F494652

General Info

Members Datasets Scaffolds Average Seq Length
1540 367 3080 170

Family's Representative Sequence

Representative Sequence 3300024225|Ga0224572_1037013|Ga0224572_10370132
Length 172
Sequence MIYPIVKFGNPVLEKPAEPVTVFDDELKKLVEDMFESMYEAHGVGLAAPQIGISQRLAVIDVTFKEDPDAKLVLANPEILHTEGKHTQPEGCLSIPEFREPVSRARKVTIRAQDVNGKWYEKTTKEGEELLARAFLHETEHLNGKLYISHISALKRDLMKRKIRKLMKAGEW

Samples

Sample ID Description Type Environment
1 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
133 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
134 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
202 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
203 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
212 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
268 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
269 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
270 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
271 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
272 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
348 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
351 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
352 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
353 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
354 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.06
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 18.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224572_1037013 3300024225 Unclassified 923
2 MBSR1b_contig_11819402 2162886012 Unclassified 1532
3 LJNas_1001454 3300000546 Bacteria 3381
4 JGI24034J26672_10005869 3300002239 Unclassified 1766
5 JGI24751J29686_10014259 3300002459 Unclassified 1641
6 Ga0065712_10152185 3300005290 Unclassified 1361
7 Ga0065712_10173172 3300005290 Unclassified 1232
8 Ga0065715_10037980 3300005293 Unclassified 1581
9 Ga0065715_10103000 3300005293 Bacteria 3068
10 Ga0065715_10178575 3300005293 Unclassified 1493
11 Ga0070658_10005929 3300005327 Bacteria 9915
12 Ga0070658_10418706 3300005327 Unclassified 1152
13 Ga0070658_10701949 3300005327 Bacteria 878
14 Ga0070676_10016811 3300005328 Bacteria 4044
15 Ga0070676_10151440 3300005328 Bacteria 1485
16 Ga0070683_100000035 3300005329 Bacteria 122362
17 Ga0070683_100012627 3300005329 Bacteria 7342
18 Ga0070683_100026713 3300005329 Bacteria 5202
19 Ga0070683_100290670 3300005329 Bacteria 1554
20 Ga0070683_100546070 3300005329 Bacteria 1108
21 Ga0070683_100554868 3300005329 Unclassified 1098
22 Ga0070690_100224183 3300005330 Bacteria 1318
23 Ga0070690_100585602 3300005330 Bacteria 845
24 Ga0070670_100005429 3300005331 Bacteria 10749
25 Ga0070670_100016074 3300005331 Bacteria 6423
26 Ga0070670_100035001 3300005331 Unclassified 4323
27 Ga0068869_100009378 3300005334 Bacteria 6350
28 Ga0068869_100012141 3300005334 Bacteria 5680
29 Ga0068869_100013081 3300005334 Bacteria 5508
30 Ga0068869_101315843 3300005334 Bacteria 638
31 Ga0070666_10008702 3300005335 Bacteria 6312
32 Ga0070666_10104046 3300005335 Bacteria 1959
33 Ga0070680_100135893 3300005336 Bacteria 2060
34 Ga0070680_100443266 3300005336 Bacteria 1109
35 Ga0070682_100011890 3300005337 Bacteria 4980
36 Ga0070682_100025124 3300005337 Unclassified 3553
37 Ga0070682_100383356 3300005337 Bacteria 1058
38 Ga0068868_100002728 3300005338 Bacteria 12233
39 Ga0068868_100002835 3300005338 Bacteria 12010
40 Ga0068868_100022051 3300005338 Bacteria 4802
41 Ga0068868_100036034 3300005338 Bacteria 3827
42 Ga0068868_100125206 3300005338 Bacteria 2099
43 Ga0068868_100155671 3300005338 Unclassified 1885
44 Ga0068868_101028202 3300005338 Bacteria 755
45 Ga0070660_100009702 3300005339 Bacteria 6782
46 Ga0070660_100614258 3300005339 Unclassified 909
47 Ga0070689_100068871 3300005340 Bacteria 2760
48 Ga0070689_100069133 3300005340 Unclassified 2755
49 Ga0070689_100185672 3300005340 Bacteria 1691
50 Ga0070691_10054356 3300005341 Unclassified 1917
51 Ga0070661_100007203 3300005344 Bacteria 7664
52 Ga0070661_100025417 3300005344 Bacteria 4255
53 Ga0070692_10077057 3300005345 Unclassified 1788
54 Ga0070692_10099137 3300005345 Unclassified 1595
55 Ga0070668_100002226 3300005347 Bacteria 14253
56 Ga0070668_100007587 3300005347 Bacteria 8054
57 Ga0070668_100465366 3300005347 Bacteria 1089
58 Ga0070669_100005043 3300005353 Bacteria 9542
59 Ga0070669_100049122 3300005353 Bacteria 3080
60 Ga0070675_100047761 3300005354 Bacteria 3508
61 Ga0070675_100155371 3300005354 Unclassified 1964
62 Ga0070675_100732877 3300005354 Bacteria 901
63 Ga0070675_100737801 3300005354 Unclassified 898
64 Ga0070675_100953992 3300005354 Bacteria 787
65 Ga0070675_100962791 3300005354 Bacteria 783
66 Ga0070675_101060470 3300005354 Bacteria 745
67 Ga0070671_100976174 3300005355 Unclassified 742
68 Ga0070671_101066372 3300005355 Bacteria 709
69 Ga0070674_100221991 3300005356 Unclassified 1470
70 Ga0070674_100462311 3300005356 Unclassified 1050
71 Ga0070674_101026534 3300005356 Bacteria 725
72 Ga0070673_100062580 3300005364 Unclassified 2957
73 Ga0070673_100665248 3300005364 Bacteria 954
74 Ga0070673_101074723 3300005364 Bacteria 751
75 Ga0070688_100013826 3300005365 Unclassified 4564
76 Ga0070688_100357010 3300005365 Bacteria 1071
77 Ga0070659_100001203 3300005366 Bacteria 18844
78 Ga0070659_100080397 3300005366 Bacteria 2602
79 Ga0070667_100116848 3300005367 Bacteria 2317
80 Ga0070709_10018837 3300005434 Bacteria 3983
81 Ga0070709_10020338 3300005434 Bacteria 3849
82 Ga0070709_10031911 3300005434 Bacteria 3173
83 Ga0070709_10040735 3300005434 Bacteria 2858
84 Ga0070709_10065352 3300005434 Bacteria 2329
85 Ga0070709_10087970 3300005434 Unclassified 2042
86 Ga0070709_10119214 3300005434 Bacteria 1786
87 Ga0070709_10162923 3300005434 Bacteria 1552
88 Ga0070709_10176908 3300005434 Bacteria 1495
89 Ga0070709_10206445 3300005434 Bacteria 1394
90 Ga0070709_10276903 3300005434 Bacteria 1218
91 Ga0070709_10472435 3300005434 Bacteria 948
92 Ga0070709_10751656 3300005434 Bacteria 762
93 Ga0070714_100000169 3300005435 Bacteria 52788
94 Ga0070714_100008519 3300005435 Bacteria 8016
95 Ga0070714_100020608 3300005435 Bacteria 5388
96 Ga0070714_100059174 3300005435 Bacteria 3284
97 Ga0070714_100072893 3300005435 Bacteria 2974
98 Ga0070714_100149551 3300005435 Bacteria 2103
99 Ga0070714_100174919 3300005435 Bacteria 1950
100 Ga0070714_100180387 3300005435 Bacteria 1921
101 Ga0070714_100214185 3300005435 Bacteria 1767
102 Ga0070714_100285751 3300005435 Bacteria 1534
103 Ga0070714_100299439 3300005435 Bacteria 1499
104 Ga0070714_100335812 3300005435 Bacteria 1416
105 Ga0070714_100350431 3300005435 Bacteria 1386
106 Ga0070714_100633047 3300005435 Unclassified 1029
107 Ga0070714_100832475 3300005435 Unclassified 894
108 Ga0070713_100000649 3300005436 Bacteria 22243
109 Ga0070713_100002519 3300005436 Bacteria 11974
110 Ga0070713_100005251 3300005436 Bacteria 8830
111 Ga0070713_100012465 3300005436 Bacteria 6237
112 Ga0070713_100020997 3300005436 Bacteria 5014
113 Ga0070713_100061733 3300005436 Bacteria 3136
114 Ga0070713_100068860 3300005436 Bacteria 2983
115 Ga0070713_100084009 3300005436 Unclassified 2723
116 Ga0070713_100086586 3300005436 Unclassified 2686
117 Ga0070713_100101904 3300005436 Bacteria 2488
118 Ga0070713_100136863 3300005436 Bacteria 2165
119 Ga0070713_100228716 3300005436 Bacteria 1690
120 Ga0070713_100272077 3300005436 Bacteria 1551
121 Ga0070713_100308576 3300005436 Bacteria 1458
122 Ga0070713_100425658 3300005436 Bacteria 1243
123 Ga0070713_100551494 3300005436 Bacteria 1091
124 Ga0070713_100559448 3300005436 Bacteria 1083
125 Ga0070713_100652762 3300005436 Bacteria 1002
126 Ga0070713_101459694 3300005436 Bacteria 664
127 Ga0070713_101687081 3300005436 Unclassified 615
128 Ga0070713_101754075 3300005436 Bacteria 602
129 Ga0070710_10027644 3300005437 Bacteria 3027
130 Ga0070710_10035124 3300005437 Unclassified 2732
131 Ga0070710_10069378 3300005437 Bacteria 2028
132 Ga0070710_10073573 3300005437 Bacteria 1976
133 Ga0070710_10082954 3300005437 Unclassified 1875
134 Ga0070710_10416500 3300005437 Bacteria 904
135 Ga0070711_100000293 3300005439 Bacteria 26001
136 Ga0070711_100001830 3300005439 Bacteria 11867
137 Ga0070711_100007650 3300005439 Bacteria 6580
138 Ga0070711_100054373 3300005439 Bacteria 2763
139 Ga0070711_100060645 3300005439 Bacteria 2630
140 Ga0070711_100065489 3300005439 Bacteria 2542
141 Ga0070711_100104622 3300005439 Bacteria 2065
142 Ga0070711_100283720 3300005439 Bacteria 1311
143 Ga0070711_100933380 3300005439 Bacteria 742
144 Ga0070711_101500636 3300005439 Unclassified 588
145 Ga0070705_100038418 3300005440 Unclassified 2708
146 Ga0070705_100107033 3300005440 Bacteria 1779
147 Ga0070705_100194634 3300005440 Bacteria 1385
148 Ga0070700_100366056 3300005441 Bacteria 1073
149 Ga0070694_100530115 3300005444 Bacteria 941
150 Ga0070708_100000242 3300005445 Bacteria 40613
151 Ga0070708_100001715 3300005445 Bacteria 16862
152 Ga0070708_100003584 3300005445 Bacteria 12182
153 Ga0070708_100006436 3300005445 Bacteria 9353
154 Ga0070708_100020572 3300005445 Bacteria 5568
155 Ga0070708_100086330 3300005445 Bacteria 2850
156 Ga0070663_100043712 3300005455 Bacteria 3154
157 Ga0070678_100071377 3300005456 Bacteria 2599
158 Ga0070678_100188708 3300005456 Bacteria 1693
159 Ga0070662_100004575 3300005457 Bacteria 8759
160 Ga0070662_100011008 3300005457 Bacteria 5959
161 Ga0070662_100268491 3300005457 Unclassified 1377
162 Ga0070662_100646416 3300005457 Bacteria 892
163 Ga0070681_10008506 3300005458 Bacteria 10048
164 Ga0070681_10012341 3300005458 Bacteria 8472
165 Ga0070681_10073861 3300005458 Bacteria 3372
166 Ga0070681_10074017 3300005458 Unclassified 3368
167 Ga0070681_10082353 3300005458 Bacteria 3173
168 Ga0070681_10155758 3300005458 Bacteria 2210
169 Ga0070681_10518012 3300005458 Bacteria 1106
170 Ga0070681_10654872 3300005458 Unclassified 965
171 Ga0068867_100001484 3300005459 Bacteria 16236
172 Ga0068867_100013571 3300005459 Bacteria 5769
173 Ga0068867_100024102 3300005459 Bacteria 4361
174 Ga0070685_10031930 3300005466 Bacteria 2946
175 Ga0070706_100001331 3300005467 Bacteria 26271
176 Ga0070706_100001385 3300005467 Bacteria 25705
177 Ga0070706_100002503 3300005467 Bacteria 18507
178 Ga0070706_100013794 3300005467 Bacteria 7474
179 Ga0070706_100044511 3300005467 Bacteria 4101
