340898 | 3300014325 | Unclassified | 1554 |
| 618 | Ga0163163_10445884 | 3300014325 | Bacteria | 1354 |
| 619 | Ga0163163_10563764 | 3300014325 | Bacteria | 1202 |
| 620 | Ga0163163_10937098 | 3300014325 | Bacteria | 929 |
| 621 | Ga0163163_11393492 | 3300014325 | Bacteria | 763 |
| 622 | Ga0163163_11597050 | 3300014325 | Bacteria | 713 |
| 623 | Ga0157380_11681187 | 3300014326 | Bacteria | 692 |
| 624 | Ga0182008_10004678 | 3300014497 | Bacteria | 7952 |
| 625 | Ga0182008_10020896 | 3300014497 | Unclassified | 3368 |
| 626 | Ga0182008_10158242 | 3300014497 | Bacteria | 1139 |
| 627 | Ga0157377_10006706 | 3300014745 | Bacteria | 5512 |
| 628 | Ga0157377_10327853 | 3300014745 | Bacteria | 1019 |
| 629 | Ga0157377_10354088 | 3300014745 | Bacteria | 986 |
| 630 | Ga0157377_11015507 | 3300014745 | Bacteria | 629 |
| 631 | Ga0157379_10003409 | 3300014968 | Bacteria | 13441 |
| 632 | Ga0157379_10034772 | 3300014968 | Bacteria | 4494 |
| 633 | Ga0157379_10151447 | 3300014968 | Bacteria | 2092 |
| 634 | Ga0157379_10171237 | 3300014968 | Bacteria | 1960 |
| 635 | Ga0157379_10349408 | 3300014968 | Bacteria | 1353 |
| 636 | Ga0157379_10656943 | 3300014968 | Unclassified | 982 |
| 637 | Ga0157379_11279596 | 3300014968 | Bacteria | 708 |
| 638 | Ga0157376_10004658 | 3300014969 | Bacteria | 9559 |
| 639 | Ga0157376_10029519 | 3300014969 | Bacteria | 4368 |
| 640 | Ga0157376_10069210 | 3300014969 | Bacteria | 2991 |
| 641 | Ga0157376_10247471 | 3300014969 | Bacteria | 1663 |
| 642 | Ga0157376_10292498 | 3300014969 | Bacteria | 1538 |
| 643 | Ga0157376_10386907 | 3300014969 | Bacteria | 1349 |
| 644 | Ga0157376_10564970 | 3300014969 | Bacteria | 1128 |
| 645 | Ga0157376_11052914 | 3300014969 | Bacteria | 838 |
| 646 | Ga0182007_10024426 | 3300015262 | Bacteria | 2114 |
| 647 | Ga0182007_10227876 | 3300015262 | Bacteria | 661 |
| 648 | Ga0182005_1003699 | 3300015265 | Bacteria | 5105 |
| 649 | Ga0182005_1097660 | 3300015265 | Bacteria | 821 |
| 650 | Ga0163161_10032069 | 3300017792 | Bacteria | 3748 |
| 651 | Ga0163161_10733077 | 3300017792 | Unclassified | 825 |
| 652 | Ga0213876_10246687 | 3300021384 | Bacteria | 949 |
| 653 | Ga0213875_10004172 | 3300021388 | Bacteria | 7999 |
| 654 | Ga0224712_10480315 | 3300022467 | Bacteria | 599 |
| 655 | Ga0224570_100116 | 3300022730 | Bacteria | 5034 |
| 656 | Ga0224569_100063 | 3300022732 | Bacteria | 6837 |
| 657 | Ga0224569_103169 | 3300022732 | Bacteria | 1296 |
| 658 | Ga0224571_100789 | 3300022734 | Bacteria | 1866 |
| 659 | Ga0224572_1015389 | 3300024225 | Bacteria | 1464 |
| 660 | Ga0224572_1018281 | 3300024225 | Bacteria | 1347 |
| 661 | Ga0224572_1063119 | 3300024225 | Bacteria | 685 |
| 662 | Ga0228598_1000002 | 3300024227 | Bacteria | 37716 |
| 663 | Ga0228598_1000333 | 3300024227 | Bacteria | 9259 |
| 664 | Ga0228598_1005227 | 3300024227 | Bacteria | 2724 |
| 665 | Ga0207697_10014218 | 3300025315 | Unclassified | 3307 |
| 666 | Ga0207656_10002371 | 3300025321 | Bacteria | 6326 |
| 667 | Ga0207692_10024383 | 3300025898 | Bacteria | 2812 |
| 668 | Ga0207692_10028069 | 3300025898 | Bacteria | 2657 |
| 669 | Ga0207692_10062910 | 3300025898 | Unclassified | 1927 |
| 670 | Ga0207692_10176892 | 3300025898 | Unclassified | 1241 |
| 671 | Ga0207692_10200597 | 3300025898 | Bacteria | 1173 |
| 672 | Ga0207692_10241162 | 3300025898 | Bacteria | 1080 |
| 673 | Ga0207692_10598833 | 3300025898 | Bacteria | 708 |
| 674 | Ga0207692_10683838 | 3300025898 | Bacteria | 665 |
| 675 | Ga0207692_10867374 | 3300025898 | Unclassified | 593 |
| 676 | Ga0207642_10004640 | 3300025899 | Unclassified | 4438 |
| 677 | Ga0207642_10017427 | 3300025899 | Bacteria | 2731 |
| 678 | Ga0207642_10029862 | 3300025899 | Bacteria | 2263 |
| 679 | Ga0207642_10475266 | 3300025899 | Bacteria | 761 |
| 680 | Ga0207710_10023501 | 3300025900 | Bacteria | 2649 |
| 681 | Ga0207710_10097775 | 3300025900 | Unclassified | 1381 |
| 682 | Ga0207710_10113691 | 3300025900 | Bacteria | 1287 |
| 683 | Ga0207688_10055000 | 3300025901 | Bacteria | 2233 |
| 684 | Ga0207680_10081689 | 3300025903 | Bacteria | 2032 |
| 685 | Ga0207680_10236894 | 3300025903 | Unclassified | 1256 |
| 686 | Ga0207680_10393459 | 3300025903 | Bacteria | 979 |
| 687 | Ga0207647_10013732 | 3300025904 | Bacteria | 5608 |
| 688 | Ga0207647_10017367 | 3300025904 | Unclassified | 4891 |
| 689 | Ga0207647_10029904 | 3300025904 | Bacteria | 3519 |
| 690 | Ga0207685_10008705 | 3300025905 | Bacteria | 2908 |
| 691 | Ga0207685_10036045 | 3300025905 | Bacteria | 1810 |
| 692 | Ga0207685_10090705 | 3300025905 | Bacteria | 1286 |
| 693 | Ga0207685_10211595 | 3300025905 | Unclassified | 917 |
| 694 | Ga0207685_10385944 | 3300025905 | Bacteria | 715 |
| 695 | Ga0207699_10010406 | 3300025906 | Bacteria | 4667 |
| 696 | Ga0207699_10013470 | 3300025906 | Unclassified | 4188 |
| 697 | Ga0207699_10026320 | 3300025906 | Bacteria | 3204 |
| 698 | Ga0207699_10074634 | 3300025906 | Unclassified | 2084 |
| 699 | Ga0207699_10079595 | 3300025906 | Bacteria | 2028 |
| 700 | Ga0207699_10120186 | 3300025906 | Bacteria | 1698 |
| 701 | Ga0207699_10124813 | 3300025906 | Bacteria | 1670 |
| 702 | Ga0207699_10311647 | 3300025906 | Bacteria | 1101 |
| 703 | Ga0207699_10463961 | 3300025906 | Bacteria | 910 |
| 704 | Ga0207699_10480103 | 3300025906 | Bacteria | 895 |
| 705 | Ga0207699_10742188 | 3300025906 | Bacteria | 720 |
| 706 | Ga0207645_10000125 | 3300025907 | Bacteria | 58051 |
| 707 | Ga0207645_10142836 | 3300025907 | Unclassified | 1560 |
| 708 | Ga0207645_10483605 | 3300025907 | Bacteria | 837 |
| 709 | Ga0207643_10000488 | 3300025908 | Bacteria | 25463 |
| 710 | Ga0207643_10376564 | 3300025908 | Unclassified | 894 |
| 711 | Ga0207705_10024329 | 3300025909 | Unclassified | 4324 |
| 712 | Ga0207705_10449652 | 3300025909 | Bacteria | 999 |
| 713 | Ga0207684_10000223 | 3300025910 | Bacteria | 87514 |
| 714 | Ga0207684_10003613 | 3300025910 | Bacteria | 15050 |
| 715 | Ga0207684_10005360 | 3300025910 | Bacteria | 11848 |
| 716 | Ga0207684_10027576 | 3300025910 | Bacteria | 4837 |
| 717 | Ga0207684_10051827 | 3300025910 | Bacteria | 3482 |
| 718 | Ga0207684_10503490 | 3300025910 | Bacteria | 1038 |
| 719 | Ga0207654_10003381 | 3300025911 | Bacteria | 8076 |
| 720 | Ga0207654_10008923 | 3300025911 | Bacteria | 5086 |
| 721 | Ga0207654_10012212 | 3300025911 | Bacteria | 4397 |
| 722 | Ga0207654_10018603 | 3300025911 | Bacteria | 3649 |
| 723 | Ga0207654_10057660 | 3300025911 | Bacteria | 2258 |
| 724 | Ga0207654_10059531 | 3300025911 | Bacteria | 2228 |
| 725 | Ga0207654_10078327 | 3300025911 | Bacteria | 1983 |
| 726 | Ga0207654_10473775 | 3300025911 | Bacteria | 881 |
| 727 | Ga0207654_10597928 | 3300025911 | Unclassified | 787 |
| 728 | Ga0207707_10011464 | 3300025912 | Bacteria | 7720 |
| 729 | Ga0207707_10014133 | 3300025912 | Bacteria | 6956 |
| 730 | Ga0207707_10054384 | 3300025912 | Unclassified | 3485 |
| 731 | Ga0207707_10063047 | 3300025912 | Bacteria | 3226 |
| 732 | Ga0207707_10429255 | 3300025912 | Unclassified | 1132 |
| 733 | Ga0207695_10006382 | 3300025913 | Bacteria | 15343 |
| 734 | Ga0207695_10006994 | 3300025913 | Bacteria | 14477 |
| 735 | Ga0207695_10018543 | 3300025913 | Bacteria | 8041 |
| 736 | Ga0207695_10074781 | 3300025913 | Bacteria | 3448 |
| 737 | Ga0207695_10131230 | 3300025913 | Bacteria | 2463 |
| 738 | Ga0207695_10134629 | 3300025913 | Bacteria | 2425 |
| 739 | Ga0207695_10136999 | 3300025913 | Bacteria | 2400 |
| 740 | Ga0207695_10143928 | 3300025913 | Bacteria | 2330 |
| 741 | Ga0207695_10276584 | 3300025913 | Bacteria | 1573 |
| 742 | Ga0207695_10501488 | 3300025913 | Bacteria | 1096 |
| 743 | Ga0207695_10556484 | 3300025913 | Bacteria | 1028 |
| 744 | Ga0207695_10652576 | 3300025913 | Unclassified | 933 |
| 745 | Ga0207695_10754790 | 3300025913 | Bacteria | 853 |
| 746 | Ga0207671_10006781 | 3300025914 | Bacteria | 10122 |
| 747 | Ga0207671_10011713 | 3300025914 | Bacteria | 7106 |
| 748 | Ga0207671_10016797 | 3300025914 | Bacteria | 5673 |
| 749 | Ga0207671_10346429 | 3300025914 | Bacteria | 1178 |
| 750 | Ga0207671_10926364 | 3300025914 | Unclassified | 688 |
| 751 | Ga0207693_10000524 | 3300025915 | Bacteria | 34688 |
| 752 | Ga0207693_10000961 | 3300025915 | Bacteria | 25847 |
| 753 | Ga0207693_10008223 | 3300025915 | Bacteria | 8543 |
| 754 | Ga0207693_10013230 | 3300025915 | Bacteria | 6658 |
| 755 | Ga0207693_10014832 | 3300025915 | Bacteria | 6259 |
| 756 | Ga0207693_10023945 | 3300025915 | Bacteria | 4847 |
| 757 | Ga0207693_10075765 | 3300025915 | Bacteria | 2635 |
| 758 | Ga0207693_10119681 | 3300025915 | Bacteria | 2068 |
| 759 | Ga0207693_10171491 | 3300025915 | Bacteria | 1708 |
| 760 | Ga0207693_10938887 | 3300025915 | Bacteria | 663 |
| 761 | Ga0207663_10001734 | 3300025916 | Bacteria | 10244 |
| 762 | Ga0207663_10001859 | 3300025916 | Bacteria | 9984 |
| 763 | Ga0207663_10004743 | 3300025916 | Bacteria | 6793 |
| 764 | Ga0207663_10015680 | 3300025916 | Bacteria | 4187 |
| 765 | Ga0207663_10026236 | 3300025916 | Bacteria | 3379 |
| 766 | Ga0207663_10028036 | 3300025916 | Bacteria | 3291 |
| 767 | Ga0207663_10125516 | 3300025916 | Bacteria | 1765 |
| 768 | Ga0207663_10138418 | 3300025916 | Bacteria | 1692 |
| 769 | Ga0207663_10155129 | 3300025916 | Bacteria | 1610 |
| 770 | Ga0207663_10210328 | 3300025916 | Bacteria | 1409 |
| 771 | Ga0207663_10270634 | 3300025916 | Unclassified | 1258 |
| 772 | Ga0207663_10593226 | 3300025916 | Bacteria | 870 |
| 773 | Ga0207663_10688618 | 3300025916 | Bacteria | 809 |
| 774 | Ga0207660_10098507 | 3300025917 | Unclassified | 2181 |
| 775 | Ga0207660_10449225 | 3300025917 | Bacteria | 1042 |
| 776 | Ga0207660_10607143 | 3300025917 | Bacteria | 891 |
| 777 | Ga0207660_10607628 | 3300025917 | Unclassified | 891 |
| 778 | Ga0207657_10000242 | 3300025919 | Bacteria | 57883 |
| 779 | Ga0207657_10004544 | 3300025919 | Bacteria | 14660 |
| 780 | Ga0207657_10540098 | 3300025919 | Unclassified | 912 |
| 781 | Ga0207649_10000177 | 3300025920 | Bacteria | 52361 |
| 782 | Ga0207649_10017954 | 3300025920 | Bacteria | 4013 |
| 783 | Ga0207649_10135827 | 3300025920 | Unclassified | 1676 |
| 784 | Ga0207652_10051559 | 3300025921 | Bacteria | 3528 |
| 785 | Ga0207652_10085723 | 3300025921 | Unclassified | 2760 |
| 786 | Ga0207652_10178854 | 3300025921 | Bacteria | 1906 |
| 787 | Ga0207652_10204269 | 3300025921 | Bacteria | 1778 |
| 788 | Ga0207652_10229348 | 3300025921 | Bacteria | 1673 |
| 789 | Ga0207652_10300171 | 3300025921 | Unclassified | 1450 |
| 790 | Ga0207652_11013346 | 3300025921 | Unclassified | 729 |
| 791 | Ga0207646_10000348 | 3300025922 | Bacteria | 62738 |
| 792 | Ga0207646_10001267 | 3300025922 | Bacteria | 31649 |
| 793 | Ga0207646_10033930 | 3300025922 | Bacteria | 4612 |
| 794 | Ga0207646_10180094 | 3300025922 | Bacteria | 1909 |
| 795 | Ga0207646_10519122 | 3300025922 | Bacteria | 1072 |
| 796 | Ga0207681_10137815 | 3300025923 | Unclassified | 1813 |
| 797 | Ga0207681_10274769 | 3300025923 | Unclassified | 1324 |
| 798 | Ga0207694_10019580 | 3300025924 | Bacteria | 5117 |
| 799 | Ga0207694_10078313 | 3300025924 | Bacteria | 2591 |
| 800 | Ga0207694_10152856 | 3300025924 | Unclassified | 1860 |
| 801 | Ga0207694_10158395 | 3300025924 | Bacteria | 1828 |
| 802 | Ga0207694_10164503 | 3300025924 | Bacteria | 1793 |
| 803 | Ga0207694_10333271 | 3300025924 | Unclassified | 1254 |
| 804 | Ga0207650_10000072 | 3300025925 | Bacteria | 137765 |
| 805 | Ga0207650_10000078 | 3300025925 | Bacteria | 130954 |
| 806 | Ga0207650_10020813 | 3300025925 | Bacteria | 4632 |
| 807 | Ga0207650_10259650 | 3300025925 | Bacteria | 1409 |
| 808 | Ga0207650_10376014 | 3300025925 | Bacteria | 1172 |
| 809 | Ga0207659_10092620 | 3300025926 | Unclassified | 2260 |
| 810 | Ga0207659_10138410 | 3300025926 | Unclassified | 1887 |
| 811 | Ga0207659_10143413 | 3300025926 | Bacteria | 1857 |
| 812 | Ga0207659_10683307 | 3300025926 | Bacteria | 878 |
| 813 | Ga0207659_11067929 | 3300025926 | Bacteria | 695 |
| 814 | Ga0207687_10001734 | 3300025927 | Bacteria | 15023 |
| 815 | Ga0207687_10004355 | 3300025927 | Bacteria | 9444 |
| 816 | Ga0207687_10042892 | 3300025927 | Bacteria | 3115 |
| 817 | Ga0207687_10211196 | 3300025927 | Bacteria | 1523 |
| 818 | Ga0207687_10335612 | 3300025927 | Bacteria | 1227 |
| 819 | Ga0207687_10557002 | 3300025927 | Bacteria | 962 |
| 820 | Ga0207700_10001427 | 3300025928 | Bacteria | 13541 |
| 821 | Ga0207700_10021787 | 3300025928 | Bacteria | 4382 |
| 822 | Ga0207700_10022935 | 3300025928 | Bacteria | 4292 |
| 823 | Ga0207700_10027238 | 3300025928 | Unclassified | 4000 |
| 824 | Ga0207700_10028863 | 3300025928 | Bacteria | 3909 |
| 825 | Ga0207700_10034336 | 3300025928 | Bacteria | 3641 |
| 826 | Ga0207700_10041527 | 3300025928 | Bacteria | 3366 |
| 827 | Ga0207700_10063437 | 3300025928 | Bacteria | 2810 |
| 828 | Ga0207700_10104271 | 3300025928 | Bacteria | 2269 |
| 829 | Ga0207700_10104872 | 3300025928 | Unclassified | 2263 |
| 830 | Ga0207700_10106753 | 3300025928 | Bacteria | 2245 |
| 831 | Ga0207700_10191786 | 3300025928 | Bacteria | 1717 |
| 832 | Ga0207700_10206384 | 3300025928 | Bacteria | 1659 |
| 833 | Ga0207700_10207494 | 3300025928 | Bacteria | 1654 |
| 834 | Ga0207700_10221360 | 3300025928 | Bacteria | 1604 |
| 835 | Ga0207700_10259524 | 3300025928 | Bacteria | 1487 |
| 836 | Ga0207700_10428458 | 3300025928 | Unclassified | 1163 |
| 837 | Ga0207700_10483438 | 3300025928 | Bacteria | 1094 |
| 838 | Ga0207700_10562919 | 3300025928 | Bacteria | 1012 |
| 839 | Ga0207700_10652505 | 3300025928 | Bacteria | 938 |
| 840 | Ga0207700_11002775 | 3300025928 | Bacteria | 747 |
| 841 | Ga0207700_11480480 | 3300025928 | Bacteria | 603 |
| 842 | Ga0207700_11604665 | 3300025928 | Bacteria | 575 |
| 843 | Ga0207664_10035117 | 3300025929 | Bacteria | 3866 |
| 844 | Ga0207664_10049398 | 3300025929 | Unclassified | 3312 |
| 845 | Ga0207664_10055328 | 3300025929 | Bacteria | 3148 |
| 846 | Ga0207664_10064901 | 3300025929 | Bacteria | 2922 |
| 847 | Ga0207664_10073009 | 3300025929 | Bacteria | 2768 |
| 848 | Ga0207664_10119385 | 3300025929 | Bacteria | 2204 |
| 849 | Ga0207664_10120971 | 3300025929 | Unclassified | 2191 |
| 850 | Ga0207664_10125915 | 3300025929 | Bacteria | 2151 |
| 851 | Ga0207664_10145912 | 3300025929 | Bacteria | 2006 |
| 852 | Ga0207664_10206778 | 3300025929 | Bacteria | 1697 |
| 853 | Ga0207664_10267429 | 3300025929 | Bacteria | 1497 |
| 854 | Ga0207664_10280458 | 3300025929 | Bacteria | 1462 |
| 855 | Ga0207664_10322698 | 3300025929 | Bacteria | 1363 |
| 856 | Ga0207664_10408277 | 3300025929 | Unclassified | 1209 |
| 857 | Ga0207664_10575630 | 3300025929 | Bacteria | 1011 |
| 858 | Ga0207664_10810414 | 3300025929 | Bacteria | 842 |
| 859 | Ga0207664_10874765 | 3300025929 | Bacteria | 807 |
| 860 | Ga0207664_10920441 | 3300025929 | Bacteria | 785 |
| 861 | Ga0207644_10088536 | 3300025931 | Unclassified | 2303 |
| 862 | Ga0207644_11014172 | 3300025931 | Unclassified | 697 |
| 863 | Ga0207690_10022280 | 3300025932 | Unclassified | 3938 |
| 864 | Ga0207690_10655260 | 3300025932 | Unclassified | 861 |
| 865 | Ga0207706_10003412 | 3300025933 | Bacteria | 15181 |
| 866 | Ga0207706_10020486 | 3300025933 | Bacteria | 5944 |
| 867 | Ga0207706_10022082 | 3300025933 | Bacteria | 5712 |
| 868 | Ga0207686_10060006 | 3300025934 | Bacteria | 2406 |
| 869 | Ga0207686_10084322 | 3300025934 | Bacteria | 2082 |
| 870 | Ga0207686_10095150 | 3300025934 | Bacteria | 1976 |
| 871 | Ga0207709_10277959 | 3300025935 | Bacteria | 1235 |
| 872 | Ga0207670_10035848 | 3300025936 | Bacteria | 3221 |
| 873 | Ga0207670_10290118 | 3300025936 | Unclassified | 1278 |
| 874 | Ga0207670_11168690 | 3300025936 | Bacteria | 651 |
| 875 | Ga0207669_10871523 | 3300025937 | Unclassified | 750 |
| 876 | Ga0207704_10016976 | 3300025938 | Bacteria | 3759 |
| 877 | Ga0207704_10077655 | 3300025938 | Bacteria | 2133 |
| 878 | Ga0207704_10162300 | 3300025938 | Bacteria | 1592 |
| 879 | Ga0207704_10313466 | 3300025938 | Unclassified | 1207 |
| 880 | Ga0207665_10008885 | 3300025939 | Bacteria | 6598 |
| 881 | Ga0207665_10011904 | 3300025939 | Bacteria | 5713 |
| 882 | Ga0207665_10026521 | 3300025939 | Bacteria | 3825 |
| 883 | Ga0207665_10029957 | 3300025939 | Bacteria | 3596 |
| 884 | Ga0207665_10059495 | 3300025939 | Bacteria | 2586 |
| 885 | Ga0207665_10062057 | 3300025939 | Bacteria | 2535 |
| 886 | Ga0207665_10102172 | 3300025939 | Bacteria | 2003 |
| 887 | Ga0207665_10151101 | 3300025939 | Bacteria | 1663 |
| 888 | Ga0207665_10152393 | 3300025939 | Unclassified | 1657 |
| 889 | Ga0207665_10222969 | 3300025939 | Unclassified | 1382 |
| 890 | Ga0207665_10310186 | 3300025939 | Bacteria | 1182 |
| 891 | Ga0207665_10435044 | 3300025939 | Bacteria | 1004 |
| 892 | Ga0207665_10518534 | 3300025939 | Bacteria | 923 |
| 893 | Ga0207665_10661700 | 3300025939 | Bacteria | 819 |
| 894 | Ga0207665_10883712 | 3300025939 | Bacteria | 708 |
| 895 | Ga0207691_10000853 | 3300025940 | Bacteria | 30247 |
| 896 | Ga0207691_10386750 | 3300025940 | Bacteria | 1194 |
| 897 | Ga0207691_10769395 | 3300025940 | Unclassified | 810 |
| 898 | Ga0207711_10006085 | 3300025941 | Bacteria | 10191 |
| 899 | Ga0207711_10020209 | 3300025941 | Bacteria | 5549 |
| 900 | Ga0207711_10025091 | 3300025941 | Bacteria | 5001 |
| 901 | Ga0207711_10031024 | 3300025941 | Unclassified | 4509 |
| 902 | Ga0207711_10486305 | 3300025941 | Bacteria | 1150 |
| 903 | Ga0207711_10705534 | 3300025941 | Bacteria | 941 |
| 904 | Ga0207711_11238307 | 3300025941 | Bacteria | 688 |
| 905 | Ga0207711_11251049 | 3300025941 | Bacteria | 684 |
| 906 | Ga0207689_10000495 | 3300025942 | Bacteria | 37206 |
| 907 | Ga0207689_10000707 | 3300025942 | Bacteria | 31997 |
| 908 | Ga0207689_10020706 | 3300025942 | Bacteria | 5530 |
| 909 | Ga0207661_10000008 | 3300025944 | Bacteria | 451211 |
| 910 | Ga0207661_10001451 | 3300025944 | Bacteria | 16007 |
| 911 | Ga0207661_10159466 | 3300025944 | Unclassified | 1956 |
| 912 | Ga0207661_10840439 | 3300025944 | Bacteria | 845 |
| 913 | Ga0207661_11007782 | 3300025944 | Bacteria | 767 |
| 914 | Ga0207679_10000177 | 3300025945 | Bacteria | 52657 |
| 915 | Ga0207679_10038189 | 3300025945 | Unclassified | 3419 |
| 916 | Ga0207667_10002400 | 3300025949 | Bacteria | 23462 |
| 917 | Ga0207667_10016688 | 3300025949 | Bacteria | 8287 |
| 918 | Ga0207667_10046866 | 3300025949 | Bacteria | 4577 |
| 919 | Ga0207667_10064709 | 3300025949 | Bacteria | 3816 |
| 920 | Ga0207667_10121862 | 3300025949 | Bacteria | 2687 |
| 921 | Ga0207667_10317984 | 3300025949 | Bacteria | 1590 |
| 922 | Ga0207667_10331765 | 3300025949 | Unclassified | 1553 |
| 923 | Ga0207667_10493290 | 3300025949 | Bacteria | 1243 |
| 924 | Ga0207667_10544159 | 3300025949 | Bacteria | 1175 |
| 925 | Ga0207651_10004381 | 3300025960 | Bacteria | 7103 |
| 926 | Ga0207651_10037247 | 3300025960 | Unclassified | 3185 |
| 927 | Ga0207651_10569137 | 3300025960 | Bacteria | 987 |
| 928 | Ga0207651_10569485 | 3300025960 | Bacteria | 987 |
| 929 | Ga0207712_11015935 | 3300025961 | Bacteria | 736 |
| 930 | Ga0207668_10019365 | 3300025972 | Bacteria | 4301 |
| 931 | Ga0207640_10000843 | 3300025981 | Bacteria | 17434 |
| 932 | Ga0207640_10002817 | 3300025981 | Bacteria | 9326 |
| 933 | Ga0207640_10048913 | 3300025981 | Bacteria | 2736 |
| 934 | Ga0207640_10068120 | 3300025981 | Bacteria | 2384 |
| 935 | Ga0207640_10079331 | 3300025981 | Bacteria | 2237 |
| 936 | Ga0207640_10625896 | 3300025981 | Bacteria | 914 |
| 937 | Ga0207658_10127573 | 3300025986 | Unclassified | 2038 |
| 938 | Ga0207658_10367425 | 3300025986 | Bacteria | 1257 |
| 939 | Ga0207658_10477139 | 3300025986 | Bacteria | 1108 |
| 940 | Ga0207677_10001146 | 3300026023 | Bacteria | 14471 |
| 941 | Ga0207677_10004684 | 3300026023 | Bacteria | 7369 |
| 942 | Ga0207677_10039291 | 3300026023 | Bacteria | 3110 |
| 943 | Ga0207677_10111614 | 3300026023 | Bacteria | 2037 |
| 944 | Ga0207677_10136790 | 3300026023 | Unclassified | 1869 |
| 945 | Ga0207677_10860316 | 3300026023 | Unclassified | 815 |
| 946 | Ga0207677_10970364 | 3300026023 | Bacteria | 769 |
| 947 | Ga0207703_10007481 | 3300026035 | Bacteria | 8674 |
| 948 | Ga0207703_10014707 | 3300026035 | Bacteria | 6107 |
| 949 | Ga0207703_10029526 | 3300026035 | Bacteria | 4327 |
| 950 | Ga0207703_10071736 | 3300026035 | Bacteria | 2861 |
| 951 | Ga0207703_10253027 | 3300026035 | Bacteria | 1589 |
| 952 | Ga0207703_10690093 | 3300026035 | Bacteria | 970 |
| 953 | Ga0207703_10852301 | 3300026035 | Bacteria | 871 |
| 954 | Ga0207703_11341010 | 3300026035 | Bacteria | 688 |
| 955 | Ga0207639_10298587 | 3300026041 | Bacteria | 1423 |
| 956 | Ga0207639_10464596 | 3300026041 | Bacteria | 1151 |
| 957 | Ga0207639_10566526 | 3300026041 | Bacteria | 1044 |
| 958 | Ga0207678_10001196 | 3300026067 | Bacteria | 23816 |
| 959 | Ga0207678_10001295 | 3300026067 | Bacteria | 23151 |
| 960 | Ga0207708_10323073 | 3300026075 | Unclassified | 1260 |
| 961 | Ga0207702_10001116 | 3300026078 | Bacteria | 27436 |
| 962 | Ga0207702_10006348 | 3300026078 | Bacteria | 10211 |
| 963 | Ga0207702_10027482 | 3300026078 | Bacteria | 4725 |
| 964 | Ga0207702_10030402 | 3300026078 | Bacteria | 4501 |
| 965 | Ga0207702_10118325 | 3300026078 | Bacteria | 2367 |
| 966 | Ga0207702_10173068 | 3300026078 | Bacteria | 1982 |
| 967 | Ga0207702_10256585 | 3300026078 | Bacteria | 1644 |
| 968 | Ga0207702_10579191 | 3300026078 | Bacteria | 1100 |
| 969 | Ga0207702_10600752 | 3300026078 | Bacteria | 1080 |
| 970 | Ga0207702_10606411 | 3300026078 | Unclassified | 1074 |
| 971 | Ga0207702_10698639 | 3300026078 | Bacteria | 999 |
| 972 | Ga0207641_10000237 | 3300026088 | Bacteria | 71168 |
| 973 | Ga0207641_10022076 | 3300026088 | Bacteria | 5236 |
| 974 | Ga0207641_10052884 | 3300026088 | Bacteria | 3441 |
| 975 | Ga0207641_10071506 | 3300026088 | Unclassified | 2984 |
| 976 | Ga0207641_10132612 | 3300026088 | Bacteria | 2239 |
| 977 | Ga0207641_10199655 | 3300026088 | Unclassified | 1843 |
| 978 | Ga0207641_10224754 | 3300026088 | Bacteria | 1743 |
| 979 | Ga0207641_10286867 | 3300026088 | Bacteria | 1550 |
| 980 | Ga0207641_10404294 | 3300026088 | Unclassified | 1312 |
| 981 | Ga0207648_10010733 | 3300026089 | Bacteria | 8660 |
| 982 | Ga0207648_10014004 | 3300026089 | Bacteria | 7430 |
| 983 | Ga0207648_10731050 | 3300026089 | Bacteria | 918 |
| 984 | Ga0207648_11660121 | 3300026089 | Bacteria | 600 |
| 985 | Ga0207676_10000050 | 3300026095 | Bacteria | 133298 |
| 986 | Ga0207676_10012503 | 3300026095 | Bacteria | 6085 |
| 987 | Ga0207676_10081753 | 3300026095 | Bacteria | 2625 |
| 988 | Ga0207674_10000130 | 3300026116 | Bacteria | 88123 |
| 989 | Ga0207674_10000269 | 3300026116 | Bacteria | 65505 |
| 990 | Ga0207674_10048042 | 3300026116 | Bacteria | 4371 |
| 991 | Ga0207674_10238253 | 3300026116 | Bacteria | 1766 |
| 992 | Ga0207674_10358129 | 3300026116 | Bacteria | 1410 |
| 993 | Ga0207674_10538057 | 3300026116 | Bacteria | 1128 |
| 994 | Ga0207674_10898673 | 3300026116 | Unclassified | 854 |
| 995 | Ga0207675_100191788 | 3300026118 | Bacteria | 1960 |
| 996 | Ga0207675_100715655 | 3300026118 | Unclassified | 1011 |
| 997 | Ga0207683_10000139 | 3300026121 | Bacteria | 59769 |
| 998 | Ga0207683_10082676 | 3300026121 | Bacteria | 2853 |
| 999 | Ga0207683_10112642 | 3300026121 | Bacteria | 2436 |
| 1000 | Ga0207683_10187805 | 3300026121 | Bacteria | 1875 |
| 1001 | Ga0207683_10294985 | 3300026121 | Bacteria | 1483 |
| 1002 | Ga0207698_10055373 | 3300026142 | Bacteria | 3057 |
| 1003 | Ga0207698_10060280 | 3300026142 | Unclassified | 2950 |
| 1004 | Ga0207698_10080622 | 3300026142 | Bacteria | 2623 |
| 1005 | Ga0207698_10696240 | 3300026142 | Bacteria | 1011 |
| 1006 | Ga0207698_10717698 | 3300026142 | Bacteria | 996 |
| 1007 | Ga0265354_1007310 | 3300028016 | Bacteria | 1082 |
| 1008 | Ga0265356_1000067 | 3300028017 | Bacteria | 17129 |
| 1009 | Ga0265356_1007396 | 3300028017 | Bacteria | 1267 |
| 1010 | Ga0265355_1002063 | 3300028036 | Bacteria | 1374 |
| 1011 | Ga0265355_1008363 | 3300028036 | Unclassified | 827 |
| 1012 | Ga0268266_10004469 | 3300028379 | Bacteria | 13368 |
| 1013 | Ga0268266_10079038 | 3300028379 | Bacteria | 2863 |
| 1014 | Ga0268266_10614477 | 3300028379 | Unclassified | 1045 |
| 1015 | Ga0268265_10022237 | 3300028380 | Unclassified | 4452 |
| 1016 | Ga0268265_10593707 | 3300028380 | Bacteria | 1057 |
| 1017 | Ga0268264_10004223 | 3300028381 | Bacteria | 12261 |
| 1018 | Ga0268264_10171272 | 3300028381 | Bacteria | 1964 |
| 1019 | Ga0268264_10238198 | 3300028381 | Bacteria | 1684 |
| 1020 | Ga0268264_10453458 | 3300028381 | Bacteria | 1243 |
| 1021 | Ga0265326_10102496 | 3300028558 | Bacteria | 812 |
| 1022 | Ga0265319_1042553 | 3300028563 | Bacteria | 1528 |
| 1023 | Ga0265318_10030718 | 3300028577 | Bacteria | 2088 |
| 1024 | Ga0265338_10003647 | 3300028800 | Bacteria | 21449 |
| 1025 | Ga0265338_10062736 | 3300028800 | Bacteria | 3246 |
| 1026 | Ga0265338_10068968 | 3300028800 | Bacteria | 3042 |
| 1027 | Ga0265338_10094425 | 3300028800 | Bacteria | 2460 |
| 1028 | Ga0265338_10160055 | 3300028800 | Bacteria | 1740 |
| 1029 | Ga0265338_10191003 | 3300028800 | Bacteria | 1553 |
| 1030 | Ga0265324_10008993 | 3300029957 | Bacteria | 3926 |
| 1031 | Ga0265762_1004268 | 3300030760 | Bacteria | 2562 |
| 1032 | Ga0265770_1010176 | 3300030878 | Bacteria | 1362 |
| 1033 | Ga0265765_1000153 | 3300030879 | Bacteria | 4352 |
| 1034 | Ga0265760_10002485 | 3300031090 | Bacteria | 5380 |
| 1035 | Ga0265760_10005151 | 3300031090 | Bacteria | 3746 |
| 1036 | Ga0265760_10014930 | 3300031090 | Bacteria | 2226 |
| 1037 | Ga0265760_10048912 | 3300031090 | Unclassified | 1271 |
| 1038 | Ga0265330_10033168 | 3300031235 | Bacteria | 2311 |
| 1039 | Ga0265330_10163731 | 3300031235 | Unclassified | 944 |
| 1040 | Ga0265332_10028089 | 3300031238 | Bacteria | 2464 |
| 1041 | Ga0265332_10072165 | 3300031238 | Bacteria | 1470 |
| 1042 | Ga0265332_10072223 | 3300031238 | Bacteria | 1469 |
| 1043 | Ga0265328_10005736 | 3300031239 | Bacteria | 5304 |
| 1044 | Ga0265328_10047778 | 3300031239 | Bacteria | 1573 |
| 1045 | Ga0265320_10009889 | 3300031240 | Bacteria | 5714 |
| 1046 | Ga0265325_10000515 | 3300031241 | Bacteria | 28005 |
| 1047 | Ga0265325_10056890 | 3300031241 | Bacteria | 1996 |
| 1048 | Ga0265325_10095371 | 3300031241 | Bacteria | 1462 |
| 1049 | Ga0265325_10131863 | 3300031241 | Unclassified | 1196 |
| 1050 | Ga0265325_10184316 | 3300031241 | Bacteria | 971 |
| 1051 | Ga0265329_10048292 | 3300031242 | Bacteria | 1357 |
| 1052 | Ga0265340_10001090 | 3300031247 | Bacteria | 15466 |
| 1053 | Ga0265340_10024598 | 3300031247 | Bacteria | 3057 |
| 1054 | Ga0265340_10069313 | 3300031247 | Bacteria | 1674 |
| 1055 | Ga0265339_10026663 | 3300031249 | Bacteria | 3308 |
| 1056 | Ga0265339_10027470 | 3300031249 | Unclassified | 3248 |
| 1057 | Ga0265339_10034507 | 3300031249 | Bacteria | 2842 |
| 1058 | Ga0265339_10072131 | 3300031249 | Bacteria | 1838 |
| 1059 | Ga0265339_10234287 | 3300031249 | Bacteria | 894 |
| 1060 | Ga0265331_10003381 | 3300031250 | Bacteria | 10345 |
| 1061 | Ga0265331_10006153 | 3300031250 | Bacteria | 7136 |
| 1062 | Ga0265331_10048760 | 3300031250 | Unclassified | 2035 |
| 1063 | Ga0265331_10105229 | 3300031250 | Unclassified | 1296 |
| 1064 | Ga0265316_10001130 | 3300031344 | Bacteria | 28937 |
| 1065 | Ga0265316_10003692 | 3300031344 | Bacteria | 15426 |
| 1066 | Ga0265316_10006205 | 3300031344 | Bacteria | 11456 |
| 1067 | Ga0265316_10009598 | 3300031344 | Bacteria | 8891 |
| 1068 | Ga0265316_10030197 | 3300031344 | Bacteria | 4446 |
| 1069 | Ga0265316_10041585 | 3300031344 | Bacteria | 3677 |