180 Ga0070706_100233521 3300005467 Unclassified 1717
181 Ga0070706_100280770 3300005467 Bacteria 1554
182 Ga0070707_100002130 3300005468 Bacteria 18942
183 Ga0070707_100002318 3300005468 Bacteria 18176
184 Ga0070707_100012306 3300005468 Bacteria 7988
185 Ga0070707_100137336 3300005468 Bacteria 2378
186 Ga0070707_100384795 3300005468 Bacteria 1363
187 Ga0070707_100400753 3300005468 Bacteria 1332
188 Ga0070698_100000589 3300005471 Bacteria 39008
189 Ga0070698_100000689 3300005471 Bacteria 36131
190 Ga0070698_100040140 3300005471 Bacteria 4813
191 Ga0070699_100000679 3300005518 Bacteria 31766
192 Ga0070699_100000716 3300005518 Bacteria 30815
193 Ga0070699_100025935 3300005518 Bacteria 5054
194 Ga0070699_100027280 3300005518 Bacteria 4928
195 Ga0070699_100639241 3300005518 Bacteria 971
196 Ga0070679_100074471 3300005530 Bacteria 3386
197 Ga0070679_100159877 3300005530 Bacteria 2227
198 Ga0070679_100398877 3300005530 Bacteria 1321
199 Ga0070679_100736401 3300005530 Unclassified 929
200 Ga0070679_101177436 3300005530 Bacteria 711
201 Ga0070684_100000037 3300005535 Bacteria 95058
202 Ga0070684_100083944 3300005535 Bacteria 2823
203 Ga0070684_100086086 3300005535 Bacteria 2788
204 Ga0070684_100128722 3300005535 Bacteria 2283
205 Ga0070684_100401329 3300005535 Unclassified 1264
206 Ga0070697_100000053 3300005536 Bacteria 88025
207 Ga0070697_100000280 3300005536 Bacteria 41171
208 Ga0070697_100000694 3300005536 Bacteria 25190
209 Ga0070697_100001256 3300005536 Bacteria 19162
210 Ga0070697_100013559 3300005536 Bacteria 6393
211 Ga0070697_100018478 3300005536 Bacteria 5496
212 Ga0070697_100111046 3300005536 Bacteria 2285
213 Ga0070697_100414907 3300005536 Bacteria 1169
214 Ga0070697_100430598 3300005536 Bacteria 1147
215 Ga0070697_101383730 3300005536 Unclassified 628
216 Ga0068853_100004040 3300005539 Bacteria 11293
217 Ga0070672_100003042 3300005543 Bacteria 10803
218 Ga0070672_100366589 3300005543 Bacteria 1230
219 Ga0070672_100462223 3300005543 Bacteria 1094
220 Ga0070686_100008692 3300005544 Bacteria 5690
221 Ga0070695_100032361 3300005545 Unclassified 3269
222 Ga0070695_100088098 3300005545 Bacteria 2066
223 Ga0070695_100192023 3300005545 Unclassified 1454
224 Ga0070696_100142696 3300005546 Bacteria 1752
225 Ga0070696_100164097 3300005546 Bacteria 1638
226 Ga0070696_100196285 3300005546 Bacteria 1504
227 Ga0070696_100441270 3300005546 Bacteria 1025
228 Ga0070693_100004450 3300005547 Bacteria 6626
229 Ga0070693_100034556 3300005547 Bacteria 2798
230 Ga0070693_100261979 3300005547 Unclassified 1150
231 Ga0070693_100702313 3300005547 Bacteria 741
232 Ga0070693_101079393 3300005547 Bacteria 611
233 Ga0070665_100023323 3300005548 Bacteria 6229
234 Ga0070704_100120474 3300005549 Bacteria 2015
235 Ga0068855_100010022 3300005563 Bacteria 11420
236 Ga0068855_100011722 3300005563 Bacteria 10595
237 Ga0068855_100012992 3300005563 Bacteria 10049
238 Ga0068855_100074528 3300005563 Bacteria 3941
239 Ga0068855_100080699 3300005563 Unclassified 3772
240 Ga0068855_100151046 3300005563 Bacteria 2641
241 Ga0068855_100248520 3300005563 Unclassified 1984
242 Ga0068855_100347599 3300005563 Bacteria 1634
243 Ga0068855_100449358 3300005563 Unclassified 1406
244 Ga0068855_100487674 3300005563 Bacteria 1341
245 Ga0068855_100972414 3300005563 Unclassified 893
246 Ga0070664_100000972 3300005564 Bacteria 22427
247 Ga0070664_100008272 3300005564 Bacteria 8414
248 Ga0070664_100019355 3300005564 Bacteria 5602
249 Ga0068857_100000259 3300005577 Bacteria 35729
250 Ga0068857_100000335 3300005577 Bacteria 32411
251 Ga0068857_100199313 3300005577 Unclassified 1825
252 Ga0068857_100314612 3300005577 Bacteria 1445
253 Ga0068857_100475411 3300005577 Bacteria 1171
254 Ga0068857_100580462 3300005577 Bacteria 1058
255 Ga0068857_100995258 3300005577 Bacteria 807
256 Ga0068854_100011053 3300005578 Bacteria 5860
257 Ga0068854_100023615 3300005578 Bacteria 4202
258 Ga0068854_100028231 3300005578 Unclassified 3875
259 Ga0068854_100033635 3300005578 Unclassified 3575
260 Ga0068854_100096525 3300005578 Unclassified 2209
261 Ga0068856_100000995 3300005614 Bacteria 30196
262 Ga0068856_100002426 3300005614 Bacteria 19184
263 Ga0068856_100003097 3300005614 Bacteria 16972
264 Ga0068856_100005963 3300005614 Bacteria 11992
265 Ga0068856_100006696 3300005614 Bacteria 11296
266 Ga0068856_100023013 3300005614 Bacteria 6058
267 Ga0068856_100035413 3300005614 Bacteria 4892
268 Ga0068856_100387787 3300005614 Bacteria 1417
269 Ga0068856_100551276 3300005614 Unclassified 1174
270 Ga0068856_100634798 3300005614 Bacteria 1089
271 Ga0068856_100646876 3300005614 Unclassified 1078
272 Ga0068856_100907641 3300005614 Bacteria 900
273 Ga0068856_102109757 3300005614 Bacteria 573
274 Ga0070702_100000387 3300005615 Bacteria 15639
275 Ga0070702_100070013 3300005615 Bacteria 2069
276 Ga0070702_100267006 3300005615 Bacteria 1168
277 Ga0068852_100009501 3300005616 Bacteria 7227
278 Ga0068852_100050228 3300005616 Bacteria 3572
279 Ga0068852_100145329 3300005616 Bacteria 2199
280 Ga0068852_100206105 3300005616 Bacteria 1863
281 Ga0068852_101254597 3300005616 Bacteria 762
282 Ga0068859_100014831 3300005617 Bacteria 7825
283 Ga0068859_100015248 3300005617 Bacteria 7717
284 Ga0068859_100094432 3300005617 Unclassified 3043
285 Ga0068859_100253500 3300005617 Bacteria 1850
286 Ga0068859_100298463 3300005617 Unclassified 1704
287 Ga0068859_100344748 3300005617 Bacteria 1584
288 Ga0068859_101027082 3300005617 Bacteria 906
289 Ga0068864_100003998 3300005618 Bacteria 12141
290 Ga0068864_100034805 3300005618 Bacteria 4286
291 Ga0068866_10000735 3300005718 Bacteria 14853
292 Ga0068866_10003232 3300005718 Bacteria 6714
293 Ga0068866_10008403 3300005718 Bacteria 4351
294 Ga0068866_10036584 3300005718 Bacteria 2406
295 Ga0068866_10044217 3300005718 Bacteria 2227
296 Ga0068866_10367819 3300005718 Unclassified 918
297 Ga0068861_100013572 3300005719 Bacteria 5702
298 Ga0068861_100086221 3300005719 Unclassified 2468
299 Ga0068861_100242727 3300005719 Bacteria 1533
300 Ga0068851_10004069 3300005834 Bacteria 6566
301 Ga0068851_10006547 3300005834 Bacteria 5322
302 Ga0068851_10010242 3300005834 Unclassified 4372
303 Ga0068851_10099054 3300005834 Bacteria 1544
304 Ga0068870_10026876 3300005840 Bacteria 2873
305 Ga0068870_10319471 3300005840 Bacteria 986
306 Ga0068863_100031255 3300005841 Bacteria 5083
307 Ga0068863_100058799 3300005841 Unclassified 3638
308 Ga0068863_100085787 3300005841 Unclassified 2983
309 Ga0068863_100301358 3300005841 Bacteria 1555
310 Ga0068863_100338804 3300005841 Unclassified 1463
311 Ga0068863_101176067 3300005841 Bacteria 772
312 Ga0068858_100000404 3300005842 Bacteria 44997
313 Ga0068858_100004032 3300005842 Bacteria 14492
314 Ga0068858_100274148 3300005842 Bacteria 1606
315 Ga0068858_100473751 3300005842 Bacteria 1208
316 Ga0068860_100012091 3300005843 Bacteria 8501
317 Ga0068860_100038625 3300005843 Unclassified 4567
318 Ga0068860_100405138 3300005843 Bacteria 1350
319 Ga0068862_100151271 3300005844 Bacteria 2066
320 Ga0081540_1093264 3300005983 Bacteria 1319
321 Ga0070717_10001683 3300006028 Bacteria 15379
322 Ga0070717_10004512 3300006028 Bacteria 10057
323 Ga0070717_10005108 3300006028 Bacteria 9573
324 Ga0070717_10005704 3300006028 Bacteria 9102
325 Ga0070717_10011319 3300006028 Bacteria 6771
326 Ga0070717_10032487 3300006028 Bacteria 4206
327 Ga0070717_10051470 3300006028 Unclassified 3390
328 Ga0070717_10064277 3300006028 Bacteria 3047
329 Ga0070717_10111341 3300006028 Unclassified 2336
330 Ga0070717_10148095 3300006028 Bacteria 2029
331 Ga0070717_10207105 3300006028 Bacteria 1720
332 Ga0070717_10221443 3300006028 Unclassified 1663
333 Ga0070717_10237926 3300006028 Bacteria 1605
334 Ga0070717_10255225 3300006028 Bacteria 1550
335 Ga0070717_10262381 3300006028 Bacteria 1528
336 Ga0070717_10315890 3300006028 Bacteria 1391
337 Ga0070717_10342052 3300006028 Bacteria 1336
338 Ga0070717_10423608 3300006028 Bacteria 1197
339 Ga0070717_10752709 3300006028 Unclassified 886
340 Ga0070717_11288950 3300006028 Bacteria 664
341 Ga0070717_11341997 3300006028 Bacteria 650
342 Ga0070715_10002128 3300006163 Bacteria 5989
343 Ga0070715_10013154 3300006163 Bacteria 3032
344 Ga0070715_10094090 3300006163 Bacteria 1385
345 Ga0070715_10099475 3300006163 Unclassified 1354
346 Ga0070715_10112816 3300006163 Bacteria 1285
347 Ga0070715_10178923 3300006163 Bacteria 1062
348 Ga0070715_10320858 3300006163 Bacteria 836
349 Ga0070715_10480664 3300006163 Unclassified 707
350 Ga0070715_10802027 3300006163 Unclassified 571
351 Ga0070716_100013165 3300006173 Bacteria 4212
352 Ga0070716_100015752 3300006173 Bacteria 3890
353 Ga0070716_100026282 3300006173 Unclassified 3116
354 Ga0070716_100034551 3300006173 Unclassified 2773
355 Ga0070716_100039117 3300006173 Bacteria 2630
356 Ga0070716_100155544 3300006173 Bacteria 1476
357 Ga0070716_100181495 3300006173 Bacteria 1382
358 Ga0070716_100215542 3300006173 Bacteria 1286
359 Ga0070716_100228980 3300006173 Bacteria 1253
360 Ga0070716_100252626 3300006173 Bacteria 1202
361 Ga0070716_100272120 3300006173 Bacteria 1164
362 Ga0070716_100319623 3300006173 Bacteria 1087
363 Ga0070716_100913697 3300006173 Bacteria 688
364 Ga0070712_100000188 3300006175 Bacteria 34294
365 Ga0070712_100000723 3300006175 Bacteria 19476
366 Ga0070712_100026038 3300006175 Bacteria 3892
367 Ga0070712_100026743 3300006175 Bacteria 3847
368 Ga0070712_100027377 3300006175 Bacteria 3807
369 Ga0070712_100027607 3300006175 Bacteria 3791
370 Ga0070712_100040986 3300006175 Unclassified 3177
371 Ga0070712_100072539 3300006175 Bacteria 2466
372 Ga0070712_100103103 3300006175 Bacteria 2114
373 Ga0070712_100260476 3300006175 Unclassified 1389
374 Ga0070712_100288502 3300006175 Bacteria 1324
375 Ga0070712_100496834 3300006175 Bacteria 1022
376 Ga0070712_100624568 3300006175 Unclassified 914
377 Ga0070712_101013852 3300006175 Bacteria 719
378 Ga0097621_100013631 3300006237 Bacteria 6066
379 Ga0097621_100024654 3300006237 Bacteria 4700
380 Ga0097621_100039766 3300006237 Bacteria 3779
381 Ga0097621_100076590 3300006237 Unclassified 2775
382 Ga0097621_100121598 3300006237 Bacteria 2214
383 Ga0097621_100139551 3300006237 Bacteria 2070
384 Ga0097621_100158187 3300006237 Bacteria 1946
385 Ga0097621_100459508 3300006237 Unclassified 1148
386 Ga0097621_100565154 3300006237 Unclassified 1036