| 1070 | Ga0265316_10144087 | 3300031344 | Bacteria | 1788 |
| 1071 | Ga0265316_10203343 | 3300031344 | Unclassified | 1467 |
| 1072 | Ga0265316_10523500 | 3300031344 | Bacteria | 845 |
| 1073 | Ga0265313_10002383 | 3300031595 | Bacteria | 16313 |
| 1074 | Ga0265314_10001611 | 3300031711 | Bacteria | 24771 |
| 1075 | Ga0265314_10008835 | 3300031711 | Bacteria | 8606 |
| 1076 | Ga0265314_10103896 | 3300031711 | Unclassified | 1820 |
| 1077 | Ga0265342_10056404 | 3300031712 | Bacteria | 2328 |
| 1078 | Ga0307405_10251639 | 3300031731 | Unclassified | 1315 |
| 1079 | Ga0307405_10365018 | 3300031731 | Bacteria | 1119 |
| 1080 | Ga0307410_10001021 | 3300031852 | Bacteria | 12145 |
| 1081 | Ga0307406_10037832 | 3300031901 | Bacteria | 2983 |
| 1082 | Ga0307406_10445054 | 3300031901 | Bacteria | 1038 |
| 1083 | Ga0307407_10307731 | 3300031903 | Bacteria | 1107 |
| 1084 | Ga0307416_100093784 | 3300032002 | Unclassified | 2587 |
| 1085 | Ga0307416_100224104 | 3300032002 | Bacteria | 1806 |
| 1086 | Ga0307414_10074236 | 3300032004 | Bacteria | 2463 |
| 1087 | Ga0307415_101099249 | 3300032126 | Unclassified | 744 |
| 1088 | Ga0373930_0002114 | 3300034816 | Unclassified | 3043 |
| 1089 | Ga0373926_0007641 | 3300035083 | Bacteria | 3599 |
| 1090 | Ga0373926_0020857 | 3300035083 | Bacteria | 2266 |
| 1091 | Ga0373926_0028374 | 3300035083 | Unclassified | 1964 |
| 1092 | Ga0373926_0187838 | 3300035083 | Bacteria | 793 |
| 1093 | Ga0373928_0028357 | 3300035084 | Bacteria | 1225 |
| 1094 | Ga0373934_0031847 | 3300035086 | Bacteria | 2066 |
| 1095 | Ga0373934_0232490 | 3300035086 | Bacteria | 761 |
| 1096 | Ga0373940_0056696 | 3300035088 | Bacteria | 1112 |
| 1097 | Ga0373944_0011305 | 3300035089 | Bacteria | 2444 |
| 1098 | Ga0373923_0068497 | 3300035111 | Bacteria | 1520 |
| 1099 | Ga0373923_0085489 | 3300035111 | Bacteria | 1373 |
| 1100 | Ga0373923_0194956 | 3300035111 | Bacteria | 935 |
| 1101 | Ga0373932_0091587 | 3300035112 | Bacteria | 976 |
| 1102 | Ga0373936_0000172 | 3300035113 | Bacteria | 21486 |
| 1103 | Ga0373936_0012995 | 3300035113 | Bacteria | 3175 |
| 1104 | Ga0373936_0102549 | 3300035113 | Bacteria | 1208 |
| 1105 | Ga0373936_0410490 | 3300035113 | Bacteria | 623 |
| 1106 | Ga0373939_0123489 | 3300035114 | Bacteria | 916 |
| 1107 | Ga0373941_0074815 | 3300035115 | Bacteria | 1132 |
| 1108 | Ga0373945_0001375 | 3300035116 | Bacteria | 7385 |
| 1109 | Ga0373945_0002395 | 3300035116 | Bacteria | 5881 |
| 1110 | Ga0373945_0128264 | 3300035116 | Bacteria | 1014 |
| 1111 | Ga0373945_0134718 | 3300035116 | Unclassified | 992 |
| 1112 | Ga0373953_0003772 | 3300035117 | Bacteria | 4764 |
| 1113 | Ga0373953_0192043 | 3300035117 | Bacteria | 882 |
| 1114 | Ga0373954_0007793 | 3300035118 | Bacteria | 4688 |
| 1115 | Ga0373954_0013276 | 3300035118 | Bacteria | 3670 |
| 1116 | Ga0373954_0169065 | 3300035118 | Bacteria | 1070 |
| 1117 | Ga0373956_0036548 | 3300035119 | Bacteria | 2168 |
| 1118 | Ga0373956_0039447 | 3300035119 | Bacteria | 2093 |
| 1119 | Ga0373956_0054467 | 3300035119 | Bacteria | 1802 |
| 1120 | Ga0373957_0017752 | 3300035120 | Bacteria | 2484 |
| 1121 | Ga0373943_0000055 | 3300035170 | Bacteria | 38929 |
| 1122 | Ga0373943_0003910 | 3300035170 | Bacteria | 6779 |
| 1123 | Ga0373943_0020297 | 3300035170 | Bacteria | 3062 |
| 1124 | Ga0373943_0226425 | 3300035170 | Bacteria | 1043 |
| 1125 | Ga0373943_0344765 | 3300035170 | Unclassified | 853 |
| 1126 | Ga0373946_0029038 | 3300035171 | Unclassified | 2198 |
| 1127 | Ga0373946_0194772 | 3300035171 | Bacteria | 968 |
| 1128 | Ga0373955_0008998 | 3300035172 | Bacteria | 4661 |
| 1129 | Ga0373955_0420749 | 3300035172 | Bacteria | 813 |
| 1130 | Ga0373955_0429442 | 3300035172 | Bacteria | 804 |
| 1131 | Ga0373961_0008159 | 3300035241 | Bacteria | 2544 |
| 1132 | Ga0373961_0025165 | 3300035241 | Bacteria | 1616 |
| 1133 | Ga0373924_0000091 | 3300035410 | Bacteria | 24866 |
| 1134 | Ga0373924_0014882 | 3300035410 | Bacteria | 2945 |
| 1135 | Ga0373924_0026543 | 3300035410 | Bacteria | 2298 |
| 1136 | Ga0373924_0090317 | 3300035410 | Bacteria | 1310 |
| 1137 | Ga0373931_0053587 | 3300035691 | Bacteria | 2153 |
| 1138 | Ga0373931_0059959 | 3300035691 | Unclassified | 2047 |
| 1139 | Ga0373931_0081062 | 3300035691 | Bacteria | 1791 |
| 1140 | Ga0373931_0084890 | 3300035691 | Bacteria | 1754 |
| 1141 | Ga0373931_0504067 | 3300035691 | Unclassified | 781 |
| 1142 | Ga0373931_0602238 | 3300035691 | Bacteria | 718 |
| 1143 | Ga0373935_0002091 | 3300035692 | Bacteria | 11335 |
| 1144 | Ga0373935_0010861 | 3300035692 | Bacteria | 5470 |
| 1145 | Ga0373935_0020803 | 3300035692 | Bacteria | 4012 |
| 1146 | Ga0373935_0052573 | 3300035692 | Bacteria | 2590 |
| 1147 | Ga0373935_0082770 | 3300035692 | Bacteria | 2088 |
| 1148 | Ga0373935_0108297 | 3300035692 | Bacteria | 1841 |
| 1149 | Ga0373935_0126285 | 3300035692 | Bacteria | 1714 |
| 1150 | Ga0373935_0199832 | 3300035692 | Bacteria | 1381 |
| 1151 | Ga0373935_0218085 | 3300035692 | Bacteria | 1324 |
| 1152 | Ga0373935_0309731 | 3300035692 | Unclassified | 1118 |
| 1153 | Ga0373935_0423798 | 3300035692 | Bacteria | 958 |
| 1154 | Ga0373935_1157644 | 3300035692 | Bacteria | 576 |
| 1155 | Ga0373927_0000378 | 3300035695 | Bacteria | 34466 |
| 1156 | Ga0373927_0001571 | 3300035695 | Bacteria | 17119 |
| 1157 | Ga0373927_0005079 | 3300035695 | Bacteria | 9105 |
| 1158 | Ga0373927_0013728 | 3300035695 | Bacteria | 5378 |
| 1159 | Ga0373927_0096748 | 3300035695 | Unclassified | 1919 |
| 1160 | Ga0373927_0153053 | 3300035695 | Bacteria | 1510 |
| 1161 | Ga0373927_0198094 | 3300035695 | Unclassified | 1318 |
| 1162 | Ga0373927_0416032 | 3300035695 | Bacteria | 887 |
| 1163 | Ga0373927_0499868 | 3300035695 | Bacteria | 803 |
| 1164 | Ga0373927_0621639 | 3300035695 | Bacteria | 714 |
| 1165 | Ga0373933_0016430 | 3300035724 | Bacteria | 4139 |
| 1166 | Ga0373933_0192365 | 3300035724 | Bacteria | 1303 |
| 1167 | Ga0373933_0331569 | 3300035724 | Bacteria | 987 |
| 1168 | Ga0373933_0359390 | 3300035724 | Unclassified | 947 |
| 1169 | Ga0373933_0506434 | 3300035724 | Bacteria | 791 |
| 1170 | Ga0373933_0680214 | 3300035724 | Bacteria | 676 |
| 1171 | Ga0373947_0000167 | 3300035725 | Bacteria | 35438 |
| 1172 | Ga0373947_0001658 | 3300035725 | Bacteria | 13619 |
| 1173 | Ga0373947_0008836 | 3300035725 | Bacteria | 5794 |
| 1174 | Ga0373947_0050887 | 3300035725 | Bacteria | 2491 |
| 1175 | Ga0373947_0057197 | 3300035725 | Bacteria | 2359 |
| 1176 | Ga0373947_0061444 | 3300035725 | Bacteria | 2283 |
| 1177 | Ga0373947_0100146 | 3300035725 | Bacteria | 1820 |
| 1178 | Ga0373947_0471052 | 3300035725 | Bacteria | 852 |
| 1179 | Ga0373947_0530924 | 3300035725 | Bacteria | 800 |
| 1180 | Ga0373947_0668456 | 3300035725 | Bacteria | 708 |
| 1181 | Ga0373947_0989113 | 3300035725 | Unclassified | 574 |
| 1182 | Ga0373937_0000027 | 3300036401 | Bacteria | 123975 |
| 1183 | Ga0373937_0014721 | 3300036401 | Bacteria | 6904 |
| 1184 | Ga0373937_0018754 | 3300036401 | Bacteria | 6184 |
| 1185 | Ga0373937_0020676 | 3300036401 | Bacteria | 5903 |
| 1186 | Ga0373937_0041141 | 3300036401 | Bacteria | 4216 |
| 1187 | Ga0373937_0047249 | 3300036401 | Bacteria | 3938 |
| 1188 | Ga0373937_0076681 | 3300036401 | Bacteria | 3088 |
| 1189 | Ga0373937_0094328 | 3300036401 | Unclassified | 2775 |
| 1190 | Ga0373937_0105712 | 3300036401 | Bacteria | 2616 |
| 1191 | Ga0373937_0238504 | 3300036401 | Bacteria | 1713 |
| 1192 | Ga0373937_0310966 | 3300036401 | Bacteria | 1490 |
| 1193 | Ga0373937_0360043 | 3300036401 | Bacteria | 1379 |
| 1194 | Ga0373937_0374832 | 3300036401 | Unclassified | 1349 |
| 1195 | Ga0373937_0832647 | 3300036401 | Bacteria | 871 |
| 1196 | Ga0373937_1055870 | 3300036401 | Bacteria | 761 |
| 1197 | Ga0373937_1312534 | 3300036401 | Bacteria | 672 |
| 1198 | Ga0373925_0000224 | 3300037068 | Bacteria | 60518 |
| 1199 | Ga0373925_0015611 | 3300037068 | Bacteria | 5494 |
| 1200 | Ga0373925_0030136 | 3300037068 | Bacteria | 3981 |
| 1201 | Ga0373925_0034052 | 3300037068 | Bacteria | 3755 |
| 1202 | Ga0373925_0038481 | 3300037068 | Bacteria | 3537 |
| 1203 | Ga0373925_0073647 | 3300037068 | Bacteria | 2585 |
| 1204 | Ga0373925_0085587 | 3300037068 | Bacteria | 2403 |
| 1205 | Ga0373925_0111187 | 3300037068 | Bacteria | 2116 |
| 1206 | Ga0373925_0122640 | 3300037068 | Bacteria | 2019 |
| 1207 | Ga0373925_0124740 | 3300037068 | Bacteria | 2002 |
| 1208 | Ga0373925_0176346 | 3300037068 | Bacteria | 1690 |
| 1209 | Ga0373925_0180170 | 3300037068 | Bacteria | 1672 |
| 1210 | Ga0373925_0280191 | 3300037068 | Bacteria | 1343 |
| 1211 | Ga0373925_1142123 | 3300037068 | Unclassified | 641 |
| 1212 | Ga0436364_0135933 | 3300037853 | Bacteria | 793 |
| 1213 | Ga0436364_1194151 | 3300037853 | Bacteria | 7993 |
| 1214 | Ga0395901_0380383 | 3300038443 | Unclassified | 1453 |
| 1215 | Ga0436365_1136717 | 3300039437 | Bacteria | 1154 |
| 1216 | Ga0436365_1311817 | 3300039437 | Unclassified | 733 |
| 1217 | Ga0436365_1314150 | 3300039437 | Bacteria | 563 |
| 1218 | Ga0436365_1559181 | 3300039437 | Bacteria | 1256 |
| 1219 | Ga0436365_1751127 | 3300039437 | Bacteria | 5277 |
| 1220 | Ga0436360_0673759 | 3300039438 | Bacteria | 863 |
| 1221 | Ga0436361_0293375 | 3300039447 | Unclassified | 639 |
| 1222 | Ga0436363_0356673 | 3300039450 | Bacteria | 1835 |
| 1223 | Ga0436363_0862048 | 3300039450 | Bacteria | 1149 |
| 1224 | Ga0436363_1295381 | 3300039450 | Bacteria | 3791 |
| 1225 | Ga0436362_1047223 | 3300039453 | Bacteria | 1129 |
| 1226 | Ga0451849_1404825 | 3300041505 | Bacteria | 736 |
| 1227 | Ga0451853_1241128 | 3300041512 | Bacteria | 762 |
| 1228 | Ga0451577_1169536 | 3300042876 | Bacteria | 687 |
| 1229 | Ga0466969_0257031 | 3300044656 | Bacteria | 792 |
| 1230 | Ga0466966_0147888 | 3300044684 | Bacteria | 1434 |
| 1231 | Ga0466966_0228892 | 3300044684 | Bacteria | 1122 |
| 1232 | Ga0466961_0263248 | 3300044693 | Bacteria | 1057 |
| 1233 | Ga0466963_0003772 | 3300044694 | Bacteria | 8731 |
| 1234 | Ga0466963_0039609 | 3300044694 | Bacteria | 3087 |
| 1235 | Ga0466963_0147368 | 3300044694 | Bacteria | 1633 |
| 1236 | Ga0466964_0060019 | 3300044706 | Bacteria | 1581 |
| 1237 | Ga0466964_0130794 | 3300044706 | Unclassified | 1143 |
| 1238 | Ga0466971_0314619 | 3300044719 | Bacteria | 754 |
| 1239 | Ga0466957_0076950 | 3300044842 | Unclassified | 2073 |
| 1240 | Ga0466957_0314525 | 3300044842 | Bacteria | 1055 |
| 1241 | Ga0466959_0183933 | 3300045049 | Bacteria | 1461 |
| 1242 | Ga0451576_0097819 | 3300045051 | Unclassified | 3052 |
| 1243 | Ga0451576_0220984 | 3300045051 | Unclassified | 1978 |
| 1244 | Ga0451576_0288790 | 3300045051 | Bacteria | 1715 |
| 1245 | Ga0451576_1428665 | 3300045051 | Bacteria | 720 |
| 1246 | Ga0466967_0017316 | 3300045976 | Bacteria | 5716 |
| 1247 | Ga0466967_0046110 | 3300045976 | Bacteria | 3793 |
| 1248 | Ga0466967_0055367 | 3300045976 | Bacteria | 3494 |
| 1249 | Ga0466967_0093669 | 3300045976 | Bacteria | 2734 |
| 1250 | Ga0466967_0105221 | 3300045976 | Bacteria | 2585 |
| 1251 | Ga0466967_0338174 | 3300045976 | Bacteria | 1455 |
| 1252 | Ga0466967_0678854 | 3300045976 | Bacteria | 1020 |
| 1253 | Ga0495629_0256515 | 3300046459 | Bacteria | 1202 |
| 1254 | Ga0495629_0698185 | 3300046459 | Unclassified | 674 |
| 1255 | Ga0495651_0008434 | 3300046462 | Bacteria | 7900 |
| 1256 | Ga0495651_0050799 | 3300046462 | Bacteria | 3198 |
| 1257 | Ga0495651_0119950 | 3300046462 | Bacteria | 1934 |
| 1258 | Ga0495651_0140835 | 3300046462 | Bacteria | 1749 |
| 1259 | Ga0495651_0265564 | 3300046462 | Bacteria | 1166 |
| 1260 | Ga0495651_0449636 | 3300046462 | Bacteria | 833 |
| 1261 | Ga0495653_0045879 | 3300046463 | Bacteria | 3386 |
| 1262 | Ga0495653_0107349 | 3300046463 | Bacteria | 2012 |
| 1263 | Ga0495653_0427750 | 3300046463 | Unclassified | 837 |
| 1264 | Ga0495580_0001464 | 3300046472 | Bacteria | 20696 |
| 1265 | Ga0495580_0003534 | 3300046472 | Bacteria | 13276 |
| 1266 | Ga0495580_0006199 | 3300046472 | Bacteria | 9779 |
| 1267 | Ga0495580_0006438 | 3300046472 | Bacteria | 9560 |
| 1268 | Ga0495580_0017479 | 3300046472 | Bacteria | 5364 |
| 1269 | Ga0495580_0017970 | 3300046472 | Bacteria | 5273 |
| 1270 | Ga0495580_0018597 | 3300046472 | Bacteria | 5172 |
| 1271 | Ga0495580_0022698 | 3300046472 | Bacteria | 4614 |
| 1272 | Ga0495580_0026438 | 3300046472 | Bacteria | 4231 |
| 1273 | Ga0495580_0046088 | 3300046472 | Bacteria | 3095 |
| 1274 | Ga0495580_0056536 | 3300046472 | Unclassified | 2763 |
| 1275 | Ga0495580_0063028 | 3300046472 | Bacteria | 2601 |
| 1276 | Ga0495580_0063517 | 3300046472 | Bacteria | 2589 |
| 1277 | Ga0495580_0089990 | 3300046472 | Bacteria | 2137 |
| 1278 | Ga0495580_0111264 | 3300046472 | Bacteria | 1902 |
| 1279 | Ga0495580_0161973 | 3300046472 | Bacteria | 1548 |
| 1280 | Ga0495580_0224717 | 3300046472 | Bacteria | 1290 |
| 1281 | Ga0495580_0262763 | 3300046472 | Bacteria | 1180 |
| 1282 | Ga0495580_0286305 | 3300046472 | Bacteria | 1123 |
| 1283 | Ga0495580_0362672 | 3300046472 | Bacteria | 980 |
| 1284 | Ga0495580_0416062 | 3300046472 | Bacteria | 905 |
| 1285 | Ga0495582_0012871 | 3300046473 | Bacteria | 4609 |
| 1286 | Ga0495582_0074764 | 3300046473 | Bacteria | 1876 |
| 1287 | Ga0495582_0101868 | 3300046473 | Bacteria | 1608 |
| 1288 | Ga0495582_0214216 | 3300046473 | Bacteria | 1101 |
| 1289 | Ga0495582_0521101 | 3300046473 | Unclassified | 687 |
| 1290 | Ga0495605_0166527 | 3300046474 | Bacteria | 976 |
| 1291 | Ga0495639_0074315 | 3300046475 | Bacteria | 1575 |
| 1292 | Ga0495662_0030179 | 3300046476 | Bacteria | 2617 |
| 1293 | Ga0495662_0245639 | 3300046476 | Bacteria | 882 |
| 1294 | Ga0495664_0003847 | 3300046477 | Bacteria | 8192 |
| 1295 | Ga0495664_0094774 | 3300046477 | Unclassified | 1797 |
| 1296 | Ga0495664_0164274 | 3300046477 | Bacteria | 1347 |