387 Ga0097621_100567341 3300006237 Bacteria 1034
388 Ga0097621_101100404 3300006237 Unclassified 746
389 Ga0068871_100000389 3300006358 Bacteria 30917
390 Ga0068871_100007884 3300006358 Bacteria 7635
391 Ga0068871_100034094 3300006358 Bacteria 4037
392 Ga0068871_100043390 3300006358 Bacteria 3612
393 Ga0068871_100049645 3300006358 Bacteria 3392
394 Ga0068871_100049912 3300006358 Bacteria 3383
395 Ga0068871_100091844 3300006358 Bacteria 2531
396 Ga0068871_100314305 3300006358 Bacteria 1378
397 Ga0068871_100541172 3300006358 Bacteria 1054
398 Ga0075431_100508146 3300006847 Bacteria 1196
399 Ga0075433_10000636 3300006852 Bacteria 23485
400 Ga0075433_10777035 3300006852 Bacteria 837
401 Ga0075434_100001288 3300006871 Bacteria 20919
402 Ga0075434_100001829 3300006871 Bacteria 18360
403 Ga0075434_100035785 3300006871 Unclassified 4909
404 Ga0068865_100044263 3300006881 Bacteria 3046
405 Ga0068865_100235879 3300006881 Bacteria 1437
406 Ga0068865_100441121 3300006881 Unclassified 1074
407 Ga0075436_100003222 3300006914 Bacteria 11191
408 Ga0075436_100006615 3300006914 Bacteria 7943
409 Ga0075436_100007751 3300006914 Bacteria 7342
410 Ga0075436_100013183 3300006914 Bacteria 5668
411 Ga0075436_100046263 3300006914 Bacteria 3001
412 Ga0075436_100088486 3300006914 Bacteria 2151
413 Ga0075436_100139706 3300006914 Bacteria 1702
414 Ga0075436_100362595 3300006914 Bacteria 1046
415 Ga0075436_100448902 3300006914 Bacteria 939
416 Ga0075436_100526995 3300006914 Bacteria 866
417 Ga0097620_100014831 3300006931 Bacteria 7825
418 Ga0097620_100015253 3300006931 Bacteria 7717
419 Ga0097620_100094426 3300006931 Unclassified 3043
420 Ga0097620_100253503 3300006931 Bacteria 1850
421 Ga0097620_100298470 3300006931 Unclassified 1704
422 Ga0097620_100344743 3300006931 Bacteria 1584
423 Ga0097620_101026981 3300006931 Bacteria 906
424 Ga0097620_101680699 3300006931 Bacteria 701
425 Ga0075435_100002192 3300007076 Bacteria 12887
426 Ga0075435_100016802 3300007076 Bacteria 5522
427 Ga0075435_100101237 3300007076 Unclassified 2387
428 Ga0075435_100427608 3300007076 Bacteria 1141
429 Ga0075435_101252867 3300007076 Bacteria 649
430 Ga0099794_10044594 3300007265 Bacteria 2120
431 Ga0099794_10074135 3300007265 Bacteria 1671
432 Ga0099794_10402595 3300007265 Unclassified 715
433 Ga0099795_10030520 3300007788 Unclassified 1851
434 Ga0105240_10055750 3300009093 Bacteria 4948
435 Ga0105240_10061239 3300009093 Bacteria 4690
436 Ga0105240_10098841 3300009093 Bacteria 3553
437 Ga0105240_10147828 3300009093 Bacteria 2802
438 Ga0105240_10197359 3300009093 Bacteria 2361
439 Ga0105240_10205854 3300009093 Bacteria 2303
440 Ga0105240_10259198 3300009093 Bacteria 2007
441 Ga0105240_10519746 3300009093 Bacteria 1321
442 Ga0105240_10580303 3300009093 Bacteria 1237
443 Ga0105240_10581698 3300009093 Bacteria 1235
444 Ga0105240_10775099 3300009093 Bacteria 1041
445 Ga0105240_10819970 3300009093 Unclassified 1006
446 Ga0105240_11018321 3300009093 Bacteria 885
447 Ga0105240_11148092 3300009093 Bacteria 825
448 Ga0105240_11780744 3300009093 Bacteria 642
449 Ga0111539_10407355 3300009094 Bacteria 1584
450 Ga0111539_11498579 3300009094 Bacteria 782
451 Ga0105245_10003248 3300009098 Bacteria 14574
452 Ga0105245_10007752 3300009098 Bacteria 9401
453 Ga0105245_10007882 3300009098 Bacteria 9316
454 Ga0105245_10018174 3300009098 Bacteria 6148
455 Ga0105245_10052722 3300009098 Bacteria 3648
456 Ga0105245_10064552 3300009098 Bacteria 3309
457 Ga0105245_10093343 3300009098 Unclassified 2773
458 Ga0105245_10179724 3300009098 Bacteria 2020
459 Ga0105245_10423149 3300009098 Bacteria 1335
460 Ga0105245_10481162 3300009098 Bacteria 1255
461 Ga0105245_10778165 3300009098 Bacteria 994
462 Ga0105247_10001594 3300009101 Bacteria 16066
463 Ga0105247_10017504 3300009101 Bacteria 4299
464 Ga0114129_10061374 3300009147 Bacteria 5253
465 Ga0114129_10165885 3300009147 Bacteria 3014
466 Ga0105243_10626305 3300009148 Unclassified 1039
467 Ga0105243_11377270 3300009148 Bacteria 725
468 Ga0105241_10004558 3300009174 Bacteria 10250
469 Ga0105241_10024348 3300009174 Bacteria 4495
470 Ga0105241_10043109 3300009174 Bacteria 3416
471 Ga0105241_10049184 3300009174 Bacteria 3210
472 Ga0105241_10070311 3300009174 Bacteria 2716
473 Ga0105241_10094522 3300009174 Bacteria 2364
474 Ga0105241_10258229 3300009174 Bacteria 1480
475 Ga0105241_10397954 3300009174 Unclassified 1207
476 Ga0105241_10407320 3300009174 Bacteria 1194
477 Ga0105241_11769001 3300009174 Unclassified 602
478 Ga0105242_10006980 3300009176 Bacteria 8717
479 Ga0105242_10171301 3300009176 Bacteria 1908
480 Ga0105242_10274578 3300009176 Bacteria 1528
481 Ga0105242_10449797 3300009176 Unclassified 1214
482 Ga0105242_11373422 3300009176 Unclassified 733
483 Ga0105248_10011433 3300009177 Bacteria 9783
484 Ga0105248_10026687 3300009177 Bacteria 6422
485 Ga0105248_10086566 3300009177 Unclassified 3525
486 Ga0105248_10099247 3300009177 Bacteria 3281
487 Ga0105248_10283297 3300009177 Bacteria 1866
488 Ga0105248_10570011 3300009177 Bacteria 1277
489 Ga0105248_10872668 3300009177 Bacteria 1016
490 Ga0105237_10006364 3300009545 Bacteria 13118
491 Ga0105237_10013796 3300009545 Bacteria 8457
492 Ga0105237_10045567 3300009545 Bacteria 4412
493 Ga0105237_10072667 3300009545 Bacteria 3433
494 Ga0105237_10075837 3300009545 Bacteria 3353
495 Ga0105237_10216179 3300009545 Unclassified 1917
496 Ga0105237_10273158 3300009545 Bacteria 1693
497 Ga0105237_10285608 3300009545 Bacteria 1653
498 Ga0105237_10321170 3300009545 Unclassified 1552
499 Ga0105237_10410467 3300009545 Bacteria 1359
500 Ga0105237_10653280 3300009545 Bacteria 1058
501 Ga0105237_10691100 3300009545 Bacteria 1027
502 Ga0105237_10723015 3300009545 Unclassified 1002
503 Ga0105237_10899599 3300009545 Unclassified 892
504 Ga0105237_11092496 3300009545 Bacteria 804
505 Ga0105237_11725016 3300009545 Bacteria 634
506 Ga0105238_10025430 3300009551 Bacteria 6035
507 Ga0105238_10138524 3300009551 Unclassified 2411
508 Ga0105238_10157265 3300009551 Bacteria 2248
509 Ga0105238_10206998 3300009551 Bacteria 1938
510 Ga0105238_10235107 3300009551 Bacteria 1810
511 Ga0105238_10249507 3300009551 Bacteria 1753
512 Ga0105249_10041603 3300009553 Bacteria 4178
513 Ga0105249_10290290 3300009553 Bacteria 1637
514 Ga0105249_10308379 3300009553 Unclassified 1590
515 Ga0099796_10028145 3300010159 Bacteria 1801
516 Ga0105239_10003652 3300010375 Bacteria 18811
517 Ga0105239_10066583 3300010375 Bacteria 3957
518 Ga0105239_10070525 3300010375 Unclassified 3839
519 Ga0105239_10087659 3300010375 Bacteria 3431
520 Ga0105239_10095971 3300010375 Unclassified 3275
521 Ga0105239_10370397 3300010375 Bacteria 1619
522 Ga0105239_10713671 3300010375 Bacteria 1147
523 Ga0105239_11270780 3300010375 Bacteria 849
524 Ga0105239_12512498 3300010375 Unclassified 600
525 Ga0105246_10004431 3300011119 Bacteria 8546
526 Ga0105246_10251252 3300011119 Unclassified 1403
527 Ga0105246_10487443 3300011119 Bacteria 1044
528 Ga0105246_10726030 3300011119 Unclassified 873
529 Ga0105246_10810470 3300011119 Bacteria 831
530 Ga0157324_1004648 3300012506 Unclassified 959
531 Ga0157373_10002519 3300013100 Bacteria 13955
532 Ga0157373_10007083 3300013100 Bacteria 8360
533 Ga0157373_10030097 3300013100 Unclassified 3907
534 Ga0157373_10108259 3300013100 Bacteria 1954
535 Ga0157373_10116116 3300013100 Bacteria 1881
536 Ga0157373_10182073 3300013100 Bacteria 1479
537 Ga0157373_10338975 3300013100 Unclassified 1071
538 Ga0157373_10470852 3300013100 Bacteria 906
539 Ga0157371_10008414 3300013102 Bacteria 8219
540 Ga0157371_10009414 3300013102 Bacteria 7689
541 Ga0157371_10049901 3300013102 Bacteria 2972
542 Ga0157370_10045645 3300013104 Bacteria 4202
543 Ga0157370_10080214 3300013104 Bacteria 3072
544 Ga0157370_10108342 3300013104 Bacteria 2598
545 Ga0157370_10209613 3300013104 Unclassified 1806
546 Ga0157370_10294890 3300013104 Bacteria 1497
547 Ga0157370_10692587 3300013104 Bacteria 930
548 Ga0157369_10017191 3300013105 Bacteria 8127
549 Ga0157369_10060408 3300013105 Unclassified 4087
550 Ga0157369_10122971 3300013105 Bacteria 2753
551 Ga0157369_10127242 3300013105 Bacteria 2700
552 Ga0157369_10258603 3300013105 Bacteria 1816
553 Ga0157369_10363215 3300013105 Bacteria 1503
554 Ga0157369_10515747 3300013105 Bacteria 1237
555 Ga0157369_11047837 3300013105 Bacteria 834
556 Ga0157374_10000634 3300013296 Bacteria 30935
557 Ga0157374_10001978 3300013296 Bacteria 17189
558 Ga0157374_10002353 3300013296 Bacteria 15957
559 Ga0157374_10007704 3300013296 Bacteria 9195
560 Ga0157374_10020608 3300013296 Bacteria 5854
561 Ga0157374_10059771 3300013296 Unclassified 3565
562 Ga0157374_10113865 3300013296 Bacteria 2603
563 Ga0157374_10140007 3300013296 Unclassified 2348
564 Ga0157374_10392430 3300013296 Unclassified 1383
565 Ga0157374_10650860 3300013296 Bacteria 1066
566 Ga0157374_11987540 3300013296 Bacteria 608
567 Ga0157378_10000202 3300013297 Bacteria 58070
568 Ga0157378_10000725 3300013297 Bacteria 30797
569 Ga0157378_10001795 3300013297 Bacteria 19272
570 Ga0157378_10012660 3300013297 Bacteria 7380
571 Ga0157378_10072136 3300013297 Bacteria 3102
572 Ga0157378_10090402 3300013297 Bacteria 2782
573 Ga0157378_10340913 3300013297 Unclassified 1461
574 Ga0157378_10543179 3300013297 Bacteria 1166
575 Ga0157378_10717651 3300013297 Bacteria 1020
576 Ga0157378_10754322 3300013297 Unclassified 996
577 Ga0157378_11058524 3300013297 Bacteria 847
578 Ga0157378_11443155 3300013297 Bacteria 732
579 Ga0163162_10009643 3300013306 Bacteria 9392
580 Ga0163162_10040280 3300013306 Bacteria 4671
581 Ga0163162_10055031 3300013306 Bacteria 4004
582 Ga0163162_10070409 3300013306 Bacteria 3549
583 Ga0163162_10112681 3300013306 Unclassified 2819
584 Ga0163162_10152829 3300013306 Bacteria 2426
585 Ga0163162_10191003 3300013306 Bacteria 2176
586 Ga0163162_10314703 3300013306 Unclassified 1698
587 Ga0163162_10759984 3300013306 Bacteria 1088
588 Ga0163162_11004324 3300013306 Bacteria 943
589 Ga0163162_11046858 3300013306 Bacteria 923
590 Ga0163162_11072492 3300013306 Bacteria 912
591 Ga0163162_11162495 3300013306 Bacteria 875
592 Ga0163162_12053660 3300013306 Bacteria 655
593 Ga0157372_10000565 3300013307 Bacteria 40736
594 Ga0157372_10002050 3300013307 Bacteria 21927
595 Ga0157372_10003078 3300013307 Bacteria 17961
596 Ga0157372_10015430 3300013307 Bacteria 8187