| 1297 | Ga0495664_0212461 | 3300046477 | Bacteria | 1172 |
| 1298 | Ga0495664_0333026 | 3300046477 | Bacteria | 915 |
| 1299 | Ga0495585_0441807 | 3300046492 | Unclassified | 623 |
| 1300 | Ga0495594_0152024 | 3300046499 | Bacteria | 1314 |
| 1301 | Ga0495608_0082532 | 3300046511 | Bacteria | 2087 |
| 1302 | Ga0495608_0108032 | 3300046511 | Bacteria | 1790 |
| 1303 | Ga0495608_0159226 | 3300046511 | Bacteria | 1436 |
| 1304 | Ga0495618_0221675 | 3300046514 | Bacteria | 1193 |
| 1305 | Ga0495618_0253768 | 3300046514 | Bacteria | 1103 |
| 1306 | Ga0495628_0023575 | 3300046516 | Bacteria | 5050 |
| 1307 | Ga0495628_0244132 | 3300046516 | Unclassified | 1343 |
| 1308 | Ga0495628_0428850 | 3300046516 | Bacteria | 963 |
| 1309 | Ga0495628_0489103 | 3300046516 | Bacteria | 890 |
| 1310 | Ga0495628_0748032 | 3300046516 | Bacteria | 687 |
| 1311 | Ga0495630_0013505 | 3300046517 | Bacteria | 5939 |
| 1312 | Ga0495630_0051815 | 3300046517 | Bacteria | 3072 |
| 1313 | Ga0495630_0058816 | 3300046517 | Bacteria | 2882 |
| 1314 | Ga0495630_0109713 | 3300046517 | Bacteria | 2090 |
| 1315 | Ga0495630_0299420 | 3300046517 | Bacteria | 1229 |
| 1316 | Ga0495666_0208869 | 3300046526 | Bacteria | 896 |
| 1317 | Ga0495666_0227609 | 3300046526 | Bacteria | 853 |
| 1318 | Ga0495642_0237719 | 3300046528 | Bacteria | 796 |
| 1319 | Ga0495642_0340052 | 3300046528 | Bacteria | 659 |
| 1320 | Ga0495652_0168939 | 3300046529 | Bacteria | 1690 |
| 1321 | Ga0495652_0349477 | 3300046529 | Bacteria | 1060 |
| 1322 | Ga0495652_0395440 | 3300046529 | Bacteria | 980 |
| 1323 | Ga0495665_0021545 | 3300046531 | Bacteria | 3463 |
| 1324 | Ga0495665_0025270 | 3300046531 | Bacteria | 3191 |
| 1325 | Ga0495665_0034989 | 3300046531 | Bacteria | 2685 |
| 1326 | Ga0495665_0088377 | 3300046531 | Bacteria | 1629 |
| 1327 | Ga0495665_0203784 | 3300046531 | Bacteria | 1025 |
| 1328 | Ga0495665_0236414 | 3300046531 | Bacteria | 942 |
| 1329 | Ga0495665_0428360 | 3300046531 | Unclassified | 670 |
| 1330 | Ga0495640_0058921 | 3300046533 | Bacteria | 2618 |
| 1331 | Ga0495640_0085863 | 3300046533 | Bacteria | 2085 |
| 1332 | Ga0495640_0433249 | 3300046533 | Bacteria | 805 |
| 1333 | Ga0495640_0583376 | 3300046533 | Bacteria | 676 |
| 1334 | Ga0495586_0133604 | 3300046535 | Unclassified | 1390 |
| 1335 | Ga0495587_0066973 | 3300046536 | Bacteria | 2094 |
| 1336 | Ga0495587_0072064 | 3300046536 | Bacteria | 2009 |
| 1337 | Ga0495587_0292904 | 3300046536 | Bacteria | 911 |
| 1338 | Ga0495587_0373681 | 3300046536 | Bacteria | 793 |
| 1339 | Ga0495645_0022167 | 3300046543 | Bacteria | 4593 |
| 1340 | Ga0495645_0035649 | 3300046543 | Bacteria | 3626 |
| 1341 | Ga0495645_0071844 | 3300046543 | Unclassified | 2494 |
| 1342 | Ga0495645_0096994 | 3300046543 | Bacteria | 2100 |
| 1343 | Ga0495645_0170135 | 3300046543 | Bacteria | 1500 |
| 1344 | Ga0495645_0171349 | 3300046543 | Bacteria | 1494 |
| 1345 | Ga0495645_0210936 | 3300046543 | Bacteria | 1311 |
| 1346 | Ga0495645_0239024 | 3300046543 | Unclassified | 1213 |
| 1347 | Ga0495667_0024521 | 3300046559 | Bacteria | 4062 |
| 1348 | Ga0495667_0052413 | 3300046559 | Bacteria | 2688 |
| 1349 | Ga0495667_0069290 | 3300046559 | Bacteria | 2302 |
| 1350 | Ga0495667_0080351 | 3300046559 | Bacteria | 2120 |
| 1351 | Ga0495667_0249252 | 3300046559 | Bacteria | 1130 |
| 1352 | Ga0495668_0097647 | 3300046616 | Bacteria | 1608 |
| 1353 | Ga0495634_0029185 | 3300046642 | Bacteria | 3820 |
| 1354 | Ga0495634_0093797 | 3300046642 | Bacteria | 1946 |
| 1355 | Ga0495635_0033329 | 3300046663 | Bacteria | 3573 |
| 1356 | Ga0495635_0073100 | 3300046663 | Bacteria | 2349 |
| 1357 | Ga0495635_0128451 | 3300046663 | Bacteria | 1728 |
| 1358 | Ga0495635_0380479 | 3300046663 | Bacteria | 939 |
| 1359 | Ga0495635_0429997 | 3300046663 | Archaea | 874 |
| 1360 | Ga0495635_0539678 | 3300046663 | Bacteria | 765 |
| 1361 | Ga0495635_0540406 | 3300046663 | Bacteria | 765 |
| 1362 | Ga0495588_0051739 | 3300046674 | Bacteria | 2116 |
| 1363 | Ga0495657_0338759 | 3300046675 | Bacteria | 892 |
| 1364 | Ga0495657_0361939 | 3300046675 | Unclassified | 857 |
| 1365 | Ga0495657_0417701 | 3300046675 | Bacteria | 788 |
| 1366 | Ga0495657_0733268 | 3300046675 | Unclassified | 567 |
| 1367 | Ga0495599_0223933 | 3300046678 | Archaea | 1150 |
| 1368 | Ga0495599_0358715 | 3300046678 | Bacteria | 873 |
| 1369 | Ga0495599_0367222 | 3300046678 | Bacteria | 861 |
| 1370 | Ga0495623_0030436 | 3300046679 | Bacteria | 3472 |
| 1371 | Ga0495623_0049156 | 3300046679 | Bacteria | 2673 |
| 1372 | Ga0495623_0053782 | 3300046679 | Bacteria | 2542 |
| 1373 | Ga0495623_0053948 | 3300046679 | Bacteria | 2537 |
| 1374 | Ga0495623_0092747 | 3300046679 | Bacteria | 1850 |
| 1375 | Ga0495623_0157856 | 3300046679 | Unclassified | 1335 |
| 1376 | Ga0495646_0216913 | 3300046680 | Bacteria | 1036 |
| 1377 | Ga0495646_0472851 | 3300046680 | Bacteria | 646 |
| 1378 | Ga0495658_0148169 | 3300046683 | Bacteria | 1440 |
| 1379 | Ga0495658_0293942 | 3300046683 | Bacteria | 1027 |
| 1380 | Ga0495669_0093846 | 3300046684 | Bacteria | 1388 |
| 1381 | Ga0495669_0096014 | 3300046684 | Bacteria | 1373 |
| 1382 | Ga0495669_0235678 | 3300046684 | Bacteria | 878 |
| 1383 | Ga0495613_0129225 | 3300046689 | Bacteria | 1810 |
| 1384 | Ga0495613_0219233 | 3300046689 | Bacteria | 1336 |
| 1385 | Ga0495613_0252098 | 3300046689 | Bacteria | 1231 |
| 1386 | Ga0495624_0079166 | 3300046690 | Bacteria | 2038 |
| 1387 | Ga0495624_0207276 | 3300046690 | Bacteria | 1190 |
| 1388 | Ga0495624_0482240 | 3300046690 | Bacteria | 742 |
| 1389 | Ga0495600_0105863 | 3300046809 | Unclassified | 1833 |
| 1390 | Ga0495600_0209420 | 3300046809 | Bacteria | 1250 |
| 1391 | Ga0495581_0346156 | 3300047315 | Unclassified | 868 |
| 1392 | Ga0495581_0448424 | 3300047315 | Unclassified | 751 |
| 1393 | Ga0495604_0028727 | 3300047317 | Bacteria | 4425 |
| 1394 | Ga0495604_0223775 | 3300047317 | Unclassified | 1294 |
| 1395 | Ga0495604_0315374 | 3300047317 | Bacteria | 1046 |
| 1396 | Ga0495604_0328327 | 3300047317 | Bacteria | 1021 |
| 1397 | Ga0495604_0378280 | 3300047317 | Bacteria | 936 |
| 1398 | Ga0495604_0463835 | 3300047317 | Bacteria | 826 |
| 1399 | Ga0495674_0018563 | 3300047319 | Bacteria | 6474 |
| 1400 | Ga0495674_0049400 | 3300047319 | Bacteria | 3718 |
| 1401 | Ga0495674_0053968 | 3300047319 | Bacteria | 3531 |
| 1402 | Ga0495674_0076241 | 3300047319 | Bacteria | 2884 |
| 1403 | Ga0495674_0214478 | 3300047319 | Bacteria | 1593 |
| 1404 | Ga0495674_0299726 | 3300047319 | Bacteria | 1313 |
| 1405 | Ga0495674_0334738 | 3300047319 | Bacteria | 1231 |
| 1406 | Ga0495674_0578558 | 3300047319 | Bacteria | 891 |
| 1407 | Ga0495676_0152757 | 3300047321 | Bacteria | 1641 |
| 1408 | Ga0495675_0015725 | 3300047444 | Bacteria | 4785 |
| 1409 | Ga0495675_0034121 | 3300047444 | Unclassified | 3247 |
| 1410 | Ga0495675_0116060 | 3300047444 | Bacteria | 1669 |
| 1411 | Ga0495675_0128649 | 3300047444 | Bacteria | 1575 |
| 1412 | Ga0495675_0204648 | 3300047444 | Bacteria | 1200 |
| 1413 | Ga0495675_0208231 | 3300047444 | Bacteria | 1188 |
| 1414 | Ga0495675_0383412 | 3300047444 | Bacteria | 822 |
| 1415 | Ga0495675_0414371 | 3300047444 | Bacteria | 784 |
| 1416 | Ga0495675_0760431 | 3300047444 | Bacteria | 539 |
| 1417 | Ga0495677_0034216 | 3300047445 | Bacteria | 1853 |
| 1418 | Ga0495684_0016103 | 3300047471 | Bacteria | 5755 |
| 1419 | Ga0495684_0054549 | 3300047471 | Unclassified | 3049 |
| 1420 | Ga0495684_0083283 | 3300047471 | Bacteria | 2426 |
| 1421 | Ga0495684_0112561 | 3300047471 | Bacteria | 2052 |
| 1422 | Ga0495684_0220029 | 3300047471 | Bacteria | 1392 |
| 1423 | Ga0495684_0460381 | 3300047471 | Bacteria | 882 |
| 1424 | Ga0495593_0018737 | 3300047673 | Bacteria | 3887 |
| 1425 | Ga0495593_0050171 | 3300047673 | Bacteria | 2212 |
| 1426 | Ga0495602_0087286 | 3300048088 | Bacteria | 2601 |
| 1427 | Ga0495602_0104306 | 3300048088 | Bacteria | 2320 |
| 1428 | Ga0495602_0185006 | 3300048088 | Bacteria | 1603 |
| 1429 | Ga0495602_0233374 | 3300048088 | Bacteria | 1381 |
| 1430 | Ga0495602_0310671 | 3300048088 | Bacteria | 1150 |
| 1431 | Ga0495602_0496241 | 3300048088 | Bacteria | 854 |
| 1432 | Ga0495602_0630559 | 3300048088 | Bacteria | 734 |
| 1433 | Ga0495614_0111573 | 3300048089 | Bacteria | 1201 |
| 1434 | Ga0495614_0339422 | 3300048089 | Bacteria | 699 |
| 1435 | Ga0496100_0090533 | 3300048903 | Bacteria | 2086 |
| 1436 | Ga0496100_0121910 | 3300048903 | Bacteria | 1825 |
| 1437 | Ga0496100_0172721 | 3300048903 | Unclassified | 1558 |
| 1438 | Ga0496100_0208629 | 3300048903 | Unclassified | 1428 |
| 1439 | Ga0496100_0335090 | 3300048903 | Unclassified | 1140 |
| 1440 | Ga0496100_0495284 | 3300048903 | Unclassified | 941 |
| 1441 | Ga0496101_0032991 | 3300048904 | Bacteria | 3649 |
| 1442 | Ga0496101_0120052 | 3300048904 | Unclassified | 1987 |
| 1443 | Ga0496101_0275424 | 3300048904 | Bacteria | 1314 |
| 1444 | Ga0496101_0390554 | 3300048904 | Unclassified | 1095 |
| 1445 | Ga0496101_0650150 | 3300048904 | Unclassified | 833 |
| 1446 | Ga0496102_0020175 | 3300048905 | Bacteria | 5885 |
| 1447 | Ga0496102_0089212 | 3300048905 | Bacteria | 2852 |
| 1448 | Ga0496102_0152540 | 3300048905 | Bacteria | 2172 |
| 1449 | Ga0496102_0203032 | 3300048905 | Unclassified | 1868 |
| 1450 | Ga0496102_0335279 | 3300048905 | Unclassified | 1424 |
| 1451 | Ga0496102_0503319 | 3300048905 | Bacteria | 1134 |
| 1452 | Ga0496102_0611992 | 3300048905 | Bacteria | 1012 |
| 1453 | Ga0496103_0022488 | 3300048906 | Bacteria | 3797 |
| 1454 | Ga0496103_0032022 | 3300048906 | Unclassified | 3207 |
| 1455 | Ga0496103_0061583 | 3300048906 | Bacteria | 2334 |
| 1456 | Ga0496103_0616247 | 3300048906 | Bacteria | 691 |
| 1457 | Ga0496104_0003663 | 3300048907 | Bacteria | 13265 |
| 1458 | Ga0496104_0017687 | 3300048907 | Bacteria | 6498 |
| 1459 | Ga0496104_0093755 | 3300048907 | Bacteria | 2872 |
| 1460 | Ga0496104_0209709 | 3300048907 | Unclassified | 1860 |
| 1461 | Ga0496104_0325362 | 3300048907 | Bacteria | 1450 |
| 1462 | Ga0496104_0338449 | 3300048907 | Unclassified | 1418 |
| 1463 | Ga0496104_0777467 | 3300048907 | Bacteria | 864 |
| 1464 | Ga0496105_0008105 | 3300048908 | Bacteria | 8169 |
| 1465 | Ga0496105_0040114 | 3300048908 | Bacteria | 3860 |
| 1466 | Ga0496105_0603685 | 3300048908 | Unclassified | 851 |
| 1467 | Ga0496105_0666460 | 3300048908 | Bacteria | 801 |
| 1468 | Ga0496106_0034342 | 3300048909 | Unclassified | 3787 |
| 1469 | Ga0496106_0063470 | 3300048909 | Bacteria | 2807 |
| 1470 | Ga0496106_0641193 | 3300048909 | Bacteria | 849 |
| 1471 | Ga0496107_0223273 | 3300048910 | Unclassified | 1402 |
| 1472 | Ga0496108_0000106 | 3300048911 | Bacteria | 87028 |
| 1473 | Ga0496108_0216047 | 3300048911 | Bacteria | 1665 |
| 1474 | Ga0496109_0000133 | 3300048912 | Bacteria | 76299 |
| 1475 | Ga0496109_0167149 | 3300048912 | Bacteria | 2063 |
| 1476 | Ga0496109_0332953 | 3300048912 | Unclassified | 1433 |
| 1477 | Ga0496109_0370111 | 3300048912 | Unclassified | 1354 |
| 1478 | Ga0496109_1041215 | 3300048912 | Bacteria | 756 |
| 1479 | Ga0496110_0002218 | 3300048913 | Bacteria | 14511 |
| 1480 | Ga0496110_0186389 | 3300048913 | Bacteria | 1884 |
| 1481 | Ga0496110_0890889 | 3300048913 | Unclassified | 796 |
| 1482 | Ga0496111_0004591 | 3300048914 | Bacteria | 8744 |
| 1483 | Ga0496112_0000028 | 3300048915 | Bacteria | 130942 |
| 1484 | Ga0496112_0014386 | 3300048915 | Bacteria | 7336 |
| 1485 | Ga0496112_0030600 | 3300048915 | Bacteria | 5211 |
| 1486 | Ga0496112_0043741 | 3300048915 | Bacteria | 4386 |
| 1487 | Ga0496112_0055340 | 3300048915 | Bacteria | 3901 |
| 1488 | Ga0496112_0099017 | 3300048915 | Unclassified | 2885 |
| 1489 | Ga0496112_0162289 | 3300048915 | Bacteria | 2201 |
| 1490 | Ga0496112_0217038 | 3300048915 | Bacteria | 1869 |
| 1491 | Ga0496112_0331081 | 3300048915 | Bacteria | 1467 |
| 1492 | Ga0496112_0368375 | 3300048915 | Bacteria | 1378 |
| 1493 | Ga0496112_1137669 | 3300048915 | Bacteria | 698 |
| 1494 | Ga0496112_1320429 | 3300048915 | Bacteria | 637 |
| 1495 | Ga0496113_0000179 | 3300048916 | Bacteria | 28343 |
| 1496 | Ga0496113_0013416 | 3300048916 | Bacteria | 5551 |
| 1497 | Ga0496113_0091882 | 3300048916 | Unclassified | 2340 |
| 1498 | Ga0496113_0326988 | 3300048916 | Unclassified | 1229 |
| 1499 | Ga0496114_0062374 | 3300048917 | Unclassified | 3120 |
| 1500 | Ga0496115_0030865 | 3300048918 | Bacteria | 4219 |
| 1501 | Ga0496115_1078642 | 3300048918 | Bacteria | 610 |
| 1502 | Ga0501292_039726 | 3300049515 | Unclassified | 810 |
| 1503 | Ga0501299_013919 | 3300049522 | Bacteria | 1393 |
| 1504 | Ga0501073_0087107 | 3300049589 | Bacteria | 2172 |
| 1505 | Ga0501216_060176 | 3300049660 | Unclassified | 764 |
| 1506 | Ga0501217_115749 | 3300049661 | Unclassified | 774 |
| 1507 | Ga0501261_021495 | 3300049690 | Unclassified | 928 |
| 1508 | Ga0501221_038951 | 3300049704 | Bacteria | 1029 |
| 1509 | Ga0501225_0030165 | 3300049705 | Unclassified | 1491 |
| 1510 | Ga0501083_0114773 | 3300049744 | Bacteria | 1769 |
| 1511 | Ga0501268_083469 | 3300049765 | Unclassified | 663 |
| 1512 | nmdc:mga05p37_668048_c1 | 3300050507 | Unclassified | 1160 |
| 1513 | nmdc:mga05p37_887748_c1 | 3300050507 | Bacteria | 963 |
| 1514 | nmdc:mga08y16_962509_c1 | 3300050511 | Bacteria | 836 |
| 1515 | nmdc:mga0n895_1051089_c1 | 3300050512 | Bacteria | 793 |
| 1516 | nmdc:mga0n895_123435_c1 | 3300050512 | Unclassified | 2612 |
| 1517 | nmdc:mga0n895_1547_c1 | 3300050512 | Bacteria | 17269 |
| 1518 | nmdc:mga0n895_4579_c1 | 3300050512 | Bacteria | 11389 |
| 1519 | nmdc:mga0rr50_16895_c1 | 3300050513 | Unclassified | 4859 |
| 1520 | nmdc:mga0rr50_433943_c1 | 3300050513 | Bacteria | 1112 |
| 1521 | nmdc:mga08x19_14306_c1 | 3300050514 | Bacteria | 4813 |
| 1522 | nmdc:mga08x19_178361_c1 | 3300050514 | Bacteria | 1449 |
| 1523 | nmdc:mga08x19_191779_c1 | 3300050514 | Bacteria | 1398 |
| 1524 | nmdc:mga08x19_2368_c1 | 3300050514 | Bacteria | 11425 |
| 1525 | nmdc:mga08x19_27172_c1 | 3300050514 | Bacteria | 3578 |
| 1526 | nmdc:mga08x19_6108_c1 | 3300050514 | Bacteria | 7121 |
| 1527 | nmdc:mga08x19_761213_c1 | 3300050514 | Bacteria | 688 |
| 1528 | nmdc:mga08x19_7696_c1 | 3300050514 | Bacteria | 6397 |
| 1529 | nmdc:mga0a205_806225_c1 | 3300050515 | Unclassified | 787 |
| 1530 | nmdc:mga0a205_947_c1 | 3300050515 | Bacteria | 23925 |
| 1531 | Ga0495601_0217699 | 3300053077 | Bacteria | 1247 |
| 1532 | Ga0495619_0064914 | 3300053085 | Unclassified | 2435 |
| 1533 | Ga0495619_0596418 | 3300053085 | Bacteria | 756 |
| 1534 | Ga0495619_0597208 | 3300053085 | Bacteria | 755 |
| 1535 | Ga0495619_0615705 | 3300053085 | Archaea | 742 |
| 1536 | Ga0495619_0899215 | 3300053085 | Bacteria | 596 |
| 1537 | Ga0500590_059292 | 3300053148 | Bacteria | 1926 |
| 1538 | Ga0501084_0080902 | 3300054114 | Bacteria | 2724 |
| 1539 | Ga0501082_0002389 | 3300060353 | Bacteria | 16456 |
| 1540 | Ga0501082_0129551 | 3300060353 | Bacteria | 2189 |
| 1541 | Ga0224572_1037013 | |||
| 1542 | MBSR1b_contig_11819402 | |||
| 1543 | LJNas_1001454 | |||
| 1544 | JGI24034J26672_10005869 | |||
| 1545 | JGI24751J29686_10014259 | |||
| 1546 | Ga0065712_10152185 | |||
| 1547 | Ga0065712_10173172 | |||
| 1548 | Ga0065715_10037980 | |||
| 1549 | Ga0065715_10103000 | |||
| 1550 | Ga0065715_10178575 | |||
| 1551 | Ga0070658_10005929 | |||
| 1552 | Ga0070658_10418706 | |||
| 1553 | Ga0070658_10701949 | |||
| 1554 | Ga0070676_10016811 | |||
| 1555 | Ga0070676_10151440 | |||
| 1556 | Ga0070683_100000035 | |||
| 1557 | Ga0070683_100012627 | |||
| 1558 | Ga0070683_100026713 | |||
| 1559 | Ga0070683_100290670 | |||
| 1560 | Ga0070683_100546070 | |||
| 1561 | Ga0070683_100554868 | |||
| 1562 | Ga0070690_100224183 | |||
| 1563 | Ga0070690_100585602 | |||
| 1564 | Ga0070670_100005429 | |||
| 1565 | Ga0070670_100016074 | |||
| 1566 | Ga0070670_100035001 | |||
| 1567 | Ga0068869_100009378 | |||
| 1568 | Ga0068869_100012141 | |||
| 1569 | Ga0068869_100013081 | |||
| 1570 | Ga0068869_101315843 | |||
| 1571 | Ga0070666_10008702 | |||
| 1572 | Ga0070666_10104046 | |||
| 1573 | Ga0070680_100135893 | |||
| 1574 | Ga0070680_100443266 | |||
| 1575 | Ga0070682_100011890 | |||
| 1576 | Ga0070682_100025124 | |||
| 1577 | Ga0070682_100383356 | |||
| 1578 | Ga0068868_100002728 | |||
| 1579 | Ga0068868_100002835 | |||
| 1580 | Ga0068868_100022051 | |||
| 1581 | Ga0068868_100036034 | |||
| 1582 | Ga0068868_100125206 | |||
| 1583 | Ga0068868_100155671 | |||
| 1584 | Ga0068868_101028202 | |||
| 1585 | Ga0070660_100009702 | |||
| 1586 | Ga0070660_100614258 | |||
| 1587 | Ga0070689_100068871 | |||
| 1588 | Ga0070689_100069133 | |||
| 1589 | Ga0070689_100185672 | |||
| 1590 | Ga0070691_10054356 | |||
| 1591 | Ga0070661_100007203 | |||
| 1592 | Ga0070661_100025417 | |||
| 1593 | Ga0070692_10077057 | |||
| 1594 | Ga0070692_10099137 | |||
| 1595 | Ga0070668_100002226 | |||
| 1596 | Ga0070668_100007587 | |||
| 1597 | Ga0070668_100465366 | |||
| 1598 | Ga0070669_100005043 | |||
| 1599 | Ga0070669_100049122 | |||
| 1600 | Ga0070675_100047761 | |||
| 1601 | Ga0070675_100155371 | |||
| 1602 | Ga0070675_100732877 | |||
| 1603 | Ga0070675_100737801 | |||
| 1604 | Ga0070675_100953992 | |||
| 1605 | Ga0070675_100962791 | |||
| 1606 | Ga0070675_101060470 | |||
| 1607 | Ga0070671_100976174 | |||
| 1608 | Ga0070671_101066372 | |||
| 1609 | Ga0070674_100221991 | |||
| 1610 | Ga0070674_100462311 | |||
| 1611 | Ga0070674_101026534 | |||
| 1612 | Ga0070673_100062580 | |||
| 1613 | Ga0070673_100665248 | |||
| 1614 | Ga0070673_101074723 | |||
| 1615 | Ga0070688_100013826 | |||
| 1616 | Ga0070688_100357010 | |||
| 1617 | Ga0070659_100001203 | |||
| 1618 | Ga0070659_100080397 | |||
| 1619 | Ga0070667_100116848 | |||
| 1620 | Ga0070709_10018837 | |||
| 1621 | Ga0070709_10020338 | |||
| 1622 | Ga0070709_10031911 | |||
| 1623 | Ga0070709_10040735 | |||
| 1624 | Ga0070709_10065352 | |||
| 1625 | Ga0070709_10087970 | |||
| 1626 | Ga0070709_10119214 | |||
| 1627 | Ga0070709_10162923 | |||
| 1628 | Ga0070709_10176908 | |||
| 1629 | Ga0070709_10206445 | |||
| 1630 | Ga0070709_10276903 | |||
| 1631 | Ga0070709_10472435 | |||
| 1632 | Ga0070709_10751656 | |||
| 1633 | Ga0070714_100000169 | |||
| 1634 | Ga0070714_100008519 | |||
| 1635 | Ga0070714_100020608 | |||
| 1636 | Ga0070714_100059174 | |||
| 1637 | Ga0070714_100072893 | |||
| 1638 | Ga0070714_100149551 | |||
| 1639 | Ga0070714_100174919 | |||
| 1640 | Ga0070714_100180387 | |||
| 1641 | Ga0070714_100214185 | |||
| 1642 | Ga0070714_100285751 | |||
| 1643 | Ga0070714_100299439 | |||
| 1644 | Ga0070714_100335812 | |||
| 1645 | Ga0070714_100350431 | |||
| 1646 | Ga0070714_100633047 | |||
| 1647 | Ga0070714_100832475 | |||
| 1648 | Ga0070713_100000649 | |||
| 1649 | Ga0070713_100002519 | |||
| 1650 | Ga0070713_100005251 | |||
| 1651 | Ga0070713_100012465 | |||
| 1652 | Ga0070713_100020997 | |||
| 1653 | Ga0070713_100061733 | |||
| 1654 | Ga0070713_100068860 | |||
| 1655 | Ga0070713_100084009 | |||
| 1656 | Ga0070713_100086586 | |||
| 1657 | Ga0070713_100101904 | |||
| 1658 | Ga0070713_100136863 | |||
| 1659 | Ga0070713_100228716 | |||
| 1660 | Ga0070713_100272077 | |||
| 1661 | Ga0070713_100308576 | |||
| 1662 | Ga0070713_100425658 | |||
| 1663 | Ga0070713_100551494 | |||
| 1664 | Ga0070713_100559448 | |||
| 1665 | Ga0070713_100652762 | |||
| 1666 | Ga0070713_101459694 | |||
| 1667 | Ga0070713_101687081 | |||
| 1668 | Ga0070713_101754075 | |||
| 1669 | Ga0070710_10027644 | |||
| 1670 | Ga0070710_10035124 | |||
| 1671 | Ga0070710_10069378 | |||
| 1672 | Ga0070710_10073573 | |||
| 1673 | Ga0070710_10082954 | |||
| 1674 | Ga0070710_10416500 | |||
| 1675 | Ga0070711_100000293 | |||
| 1676 | Ga0070711_100001830 | |||
| 1677 | Ga0070711_100007650 | |||
| 1678 | Ga0070711_100054373 | |||
| 1679 | Ga0070711_100060645 | |||
| 1680 | Ga0070711_100065489 | |||
| 1681 | Ga0070711_100104622 | |||
| 1682 | Ga0070711_100283720 | |||
| 1683 | Ga0070711_100933380 | |||
| 1684 | Ga0070711_101500636 | |||
| 1685 | Ga0070705_100038418 | |||
| 1686 | Ga0070705_100107033 | |||
| 1687 | Ga0070705_100194634 | |||
| 1688 | Ga0070700_100366056 | |||
| 1689 | Ga0070694_100530115 | |||
| 1690 | Ga0070708_100000242 | |||
| 1691 | Ga0070708_100001715 | |||
| 1692 | Ga0070708_100003584 | |||
| 1693 | Ga0070708_100006436 | |||
| 1694 | Ga0070708_100020572 | |||
| 1695 | Ga0070708_100086330 | |||
| 1696 | Ga0070663_100043712 | |||
| 1697 | Ga0070678_100071377 | |||
| 1698 | Ga0070678_100188708 | |||
| 1699 | Ga0070662_100004575 | |||
| 1700 | Ga0070662_100011008 | |||
| 1701 | Ga0070662_100268491 | |||
| 1702 | Ga0070662_100646416 | |||
| 1703 | Ga0070681_10008506 | |||
| 1704 | Ga0070681_10012341 | |||
| 1705 | Ga0070681_10073861 | |||
| 1706 | Ga0070681_10074017 | |||
| 1707 | Ga0070681_10082353 | |||
| 1708 | Ga0070681_10155758 | |||
| 1709 | Ga0070681_10518012 | |||
| 1710 | Ga0070681_10654872 | |||
| 1711 | Ga0068867_100001484 | |||
| 1712 | Ga0068867_100013571 | |||
| 1713 | Ga0068867_100024102 | |||
| 1714 | Ga0070685_10031930 | |||
| 1715 | Ga0070706_100001331 | |||
| 1716 | Ga0070706_100001385 | |||
| 1717 | Ga0070706_100002503 | |||
| 1718 | Ga0070706_100013794 | |||
| 1719 | Ga0070706_100044511 | |||
| 1720 | Ga0070706_100233521 | |||
| 1721 | Ga0070706_100280770 | |||
| 1722 | Ga0070707_100002130 | |||
| 1723 | Ga0070707_100002318 | |||
| 1724 | Ga0070707_100012306 | |||
| 1725 | Ga0070707_100137336 | |||
| 1726 | Ga0070707_100384795 | |||
| 1727 | Ga0070707_100400753 | |||
| 1728 | Ga0070698_100000589 | |||
| 1729 | Ga0070698_100000689 | |||
| 1730 | Ga0070698_100040140 | |||
| 1731 | Ga0070699_100000679 | |||
| 1732 | Ga0070699_100000716 | |||
| 1733 | Ga0070699_100025935 | |||
| 1734 | Ga0070699_100027280 | |||
| 1735 | Ga0070699_100639241 | |||
| 1736 | Ga0070679_100074471 | |||
| 1737 | Ga0070679_100159877 | |||
| 1738 | Ga0070679_100398877 | |||
| 1739 | Ga0070679_100736401 | |||
| 1740 | Ga0070679_101177436 | |||
| 1741 | Ga0070684_100000037 | |||
| 1742 | Ga0070684_100083944 | |||
| 1743 | Ga0070684_100086086 | |||
| 1744 | Ga0070684_100128722 | |||
| 1745 | Ga0070684_100401329 | |||
| 1746 | Ga0070697_100000053 | |||
| 1747 | Ga0070697_100000280 | |||
| 1748 | Ga0070697_100000694 | |||
| 1749 | Ga0070697_100001256 | |||
| 1750 | Ga0070697_100013559 | |||
| 1751 | Ga0070697_100018478 | |||
| 1752 | Ga0070697_100111046 | |||
| 1753 | Ga0070697_100414907 | |||
| 1754 | Ga0070697_100430598 | |||
| 1755 | Ga0070697_101383730 | |||
| 1756 | Ga0068853_100004040 | |||
| 1757 | Ga0070672_100003042 | |||
| 1758 | Ga0070672_100366589 | |||
| 1759 | Ga0070672_100462223 | |||
| 1760 | Ga0070686_100008692 | |||
| 1761 | Ga0070695_100032361 | |||
| 1762 | Ga0070695_100088098 | |||
| 1763 | Ga0070695_100192023 | |||
| 1764 | Ga0070696_100142696 | |||
| 1765 | Ga0070696_100164097 | |||
| 1766 | Ga0070696_100196285 | |||
| 1767 | Ga0070696_100441270 | |||
| 1768 | Ga0070693_100004450 | |||
| 1769 | Ga0070693_100034556 | |||
| 1770 | Ga0070693_100261979 | |||
| 1771 | Ga0070693_100702313 | |||
| 1772 | Ga0070693_101079393 | |||
| 1773 | Ga0070665_100023323 | |||
| 1774 | Ga0070704_100120474 | |||
| 1775 | Ga0068855_100010022 | |||
| 1776 | Ga0068855_100011722 | |||
| 1777 | Ga0068855_100012992 | |||
| 1778 | Ga0068855_100074528 | |||
| 1779 | Ga0068855_100080699 | |||
| 1780 | Ga0068855_100151046 | |||
| 1781 | Ga0068855_100248520 | |||
| 1782 | Ga0068855_100347599 | |||
| 1783 | Ga0068855_100449358 | |||
| 1784 | Ga0068855_100487674 | |||
| 1785 | Ga0068855_100972414 | |||
| 1786 | Ga0070664_100000972 | |||
| 1787 | Ga0070664_100008272 | |||
| 1788 | Ga0070664_100019355 | |||
| 1789 | Ga0068857_100000259 | |||
| 1790 | Ga0068857_100000335 | |||
| 1791 | Ga0068857_100199313 | |||
| 1792 | Ga0068857_100314612 | |||
| 1793 | Ga0068857_100475411 | |||
| 1794 | Ga0068857_100580462 | |||
| 1795 | Ga0068857_100995258 | |||
| 1796 | Ga0068854_100011053 | |||
| 1797 | Ga0068854_100023615 | |||
| 1798 | Ga0068854_100028231 | |||
| 1799 | Ga0068854_100033635 | |||
| 1800 | Ga0068854_100096525 | |||
| 1801 | Ga0068856_100000995 | |||
| 1802 | Ga0068856_100002426 | |||
| 1803 | Ga0068856_100003097 | |||
| 1804 | Ga0068856_100005963 | |||
| 1805 | Ga0068856_100006696 | |||
| 1806 | Ga0068856_100023013 | |||
| 1807 | Ga0068856_100035413 | |||
| 1808 | Ga0068856_100387787 | |||
| 1809 | Ga0068856_100551276 | |||
| 1810 | Ga0068856_100634798 | |||
| 1811 | Ga0068856_100646876 | |||
| 1812 | Ga0068856_100907641 | |||
| 1813 | Ga0068856_102109757 | |||
| 1814 | Ga0070702_100000387 | |||
| 1815 | Ga0070702_100070013 | |||
| 1816 | Ga0070702_100267006 | |||
| 1817 | Ga0068852_100009501 | |||
| 1818 | Ga0068852_100050228 | |||
| 1819 | Ga0068852_100145329 | |||
| 1820 | Ga0068852_100206105 | |||
| 1821 | Ga0068852_101254597 | |||
| 1822 | Ga0068859_100014831 | |||
| 1823 | Ga0068859_100015248 | |||
| 1824 | Ga0068859_100094432 | |||
| 1825 | Ga0068859_100253500 | |||
| 1826 | Ga0068859_100298463 | |||
| 1827 | Ga0068859_100344748 | |||
| 1828 | Ga0068859_101027082 | |||
| 1829 | Ga0068864_100003998 | |||
| 1830 | Ga0068864_100034805 | |||
| 1831 | Ga0068866_10000735 | |||
| 1832 | Ga0068866_10003232 | |||
| 1833 | Ga0068866_10008403 | |||
| 1834 | Ga0068866_10036584 | |||
| 1835 | Ga0068866_10044217 | |||
| 1836 | Ga0068866_10367819 | |||
| 1837 | Ga0068861_100013572 | |||
| 1838 | Ga0068861_100086221 | |||
| 1839 | Ga0068861_100242727 | |||
| 1840 | Ga0068851_10004069 | |||
| 1841 | Ga0068851_10006547 | |||
| 1842 | Ga0068851_10010242 | |||
| 1843 | Ga0068851_10099054 | |||
| 1844 | Ga0068870_10026876 | |||
| 1845 | Ga0068870_10319471 | |||
| 1846 | Ga0068863_100031255 | |||
| 1847 | Ga0068863_100058799 | |||
| 1848 | Ga0068863_100085787 | |||
| 1849 | Ga0068863_100301358 | |||
| 1850 | Ga0068863_100338804 | |||
| 1851 | Ga0068863_101176067 | |||
| 1852 | Ga0068858_100000404 | |||
| 1853 | Ga0068858_100004032 | |||
| 1854 | Ga0068858_100274148 | |||
| 1855 | Ga0068858_100473751 | |||
| 1856 | Ga0068860_100012091 | |||
| 1857 | Ga0068860_100038625 | |||
| 1858 | Ga0068860_100405138 | |||
| 1859 | Ga0068862_100151271 | |||
| 1860 | Ga0081540_1093264 | |||
| 1861 | Ga0070717_10001683 | |||
| 1862 | Ga0070717_10004512 | |||
| 1863 | Ga0070717_10005108 | |||
| 1864 | Ga0070717_10005704 | |||
| 1865 | Ga0070717_10011319 | |||
| 1866 | Ga0070717_10032487 | |||
| 1867 | Ga0070717_10051470 | |||
| 1868 | Ga0070717_10064277 | |||
| 1869 | Ga0070717_10111341 | |||
| 1870 | Ga0070717_10148095 | |||
| 1871 | Ga0070717_10207105 | |||
| 1872 | Ga0070717_10221443 | |||
| 1873 | Ga0070717_10237926 | |||
| 1874 | Ga0070717_10255225 | |||
| 1875 | Ga0070717_10262381 | |||
| 1876 | Ga0070717_10315890 | |||
| 1877 | Ga0070717_10342052 | |||
| 1878 | Ga0070717_10423608 | |||
| 1879 | Ga0070717_10752709 | |||
| 1880 | Ga0070717_11288950 | |||
| 1881 | Ga0070717_11341997 | |||
| 1882 | Ga0070715_10002128 | |||
| 1883 | Ga0070715_10013154 | |||
| 1884 | Ga0070715_10094090 | |||
| 1885 | Ga0070715_10099475 | |||
| 1886 | Ga0070715_10112816 | |||
| 1887 | Ga0070715_10178923 | |||
| 1888 | Ga0070715_10320858 | |||
| 1889 | Ga0070715_10480664 | |||
| 1890 | Ga0070715_10802027 | |||
| 1891 | Ga0070716_100013165 | |||
| 1892 | Ga0070716_100015752 | |||
| 1893 | Ga0070716_100026282 | |||
| 1894 | Ga0070716_100034551 | |||
| 1895 | Ga0070716_100039117 | |||
| 1896 | Ga0070716_100155544 | |||
| 1897 | Ga0070716_100181495 | |||
| 1898 | Ga0070716_100215542 | |||
| 1899 | Ga0070716_100228980 | |||
| 1900 | Ga0070716_100252626 | |||
| 1901 | Ga0070716_100272120 | |||
| 1902 | Ga0070716_100319623 | |||
| 1903 | Ga0070716_100913697 | |||