597 Ga0157372_10016466 3300013307 Bacteria 7935
598 Ga0157372_10022661 3300013307 Bacteria 6798
599 Ga0157372_10030069 3300013307 Bacteria 5939
600 Ga0157372_10053833 3300013307 Bacteria 4487
601 Ga0157372_10054469 3300013307 Bacteria 4462
602 Ga0157372_10059528 3300013307 Bacteria 4272
603 Ga0157372_10188739 3300013307 Bacteria 2387
604 Ga0157372_10352323 3300013307 Bacteria 1715
605 Ga0157372_10390444 3300013307 Bacteria 1622
606 Ga0157372_11356269 3300013307 Bacteria 820
607 Ga0157375_10073401 3300013308 Bacteria 3440
608 Ga0157375_10248755 3300013308 Unclassified 1938
609 Ga0157375_10335458 3300013308 Unclassified 1677
610 Ga0157375_10657732 3300013308 Bacteria 1204
611 Ga0157375_11383542 3300013308 Bacteria 829
612 Ga0157375_11644918 3300013308 Bacteria 760
613 Ga0163163_10003044 3300014325 Bacteria 14194
614 Ga0163163_10040832 3300014325 Bacteria 4533
615 Ga0163163_10051769 3300014325 Bacteria 4048
616 Ga0163163_10192569 3300014325 Bacteria 2087
617 Ga0163163_10340898 3300014325 Unclassified 1554
618 Ga0163163_10445884 3300014325 Bacteria 1354
619 Ga0163163_10563764 3300014325 Bacteria 1202
620 Ga0163163_10937098 3300014325 Bacteria 929
621 Ga0163163_11393492 3300014325 Bacteria 763
622 Ga0163163_11597050 3300014325 Bacteria 713
623 Ga0157380_11681187 3300014326 Bacteria 692
624 Ga0182008_10004678 3300014497 Bacteria 7952
625 Ga0182008_10020896 3300014497 Unclassified 3368
626 Ga0182008_10158242 3300014497 Bacteria 1139
627 Ga0157377_10006706 3300014745 Bacteria 5512
628 Ga0157377_10327853 3300014745 Bacteria 1019
629 Ga0157377_10354088 3300014745 Bacteria 986
630 Ga0157377_11015507 3300014745 Bacteria 629
631 Ga0157379_10003409 3300014968 Bacteria 13441
632 Ga0157379_10034772 3300014968 Bacteria 4494
633 Ga0157379_10151447 3300014968 Bacteria 2092
634 Ga0157379_10171237 3300014968 Bacteria 1960
635 Ga0157379_10349408 3300014968 Bacteria 1353
636 Ga0157379_10656943 3300014968 Unclassified 982
637 Ga0157379_11279596 3300014968 Bacteria 708
638 Ga0157376_10004658 3300014969 Bacteria 9559
639 Ga0157376_10029519 3300014969 Bacteria 4368
640 Ga0157376_10069210 3300014969 Bacteria 2991
641 Ga0157376_10247471 3300014969 Bacteria 1663
642 Ga0157376_10292498 3300014969 Bacteria 1538
643 Ga0157376_10386907 3300014969 Bacteria 1349
644 Ga0157376_10564970 3300014969 Bacteria 1128
645 Ga0157376_11052914 3300014969 Bacteria 838
646 Ga0182007_10024426 3300015262 Bacteria 2114
647 Ga0182007_10227876 3300015262 Bacteria 661
648 Ga0182005_1003699 3300015265 Bacteria 5105
649 Ga0182005_1097660 3300015265 Bacteria 821
650 Ga0163161_10032069 3300017792 Bacteria 3748
651 Ga0163161_10733077 3300017792 Unclassified 825
652 Ga0213876_10246687 3300021384 Bacteria 949
653 Ga0213875_10004172 3300021388 Bacteria 7999
654 Ga0224712_10480315 3300022467 Bacteria 599
655 Ga0224570_100116 3300022730 Bacteria 5034
656 Ga0224569_100063 3300022732 Bacteria 6837
657 Ga0224569_103169 3300022732 Bacteria 1296
658 Ga0224571_100789 3300022734 Bacteria 1866
659 Ga0224572_1015389 3300024225 Bacteria 1464
660 Ga0224572_1018281 3300024225 Bacteria 1347
661 Ga0224572_1063119 3300024225 Bacteria 685
662 Ga0228598_1000002 3300024227 Bacteria 37716
663 Ga0228598_1000333 3300024227 Bacteria 9259
664 Ga0228598_1005227 3300024227 Bacteria 2724
665 Ga0207697_10014218 3300025315 Unclassified 3307
666 Ga0207656_10002371 3300025321 Bacteria 6326
667 Ga0207692_10024383 3300025898 Bacteria 2812
668 Ga0207692_10028069 3300025898 Bacteria 2657
669 Ga0207692_10062910 3300025898 Unclassified 1927
670 Ga0207692_10176892 3300025898 Unclassified 1241
671 Ga0207692_10200597 3300025898 Bacteria 1173
672 Ga0207692_10241162 3300025898 Bacteria 1080
673 Ga0207692_10598833 3300025898 Bacteria 708
674 Ga0207692_10683838 3300025898 Bacteria 665
675 Ga0207692_10867374 3300025898 Unclassified 593
676 Ga0207642_10004640 3300025899 Unclassified 4438
677 Ga0207642_10017427 3300025899 Bacteria 2731
678 Ga0207642_10029862 3300025899 Bacteria 2263
679 Ga0207642_10475266 3300025899 Bacteria 761
680 Ga0207710_10023501 3300025900 Bacteria 2649
681 Ga0207710_10097775 3300025900 Unclassified 1381
682 Ga0207710_10113691 3300025900 Bacteria 1287
683 Ga0207688_10055000 3300025901 Bacteria 2233
684 Ga0207680_10081689 3300025903 Bacteria 2032
685 Ga0207680_10236894 3300025903 Unclassified 1256
686 Ga0207680_10393459 3300025903 Bacteria 979
687 Ga0207647_10013732 3300025904 Bacteria 5608
688 Ga0207647_10017367 3300025904 Unclassified 4891
689 Ga0207647_10029904 3300025904 Bacteria 3519
690 Ga0207685_10008705 3300025905 Bacteria 2908
691 Ga0207685_10036045 3300025905 Bacteria 1810
692 Ga0207685_10090705 3300025905 Bacteria 1286
693 Ga0207685_10211595 3300025905 Unclassified 917
694 Ga0207685_10385944 3300025905 Bacteria 715
695 Ga0207699_10010406 3300025906 Bacteria 4667
696 Ga0207699_10013470 3300025906 Unclassified 4188
697 Ga0207699_10026320 3300025906 Bacteria 3204
698 Ga0207699_10074634 3300025906 Unclassified 2084
699 Ga0207699_10079595 3300025906 Bacteria 2028
700 Ga0207699_10120186 3300025906 Bacteria 1698
701 Ga0207699_10124813 3300025906 Bacteria 1670
702 Ga0207699_10311647 3300025906 Bacteria 1101
703 Ga0207699_10463961 3300025906 Bacteria 910
704 Ga0207699_10480103 3300025906 Bacteria 895
705 Ga0207699_10742188 3300025906 Bacteria 720
706 Ga0207645_10000125 3300025907 Bacteria 58051
707 Ga0207645_10142836 3300025907 Unclassified 1560
708 Ga0207645_10483605 3300025907 Bacteria 837
709 Ga0207643_10000488 3300025908 Bacteria 25463
710 Ga0207643_10376564 3300025908 Unclassified 894
711 Ga0207705_10024329 3300025909 Unclassified 4324
712 Ga0207705_10449652 3300025909 Bacteria 999
713 Ga0207684_10000223 3300025910 Bacteria 87514
714 Ga0207684_10003613 3300025910 Bacteria 15050
715 Ga0207684_10005360 3300025910 Bacteria 11848
716 Ga0207684_10027576 3300025910 Bacteria 4837
717 Ga0207684_10051827 3300025910 Bacteria 3482
718 Ga0207684_10503490 3300025910 Bacteria 1038
719 Ga0207654_10003381 3300025911 Bacteria 8076
720 Ga0207654_10008923 3300025911 Bacteria 5086
721 Ga0207654_10012212 3300025911 Bacteria 4397
722 Ga0207654_10018603 3300025911 Bacteria 3649
723 Ga0207654_10057660 3300025911 Bacteria 2258
724 Ga0207654_10059531 3300025911 Bacteria 2228
725 Ga0207654_10078327 3300025911 Bacteria 1983
726 Ga0207654_10473775 3300025911 Bacteria 881
727 Ga0207654_10597928 3300025911 Unclassified 787
728 Ga0207707_10011464 3300025912 Bacteria 7720
729 Ga0207707_10014133 3300025912 Bacteria 6956
730 Ga0207707_10054384 3300025912 Unclassified 3485
731 Ga0207707_10063047 3300025912 Bacteria 3226
732 Ga0207707_10429255 3300025912 Unclassified 1132
733 Ga0207695_10006382 3300025913 Bacteria 15343
734 Ga0207695_10006994 3300025913 Bacteria 14477
735 Ga0207695_10018543 3300025913 Bacteria 8041
736 Ga0207695_10074781 3300025913 Bacteria 3448
737 Ga0207695_10131230 3300025913 Bacteria 2463
738 Ga0207695_10134629 3300025913 Bacteria 2425
739 Ga0207695_10136999 3300025913 Bacteria 2400
740 Ga0207695_10143928 3300025913 Bacteria 2330
741 Ga0207695_10276584 3300025913 Bacteria 1573
742 Ga0207695_10501488 3300025913 Bacteria 1096
743 Ga0207695_10556484 3300025913 Bacteria 1028
744 Ga0207695_10652576 3300025913 Unclassified 933
745 Ga0207695_10754790 3300025913 Bacteria 853
746 Ga0207671_10006781 3300025914 Bacteria 10122
747 Ga0207671_10011713 3300025914 Bacteria 7106
748 Ga0207671_10016797 3300025914 Bacteria 5673
749 Ga0207671_10346429 3300025914 Bacteria 1178
750 Ga0207671_10926364 3300025914 Unclassified 688
751 Ga0207693_10000524 3300025915 Bacteria 34688
752 Ga0207693_10000961 3300025915 Bacteria 25847
753 Ga0207693_10008223 3300025915 Bacteria 8543
754 Ga0207693_10013230 3300025915 Bacteria 6658
755 Ga0207693_10014832 3300025915 Bacteria 6259
756 Ga0207693_10023945 3300025915 Bacteria 4847
757 Ga0207693_10075765 3300025915 Bacteria 2635
758 Ga0207693_10119681 3300025915 Bacteria 2068
759 Ga0207693_10171491 3300025915 Bacteria 1708
760 Ga0207693_10938887 3300025915 Bacteria 663
761 Ga0207663_10001734 3300025916 Bacteria 10244
762 Ga0207663_10001859 3300025916 Bacteria 9984
763 Ga0207663_10004743 3300025916 Bacteria 6793
764 Ga0207663_10015680 3300025916 Bacteria 4187
765 Ga0207663_10026236 3300025916 Bacteria 3379
766 Ga0207663_10028036 3300025916 Bacteria 3291
767 Ga0207663_10125516 3300025916 Bacteria 1765
768 Ga0207663_10138418 3300025916 Bacteria 1692
769 Ga0207663_10155129 3300025916 Bacteria 1610
770 Ga0207663_10210328 3300025916 Bacteria 1409
771 Ga0207663_10270634 3300025916 Unclassified 1258
772 Ga0207663_10593226 3300025916 Bacteria 870
773 Ga0207663_10688618 3300025916 Bacteria 809
774 Ga0207660_10098507 3300025917 Unclassified 2181
775 Ga0207660_10449225 3300025917 Bacteria 1042
776 Ga0207660_10607143 3300025917 Bacteria 891
777 Ga0207660_10607628 3300025917 Unclassified 891
778 Ga0207657_10000242 3300025919 Bacteria 57883
779 Ga0207657_10004544 3300025919 Bacteria 14660
780 Ga0207657_10540098 3300025919 Unclassified 912
781 Ga0207649_10000177 3300025920 Bacteria 52361
782 Ga0207649_10017954 3300025920 Bacteria 4013
783 Ga0207649_10135827 3300025920 Unclassified 1676
784 Ga0207652_10051559 3300025921 Bacteria 3528
785 Ga0207652_10085723 3300025921 Unclassified 2760
786 Ga0207652_10178854 3300025921 Bacteria 1906
787 Ga0207652_10204269 3300025921 Bacteria 1778
788 Ga0207652_10229348 3300025921 Bacteria 1673
789 Ga0207652_10300171 3300025921 Unclassified 1450
790 Ga0207652_11013346 3300025921 Unclassified 729
791 Ga0207646_10000348 3300025922 Bacteria 62738
792 Ga0207646_10001267 3300025922 Bacteria 31649
793 Ga0207646_10033930 3300025922 Bacteria 4612
794 Ga0207646_10180094 3300025922 Bacteria 1909
795 Ga0207646_10519122 3300025922 Bacteria 1072
796 Ga0207681_10137815 3300025923 Unclassified 1813
797 Ga0207681_10274769 3300025923 Unclassified 1324
798 Ga0207694_10019580 3300025924 Bacteria 5117
799 Ga0207694_10078313 3300025924 Bacteria 2591
800 Ga0207694_10152856 3300025924 Unclassified 1860
801 Ga0207694_10158395 3300025924 Bacteria 1828
802 Ga0207694_10164503 3300025924 Bacteria 1793
803 Ga0207694_10333271 3300025924 Unclassified 1254
804 Ga0207650_10000072 3300025925 Bacteria 137765
805 Ga0207650_10000078 3300025925 Bacteria 130954
806 Ga0207650_10020813 3300025925 Bacteria 4632
807 Ga0207650_10259650 3300025925 Bacteria 1409