| 1904 | Ga0070712_100000188 | |||
| 1905 | Ga0070712_100000723 | |||
| 1906 | Ga0070712_100026038 | |||
| 1907 | Ga0070712_100026743 | |||
| 1908 | Ga0070712_100027377 | |||
| 1909 | Ga0070712_100027607 | |||
| 1910 | Ga0070712_100040986 | |||
| 1911 | Ga0070712_100072539 | |||
| 1912 | Ga0070712_100103103 | |||
| 1913 | Ga0070712_100260476 | |||
| 1914 | Ga0070712_100288502 | |||
| 1915 | Ga0070712_100496834 | |||
| 1916 | Ga0070712_100624568 | |||
| 1917 | Ga0070712_101013852 | |||
| 1918 | Ga0097621_100013631 | |||
| 1919 | Ga0097621_100024654 | |||
| 1920 | Ga0097621_100039766 | |||
| 1921 | Ga0097621_100076590 | |||
| 1922 | Ga0097621_100121598 | |||
| 1923 | Ga0097621_100139551 | |||
| 1924 | Ga0097621_100158187 | |||
| 1925 | Ga0097621_100459508 | |||
| 1926 | Ga0097621_100565154 | |||
| 1927 | Ga0097621_100567341 | |||
| 1928 | Ga0097621_101100404 | |||
| 1929 | Ga0068871_100000389 | |||
| 1930 | Ga0068871_100007884 | |||
| 1931 | Ga0068871_100034094 | |||
| 1932 | Ga0068871_100043390 | |||
| 1933 | Ga0068871_100049645 | |||
| 1934 | Ga0068871_100049912 | |||
| 1935 | Ga0068871_100091844 | |||
| 1936 | Ga0068871_100314305 | |||
| 1937 | Ga0068871_100541172 | |||
| 1938 | Ga0075431_100508146 | |||
| 1939 | Ga0075433_10000636 | |||
| 1940 | Ga0075433_10777035 | |||
| 1941 | Ga0075434_100001288 | |||
| 1942 | Ga0075434_100001829 | |||
| 1943 | Ga0075434_100035785 | |||
| 1944 | Ga0068865_100044263 | |||
| 1945 | Ga0068865_100235879 | |||
| 1946 | Ga0068865_100441121 | |||
| 1947 | Ga0075436_100003222 | |||
| 1948 | Ga0075436_100006615 | |||
| 1949 | Ga0075436_100007751 | |||
| 1950 | Ga0075436_100013183 | |||
| 1951 | Ga0075436_100046263 | |||
| 1952 | Ga0075436_100088486 | |||
| 1953 | Ga0075436_100139706 | |||
| 1954 | Ga0075436_100362595 | |||
| 1955 | Ga0075436_100448902 | |||
| 1956 | Ga0075436_100526995 | |||
| 1957 | Ga0097620_100014831 | |||
| 1958 | Ga0097620_100015253 | |||
| 1959 | Ga0097620_100094426 | |||
| 1960 | Ga0097620_100253503 | |||
| 1961 | Ga0097620_100298470 | |||
| 1962 | Ga0097620_100344743 | |||
| 1963 | Ga0097620_101026981 | |||
| 1964 | Ga0097620_101680699 | |||
| 1965 | Ga0075435_100002192 | |||
| 1966 | Ga0075435_100016802 | |||
| 1967 | Ga0075435_100101237 | |||
| 1968 | Ga0075435_100427608 | |||
| 1969 | Ga0075435_101252867 | |||
| 1970 | Ga0099794_10044594 | |||
| 1971 | Ga0099794_10074135 | |||
| 1972 | Ga0099794_10402595 | |||
| 1973 | Ga0099795_10030520 | |||
| 1974 | Ga0105240_10055750 | |||
| 1975 | Ga0105240_10061239 | |||
| 1976 | Ga0105240_10098841 | |||
| 1977 | Ga0105240_10147828 | |||
| 1978 | Ga0105240_10197359 | |||
| 1979 | Ga0105240_10205854 | |||
| 1980 | Ga0105240_10259198 | |||
| 1981 | Ga0105240_10519746 | |||
| 1982 | Ga0105240_10580303 | |||
| 1983 | Ga0105240_10581698 | |||
| 1984 | Ga0105240_10775099 | |||
| 1985 | Ga0105240_10819970 | |||
| 1986 | Ga0105240_11018321 | |||
| 1987 | Ga0105240_11148092 | |||
| 1988 | Ga0105240_11780744 | |||
| 1989 | Ga0111539_10407355 | |||
| 1990 | Ga0111539_11498579 | |||
| 1991 | Ga0105245_10003248 | |||
| 1992 | Ga0105245_10007752 | |||
| 1993 | Ga0105245_10007882 | |||
| 1994 | Ga0105245_10018174 | |||
| 1995 | Ga0105245_10052722 | |||
| 1996 | Ga0105245_10064552 | |||
| 1997 | Ga0105245_10093343 | |||
| 1998 | Ga0105245_10179724 | |||
| 1999 | Ga0105245_10423149 | |||
| 2000 | Ga0105245_10481162 | |||
| 2001 | Ga0105245_10778165 | |||
| 2002 | Ga0105247_10001594 | |||
| 2003 | Ga0105247_10017504 | |||
| 2004 | Ga0114129_10061374 | |||
| 2005 | Ga0114129_10165885 | |||
| 2006 | Ga0105243_10626305 | |||
| 2007 | Ga0105243_11377270 | |||
| 2008 | Ga0105241_10004558 | |||
| 2009 | Ga0105241_10024348 | |||
| 2010 | Ga0105241_10043109 | |||
| 2011 | Ga0105241_10049184 | |||
| 2012 | Ga0105241_10070311 | |||
| 2013 | Ga0105241_10094522 | |||
| 2014 | Ga0105241_10258229 | |||
| 2015 | Ga0105241_10397954 | |||
| 2016 | Ga0105241_10407320 | |||
| 2017 | Ga0105241_11769001 | |||
| 2018 | Ga0105242_10006980 | |||
| 2019 | Ga0105242_10171301 | |||
| 2020 | Ga0105242_10274578 | |||
| 2021 | Ga0105242_10449797 | |||
| 2022 | Ga0105242_11373422 | |||
| 2023 | Ga0105248_10011433 | |||
| 2024 | Ga0105248_10026687 | |||
| 2025 | Ga0105248_10086566 | |||
| 2026 | Ga0105248_10099247 | |||
| 2027 | Ga0105248_10283297 | |||
| 2028 | Ga0105248_10570011 | |||
| 2029 | Ga0105248_10872668 | |||
| 2030 | Ga0105237_10006364 | |||
| 2031 | Ga0105237_10013796 | |||
| 2032 | Ga0105237_10045567 | |||
| 2033 | Ga0105237_10072667 | |||
| 2034 | Ga0105237_10075837 | |||
| 2035 | Ga0105237_10216179 | |||
| 2036 | Ga0105237_10273158 | |||
| 2037 | Ga0105237_10285608 | |||
| 2038 | Ga0105237_10321170 | |||
| 2039 | Ga0105237_10410467 | |||
| 2040 | Ga0105237_10653280 | |||
| 2041 | Ga0105237_10691100 | |||
| 2042 | Ga0105237_10723015 | |||
| 2043 | Ga0105237_10899599 | |||
| 2044 | Ga0105237_11092496 | |||
| 2045 | Ga0105237_11725016 | |||
| 2046 | Ga0105238_10025430 | |||
| 2047 | Ga0105238_10138524 | |||
| 2048 | Ga0105238_10157265 | |||
| 2049 | Ga0105238_10206998 | |||
| 2050 | Ga0105238_10235107 | |||
| 2051 | Ga0105238_10249507 | |||
| 2052 | Ga0105249_10041603 | |||
| 2053 | Ga0105249_10290290 | |||
| 2054 | Ga0105249_10308379 | |||
| 2055 | Ga0099796_10028145 | |||
| 2056 | Ga0105239_10003652 | |||
| 2057 | Ga0105239_10066583 | |||
| 2058 | Ga0105239_10070525 | |||
| 2059 | Ga0105239_10087659 | |||
| 2060 | Ga0105239_10095971 | |||
| 2061 | Ga0105239_10370397 | |||
| 2062 | Ga0105239_10713671 | |||
| 2063 | Ga0105239_11270780 | |||
| 2064 | Ga0105239_12512498 | |||
| 2065 | Ga0105246_10004431 | |||
| 2066 | Ga0105246_10251252 | |||
| 2067 | Ga0105246_10487443 | |||
| 2068 | Ga0105246_10726030 | |||
| 2069 | Ga0105246_10810470 | |||
| 2070 | Ga0157324_1004648 | |||
| 2071 | Ga0157373_10002519 | |||
| 2072 | Ga0157373_10007083 | |||
| 2073 | Ga0157373_10030097 | |||
| 2074 | Ga0157373_10108259 | |||
| 2075 | Ga0157373_10116116 | |||
| 2076 | Ga0157373_10182073 | |||
| 2077 | Ga0157373_10338975 | |||
| 2078 | Ga0157373_10470852 | |||
| 2079 | Ga0157371_10008414 | |||
| 2080 | Ga0157371_10009414 | |||
| 2081 | Ga0157371_10049901 | |||
| 2082 | Ga0157370_10045645 | |||
| 2083 | Ga0157370_10080214 | |||
| 2084 | Ga0157370_10108342 | |||
| 2085 | Ga0157370_10209613 | |||
| 2086 | Ga0157370_10294890 | |||
| 2087 | Ga0157370_10692587 | |||
| 2088 | Ga0157369_10017191 | |||
| 2089 | Ga0157369_10060408 | |||
| 2090 | Ga0157369_10122971 | |||
| 2091 | Ga0157369_10127242 | |||
| 2092 | Ga0157369_10258603 | |||
| 2093 | Ga0157369_10363215 | |||
| 2094 | Ga0157369_10515747 | |||
| 2095 | Ga0157369_11047837 | |||
| 2096 | Ga0157374_10000634 | |||
| 2097 | Ga0157374_10001978 | |||
| 2098 | Ga0157374_10002353 | |||
| 2099 | Ga0157374_10007704 | |||
| 2100 | Ga0157374_10020608 | |||
| 2101 | Ga0157374_10059771 | |||
| 2102 | Ga0157374_10113865 | |||
| 2103 | Ga0157374_10140007 | |||
| 2104 | Ga0157374_10392430 | |||
| 2105 | Ga0157374_10650860 | |||
| 2106 | Ga0157374_11987540 | |||
| 2107 | Ga0157378_10000202 | |||
| 2108 | Ga0157378_10000725 | |||
| 2109 | Ga0157378_10001795 | |||
| 2110 | Ga0157378_10012660 | |||
| 2111 | Ga0157378_10072136 | |||
| 2112 | Ga0157378_10090402 | |||
| 2113 | Ga0157378_10340913 | |||
| 2114 | Ga0157378_10543179 | |||
| 2115 | Ga0157378_10717651 | |||
| 2116 | Ga0157378_10754322 | |||
| 2117 | Ga0157378_11058524 | |||
| 2118 | Ga0157378_11443155 | |||
| 2119 | Ga0163162_10009643 | |||
| 2120 | Ga0163162_10040280 | |||
| 2121 | Ga0163162_10055031 | |||
| 2122 | Ga0163162_10070409 | |||
| 2123 | Ga0163162_10112681 | |||
| 2124 | Ga0163162_10152829 | |||
| 2125 | Ga0163162_10191003 | |||
| 2126 | Ga0163162_10314703 | |||
| 2127 | Ga0163162_10759984 | |||
| 2128 | Ga0163162_11004324 | |||
| 2129 | Ga0163162_11046858 | |||
| 2130 | Ga0163162_11072492 | |||
| 2131 | Ga0163162_11162495 | |||
| 2132 | Ga0163162_12053660 | |||
| 2133 | Ga0157372_10000565 | |||
| 2134 | Ga0157372_10002050 | |||
| 2135 | Ga0157372_10003078 | |||
| 2136 | Ga0157372_10015430 | |||
| 2137 | Ga0157372_10016466 | |||
| 2138 | Ga0157372_10022661 | |||
| 2139 | Ga0157372_10030069 | |||
| 2140 | Ga0157372_10053833 | |||
| 2141 | Ga0157372_10054469 | |||
| 2142 | Ga0157372_10059528 | |||
| 2143 | Ga0157372_10188739 | |||
| 2144 | Ga0157372_10352323 | |||
| 2145 | Ga0157372_10390444 | |||
| 2146 | Ga0157372_11356269 | |||
| 2147 | Ga0157375_10073401 | |||
| 2148 | Ga0157375_10248755 | |||
| 2149 | Ga0157375_10335458 | |||
| 2150 | Ga0157375_10657732 | |||
| 2151 | Ga0157375_11383542 | |||
| 2152 | Ga0157375_11644918 | |||
| 2153 | Ga0163163_10003044 | |||
| 2154 | Ga0163163_10040832 | |||
| 2155 | Ga0163163_10051769 | |||
| 2156 | Ga0163163_10192569 | |||
| 2157 | Ga0163163_10340898 | |||
| 2158 | Ga0163163_10445884 | |||
| 2159 | Ga0163163_10563764 | |||
| 2160 | Ga0163163_10937098 | |||
| 2161 | Ga0163163_11393492 | |||
| 2162 | Ga0163163_11597050 | |||
| 2163 | Ga0157380_11681187 | |||
| 2164 | Ga0182008_10004678 | |||
| 2165 | Ga0182008_10020896 | |||
| 2166 | Ga0182008_10158242 | |||
| 2167 | Ga0157377_10006706 | |||
| 2168 | Ga0157377_10327853 | |||
| 2169 | Ga0157377_10354088 | |||
| 2170 | Ga0157377_11015507 | |||
| 2171 | Ga0157379_10003409 | |||
| 2172 | Ga0157379_10034772 | |||
| 2173 | Ga0157379_10151447 | |||
| 2174 | Ga0157379_10171237 | |||
| 2175 | Ga0157379_10349408 | |||
| 2176 | Ga0157379_10656943 | |||
| 2177 | Ga0157379_11279596 | |||
| 2178 | Ga0157376_10004658 | |||
| 2179 | Ga0157376_10029519 | |||
| 2180 | Ga0157376_10069210 | |||
| 2181 | Ga0157376_10247471 | |||
| 2182 | Ga0157376_10292498 | |||
| 2183 | Ga0157376_10386907 | |||
| 2184 | Ga0157376_10564970 | |||
| 2185 | Ga0157376_11052914 | |||
| 2186 | Ga0182007_10024426 | |||
| 2187 | Ga0182007_10227876 | |||
| 2188 | Ga0182005_1003699 | |||
| 2189 | Ga0182005_1097660 | |||
| 2190 | Ga0163161_10032069 | |||
| 2191 | Ga0163161_10733077 | |||
| 2192 | Ga0213876_10246687 | |||
| 2193 | Ga0213875_10004172 | |||
| 2194 | Ga0224712_10480315 | |||
| 2195 | Ga0224570_100116 | |||
| 2196 | Ga0224569_100063 | |||
| 2197 | Ga0224569_103169 | |||
| 2198 | Ga0224571_100789 | |||
| 2199 | Ga0224572_1015389 | |||
| 2200 | Ga0224572_1018281 | |||
| 2201 | Ga0224572_1063119 | |||
| 2202 | Ga0228598_1000002 | |||
| 2203 | Ga0228598_1000333 | |||
| 2204 | Ga0228598_1005227 | |||
| 2205 | Ga0207697_10014218 | |||
| 2206 | Ga0207656_10002371 | |||
| 2207 | Ga0207692_10024383 | |||
| 2208 | Ga0207692_10028069 | |||
| 2209 | Ga0207692_10062910 | |||
| 2210 | Ga0207692_10176892 | |||
| 2211 | Ga0207692_10200597 | |||
| 2212 | Ga0207692_10241162 | |||
| 2213 | Ga0207692_10598833 | |||
| 2214 | Ga0207692_10683838 | |||
| 2215 | Ga0207692_10867374 | |||
| 2216 | Ga0207642_10004640 | |||
| 2217 | Ga0207642_10017427 | |||
| 2218 | Ga0207642_10029862 | |||
| 2219 | Ga0207642_10475266 | |||
| 2220 | Ga0207710_10023501 | |||
| 2221 | Ga0207710_10097775 | |||
| 2222 | Ga0207710_10113691 | |||
| 2223 | Ga0207688_10055000 | |||
| 2224 | Ga0207680_10081689 | |||
| 2225 | Ga0207680_10236894 | |||
| 2226 | Ga0207680_10393459 | |||
| 2227 | Ga0207647_10013732 | |||
| 2228 | Ga0207647_10017367 | |||
| 2229 | Ga0207647_10029904 | |||
| 2230 | Ga0207685_10008705 | |||
| 2231 | Ga0207685_10036045 | |||
| 2232 | Ga0207685_10090705 | |||
| 2233 | Ga0207685_10211595 | |||
| 2234 | Ga0207685_10385944 | |||
| 2235 | Ga0207699_10010406 | |||
| 2236 | Ga0207699_10013470 | |||
| 2237 | Ga0207699_10026320 | |||
| 2238 | Ga0207699_10074634 | |||
| 2239 | Ga0207699_10079595 | |||
| 2240 | Ga0207699_10120186 | |||
| 2241 | Ga0207699_10124813 | |||
| 2242 | Ga0207699_10311647 | |||
| 2243 | Ga0207699_10463961 | |||
| 2244 | Ga0207699_10480103 | |||
| 2245 | Ga0207699_10742188 | |||
| 2246 | Ga0207645_10000125 | |||
| 2247 | Ga0207645_10142836 | |||
| 2248 | Ga0207645_10483605 | |||
| 2249 | Ga0207643_10000488 | |||
| 2250 | Ga0207643_10376564 | |||
| 2251 | Ga0207705_10024329 | |||
| 2252 | Ga0207705_10449652 | |||
| 2253 | Ga0207684_10000223 | |||
| 2254 | Ga0207684_10003613 | |||
| 2255 | Ga0207684_10005360 | |||
| 2256 | Ga0207684_10027576 | |||
| 2257 | Ga0207684_10051827 | |||
| 2258 | Ga0207684_10503490 | |||
| 2259 | Ga0207654_10003381 | |||
| 2260 | Ga0207654_10008923 | |||
| 2261 | Ga0207654_10012212 | |||
| 2262 | Ga0207654_10018603 | |||
| 2263 | Ga0207654_10057660 | |||
| 2264 | Ga0207654_10059531 | |||
| 2265 | Ga0207654_10078327 | |||
| 2266 | Ga0207654_10473775 | |||
| 2267 | Ga0207654_10597928 | |||
| 2268 | Ga0207707_10011464 | |||
| 2269 | Ga0207707_10014133 | |||
| 2270 | Ga0207707_10054384 | |||
| 2271 | Ga0207707_10063047 | |||
| 2272 | Ga0207707_10429255 | |||
| 2273 | Ga0207695_10006382 | |||
| 2274 | Ga0207695_10006994 | |||
| 2275 | Ga0207695_10018543 | |||
| 2276 | Ga0207695_10074781 | |||
| 2277 | Ga0207695_10131230 | |||
| 2278 | Ga0207695_10134629 | |||
| 2279 | Ga0207695_10136999 | |||
| 2280 | Ga0207695_10143928 | |||
| 2281 | Ga0207695_10276584 | |||
| 2282 | Ga0207695_10501488 | |||
| 2283 | Ga0207695_10556484 | |||
| 2284 | Ga0207695_10652576 | |||
| 2285 | Ga0207695_10754790 | |||
| 2286 | Ga0207671_10006781 | |||
| 2287 | Ga0207671_10011713 | |||
| 2288 | Ga0207671_10016797 | |||
| 2289 | Ga0207671_10346429 | |||
| 2290 | Ga0207671_10926364 | |||
| 2291 | Ga0207693_10000524 | |||
| 2292 | Ga0207693_10000961 | |||
| 2293 | Ga0207693_10008223 | |||
| 2294 | Ga0207693_10013230 | |||
| 2295 | Ga0207693_10014832 | |||
| 2296 | Ga0207693_10023945 | |||
| 2297 | Ga0207693_10075765 | |||
| 2298 | Ga0207693_10119681 | |||
| 2299 | Ga0207693_10171491 | |||
| 2300 | Ga0207693_10938887 | |||
| 2301 | Ga0207663_10001734 | |||
| 2302 | Ga0207663_10001859 | |||
| 2303 | Ga0207663_10004743 | |||
| 2304 | Ga0207663_10015680 | |||
| 2305 | Ga0207663_10026236 | |||
| 2306 | Ga0207663_10028036 | |||
| 2307 | Ga0207663_10125516 | |||
| 2308 | Ga0207663_10138418 | |||
| 2309 | Ga0207663_10155129 | |||
| 2310 | Ga0207663_10210328 | |||
| 2311 | Ga0207663_10270634 | |||
| 2312 | Ga0207663_10593226 | |||
| 2313 | Ga0207663_10688618 | |||
| 2314 | Ga0207660_10098507 | |||
| 2315 | Ga0207660_10449225 | |||
| 2316 | Ga0207660_10607143 | |||
| 2317 | Ga0207660_10607628 | |||
| 2318 | Ga0207657_10000242 | |||
| 2319 | Ga0207657_10004544 | |||
| 2320 | Ga0207657_10540098 | |||
| 2321 | Ga0207649_10000177 | |||
| 2322 | Ga0207649_10017954 | |||
| 2323 | Ga0207649_10135827 | |||
| 2324 | Ga0207652_10051559 | |||
| 2325 | Ga0207652_10085723 | |||
| 2326 | Ga0207652_10178854 | |||
| 2327 | Ga0207652_10204269 | |||
| 2328 | Ga0207652_10229348 | |||
| 2329 | Ga0207652_10300171 | |||
| 2330 | Ga0207652_11013346 | |||
| 2331 | Ga0207646_10000348 | |||
| 2332 | Ga0207646_10001267 | |||
| 2333 | Ga0207646_10033930 | |||
| 2334 | Ga0207646_10180094 | |||
| 2335 | Ga0207646_10519122 | |||
| 2336 | Ga0207681_10137815 | |||
| 2337 | Ga0207681_10274769 | |||
| 2338 | Ga0207694_10019580 | |||
| 2339 | Ga0207694_10078313 | |||
| 2340 | Ga0207694_10152856 | |||
| 2341 | Ga0207694_10158395 | |||
| 2342 | Ga0207694_10164503 | |||
| 2343 | Ga0207694_10333271 | |||
| 2344 | Ga0207650_10000072 | |||
| 2345 | Ga0207650_10000078 | |||
| 2346 | Ga0207650_10020813 | |||
| 2347 | Ga0207650_10259650 | |||
| 2348 | Ga0207650_10376014 | |||
| 2349 | Ga0207659_10092620 | |||
| 2350 | Ga0207659_10138410 | |||
| 2351 | Ga0207659_10143413 | |||
| 2352 | Ga0207659_10683307 | |||
| 2353 | Ga0207659_11067929 | |||
| 2354 | Ga0207687_10001734 | |||
| 2355 | Ga0207687_10004355 | |||
| 2356 | Ga0207687_10042892 | |||
| 2357 | Ga0207687_10211196 | |||
| 2358 | Ga0207687_10335612 | |||
| 2359 | Ga0207687_10557002 | |||
| 2360 | Ga0207700_10001427 | |||
| 2361 | Ga0207700_10021787 | |||
| 2362 | Ga0207700_10022935 | |||
| 2363 | Ga0207700_10027238 | |||
| 2364 | Ga0207700_10028863 | |||
| 2365 | Ga0207700_10034336 | |||
| 2366 | Ga0207700_10041527 | |||
| 2367 | Ga0207700_10063437 | |||
| 2368 | Ga0207700_10104271 | |||
| 2369 | Ga0207700_10104872 | |||
| 2370 | Ga0207700_10106753 | |||
| 2371 | Ga0207700_10191786 | |||
| 2372 | Ga0207700_10206384 | |||
| 2373 | Ga0207700_10207494 | |||
| 2374 | Ga0207700_10221360 | |||
| 2375 | Ga0207700_10259524 | |||
| 2376 | Ga0207700_10428458 | |||
| 2377 | Ga0207700_10483438 | |||
| 2378 | Ga0207700_10562919 | |||
| 2379 | Ga0207700_10652505 | |||
| 2380 | Ga0207700_11002775 | |||
| 2381 | Ga0207700_11480480 | |||
| 2382 | Ga0207700_11604665 | |||
| 2383 | Ga0207664_10035117 | |||
| 2384 | Ga0207664_10049398 | |||
| 2385 | Ga0207664_10055328 | |||
| 2386 | Ga0207664_10064901 | |||
| 2387 | Ga0207664_10073009 | |||
| 2388 | Ga0207664_10119385 | |||
| 2389 | Ga0207664_10120971 | |||
| 2390 | Ga0207664_10125915 | |||
| 2391 | Ga0207664_10145912 | |||
| 2392 | Ga0207664_10206778 | |||
| 2393 | Ga0207664_10267429 | |||
| 2394 | Ga0207664_10280458 | |||
| 2395 | Ga0207664_10322698 | |||
| 2396 | Ga0207664_10408277 | |||
| 2397 | Ga0207664_10575630 | |||
| 2398 | Ga0207664_10810414 | |||
| 2399 | Ga0207664_10874765 | |||
| 2400 | Ga0207664_10920441 | |||
| 2401 | Ga0207644_10088536 | |||
| 2402 | Ga0207644_11014172 | |||
| 2403 | Ga0207690_10022280 | |||
| 2404 | Ga0207690_10655260 | |||
| 2405 | Ga0207706_10003412 | |||
| 2406 | Ga0207706_10020486 | |||
| 2407 | Ga0207706_10022082 | |||
| 2408 | Ga0207686_10060006 | |||
| 2409 | Ga0207686_10084322 | |||
| 2410 | Ga0207686_10095150 | |||
| 2411 | Ga0207709_10277959 | |||
| 2412 | Ga0207670_10035848 | |||
| 2413 | Ga0207670_10290118 | |||
| 2414 | Ga0207670_11168690 | |||
| 2415 | Ga0207669_10871523 | |||
| 2416 | Ga0207704_10016976 | |||
| 2417 | Ga0207704_10077655 | |||
| 2418 | Ga0207704_10162300 | |||
| 2419 | Ga0207704_10313466 | |||
| 2420 | Ga0207665_10008885 | |||
| 2421 | Ga0207665_10011904 | |||
| 2422 | Ga0207665_10026521 | |||
| 2423 | Ga0207665_10029957 | |||
| 2424 | Ga0207665_10059495 | |||
| 2425 | Ga0207665_10062057 | |||
| 2426 | Ga0207665_10102172 | |||
| 2427 | Ga0207665_10151101 | |||
| 2428 | Ga0207665_10152393 | |||
| 2429 | Ga0207665_10222969 | |||
| 2430 | Ga0207665_10310186 | |||
| 2431 | Ga0207665_10435044 | |||
| 2432 | Ga0207665_10518534 | |||
| 2433 | Ga0207665_10661700 | |||
| 2434 | Ga0207665_10883712 | |||
| 2435 | Ga0207691_10000853 | |||
| 2436 | Ga0207691_10386750 | |||
| 2437 | Ga0207691_10769395 | |||
| 2438 | Ga0207711_10006085 | |||
| 2439 | Ga0207711_10020209 | |||
| 2440 | Ga0207711_10025091 | |||
| 2441 | Ga0207711_10031024 | |||
| 2442 | Ga0207711_10486305 | |||
| 2443 | Ga0207711_10705534 | |||
| 2444 | Ga0207711_11238307 | |||
| 2445 | Ga0207711_11251049 | |||
| 2446 | Ga0207689_10000495 | |||
| 2447 | Ga0207689_10000707 | |||
| 2448 | Ga0207689_10020706 | |||
| 2449 | Ga0207661_10000008 | |||
| 2450 | Ga0207661_10001451 | |||
| 2451 | Ga0207661_10159466 | |||
| 2452 | Ga0207661_10840439 | |||
| 2453 | Ga0207661_11007782 | |||
| 2454 | Ga0207679_10000177 | |||
| 2455 | Ga0207679_10038189 | |||
| 2456 | Ga0207667_10002400 | |||
| 2457 | Ga0207667_10016688 | |||
| 2458 | Ga0207667_10046866 | |||
| 2459 | Ga0207667_10064709 | |||
| 2460 | Ga0207667_10121862 | |||
| 2461 | Ga0207667_10317984 | |||
| 2462 | Ga0207667_10331765 | |||
| 2463 | Ga0207667_10493290 | |||
| 2464 | Ga0207667_10544159 | |||
| 2465 | Ga0207651_10004381 | |||
| 2466 | Ga0207651_10037247 | |||
| 2467 | Ga0207651_10569137 | |||
| 2468 | Ga0207651_10569485 | |||
| 2469 | Ga0207712_11015935 | |||
| 2470 | Ga0207668_10019365 | |||
| 2471 | Ga0207640_10000843 | |||
| 2472 | Ga0207640_10002817 | |||
| 2473 | Ga0207640_10048913 | |||
| 2474 | Ga0207640_10068120 | |||
| 2475 | Ga0207640_10079331 | |||
| 2476 | Ga0207640_10625896 | |||
| 2477 | Ga0207658_10127573 | |||
| 2478 | Ga0207658_10367425 | |||
| 2479 | Ga0207658_10477139 | |||
| 2480 | Ga0207677_10001146 | |||
| 2481 | Ga0207677_10004684 | |||
| 2482 | Ga0207677_10039291 | |||
| 2483 | Ga0207677_10111614 | |||
| 2484 | Ga0207677_10136790 | |||
| 2485 | Ga0207677_10860316 | |||
| 2486 | Ga0207677_10970364 | |||
| 2487 | Ga0207703_10007481 | |||
| 2488 | Ga0207703_10014707 | |||
| 2489 | Ga0207703_10029526 | |||
| 2490 | Ga0207703_10071736 | |||
| 2491 | Ga0207703_10253027 | |||
| 2492 | Ga0207703_10690093 | |||
| 2493 | Ga0207703_10852301 | |||
| 2494 | Ga0207703_11341010 | |||
| 2495 | Ga0207639_10298587 | |||
| 2496 | Ga0207639_10464596 | |||
| 2497 | Ga0207639_10566526 | |||
| 2498 | Ga0207678_10001196 | |||
| 2499 | Ga0207678_10001295 | |||
| 2500 | Ga0207708_10323073 | |||
| 2501 | Ga0207702_10001116 | |||
| 2502 | Ga0207702_10006348 | |||
| 2503 | Ga0207702_10027482 | |||
| 2504 | Ga0207702_10030402 | |||
| 2505 | Ga0207702_10118325 | |||
| 2506 | Ga0207702_10173068 | |||
| 2507 | Ga0207702_10256585 | |||
| 2508 | Ga0207702_10579191 | |||
| 2509 | Ga0207702_10600752 | |||
| 2510 | Ga0207702_10606411 | |||
| 2511 | Ga0207702_10698639 | |||
| 2512 | Ga0207641_10000237 | |||
| 2513 | Ga0207641_10022076 | |||
| 2514 | Ga0207641_10052884 | |||
| 2515 | Ga0207641_10071506 | |||
| 2516 | Ga0207641_10132612 | |||
| 2517 | Ga0207641_10199655 | |||
| 2518 | Ga0207641_10224754 | |||
| 2519 | Ga0207641_10286867 | |||
| 2520 | Ga0207641_10404294 | |||
| 2521 | Ga0207648_10010733 | |||
| 2522 | Ga0207648_10014004 | |||
| 2523 | Ga0207648_10731050 | |||
| 2524 | Ga0207648_11660121 | |||
| 2525 | Ga0207676_10000050 | |||
| 2526 | Ga0207676_10012503 | |||
| 2527 | Ga0207676_10081753 | |||
| 2528 | Ga0207674_10000130 | |||
| 2529 | Ga0207674_10000269 | |||
| 2530 | Ga0207674_10048042 | |||
| 2531 | Ga0207674_10238253 | |||
| 2532 | Ga0207674_10358129 | |||
| 2533 | Ga0207674_10538057 | |||
| 2534 | Ga0207674_10898673 | |||
| 2535 | Ga0207675_100191788 | |||
| 2536 | Ga0207675_100715655 | |||
| 2537 | Ga0207683_10000139 | |||
| 2538 | Ga0207683_10082676 | |||
| 2539 | Ga0207683_10112642 | |||
| 2540 | Ga0207683_10187805 | |||
| 2541 | Ga0207683_10294985 | |||
| 2542 | Ga0207698_10055373 | |||
| 2543 | Ga0207698_10060280 | |||
| 2544 | Ga0207698_10080622 | |||
| 2545 | Ga0207698_10696240 | |||
| 2546 | Ga0207698_10717698 | |||
| 2547 | Ga0265354_1007310 | |||
| 2548 | Ga0265356_1000067 | |||
| 2549 | Ga0265356_1007396 | |||
| 2550 | Ga0265355_1002063 | |||
| 2551 | Ga0265355_1008363 | |||
| 2552 | Ga0268266_10004469 | |||
| 2553 | Ga0268266_10079038 | |||
| 2554 | Ga0268266_10614477 | |||
| 2555 | Ga0268265_10022237 | |||
| 2556 | Ga0268265_10593707 | |||
| 2557 | Ga0268264_10004223 | |||
| 2558 | Ga0268264_10171272 | |||
| 2559 | Ga0268264_10238198 | |||
| 2560 | Ga0268264_10453458 | |||
| 2561 | Ga0265326_10102496 | |||
| 2562 | Ga0265319_1042553 | |||
| 2563 | Ga0265318_10030718 | |||
| 2564 | Ga0265338_10003647 | |||
| 2565 | Ga0265338_10062736 | |||
| 2566 | Ga0265338_10068968 | |||
| 2567 | Ga0265338_10094425 | |||
| 2568 | Ga0265338_10160055 | |||
| 2569 | Ga0265338_10191003 | |||
| 2570 | Ga0265324_10008993 | |||
| 2571 | Ga0265762_1004268 | |||
| 2572 | Ga0265770_1010176 | |||
| 2573 | Ga0265765_1000153 | |||
| 2574 | Ga0265760_10002485 | |||
| 2575 | Ga0265760_10005151 | |||
| 2576 | Ga0265760_10014930 | |||
| 2577 | Ga0265760_10048912 | |||
| 2578 | Ga0265330_10033168 | |||
| 2579 | Ga0265330_10163731 | |||
| 2580 | Ga0265332_10028089 | |||
| 2581 | Ga0265332_10072165 | |||
| 2582 | Ga0265332_10072223 | |||
| 2583 | Ga0265328_10005736 | |||
| 2584 | Ga0265328_10047778 | |||
| 2585 | Ga0265320_10009889 | |||
| 2586 | Ga0265325_10000515 | |||
| 2587 | Ga0265325_10056890 | |||
| 2588 | Ga0265325_10095371 | |||
| 2589 | Ga0265325_10131863 | |||
| 2590 | Ga0265325_10184316 | |||
| 2591 | Ga0265329_10048292 | |||
| 2592 | Ga0265340_10001090 | |||
| 2593 | Ga0265340_10024598 | |||
| 2594 | Ga0265340_10069313 | |||
| 2595 | Ga0265339_10026663 | |||
| 2596 | Ga0265339_10027470 | |||
| 2597 | Ga0265339_10034507 | |||
| 2598 | Ga0265339_10072131 | |||
| 2599 | Ga0265339_10234287 | |||
| 2600 | Ga0265331_10003381 | |||
| 2601 | Ga0265331_10006153 | |||
| 2602 | Ga0265331_10048760 | |||
| 2603 | Ga0265331_10105229 | |||
| 2604 | Ga0265316_10001130 | |||
| 2605 | Ga0265316_10003692 | |||
| 2606 | Ga0265316_10006205 | |||
| 2607 | Ga0265316_10009598 | |||
| 2608 | Ga0265316_10030197 | |||
| 2609 | Ga0265316_10041585 | |||
| 2610 | Ga0265316_10144087 | |||
| 2611 | Ga0265316_10203343 | |||
| 2612 | Ga0265316_10523500 | |||
| 2613 | Ga0265313_10002383 | |||
| 2614 | Ga0265314_10001611 | |||
| 2615 | Ga0265314_10008835 | |||
| 2616 | Ga0265314_10103896 | |||
| 2617 | Ga0265342_10056404 | |||
| 2618 | Ga0307405_10251639 | |||
| 2619 | Ga0307405_10365018 | |||
| 2620 | Ga0307410_10001021 | |||
| 2621 | Ga0307406_10037832 | |||
| 2622 | Ga0307406_10445054 | |||
| 2623 | Ga0307407_10307731 | |||
| 2624 | Ga0307416_100093784 | |||
| 2625 | Ga0307416_100224104 | |||
| 2626 | Ga0307414_10074236 | |||
| 2627 | Ga0307415_101099249 | |||
| 2628 | Ga0373930_0002114 | |||
| 2629 | Ga0373926_0007641 | |||
| 2630 | Ga0373926_0020857 | |||
| 2631 | Ga0373926_0028374 | |||
| 2632 | Ga0373926_0187838 | |||
| 2633 | Ga0373928_0028357 | |||
| 2634 | Ga0373934_0031847 | |||
| 2635 | Ga0373934_0232490 | |||
| 2636 | Ga0373940_0056696 | |||
| 2637 | Ga0373944_0011305 | |||
| 2638 | Ga0373923_0068497 | |||
| 2639 | Ga0373923_0085489 | |||
| 2640 | Ga0373923_0194956 | |||
| 2641 | Ga0373932_0091587 | |||
| 2642 | Ga0373936_0000172 | |||
| 2643 | Ga0373936_0012995 | |||
| 2644 | Ga0373936_0102549 | |||
| 2645 | Ga0373936_0410490 | |||
| 2646 | Ga0373939_0123489 | |||
| 2647 | Ga0373941_0074815 | |||
| 2648 | Ga0373945_0001375 | |||
| 2649 | Ga0373945_0002395 | |||
| 2650 | Ga0373945_0128264 | |||
| 2651 | Ga0373945_0134718 | |||
| 2652 | Ga0373953_0003772 | |||
| 2653 | Ga0373953_0192043 | |||
| 2654 | Ga0373954_0007793 | |||
| 2655 | Ga0373954_0013276 | |||
| 2656 | Ga0373954_0169065 | |||
| 2657 | Ga0373956_0036548 | |||
| 2658 | Ga0373956_0039447 | |||
| 2659 | Ga0373956_0054467 | |||
| 2660 | Ga0373957_0017752 | |||
| 2661 | Ga0373943_0000055 | |||
| 2662 | Ga0373943_0003910 | |||
| 2663 | Ga0373943_0020297 | |||
| 2664 | Ga0373943_0226425 | |||
| 2665 | Ga0373943_0344765 | |||
| 2666 | Ga0373946_0029038 | |||
| 2667 | Ga0373946_0194772 | |||
| 2668 | Ga0373955_0008998 | |||
| 2669 | Ga0373955_0420749 | |||
| 2670 | Ga0373955_0429442 | |||
| 2671 | Ga0373961_0008159 | |||
| 2672 | Ga0373961_0025165 | |||
| 2673 | Ga0373924_0000091 | |||
| 2674 | Ga0373924_0014882 | |||
| 2675 | Ga0373924_0026543 | |||
| 2676 | Ga0373924_0090317 | |||
| 2677 | Ga0373931_0053587 | |||
| 2678 | Ga0373931_0059959 | |||
| 2679 | Ga0373931_0081062 | |||
| 2680 | Ga0373931_0084890 | |||
| 2681 | Ga0373931_0504067 | |||
| 2682 | Ga0373931_0602238 | |||
| 2683 | Ga0373935_0002091 | |||
| 2684 | Ga0373935_0010861 | |||
| 2685 | Ga0373935_0020803 | |||
| 2686 | Ga0373935_0052573 | |||
| 2687 | Ga0373935_0082770 | |||
| 2688 | Ga0373935_0108297 | |||
| 2689 | Ga0373935_0126285 | |||
| 2690 | Ga0373935_0199832 | |||
| 2691 | Ga0373935_0218085 | |||
| 2692 | Ga0373935_0309731 | |||
| 2693 | Ga0373935_0423798 | |||
| 2694 | Ga0373935_1157644 | |||
| 2695 | Ga0373927_0000378 | |||
| 2696 | Ga0373927_0001571 | |||
| 2697 | Ga0373927_0005079 | |||
| 2698 | Ga0373927_0013728 | |||
| 2699 | Ga0373927_0096748 | |||
| 2700 | Ga0373927_0153053 | |||
| 2701 | Ga0373927_0198094 | |||
| 2702 | Ga0373927_0416032 | |||
| 2703 | Ga0373927_0499868 | |||
| 2704 | Ga0373927_0621639 | |||
| 2705 | Ga0373933_0016430 | |||
| 2706 | Ga0373933_0192365 | |||
| 2707 | Ga0373933_0331569 | |||
| 2708 | Ga0373933_0359390 | |||
| 2709 | Ga0373933_0506434 | |||
| 2710 | Ga0373933_0680214 | |||
| 2711 | Ga0373947_0000167 | |||
| 2712 | Ga0373947_0001658 | |||