808 Ga0207650_10376014 3300025925 Bacteria 1172
809 Ga0207659_10092620 3300025926 Unclassified 2260
810 Ga0207659_10138410 3300025926 Unclassified 1887
811 Ga0207659_10143413 3300025926 Bacteria 1857
812 Ga0207659_10683307 3300025926 Bacteria 878
813 Ga0207659_11067929 3300025926 Bacteria 695
814 Ga0207687_10001734 3300025927 Bacteria 15023
815 Ga0207687_10004355 3300025927 Bacteria 9444
816 Ga0207687_10042892 3300025927 Bacteria 3115
817 Ga0207687_10211196 3300025927 Bacteria 1523
818 Ga0207687_10335612 3300025927 Bacteria 1227
819 Ga0207687_10557002 3300025927 Bacteria 962
820 Ga0207700_10001427 3300025928 Bacteria 13541
821 Ga0207700_10021787 3300025928 Bacteria 4382
822 Ga0207700_10022935 3300025928 Bacteria 4292
823 Ga0207700_10027238 3300025928 Unclassified 4000
824 Ga0207700_10028863 3300025928 Bacteria 3909
825 Ga0207700_10034336 3300025928 Bacteria 3641
826 Ga0207700_10041527 3300025928 Bacteria 3366
827 Ga0207700_10063437 3300025928 Bacteria 2810
828 Ga0207700_10104271 3300025928 Bacteria 2269
829 Ga0207700_10104872 3300025928 Unclassified 2263
830 Ga0207700_10106753 3300025928 Bacteria 2245
831 Ga0207700_10191786 3300025928 Bacteria 1717
832 Ga0207700_10206384 3300025928 Bacteria 1659
833 Ga0207700_10207494 3300025928 Bacteria 1654
834 Ga0207700_10221360 3300025928 Bacteria 1604
835 Ga0207700_10259524 3300025928 Bacteria 1487
836 Ga0207700_10428458 3300025928 Unclassified 1163
837 Ga0207700_10483438 3300025928 Bacteria 1094
838 Ga0207700_10562919 3300025928 Bacteria 1012
839 Ga0207700_10652505 3300025928 Bacteria 938
840 Ga0207700_11002775 3300025928 Bacteria 747
841 Ga0207700_11480480 3300025928 Bacteria 603
842 Ga0207700_11604665 3300025928 Bacteria 575
843 Ga0207664_10035117 3300025929 Bacteria 3866
844 Ga0207664_10049398 3300025929 Unclassified 3312
845 Ga0207664_10055328 3300025929 Bacteria 3148
846 Ga0207664_10064901 3300025929 Bacteria 2922
847 Ga0207664_10073009 3300025929 Bacteria 2768
848 Ga0207664_10119385 3300025929 Bacteria 2204
849 Ga0207664_10120971 3300025929 Unclassified 2191
850 Ga0207664_10125915 3300025929 Bacteria 2151
851 Ga0207664_10145912 3300025929 Bacteria 2006
852 Ga0207664_10206778 3300025929 Bacteria 1697
853 Ga0207664_10267429 3300025929 Bacteria 1497
854 Ga0207664_10280458 3300025929 Bacteria 1462
855 Ga0207664_10322698 3300025929 Bacteria 1363
856 Ga0207664_10408277 3300025929 Unclassified 1209
857 Ga0207664_10575630 3300025929 Bacteria 1011
858 Ga0207664_10810414 3300025929 Bacteria 842
859 Ga0207664_10874765 3300025929 Bacteria 807
860 Ga0207664_10920441 3300025929 Bacteria 785
861 Ga0207644_10088536 3300025931 Unclassified 2303
862 Ga0207644_11014172 3300025931 Unclassified 697
863 Ga0207690_10022280 3300025932 Unclassified 3938
864 Ga0207690_10655260 3300025932 Unclassified 861
865 Ga0207706_10003412 3300025933 Bacteria 15181
866 Ga0207706_10020486 3300025933 Bacteria 5944
867 Ga0207706_10022082 3300025933 Bacteria 5712
868 Ga0207686_10060006 3300025934 Bacteria 2406
869 Ga0207686_10084322 3300025934 Bacteria 2082
870 Ga0207686_10095150 3300025934 Bacteria 1976
871 Ga0207709_10277959 3300025935 Bacteria 1235
872 Ga0207670_10035848 3300025936 Bacteria 3221
873 Ga0207670_10290118 3300025936 Unclassified 1278
874 Ga0207670_11168690 3300025936 Bacteria 651
875 Ga0207669_10871523 3300025937 Unclassified 750
876 Ga0207704_10016976 3300025938 Bacteria 3759
877 Ga0207704_10077655 3300025938 Bacteria 2133
878 Ga0207704_10162300 3300025938 Bacteria 1592
879 Ga0207704_10313466 3300025938 Unclassified 1207
880 Ga0207665_10008885 3300025939 Bacteria 6598
881 Ga0207665_10011904 3300025939 Bacteria 5713
882 Ga0207665_10026521 3300025939 Bacteria 3825
883 Ga0207665_10029957 3300025939 Bacteria 3596
884 Ga0207665_10059495 3300025939 Bacteria 2586
885 Ga0207665_10062057 3300025939 Bacteria 2535
886 Ga0207665_10102172 3300025939 Bacteria 2003
887 Ga0207665_10151101 3300025939 Bacteria 1663
888 Ga0207665_10152393 3300025939 Unclassified 1657
889 Ga0207665_10222969 3300025939 Unclassified 1382
890 Ga0207665_10310186 3300025939 Bacteria 1182
891 Ga0207665_10435044 3300025939 Bacteria 1004
892 Ga0207665_10518534 3300025939 Bacteria 923
893 Ga0207665_10661700 3300025939 Bacteria 819
894 Ga0207665_10883712 3300025939 Bacteria 708
895 Ga0207691_10000853 3300025940 Bacteria 30247
896 Ga0207691_10386750 3300025940 Bacteria 1194
897 Ga0207691_10769395 3300025940 Unclassified 810
898 Ga0207711_10006085 3300025941 Bacteria 10191
899 Ga0207711_10020209 3300025941 Bacteria 5549
900 Ga0207711_10025091 3300025941 Bacteria 5001
901 Ga0207711_10031024 3300025941 Unclassified 4509
902 Ga0207711_10486305 3300025941 Bacteria 1150
903 Ga0207711_10705534 3300025941 Bacteria 941
904 Ga0207711_11238307 3300025941 Bacteria 688
905 Ga0207711_11251049 3300025941 Bacteria 684
906 Ga0207689_10000495 3300025942 Bacteria 37206
907 Ga0207689_10000707 3300025942 Bacteria 31997
908 Ga0207689_10020706 3300025942 Bacteria 5530
909 Ga0207661_10000008 3300025944 Bacteria 451211
910 Ga0207661_10001451 3300025944 Bacteria 16007
911 Ga0207661_10159466 3300025944 Unclassified 1956
912 Ga0207661_10840439 3300025944 Bacteria 845
913 Ga0207661_11007782 3300025944 Bacteria 767
914 Ga0207679_10000177 3300025945 Bacteria 52657
915 Ga0207679_10038189 3300025945 Unclassified 3419
916 Ga0207667_10002400 3300025949 Bacteria 23462
917 Ga0207667_10016688 3300025949 Bacteria 8287
918 Ga0207667_10046866 3300025949 Bacteria 4577
919 Ga0207667_10064709 3300025949 Bacteria 3816
920 Ga0207667_10121862 3300025949 Bacteria 2687
921 Ga0207667_10317984 3300025949 Bacteria 1590
922 Ga0207667_10331765 3300025949 Unclassified 1553
923 Ga0207667_10493290 3300025949 Bacteria 1243
924 Ga0207667_10544159 3300025949 Bacteria 1175
925 Ga0207651_10004381 3300025960 Bacteria 7103
926 Ga0207651_10037247 3300025960 Unclassified 3185
927 Ga0207651_10569137 3300025960 Bacteria 987
928 Ga0207651_10569485 3300025960 Bacteria 987
929 Ga0207712_11015935 3300025961 Bacteria 736
930 Ga0207668_10019365 3300025972 Bacteria 4301
931 Ga0207640_10000843 3300025981 Bacteria 17434
932 Ga0207640_10002817 3300025981 Bacteria 9326
933 Ga0207640_10048913 3300025981 Bacteria 2736
934 Ga0207640_10068120 3300025981 Bacteria 2384
935 Ga0207640_10079331 3300025981 Bacteria 2237
936 Ga0207640_10625896 3300025981 Bacteria 914
937 Ga0207658_10127573 3300025986 Unclassified 2038
938 Ga0207658_10367425 3300025986 Bacteria 1257
939 Ga0207658_10477139 3300025986 Bacteria 1108
940 Ga0207677_10001146 3300026023 Bacteria 14471
941 Ga0207677_10004684 3300026023 Bacteria 7369
942 Ga0207677_10039291 3300026023 Bacteria 3110
943 Ga0207677_10111614 3300026023 Bacteria 2037
944 Ga0207677_10136790 3300026023 Unclassified 1869
945 Ga0207677_10860316 3300026023 Unclassified 815
946 Ga0207677_10970364 3300026023 Bacteria 769
947 Ga0207703_10007481 3300026035 Bacteria 8674
948 Ga0207703_10014707 3300026035 Bacteria 6107
949 Ga0207703_10029526 3300026035 Bacteria 4327
950 Ga0207703_10071736 3300026035 Bacteria 2861
951 Ga0207703_10253027 3300026035 Bacteria 1589
952 Ga0207703_10690093 3300026035 Bacteria 970
953 Ga0207703_10852301 3300026035 Bacteria 871
954 Ga0207703_11341010 3300026035 Bacteria 688
955 Ga0207639_10298587 3300026041 Bacteria 1423
956 Ga0207639_10464596 3300026041 Bacteria 1151
957 Ga0207639_10566526 3300026041 Bacteria 1044
958 Ga0207678_10001196 3300026067 Bacteria 23816
959 Ga0207678_10001295 3300026067 Bacteria 23151
960 Ga0207708_10323073 3300026075 Unclassified 1260
961 Ga0207702_10001116 3300026078 Bacteria 27436
962 Ga0207702_10006348 3300026078 Bacteria 10211
963 Ga0207702_10027482 3300026078 Bacteria 4725
964 Ga0207702_10030402 3300026078 Bacteria 4501
965 Ga0207702_10118325 3300026078 Bacteria 2367
966 Ga0207702_10173068 3300026078 Bacteria 1982
967 Ga0207702_10256585 3300026078 Bacteria 1644
968 Ga0207702_10579191 3300026078 Bacteria 1100
969 Ga0207702_10600752 3300026078 Bacteria 1080
970 Ga0207702_10606411 3300026078 Unclassified 1074
971 Ga0207702_10698639 3300026078 Bacteria 999
972 Ga0207641_10000237 3300026088 Bacteria 71168
973 Ga0207641_10022076 3300026088 Bacteria 5236
974 Ga0207641_10052884 3300026088 Bacteria 3441
975 Ga0207641_10071506 3300026088 Unclassified 2984
976 Ga0207641_10132612 3300026088 Bacteria 2239
977 Ga0207641_10199655 3300026088 Unclassified 1843
978 Ga0207641_10224754 3300026088 Bacteria 1743
979 Ga0207641_10286867 3300026088 Bacteria 1550
980 Ga0207641_10404294 3300026088 Unclassified 1312
981 Ga0207648_10010733 3300026089 Bacteria 8660
982 Ga0207648_10014004 3300026089 Bacteria 7430
983 Ga0207648_10731050 3300026089 Bacteria 918
984 Ga0207648_11660121 3300026089 Bacteria 600
985 Ga0207676_10000050 3300026095 Bacteria 133298
986 Ga0207676_10012503 3300026095 Bacteria 6085
987 Ga0207676_10081753 3300026095 Bacteria 2625
988 Ga0207674_10000130 3300026116 Bacteria 88123
989 Ga0207674_10000269 3300026116 Bacteria 65505
990 Ga0207674_10048042 3300026116 Bacteria 4371
991 Ga0207674_10238253 3300026116 Bacteria 1766
992 Ga0207674_10358129 3300026116 Bacteria 1410
993 Ga0207674_10538057 3300026116 Bacteria 1128
994 Ga0207674_10898673 3300026116 Unclassified 854
995 Ga0207675_100191788 3300026118 Bacteria 1960
996 Ga0207675_100715655 3300026118 Unclassified 1011
997 Ga0207683_10000139 3300026121 Bacteria 59769
998 Ga0207683_10082676 3300026121 Bacteria 2853
999 Ga0207683_10112642 3300026121 Bacteria 2436
1000 Ga0207683_10187805 3300026121 Bacteria 1875
1001 Ga0207683_10294985 3300026121 Bacteria 1483
1002 Ga0207698_10055373 3300026142 Bacteria 3057
1003 Ga0207698_10060280 3300026142 Unclassified 2950
1004 Ga0207698_10080622 3300026142 Bacteria 2623
1005 Ga0207698_10696240 3300026142 Bacteria 1011
1006 Ga0207698_10717698 3300026142 Bacteria 996
1007 Ga0265354_1007310 3300028016 Bacteria 1082
1008 Ga0265356_1000067 3300028017 Bacteria 17129
1009 Ga0265356_1007396 3300028017 Bacteria 1267
1010 Ga0265355_1002063 3300028036 Bacteria 1374
1011 Ga0265355_1008363 3300028036 Unclassified 827
1012 Ga0268266_10004469 3300028379 Bacteria 13368
1013 Ga0268266_10079038 3300028379 Bacteria 2863
1014 Ga0268266_10614477 3300028379 Unclassified 1045
1015 Ga0268265_10022237 3300028380 Unclassified 4452
1016 Ga0268265_10593707 3300028380 Bacteria 1057
1017 Ga0268264_10004223 3300028381 Bacteria 12261
1018 Ga0268264_10171272 3300028381 Bacteria 1964
1019 Ga0268264_10238198 3300028381 Bacteria 1684
1020 Ga0268264_10453458 3300028381 Bacteria 1243
1021 Ga0265326_10102496 3300028558 Bacteria 812
1022 Ga0265319_1042553 3300028563 Bacteria 1528
1023 Ga0265318_10030718 3300028577 Bacteria 2088
1024 Ga0265338_10003647 3300028800 Bacteria 21449
1025 Ga0265338_10062736 3300028800 Bacteria 3246
1026 Ga0265338_10068968 3300028800 Bacteria 3042
1027 Ga0265338_10094425 3300028800 Bacteria 2460
1028 Ga0265338_10160055 3300028800 Bacteria 1740
1029 Ga0265338_10191003 3300028800 Bacteria 1553
1030 Ga0265324_10008993 3300029957 Bacteria 3926
1031 Ga0265762_1004268 3300030760 Bacteria 2562
1032 Ga0265770_1010176 3300030878 Bacteria 1362
1033 Ga0265765_1000153 3300030879 Bacteria 4352
1034 Ga0265760_10002485 3300031090 Bacteria 5380
1035 Ga0265760_10005151 3300031090 Bacteria 3746
1036 Ga0265760_10014930 3300031090 Bacteria 2226
1037 Ga0265760_10048912 3300031090 Unclassified 1271
1038 Ga0265330_10033168 3300031235 Bacteria 2311
1039 Ga0265330_10163731 3300031235 Unclassified 944
1040 Ga0265332_10028089 3300031238 Bacteria 2464
1041 Ga0265332_10072165 3300031238 Bacteria 1470
1042 Ga0265332_10072223 3300031238 Bacteria 1469
1043 Ga0265328_10005736 3300031239 Bacteria 5304
1044 Ga0265328_10047778 3300031239 Bacteria 1573
1045 Ga0265320_10009889 3300031240 Bacteria 5714
1046 Ga0265325_10000515 3300031241 Bacteria 28005
1047 Ga0265325_10056890 3300031241 Bacteria 1996
1048 Ga0265325_10095371 3300031241 Bacteria 1462
1049 Ga0265325_10131863 3300031241 Unclassified 1196
1050 Ga0265325_10184316 3300031241 Bacteria 971
1051 Ga0265329_10048292 3300031242 Bacteria 1357
1052 Ga0265340_10001090 3300031247 Bacteria 15466
1053 Ga0265340_10024598 3300031247 Bacteria 3057
1054 Ga0265340_10069313 3300031247 Bacteria 1674
1055 Ga0265339_10026663 3300031249 Bacteria 3308
1056 Ga0265339_10027470 3300031249 Unclassified 3248
1057 Ga0265339_10034507 3300031249 Bacteria 2842
1058 Ga0265339_10072131 3300031249 Bacteria 1838
1059 Ga0265339_10234287 3300031249 Bacteria 894
1060 Ga0265331_10003381 3300031250 Bacteria 10345
1061 Ga0265331_10006153 3300031250 Bacteria 7136
1062 Ga0265331_10048760 3300031250 Unclassified 2035
1063 Ga0265331_10105229 3300031250 Unclassified 1296
1064 Ga0265316_10001130 3300031344 Bacteria 28937
1065 Ga0265316_10003692 3300031344 Bacteria 15426
1066 Ga0265316_10006205 3300031344 Bacteria 11456
1067 Ga0265316_10009598 3300031344 Bacteria 8891
1068 Ga0265316_10030197 3300031344 Bacteria 4446
1069 Ga0265316_10041585 3300031344 Bacteria 3677
1070 Ga0265316_10144087 3300031344 Bacteria 1788
1071 Ga0265316_10203343 3300031344 Unclassified 1467
1072 Ga0265316_10523500 3300031344 Bacteria 845
1073 Ga0265313_10002383 3300031595 Bacteria 16313
1074 Ga0265314_10001611 3300031711 Bacteria 24771
1075 Ga0265314_10008835 3300031711 Bacteria 8606
1076 Ga0265314_10103896 3300031711 Unclassified 1820
1077 Ga0265342_10056404 3300031712 Bacteria 2328
1078 Ga0307405_10251639 3300031731 Unclassified 1315
1079 Ga0307405_10365018 3300031731 Bacteria 1119
1080 Ga0307410_10001021 3300031852 Bacteria 12145
1081 Ga0307406_10037832 3300031901 Bacteria 2983
1082 Ga0307406_10445054 3300031901 Bacteria 1038
1083 Ga0307407_10307731 3300031903 Bacteria 1107
1084 Ga0307416_100093784 3300032002 Unclassified 2587
1085 Ga0307416_100224104 3300032002 Bacteria 1806
1086 Ga0307414_10074236 3300032004 Bacteria 2463
1087 Ga0307415_101099249 3300032126 Unclassified 744
1088 Ga0373930_0002114 3300034816 Unclassified 3043
1089 Ga0373926_0007641 3300035083 Bacteria 3599
1090 Ga0373926_0020857 3300035083 Bacteria 2266
1091 Ga0373926_0028374 3300035083 Unclassified 1964
1092 Ga0373926_0187838 3300035083 Bacteria 793
1093 Ga0373928_0028357 3300035084 Bacteria 1225
1094 Ga0373934_0031847 3300035086 Bacteria 2066
1095 Ga0373934_0232490 3300035086 Bacteria 761
1096 Ga0373940_0056696 3300035088 Bacteria 1112
1097 Ga0373944_0011305 3300035089 Bacteria 2444
1098 Ga0373923_0068497 3300035111 Bacteria 1520
1099 Ga0373923_0085489 3300035111 Bacteria 1373
1100 Ga0373923_0194956 3300035111 Bacteria 935
1101 Ga0373932_0091587 3300035112 Bacteria 976
1102 Ga0373936_0000172 3300035113 Bacteria 21486
1103 Ga0373936_0012995 3300035113 Bacteria 3175
1104 Ga0373936_0102549 3300035113 Bacteria 1208
1105 Ga0373936_0410490 3300035113 Bacteria 623
1106 Ga0373939_0123489 3300035114 Bacteria 916
1107 Ga0373941_0074815 3300035115 Bacteria 1132
1108 Ga0373945_0001375 3300035116 Bacteria 7385
1109 Ga0373945_0002395 3300035116 Bacteria 5881
1110 Ga0373945_0128264 3300035116 Bacteria 1014
1111 Ga0373945_0134718 3300035116 Unclassified 992
1112 Ga0373953_0003772 3300035117 Bacteria 4764
1113 Ga0373953_0192043 3300035117 Bacteria 882
1114 Ga0373954_0007793 3300035118 Bacteria 4688
1115 Ga0373954_0013276 3300035118 Bacteria 3670
1116 Ga0373954_0169065 3300035118 Bacteria 1070
1117 Ga0373956_0036548 3300035119 Bacteria 2168
1118 Ga0373956_0039447 3300035119 Bacteria 2093
1119 Ga0373956_0054467 3300035119 Bacteria 1802
1120 Ga0373957_0017752 3300035120 Bacteria 2484
1121 Ga0373943_0000055 3300035170 Bacteria 38929
1122 Ga0373943_0003910 3300035170 Bacteria 6779
1123 Ga0373943_0020297 3300035170 Bacteria 3062
1124 Ga0373943_0226425 3300035170 Bacteria 1043
1125 Ga0373943_0344765 3300035170 Unclassified 853
1126 Ga0373946_0029038 3300035171 Unclassified 2198
1127 Ga0373946_0194772 3300035171 Bacteria 968
1128 Ga0373955_0008998 3300035172 Bacteria 4661
1129 Ga0373955_0420749 3300035172 Bacteria 813
1130 Ga0373955_0429442 3300035172 Bacteria 804
1131 Ga0373961_0008159 3300035241 Bacteria 2544
1132 Ga0373961_0025165 3300035241 Bacteria 1616
1133 Ga0373924_0000091 3300035410 Bacteria 24866
1134 Ga0373924_0014882 3300035410 Bacteria 2945
1135 Ga0373924_0026543 3300035410 Bacteria 2298
1136 Ga0373924_0090317 3300035410 Bacteria 1310
1137 Ga0373931_0053587 3300035691 Bacteria 2153
1138 Ga0373931_0059959 3300035691 Unclassified 2047
1139 Ga0373931_0081062 3300035691 Bacteria 1791
1140 Ga0373931_0084890 3300035691 Bacteria 1754
1141 Ga0373931_0504067 3300035691 Unclassified 781
1142 Ga0373931_0602238 3300035691 Bacteria 718
1143 Ga0373935_0002091 3300035692 Bacteria 11335
1144 Ga0373935_0010861 3300035692 Bacteria 5470
1145 Ga0373935_0020803 3300035692 Bacteria 4012
1146 Ga0373935_0052573 3300035692 Bacteria 2590
1147 Ga0373935_0082770 3300035692 Bacteria 2088
1148 Ga0373935_0108297 3300035692 Bacteria 1841
1149 Ga0373935_0126285 3300035692 Bacteria 1714
1150 Ga0373935_0199832 3300035692 Bacteria 1381
1151 Ga0373935_0218085 3300035692 Bacteria 1324
1152 Ga0373935_0309731 3300035692 Unclassified 1118
1153 Ga0373935_0423798 3300035692 Bacteria 958
1154 Ga0373935_1157644 3300035692 Bacteria 576
1155 Ga0373927_0000378 3300035695 Bacteria 34466
1156 Ga0373927_0001571 3300035695 Bacteria 17119
1157 Ga0373927_0005079 3300035695 Bacteria 9105
1158 Ga0373927_0013728 3300035695 Bacteria 5378
1159 Ga0373927_0096748 3300035695 Unclassified 1919
1160 Ga0373927_0153053 3300035695 Bacteria 1510
1161 Ga0373927_0198094 3300035695 Unclassified 1318
1162 Ga0373927_0416032 3300035695 Bacteria 887
1163 Ga0373927_0499868 3300035695 Bacteria 803
1164 Ga0373927_0621639 3300035695 Bacteria 714
1165 Ga0373933_0016430 3300035724 Bacteria 4139
1166 Ga0373933_0192365 3300035724 Bacteria 1303
1167 Ga0373933_0331569 3300035724 Bacteria 987
1168 Ga0373933_0359390 3300035724 Unclassified 947
1169 Ga0373933_0506434 3300035724 Bacteria 791
1170 Ga0373933_0680214 3300035724 Bacteria 676
1171 Ga0373947_0000167 3300035725 Bacteria 35438
1172 Ga0373947_0001658 3300035725 Bacteria 13619
1173 Ga0373947_0008836 3300035725 Bacteria 5794
1174 Ga0373947_0050887 3300035725 Bacteria 2491
1175 Ga0373947_0057197 3300035725 Bacteria 2359
1176 Ga0373947_0061444 3300035725 Bacteria 2283
1177 Ga0373947_0100146 3300035725 Bacteria 1820
1178 Ga0373947_0471052 3300035725 Bacteria 852
1179 Ga0373947_0530924 3300035725 Bacteria 800
1180 Ga0373947_0668456 3300035725 Bacteria 708
1181 Ga0373947_0989113 3300035725 Unclassified 574
1182 Ga0373937_0000027 3300036401 Bacteria 123975
1183 Ga0373937_0014721 3300036401 Bacteria 6904
1184 Ga0373937_0018754 3300036401 Bacteria 6184
1185 Ga0373937_0020676 3300036401 Bacteria 5903
1186 Ga0373937_0041141 3300036401 Bacteria 4216
1187 Ga0373937_0047249 3300036401 Bacteria 3938
1188 Ga0373937_0076681 3300036401 Bacteria 3088
1189 Ga0373937_0094328 3300036401 Unclassified 2775
1190 Ga0373937_0105712 3300036401 Bacteria 2616
1191 Ga0373937_0238504 3300036401 Bacteria 1713
1192 Ga0373937_0310966 3300036401 Bacteria 1490
1193 Ga0373937_0360043 3300036401 Bacteria 1379
1194 Ga0373937_0374832 3300036401 Unclassified 1349
1195 Ga0373937_0832647 3300036401 Bacteria 871
1196 Ga0373937_1055870 3300036401 Bacteria 761
1197 Ga0373937_1312534 3300036401 Bacteria 672
1198 Ga0373925_0000224 3300037068 Bacteria 60518
1199 Ga0373925_0015611 3300037068 Bacteria 5494
1200 Ga0373925_0030136 3300037068 Bacteria 3981
1201 Ga0373925_0034052 3300037068 Bacteria 3755
1202 Ga0373925_0038481 3300037068 Bacteria 3537
1203 Ga0373925_0073647 3300037068 Bacteria 2585
1204 Ga0373925_0085587 3300037068 Bacteria 2403
1205 Ga0373925_0111187 3300037068 Bacteria 2116
1206 Ga0373925_0122640 3300037068 Bacteria 2019
1207 Ga0373925_0124740 3300037068 Bacteria 2002
1208 Ga0373925_0176346 3300037068 Bacteria 1690
1209 Ga0373925_0180170 3300037068 Bacteria 1672
1210 Ga0373925_0280191 3300037068 Bacteria 1343
1211 Ga0373925_1142123 3300037068 Unclassified 641
1212 Ga0436364_0135933 3300037853 Bacteria 793
1213 Ga0436364_1194151 3300037853 Bacteria 7993
1214 Ga0395901_0380383 3300038443 Unclassified 1453
1215 Ga0436365_1136717 3300039437 Bacteria 1154
1216 Ga0436365_1311817 3300039437 Unclassified 733
1217 Ga0436365_1314150 3300039437 Bacteria 563
1218 Ga0436365_1559181 3300039437 Bacteria 1256
1219 Ga0436365_1751127 3300039437 Bacteria 5277
1220 Ga0436360_0673759 3300039438 Bacteria 863
1221 Ga0436361_0293375 3300039447 Unclassified 639
1222 Ga0436363_0356673 3300039450 Bacteria 1835
1223 Ga0436363_0862048 3300039450 Bacteria 1149
1224 Ga0436363_1295381 3300039450 Bacteria 3791
1225 Ga0436362_1047223 3300039453 Bacteria 1129
1226 Ga0451849_1404825 3300041505 Bacteria 736
1227 Ga0451853_1241128 3300041512 Bacteria 762
1228 Ga0451577_1169536 3300042876 Bacteria 687
1229 Ga0466969_0257031 3300044656 Bacteria 792
1230 Ga0466966_0147888 3300044684 Bacteria 1434
1231 Ga0466966_0228892 3300044684 Bacteria 1122
1232 Ga0466961_0263248 3300044693 Bacteria 1057
1233 Ga0466963_0003772 3300044694 Bacteria 8731
1234 Ga0466963_0039609 3300044694 Bacteria 3087
1235 Ga0466963_0147368 3300044694 Bacteria 1633
1236 Ga0466964_0060019 3300044706 Bacteria 1581
1237 Ga0466964_0130794 3300044706 Unclassified 1143
1238 Ga0466971_0314619 3300044719 Bacteria 754
1239 Ga0466957_0076950 3300044842 Unclassified 2073
1240 Ga0466957_0314525 3300044842 Bacteria 1055
1241 Ga0466959_0183933 3300045049 Bacteria 1461
1242 Ga0451576_0097819 3300045051 Unclassified 3052
1243 Ga0451576_0220984 3300045051 Unclassified 1978
1244 Ga0451576_0288790 3300045051 Bacteria 1715
1245 Ga0451576_1428665 3300045051 Bacteria 720
1246 Ga0466967_0017316 3300045976 Bacteria 5716
1247 Ga0466967_0046110 3300045976 Bacteria 3793
1248 Ga0466967_0055367 3300045976 Bacteria 3494
1249 Ga0466967_0093669 3300045976 Bacteria 2734
1250 Ga0466967_0105221 3300045976 Bacteria 2585
1251 Ga0466967_0338174 3300045976 Bacteria 1455
1252 Ga0466967_0678854 3300045976 Bacteria 1020
1253 Ga0495629_0256515 3300046459 Bacteria 1202
1254 Ga0495629_0698185 3300046459 Unclassified 674
1255 Ga0495651_0008434 3300046462 Bacteria 7900
1256 Ga0495651_0050799 3300046462 Bacteria 3198
1257 Ga0495651_0119950 3300046462 Bacteria 1934
1258 Ga0495651_0140835 3300046462 Bacteria 1749
1259 Ga0495651_0265564 3300046462 Bacteria 1166
1260 Ga0495651_0449636 3300046462 Bacteria 833
1261 Ga0495653_0045879 3300046463 Bacteria 3386
1262 Ga0495653_0107349 3300046463 Bacteria 2012
1263 Ga0495653_0427750 3300046463 Unclassified 837
1264 Ga0495580_0001464 3300046472 Bacteria 20696
1265 Ga0495580_0003534 3300046472 Bacteria 13276
1266 Ga0495580_0006199 3300046472 Bacteria 9779
1267 Ga0495580_0006438 3300046472 Bacteria 9560
1268 Ga0495580_0017479 3300046472 Bacteria 5364
1269 Ga0495580_0017970 3300046472 Bacteria 5273
1270 Ga0495580_0018597 3300046472 Bacteria 5172
1271 Ga0495580_0022698 3300046472 Bacteria 4614
1272 Ga0495580_0026438 3300046472 Bacteria 4231
1273 Ga0495580_0046088 3300046472 Bacteria 3095
1274 Ga0495580_0056536 3300046472 Unclassified 2763
1275 Ga0495580_0063028 3300046472 Bacteria 2601
1276 Ga0495580_0063517 3300046472 Bacteria 2589
1277 Ga0495580_0089990 3300046472 Bacteria 2137
1278 Ga0495580_0111264 3300046472 Bacteria 1902
1279 Ga0495580_0161973 3300046472 Bacteria 1548
1280 Ga0495580_0224717 3300046472 Bacteria 1290
1281 Ga0495580_0262763 3300046472 Bacteria 1180
1282 Ga0495580_0286305 3300046472 Bacteria 1123
1283 Ga0495580_0362672 3300046472 Bacteria 980
1284 Ga0495580_0416062 3300046472 Bacteria 905
1285 Ga0495582_0012871 3300046473 Bacteria 4609
1286 Ga0495582_0074764 3300046473 Bacteria 1876
1287 Ga0495582_0101868 3300046473 Bacteria 1608
1288 Ga0495582_0214216 3300046473 Bacteria 1101
1289 Ga0495582_0521101 3300046473 Unclassified 687
1290 Ga0495605_0166527 3300046474 Bacteria 976
1291 Ga0495639_0074315 3300046475 Bacteria 1575
1292 Ga0495662_0030179 3300046476 Bacteria 2617
1293 Ga0495662_0245639 3300046476 Bacteria 882
1294 Ga0495664_0003847 3300046477 Bacteria 8192
1295 Ga0495664_0094774 3300046477 Unclassified 1797
1296 Ga0495664_0164274 3300046477 Bacteria 1347
1297 Ga0495664_0212461 3300046477 Bacteria 1172
1298 Ga0495664_0333026 3300046477 Bacteria 915
1299 Ga0495585_0441807 3300046492 Unclassified 623
1300 Ga0495594_0152024 3300046499 Bacteria 1314
1301 Ga0495608_0082532 3300046511 Bacteria 2087
1302 Ga0495608_0108032 3300046511 Bacteria 1790
1303 Ga0495608_0159226 3300046511 Bacteria 1436
1304 Ga0495618_0221675 3300046514 Bacteria 1193
1305 Ga0495618_0253768 3300046514 Bacteria 1103
1306 Ga0495628_0023575 3300046516 Bacteria 5050
1307 Ga0495628_0244132 3300046516 Unclassified 1343
1308 Ga0495628_0428850 3300046516 Bacteria 963
1309 Ga0495628_0489103 3300046516 Bacteria 890
1310 Ga0495628_0748032 3300046516 Bacteria 687
1311 Ga0495630_0013505 3300046517 Bacteria 5939
1312 Ga0495630_0051815 3300046517 Bacteria 3072
1313 Ga0495630_0058816 3300046517 Bacteria 2882
1314 Ga0495630_0109713 3300046517 Bacteria 2090
1315 Ga0495630_0299420 3300046517 Bacteria 1229
1316 Ga0495666_0208869 3300046526 Bacteria 896
1317 Ga0495666_0227609 3300046526 Bacteria 853
1318 Ga0495642_0237719 3300046528 Bacteria 796
1319 Ga0495642_0340052 3300046528 Bacteria 659
1320 Ga0495652_0168939 3300046529 Bacteria 1690
1321 Ga0495652_0349477 3300046529 Bacteria 1060
1322 Ga0495652_0395440 3300046529 Bacteria 980
1323 Ga0495665_0021545 3300046531 Bacteria 3463
1324 Ga0495665_0025270 3300046531 Bacteria 3191
1325 Ga0495665_0034989 3300046531 Bacteria 2685
1326 Ga0495665_0088377 3300046531 Bacteria 1629
1327 Ga0495665_0203784 3300046531 Bacteria 1025
1328 Ga0495665_0236414 3300046531 Bacteria 942
1329 Ga0495665_0428360 3300046531 Unclassified 670
1330 Ga0495640_0058921 3300046533 Bacteria 2618
1331 Ga0495640_0085863 3300046533 Bacteria 2085
1332 Ga0495640_0433249 3300046533 Bacteria 805
1333 Ga0495640_0583376 3300046533 Bacteria 676
1334 Ga0495586_0133604 3300046535 Unclassified 1390
1335 Ga0495587_0066973 3300046536 Bacteria 2094
1336 Ga0495587_0072064 3300046536 Bacteria 2009
1337 Ga0495587_0292904 3300046536 Bacteria 911
1338 Ga0495587_0373681 3300046536 Bacteria 793
1339 Ga0495645_0022167 3300046543 Bacteria 4593
1340 Ga0495645_0035649 3300046543 Bacteria 3626
1341 Ga0495645_0071844 3300046543 Unclassified 2494
1342 Ga0495645_0096994 3300046543 Bacteria 2100
1343 Ga0495645_0170135 3300046543 Bacteria 1500
1344 Ga0495645_0171349 3300046543 Bacteria 1494
1345 Ga0495645_0210936 3300046543 Bacteria 1311
1346 Ga0495645_0239024 3300046543 Unclassified 1213
1347 Ga0495667_0024521 3300046559 Bacteria 4062
1348 Ga0495667_0052413 3300046559 Bacteria 2688
1349 Ga0495667_0069290 3300046559 Bacteria 2302
1350 Ga0495667_0080351 3300046559 Bacteria 2120
1351 Ga0495667_0249252 3300046559 Bacteria 1130
1352 Ga0495668_0097647 3300046616 Bacteria 1608
1353 Ga0495634_0029185 3300046642 Bacteria 3820
1354 Ga0495634_0093797 3300046642 Bacteria 1946
1355 Ga0495635_0033329 3300046663 Bacteria 3573
1356 Ga0495635_0073100 3300046663 Bacteria 2349
1357 Ga0495635_0128451 3300046663 Bacteria 1728
1358 Ga0495635_0380479 3300046663 Bacteria 939
1359 Ga0495635_0429997 3300046663 Archaea 874
1360 Ga0495635_0539678 3300046663 Bacteria 765
1361 Ga0495635_0540406 3300046663 Bacteria 765
1362 Ga0495588_0051739 3300046674 Bacteria 2116
1363 Ga0495657_0338759 3300046675 Bacteria 892
1364 Ga0495657_0361939 3300046675 Unclassified 857
1365 Ga0495657_0417701 3300046675 Bacteria 788
1366 Ga0495657_0733268 3300046675 Unclassified 567
1367 Ga0495599_0223933 3300046678 Archaea 1150
1368 Ga0495599_0358715 3300046678 Bacteria 873
1369 Ga0495599_0367222 3300046678 Bacteria 861
1370 Ga0495623_0030436 3300046679 Bacteria 3472
1371 Ga0495623_0049156 3300046679 Bacteria 2673
1372 Ga0495623_0053782 3300046679 Bacteria 2542
1373 Ga0495623_0053948 3300046679 Bacteria 2537
1374 Ga0495623_0092747 3300046679 Bacteria 1850
1375 Ga0495623_0157856 3300046679 Unclassified 1335
1376 Ga0495646_0216913 3300046680 Bacteria 1036
1377 Ga0495646_0472851 3300046680 Bacteria 646
1378 Ga0495658_0148169 3300046683 Bacteria 1440
1379 Ga0495658_0293942 3300046683 Bacteria 1027
1380 Ga0495669_0093846 3300046684 Bacteria 1388
1381 Ga0495669_0096014 3300046684 Bacteria 1373
1382 Ga0495669_0235678 3300046684 Bacteria 878
1383 Ga0495613_0129225 3300046689 Bacteria 1810
1384 Ga0495613_0219233 3300046689 Bacteria 1336
1385 Ga0495613_0252098 3300046689 Bacteria 1231
1386 Ga0495624_0079166 3300046690 Bacteria 2038
1387 Ga0495624_0207276 3300046690 Bacteria 1190
1388 Ga0495624_0482240 3300046690 Bacteria 742
1389 Ga0495600_0105863 3300046809 Unclassified 1833
1390 Ga0495600_0209420 3300046809 Bacteria 1250
1391 Ga0495581_0346156 3300047315 Unclassified 868
1392 Ga0495581_0448424 3300047315 Unclassified 751
1393 Ga0495604_0028727 3300047317 Bacteria 4425
1394 Ga0495604_0223775 3300047317 Unclassified 1294
1395 Ga0495604_0315374 3300047317 Bacteria 1046
1396 Ga0495604_0328327 3300047317 Bacteria 1021
1397 Ga0495604_0378280 3300047317 Bacteria 936
1398 Ga0495604_0463835 3300047317 Bacteria 826
1399 Ga0495674_0018563 3300047319 Bacteria 6474
1400 Ga0495674_0049400 3300047319 Bacteria 3718
1401 Ga0495674_0053968 3300047319 Bacteria 3531
1402 Ga0495674_0076241 3300047319 Bacteria 2884
1403 Ga0495674_0214478 3300047319 Bacteria 1593
1404 Ga0495674_0299726 3300047319 Bacteria 1313
1405 Ga0495674_0334738 3300047319 Bacteria 1231
1406 Ga0495674_0578558 3300047319 Bacteria 891
1407 Ga0495676_0152757 3300047321 Bacteria 1641
1408 Ga0495675_0015725 3300047444 Bacteria 4785
1409 Ga0495675_0034121 3300047444 Unclassified 3247
1410 Ga0495675_0116060 3300047444 Bacteria 1669
1411 Ga0495675_0128649 3300047444 Bacteria 1575
1412 Ga0495675_0204648 3300047444 Bacteria 1200
1413 Ga0495675_0208231 3300047444 Bacteria 1188
1414 Ga0495675_0383412 3300047444 Bacteria 822
1415 Ga0495675_0414371 3300047444 Bacteria 784
1416 Ga0495675_0760431 3300047444 Bacteria 539
1417 Ga0495677_0034216 3300047445 Bacteria 1853
1418 Ga0495684_0016103 3300047471 Bacteria 5755
1419 Ga0495684_0054549 3300047471 Unclassified 3049
1420 Ga0495684_0083283 3300047471 Bacteria 2426
1421 Ga0495684_0112561 3300047471 Bacteria 2052
1422 Ga0495684_0220029 3300047471 Bacteria 1392
1423 Ga0495684_0460381 3300047471 Bacteria 882
1424 Ga0495593_0018737 3300047673 Bacteria 3887
1425 Ga0495593_0050171 3300047673 Bacteria 2212
1426 Ga0495602_0087286 3300048088 Bacteria 2601
1427 Ga0495602_0104306 3300048088 Bacteria 2320
1428 Ga0495602_0185006 3300048088 Bacteria 1603
1429 Ga0495602_0233374 3300048088 Bacteria 1381
1430 Ga0495602_0310671 3300048088 Bacteria 1150
1431 Ga0495602_0496241 3300048088 Bacteria 854
1432 Ga0495602_0630559 3300048088 Bacteria 734
1433 Ga0495614_0111573 3300048089 Bacteria 1201
1434 Ga0495614_0339422 3300048089 Bacteria 699
1435 Ga0496100_0090533 3300048903 Bacteria 2086
1436 Ga0496100_0121910 3300048903 Bacteria 1825
1437 Ga0496100_0172721 3300048903 Unclassified 1558
1438 Ga0496100_0208629 3300048903 Unclassified 1428
1439 Ga0496100_0335090 3300048903 Unclassified 1140
1440 Ga0496100_0495284 3300048903 Unclassified 941
1441 Ga0496101_0032991 3300048904 Bacteria 3649
1442 Ga0496101_0120052 3300048904 Unclassified 1987
1443 Ga0496101_0275424 3300048904 Bacteria 1314
1444 Ga0496101_0390554 3300048904 Unclassified 1095
1445 Ga0496101_0650150 3300048904 Unclassified 833
1446 Ga0496102_0020175 3300048905 Bacteria 5885
1447 Ga0496102_0089212 3300048905 Bacteria 2852
1448 Ga0496102_0152540 3300048905 Bacteria 2172
1449 Ga0496102_0203032 3300048905 Unclassified 1868
1450 Ga0496102_0335279 3300048905 Unclassified 1424
1451 Ga0496102_0503319 3300048905 Bacteria 1134
1452 Ga0496102_0611992 3300048905 Bacteria 1012
1453 Ga0496103_0022488 3300048906 Bacteria 3797
1454 Ga0496103_0032022 3300048906 Unclassified 3207
1455 Ga0496103_0061583 3300048906 Bacteria 2334
1456 Ga0496103_0616247 3300048906 Bacteria 691
1457 Ga0496104_0003663 3300048907 Bacteria 13265
1458 Ga0496104_0017687 3300048907 Bacteria 6498
1459 Ga0496104_0093755 3300048907 Bacteria 2872
1460 Ga0496104_0209709 3300048907 Unclassified 1860
1461 Ga0496104_0325362 3300048907 Bacteria 1450
1462 Ga0496104_0338449 3300048907 Unclassified 1418
1463 Ga0496104_0777467 3300048907 Bacteria 864
1464 Ga0496105_0008105 3300048908 Bacteria 8169
1465 Ga0496105_0040114 3300048908 Bacteria 3860
1466 Ga0496105_0603685 3300048908 Unclassified 851
1467 Ga0496105_0666460 3300048908 Bacteria 801
1468 Ga0496106_0034342 3300048909 Unclassified 3787
1469 Ga0496106_0063470 3300048909 Bacteria 2807
1470 Ga0496106_0641193 3300048909 Bacteria 849
1471 Ga0496107_0223273 3300048910 Unclassified 1402
1472 Ga0496108_0000106 3300048911 Bacteria 87028
1473 Ga0496108_0216047 3300048911 Bacteria 1665
1474 Ga0496109_0000133 3300048912 Bacteria 76299
1475 Ga0496109_0167149 3300048912 Bacteria 2063
1476 Ga0496109_0332953 3300048912 Unclassified 1433
1477 Ga0496109_0370111 3300048912 Unclassified 1354
1478 Ga0496109_1041215 3300048912 Bacteria 756
1479 Ga0496110_0002218 3300048913 Bacteria 14511
1480 Ga0496110_0186389 3300048913 Bacteria 1884
1481 Ga0496110_0890889 3300048913 Unclassified 796
1482 Ga0496111_0004591 3300048914 Bacteria 8744
1483 Ga0496112_0000028 3300048915 Bacteria 130942
1484 Ga0496112_0014386 3300048915 Bacteria 7336
1485 Ga0496112_0030600 3300048915 Bacteria 5211
1486 Ga0496112_0043741 3300048915 Bacteria 4386
1487 Ga0496112_0055340 3300048915 Bacteria 3901
1488 Ga0496112_0099017 3300048915 Unclassified 2885
1489 Ga0496112_0162289 3300048915 Bacteria 2201
1490 Ga0496112_0217038 3300048915 Bacteria 1869
1491 Ga0496112_0331081 3300048915 Bacteria 1467
1492 Ga0496112_0368375 3300048915 Bacteria 1378
1493 Ga0496112_1137669 3300048915 Bacteria 698
1494 Ga0496112_1320429 3300048915 Bacteria 637
1495 Ga0496113_0000179 3300048916 Bacteria 28343
1496 Ga0496113_0013416 3300048916 Bacteria 5551
1497 Ga0496113_0091882 3300048916 Unclassified 2340
1498 Ga0496113_0326988 3300048916 Unclassified 1229
1499 Ga0496114_0062374 3300048917 Unclassified 3120
1500 Ga0496115_0030865 3300048918 Bacteria 4219
1501 Ga0496115_1078642 3300048918 Bacteria 610
1502 Ga0501292_039726 3300049515 Unclassified 810
1503 Ga0501299_013919 3300049522 Bacteria 1393
1504 Ga0501073_0087107 3300049589 Bacteria 2172
1505 Ga0501216_060176 3300049660 Unclassified 764
1506 Ga0501217_115749 3300049661 Unclassified 774
1507 Ga0501261_021495 3300049690 Unclassified 928
1508 Ga0501221_038951 3300049704 Bacteria 1029
1509 Ga0501225_0030165 3300049705 Unclassified 1491
1510 Ga0501083_0114773 3300049744 Bacteria 1769
1511 Ga0501268_083469 3300049765 Unclassified 663
1512 nmdc:mga05p37_668048_c1 3300050507 Unclassified 1160
1513 nmdc:mga05p37_887748_c1 3300050507 Bacteria 963
1514 nmdc:mga08y16_962509_c1 3300050511 Bacteria 836
1515 nmdc:mga0n895_1051089_c1 3300050512 Bacteria 793
1516 nmdc:mga0n895_123435_c1 3300050512 Unclassified 2612
1517 nmdc:mga0n895_1547_c1 3300050512 Bacteria 17269
1518 nmdc:mga0n895_4579_c1 3300050512 Bacteria 11389
1519 nmdc:mga0rr50_16895_c1 3300050513 Unclassified 4859
1520 nmdc:mga0rr50_433943_c1 3300050513 Bacteria 1112
1521 nmdc:mga08x19_14306_c1 3300050514 Bacteria 4813
1522 nmdc:mga08x19_178361_c1 3300050514 Bacteria 1449
1523 nmdc:mga08x19_191779_c1 3300050514 Bacteria 1398
1524 nmdc:mga08x19_2368_c1 3300050514 Bacteria 11425
1525 nmdc:mga08x19_27172_c1 3300050514 Bacteria 3578
1526 nmdc:mga08x19_6108_c1 3300050514 Bacteria 7121
1527 nmdc:mga08x19_761213_c1 3300050514 Bacteria 688
1528 nmdc:mga08x19_7696_c1 3300050514 Bacteria 6397
1529 nmdc:mga0a205_806225_c1 3300050515 Unclassified 787
1530 nmdc:mga0a205_947_c1 3300050515 Bacteria 23925
1531 Ga0495601_0217699 3300053077 Bacteria 1247
1532 Ga0495619_0064914 3300053085 Unclassified 2435
1533 Ga0495619_0596418 3300053085 Bacteria 756
1534 Ga0495619_0597208 3300053085 Bacteria 755
1535 Ga0495619_0615705 3300053085 Archaea 742
1536 Ga0495619_0899215 3300053085 Bacteria 596
1537 Ga0500590_059292 3300053148 Bacteria 1926
1538 Ga0501084_0080902 3300054114 Bacteria 2724
1539 Ga0501082_0002389 3300060353 Bacteria 16456
1540 Ga0501082_0129551 3300060353 Bacteria 2189
1541 Ga0224572_1037013
1542 MBSR1b_contig_11819402
1543 LJNas_1001454
1544 JGI24034J26672_10005869
1545 JGI24751J29686_10014259
1546 Ga0065712_10152185
1547 Ga0065712_10173172
1548 Ga0065715_10037980
1549 Ga0065715_10103000
1550 Ga0065715_10178575
1551 Ga0070658_10005929
1552 Ga0070658_10418706
1553 Ga0070658_10701949
1554 Ga0070676_10016811
1555 Ga0070676_10151440
1556 Ga0070683_100000035
1557 Ga0070683_100012627
1558 Ga0070683_100026713
1559 Ga0070683_100290670
1560 Ga0070683_100546070
1561 Ga0070683_100554868
1562 Ga0070690_100224183
1563 Ga0070690_100585602
1564 Ga0070670_100005429
1565 Ga0070670_100016074
1566 Ga0070670_100035001
1567 Ga0068869_100009378
1568 Ga0068869_100012141
1569 Ga0068869_100013081
1570 Ga0068869_101315843
1571 Ga0070666_10008702
1572 Ga0070666_10104046
1573 Ga0070680_100135893
1574 Ga0070680_100443266
1575 Ga0070682_100011890
1576 Ga0070682_100025124
1577 Ga0070682_100383356
1578 Ga0068868_100002728
1579 Ga0068868_100002835
1580 Ga0068868_100022051
1581 Ga0068868_100036034
1582 Ga0068868_100125206
1583 Ga0068868_100155671
1584 Ga0068868_101028202
1585 Ga0070660_100009702
1586 Ga0070660_100614258
1587 Ga0070689_100068871
1588 Ga0070689_100069133
1589 Ga0070689_100185672
1590 Ga0070691_10054356
1591 Ga0070661_100007203
1592 Ga0070661_100025417
1593 Ga0070692_10077057
1594 Ga0070692_10099137
1595 Ga0070668_100002226
1596 Ga0070668_100007587
1597 Ga0070668_100465366
1598 Ga0070669_100005043
1599 Ga0070669_100049122
1600 Ga0070675_100047761
1601 Ga0070675_100155371
1602 Ga0070675_100732877
1603 Ga0070675_100737801
1604 Ga0070675_100953992
1605 Ga0070675_100962791
1606 Ga0070675_101060470
1607 Ga0070671_100976174
1608 Ga0070671_101066372
1609 Ga0070674_100221991
1610 Ga0070674_100462311
1611 Ga0070674_101026534
1612 Ga0070673_100062580
1613 Ga0070673_100665248
1614 Ga0070673_101074723
1615 Ga0070688_100013826
1616 Ga0070688_100357010
1617 Ga0070659_100001203
1618 Ga0070659_100080397
1619 Ga0070667_100116848
1620 Ga0070709_10018837
1621 Ga0070709_10020338
1622 Ga0070709_10031911
1623 Ga0070709_10040735
1624 Ga0070709_10065352
1625 Ga0070709_10087970
1626 Ga0070709_10119214
1627 Ga0070709_10162923
1628 Ga0070709_10176908
1629 Ga0070709_10206445
1630 Ga0070709_10276903
1631 Ga0070709_10472435
1632 Ga0070709_10751656
1633 Ga0070714_100000169
1634 Ga0070714_100008519
1635 Ga0070714_100020608
1636 Ga0070714_100059174
1637 Ga0070714_100072893
1638 Ga0070714_100149551
1639 Ga0070714_100174919
1640 Ga0070714_100180387
1641 Ga0070714_100214185
1642 Ga0070714_100285751
1643 Ga0070714_100299439
1644 Ga0070714_100335812
1645 Ga0070714_100350431
1646 Ga0070714_100633047
1647 Ga0070714_100832475
1648 Ga0070713_100000649
1649 Ga0070713_100002519
1650 Ga0070713_100005251
1651 Ga0070713_100012465
1652 Ga0070713_100020997
1653 Ga0070713_100061733
1654 Ga0070713_100068860
1655 Ga0070713_100084009
1656 Ga0070713_100086586
1657 Ga0070713_100101904
1658 Ga0070713_100136863
1659 Ga0070713_100228716
1660 Ga0070713_100272077
1661 Ga0070713_100308576
1662 Ga0070713_100425658
1663 Ga0070713_100551494
1664 Ga0070713_100559448
1665 Ga0070713_100652762
1666 Ga0070713_101459694
1667 Ga0070713_101687081
1668 Ga0070713_101754075
1669 Ga0070710_10027644
1670 Ga0070710_10035124
1671 Ga0070710_10069378
1672 Ga0070710_10073573
1673 Ga0070710_10082954
1674 Ga0070710_10416500
1675 Ga0070711_100000293
1676 Ga0070711_100001830
1677 Ga0070711_100007650
1678 Ga0070711_100054373
1679 Ga0070711_100060645
1680 Ga0070711_100065489
1681 Ga0070711_100104622
1682 Ga0070711_100283720
1683 Ga0070711_100933380
1684 Ga0070711_101500636
1685 Ga0070705_100038418
1686 Ga0070705_100107033
1687 Ga0070705_100194634
1688 Ga0070700_100366056
1689 Ga0070694_100530115
1690 Ga0070708_100000242
1691 Ga0070708_100001715
1692 Ga0070708_100003584
1693 Ga0070708_100006436
1694 Ga0070708_100020572
1695 Ga0070708_100086330
1696 Ga0070663_100043712
1697 Ga0070678_100071377
1698 Ga0070678_100188708
1699 Ga0070662_100004575
1700 Ga0070662_100011008
1701 Ga0070662_100268491
1702 Ga0070662_100646416
1703 Ga0070681_10008506
1704 Ga0070681_10012341
1705 Ga0070681_10073861
1706 Ga0070681_10074017
1707 Ga0070681_10082353
1708 Ga0070681_10155758
1709 Ga0070681_10518012
1710 Ga0070681_10654872
1711 Ga0068867_100001484
1712 Ga0068867_100013571
1713 Ga0068867_100024102
1714 Ga0070685_10031930
1715 Ga0070706_100001331
1716 Ga0070706_100001385
1717 Ga0070706_100002503
1718 Ga0070706_100013794
1719 Ga0070706_100044511
1720 Ga0070706_100233521
1721 Ga0070706_100280770
1722 Ga0070707_100002130
1723 Ga0070707_100002318
1724 Ga0070707_100012306
1725 Ga0070707_100137336
1726 Ga0070707_100384795
1727 Ga0070707_100400753
1728 Ga0070698_100000589
1729 Ga0070698_100000689
1730 Ga0070698_100040140
1731 Ga0070699_100000679
1732 Ga0070699_100000716
1733 Ga0070699_100025935
1734 Ga0070699_100027280
1735 Ga0070699_100639241
1736 Ga0070679_100074471
1737 Ga0070679_100159877
1738 Ga0070679_100398877
1739 Ga0070679_100736401
1740 Ga0070679_101177436
1741 Ga0070684_100000037
1742 Ga0070684_100083944
1743 Ga0070684_100086086
1744 Ga0070684_100128722
1745 Ga0070684_100401329
1746 Ga0070697_100000053
1747 Ga0070697_100000280
1748 Ga0070697_100000694
1749 Ga0070697_100001256
1750 Ga0070697_100013559
1751 Ga0070697_100018478