| 2713 | Ga0373947_0008836 | |||
| 2714 | Ga0373947_0050887 | |||
| 2715 | Ga0373947_0057197 | |||
| 2716 | Ga0373947_0061444 | |||
| 2717 | Ga0373947_0100146 | |||
| 2718 | Ga0373947_0471052 | |||
| 2719 | Ga0373947_0530924 | |||
| 2720 | Ga0373947_0668456 | |||
| 2721 | Ga0373947_0989113 | |||
| 2722 | Ga0373937_0000027 | |||
| 2723 | Ga0373937_0014721 | |||
| 2724 | Ga0373937_0018754 | |||
| 2725 | Ga0373937_0020676 | |||
| 2726 | Ga0373937_0041141 | |||
| 2727 | Ga0373937_0047249 | |||
| 2728 | Ga0373937_0076681 | |||
| 2729 | Ga0373937_0094328 | |||
| 2730 | Ga0373937_0105712 | |||
| 2731 | Ga0373937_0238504 | |||
| 2732 | Ga0373937_0310966 | |||
| 2733 | Ga0373937_0360043 | |||
| 2734 | Ga0373937_0374832 | |||
| 2735 | Ga0373937_0832647 | |||
| 2736 | Ga0373937_1055870 | |||
| 2737 | Ga0373937_1312534 | |||
| 2738 | Ga0373925_0000224 | |||
| 2739 | Ga0373925_0015611 | |||
| 2740 | Ga0373925_0030136 | |||
| 2741 | Ga0373925_0034052 | |||
| 2742 | Ga0373925_0038481 | |||
| 2743 | Ga0373925_0073647 | |||
| 2744 | Ga0373925_0085587 | |||
| 2745 | Ga0373925_0111187 | |||
| 2746 | Ga0373925_0122640 | |||
| 2747 | Ga0373925_0124740 | |||
| 2748 | Ga0373925_0176346 | |||
| 2749 | Ga0373925_0180170 | |||
| 2750 | Ga0373925_0280191 | |||
| 2751 | Ga0373925_1142123 | |||
| 2752 | Ga0436364_0135933 | |||
| 2753 | Ga0436364_1194151 | |||
| 2754 | Ga0395901_0380383 | |||
| 2755 | Ga0436365_1136717 | |||
| 2756 | Ga0436365_1311817 | |||
| 2757 | Ga0436365_1314150 | |||
| 2758 | Ga0436365_1559181 | |||
| 2759 | Ga0436365_1751127 | |||
| 2760 | Ga0436360_0673759 | |||
| 2761 | Ga0436361_0293375 | |||
| 2762 | Ga0436363_0356673 | |||
| 2763 | Ga0436363_0862048 | |||
| 2764 | Ga0436363_1295381 | |||
| 2765 | Ga0436362_1047223 | |||
| 2766 | Ga0451849_1404825 | |||
| 2767 | Ga0451853_1241128 | |||
| 2768 | Ga0451577_1169536 | |||
| 2769 | Ga0466969_0257031 | |||
| 2770 | Ga0466966_0147888 | |||
| 2771 | Ga0466966_0228892 | |||
| 2772 | Ga0466961_0263248 | |||
| 2773 | Ga0466963_0003772 | |||
| 2774 | Ga0466963_0039609 | |||
| 2775 | Ga0466963_0147368 | |||
| 2776 | Ga0466964_0060019 | |||
| 2777 | Ga0466964_0130794 | |||
| 2778 | Ga0466971_0314619 | |||
| 2779 | Ga0466957_0076950 | |||
| 2780 | Ga0466957_0314525 | |||
| 2781 | Ga0466959_0183933 | |||
| 2782 | Ga0451576_0097819 | |||
| 2783 | Ga0451576_0220984 | |||
| 2784 | Ga0451576_0288790 | |||
| 2785 | Ga0451576_1428665 | |||
| 2786 | Ga0466967_0017316 | |||
| 2787 | Ga0466967_0046110 | |||
| 2788 | Ga0466967_0055367 | |||
| 2789 | Ga0466967_0093669 | |||
| 2790 | Ga0466967_0105221 | |||
| 2791 | Ga0466967_0338174 | |||
| 2792 | Ga0466967_0678854 | |||
| 2793 | Ga0495629_0256515 | |||
| 2794 | Ga0495629_0698185 | |||
| 2795 | Ga0495651_0008434 | |||
| 2796 | Ga0495651_0050799 | |||
| 2797 | Ga0495651_0119950 | |||
| 2798 | Ga0495651_0140835 | |||
| 2799 | Ga0495651_0265564 | |||
| 2800 | Ga0495651_0449636 | |||
| 2801 | Ga0495653_0045879 | |||
| 2802 | Ga0495653_0107349 | |||
| 2803 | Ga0495653_0427750 | |||
| 2804 | Ga0495580_0001464 | |||
| 2805 | Ga0495580_0003534 | |||
| 2806 | Ga0495580_0006199 | |||
| 2807 | Ga0495580_0006438 | |||
| 2808 | Ga0495580_0017479 | |||
| 2809 | Ga0495580_0017970 | |||
| 2810 | Ga0495580_0018597 | |||
| 2811 | Ga0495580_0022698 | |||
| 2812 | Ga0495580_0026438 | |||
| 2813 | Ga0495580_0046088 | |||
| 2814 | Ga0495580_0056536 | |||
| 2815 | Ga0495580_0063028 | |||
| 2816 | Ga0495580_0063517 | |||
| 2817 | Ga0495580_0089990 | |||
| 2818 | Ga0495580_0111264 | |||
| 2819 | Ga0495580_0161973 | |||
| 2820 | Ga0495580_0224717 | |||
| 2821 | Ga0495580_0262763 | |||
| 2822 | Ga0495580_0286305 | |||
| 2823 | Ga0495580_0362672 | |||
| 2824 | Ga0495580_0416062 | |||
| 2825 | Ga0495582_0012871 | |||
| 2826 | Ga0495582_0074764 | |||
| 2827 | Ga0495582_0101868 | |||
| 2828 | Ga0495582_0214216 | |||
| 2829 | Ga0495582_0521101 | |||
| 2830 | Ga0495605_0166527 | |||
| 2831 | Ga0495639_0074315 | |||
| 2832 | Ga0495662_0030179 | |||
| 2833 | Ga0495662_0245639 | |||
| 2834 | Ga0495664_0003847 | |||
| 2835 | Ga0495664_0094774 | |||
| 2836 | Ga0495664_0164274 | |||
| 2837 | Ga0495664_0212461 | |||
| 2838 | Ga0495664_0333026 | |||
| 2839 | Ga0495585_0441807 | |||
| 2840 | Ga0495594_0152024 | |||
| 2841 | Ga0495608_0082532 | |||
| 2842 | Ga0495608_0108032 | |||
| 2843 | Ga0495608_0159226 | |||
| 2844 | Ga0495618_0221675 | |||
| 2845 | Ga0495618_0253768 | |||
| 2846 | Ga0495628_0023575 | |||
| 2847 | Ga0495628_0244132 | |||
| 2848 | Ga0495628_0428850 | |||
| 2849 | Ga0495628_0489103 | |||
| 2850 | Ga0495628_0748032 | |||
| 2851 | Ga0495630_0013505 | |||
| 2852 | Ga0495630_0051815 | |||
| 2853 | Ga0495630_0058816 | |||
| 2854 | Ga0495630_0109713 | |||
| 2855 | Ga0495630_0299420 | |||
| 2856 | Ga0495666_0208869 | |||
| 2857 | Ga0495666_0227609 | |||
| 2858 | Ga0495642_0237719 | |||
| 2859 | Ga0495642_0340052 | |||
| 2860 | Ga0495652_0168939 | |||
| 2861 | Ga0495652_0349477 | |||
| 2862 | Ga0495652_0395440 | |||
| 2863 | Ga0495665_0021545 | |||
| 2864 | Ga0495665_0025270 | |||
| 2865 | Ga0495665_0034989 | |||
| 2866 | Ga0495665_0088377 | |||
| 2867 | Ga0495665_0203784 | |||
| 2868 | Ga0495665_0236414 | |||
| 2869 | Ga0495665_0428360 | |||
| 2870 | Ga0495640_0058921 | |||
| 2871 | Ga0495640_0085863 | |||
| 2872 | Ga0495640_0433249 | |||
| 2873 | Ga0495640_0583376 | |||
| 2874 | Ga0495586_0133604 | |||
| 2875 | Ga0495587_0066973 | |||
| 2876 | Ga0495587_0072064 | |||
| 2877 | Ga0495587_0292904 | |||
| 2878 | Ga0495587_0373681 | |||
| 2879 | Ga0495645_0022167 | |||
| 2880 | Ga0495645_0035649 | |||
| 2881 | Ga0495645_0071844 | |||
| 2882 | Ga0495645_0096994 | |||
| 2883 | Ga0495645_0170135 | |||
| 2884 | Ga0495645_0171349 | |||
| 2885 | Ga0495645_0210936 | |||
| 2886 | Ga0495645_0239024 | |||
| 2887 | Ga0495667_0024521 | |||
| 2888 | Ga0495667_0052413 | |||
| 2889 | Ga0495667_0069290 | |||
| 2890 | Ga0495667_0080351 | |||
| 2891 | Ga0495667_0249252 | |||
| 2892 | Ga0495668_0097647 | |||
| 2893 | Ga0495634_0029185 | |||
| 2894 | Ga0495634_0093797 | |||
| 2895 | Ga0495635_0033329 | |||
| 2896 | Ga0495635_0073100 | |||
| 2897 | Ga0495635_0128451 | |||
| 2898 | Ga0495635_0380479 | |||
| 2899 | Ga0495635_0429997 | |||
| 2900 | Ga0495635_0539678 | |||
| 2901 | Ga0495635_0540406 | |||
| 2902 | Ga0495588_0051739 | |||
| 2903 | Ga0495657_0338759 | |||
| 2904 | Ga0495657_0361939 | |||
| 2905 | Ga0495657_0417701 | |||
| 2906 | Ga0495657_0733268 | |||
| 2907 | Ga0495599_0223933 | |||
| 2908 | Ga0495599_0358715 | |||
| 2909 | Ga0495599_0367222 | |||
| 2910 | Ga0495623_0030436 | |||
| 2911 | Ga0495623_0049156 | |||
| 2912 | Ga0495623_0053782 | |||
| 2913 | Ga0495623_0053948 | |||
| 2914 | Ga0495623_0092747 | |||
| 2915 | Ga0495623_0157856 | |||
| 2916 | Ga0495646_0216913 | |||
| 2917 | Ga0495646_0472851 | |||
| 2918 | Ga0495658_0148169 | |||
| 2919 | Ga0495658_0293942 | |||
| 2920 | Ga0495669_0093846 | |||
| 2921 | Ga0495669_0096014 | |||
| 2922 | Ga0495669_0235678 | |||
| 2923 | Ga0495613_0129225 | |||
| 2924 | Ga0495613_0219233 | |||
| 2925 | Ga0495613_0252098 | |||
| 2926 | Ga0495624_0079166 | |||
| 2927 | Ga0495624_0207276 | |||
| 2928 | Ga0495624_0482240 | |||
| 2929 | Ga0495600_0105863 | |||
| 2930 | Ga0495600_0209420 | |||
| 2931 | Ga0495581_0346156 | |||
| 2932 | Ga0495581_0448424 | |||
| 2933 | Ga0495604_0028727 | |||
| 2934 | Ga0495604_0223775 | |||
| 2935 | Ga0495604_0315374 | |||
| 2936 | Ga0495604_0328327 | |||
| 2937 | Ga0495604_0378280 | |||
| 2938 | Ga0495604_0463835 | |||
| 2939 | Ga0495674_0018563 | |||
| 2940 | Ga0495674_0049400 | |||
| 2941 | Ga0495674_0053968 | |||
| 2942 | Ga0495674_0076241 | |||
| 2943 | Ga0495674_0214478 | |||
| 2944 | Ga0495674_0299726 | |||
| 2945 | Ga0495674_0334738 | |||
| 2946 | Ga0495674_0578558 | |||
| 2947 | Ga0495676_0152757 | |||
| 2948 | Ga0495675_0015725 | |||
| 2949 | Ga0495675_0034121 | |||
| 2950 | Ga0495675_0116060 | |||
| 2951 | Ga0495675_0128649 | |||
| 2952 | Ga0495675_0204648 | |||
| 2953 | Ga0495675_0208231 | |||
| 2954 | Ga0495675_0383412 | |||
| 2955 | Ga0495675_0414371 | |||
| 2956 | Ga0495675_0760431 | |||
| 2957 | Ga0495677_0034216 | |||
| 2958 | Ga0495684_0016103 | |||
| 2959 | Ga0495684_0054549 | |||
| 2960 | Ga0495684_0083283 | |||
| 2961 | Ga0495684_0112561 | |||
| 2962 | Ga0495684_0220029 | |||
| 2963 | Ga0495684_0460381 | |||
| 2964 | Ga0495593_0018737 | |||
| 2965 | Ga0495593_0050171 | |||
| 2966 | Ga0495602_0087286 | |||
| 2967 | Ga0495602_0104306 | |||
| 2968 | Ga0495602_0185006 | |||
| 2969 | Ga0495602_0233374 | |||
| 2970 | Ga0495602_0310671 | |||
| 2971 | Ga0495602_0496241 | |||
| 2972 | Ga0495602_0630559 | |||
| 2973 | Ga0495614_0111573 | |||
| 2974 | Ga0495614_0339422 | |||
| 2975 | Ga0496100_0090533 | |||
| 2976 | Ga0496100_0121910 | |||
| 2977 | Ga0496100_0172721 | |||
| 2978 | Ga0496100_0208629 | |||
| 2979 | Ga0496100_0335090 | |||
| 2980 | Ga0496100_0495284 | |||
| 2981 | Ga0496101_0032991 | |||
| 2982 | Ga0496101_0120052 | |||
| 2983 | Ga0496101_0275424 | |||
| 2984 | Ga0496101_0390554 | |||
| 2985 | Ga0496101_0650150 | |||
| 2986 | Ga0496102_0020175 | |||
| 2987 | Ga0496102_0089212 | |||
| 2988 | Ga0496102_0152540 | |||
| 2989 | Ga0496102_0203032 | |||
| 2990 | Ga0496102_0335279 | |||
| 2991 | Ga0496102_0503319 | |||
| 2992 | Ga0496102_0611992 | |||
| 2993 | Ga0496103_0022488 | |||
| 2994 | Ga0496103_0032022 | |||
| 2995 | Ga0496103_0061583 | |||
| 2996 | Ga0496103_0616247 | |||
| 2997 | Ga0496104_0003663 | |||
| 2998 | Ga0496104_0017687 | |||
| 2999 | Ga0496104_0093755 | |||
| 3000 | Ga0496104_0209709 | |||
| 3001 | Ga0496104_0325362 | |||
| 3002 | Ga0496104_0338449 | |||
| 3003 | Ga0496104_0777467 | |||
| 3004 | Ga0496105_0008105 | |||
| 3005 | Ga0496105_0040114 | |||
| 3006 | Ga0496105_0603685 | |||
| 3007 | Ga0496105_0666460 | |||
| 3008 | Ga0496106_0034342 | |||
| 3009 | Ga0496106_0063470 | |||
| 3010 | Ga0496106_0641193 | |||
| 3011 | Ga0496107_0223273 | |||
| 3012 | Ga0496108_0000106 | |||
| 3013 | Ga0496108_0216047 | |||
| 3014 | Ga0496109_0000133 | |||
| 3015 | Ga0496109_0167149 | |||
| 3016 | Ga0496109_0332953 | |||
| 3017 | Ga0496109_0370111 | |||
| 3018 | Ga0496109_1041215 | |||
| 3019 | Ga0496110_0002218 | |||
| 3020 | Ga0496110_0186389 | |||
| 3021 | Ga0496110_0890889 | |||
| 3022 | Ga0496111_0004591 | |||
| 3023 | Ga0496112_0000028 | |||
| 3024 | Ga0496112_0014386 | |||
| 3025 | Ga0496112_0030600 | |||
| 3026 | Ga0496112_0043741 | |||
| 3027 | Ga0496112_0055340 | |||
| 3028 | Ga0496112_0099017 | |||
| 3029 | Ga0496112_0162289 | |||
| 3030 | Ga0496112_0217038 | |||
| 3031 | Ga0496112_0331081 | |||
| 3032 | Ga0496112_0368375 | |||
| 3033 | Ga0496112_1137669 | |||
| 3034 | Ga0496112_1320429 | |||
| 3035 | Ga0496113_0000179 | |||
| 3036 | Ga0496113_0013416 | |||
| 3037 | Ga0496113_0091882 | |||
| 3038 | Ga0496113_0326988 | |||
| 3039 | Ga0496114_0062374 | |||
| 3040 | Ga0496115_0030865 | |||
| 3041 | Ga0496115_1078642 | |||
| 3042 | Ga0501292_039726 | |||
| 3043 | Ga0501299_013919 | |||
| 3044 | Ga0501073_0087107 | |||
| 3045 | Ga0501216_060176 | |||
| 3046 | Ga0501217_115749 | |||
| 3047 | Ga0501261_021495 | |||
| 3048 | Ga0501221_038951 | |||
| 3049 | Ga0501225_0030165 | |||
| 3050 | Ga0501083_0114773 | |||
| 3051 | Ga0501268_083469 | |||
| 3052 | nmdc:mga05p37_668048_c1 | |||
| 3053 | nmdc:mga05p37_887748_c1 | |||
| 3054 | nmdc:mga08y16_962509_c1 | |||
| 3055 | nmdc:mga0n895_1051089_c1 | |||
| 3056 | nmdc:mga0n895_123435_c1 | |||
| 3057 | nmdc:mga0n895_1547_c1 | |||
| 3058 | nmdc:mga0n895_4579_c1 | |||
| 3059 | nmdc:mga0rr50_16895_c1 | |||
| 3060 | nmdc:mga0rr50_433943_c1 | |||
| 3061 | nmdc:mga08x19_14306_c1 | |||
| 3062 | nmdc:mga08x19_178361_c1 | |||
| 3063 | nmdc:mga08x19_191779_c1 | |||
| 3064 | nmdc:mga08x19_2368_c1 | |||
| 3065 | nmdc:mga08x19_27172_c1 | |||
| 3066 | nmdc:mga08x19_6108_c1 | |||
| 3067 | nmdc:mga08x19_761213_c1 | |||
| 3068 | nmdc:mga08x19_7696_c1 | |||
| 3069 | nmdc:mga0a205_806225_c1 | |||
| 3070 | nmdc:mga0a205_947_c1 | |||
| 3071 | Ga0495601_0217699 | |||
| 3072 | Ga0495619_0064914 | |||
| 3073 | Ga0495619_0596418 | |||
| 3074 | Ga0495619_0597208 | |||
| 3075 | Ga0495619_0615705 | |||
| 3076 | Ga0495619_0899215 | |||
| 3077 | Ga0500590_059292 | |||
| 3078 | Ga0501084_0080902 | |||
| 3079 | Ga0501082_0002389 | |||
| 3080 | Ga0501082_0129551 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ws1-assembly1.cif.gz_A | structure analysis of peptide deformylase from bacillus cereus | 0.9698 | 1 | 149 |
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.9597 | 1 | 149 |
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9477 | 2 | 160 |
| 6jf5-assembly1.cif.gz_A | k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii | 0.9464 | 1 | 146 |
| 3k6l-assembly1.cif.gz_A | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9444 | 1 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9698 | 1 | 149 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9595 | 1 | 149 | 3.90.45.10 |
| af_A0A0R0ELH1_60_189_3.90.45.10 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9543 | 3 | 105 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9404 | 1 | 149 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9322 | 1 | 149 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G7GEZ1-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9971 | 1 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2V9AZN5-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9965 | 2 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2V9T8P9-F1-model_v4 | Peptide deformylase | 0.9961 | 72 | 169 |
GO:0042586
GO:0043686 GO:0046872 |
| AF-A0A2W0B433-F1-model_v4 | Peptide deformylase | 0.9951 | 25 | 169 |
GO:0042586
GO:0043686 |
| AF-A0A7D8BBN9-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9944 | 1 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |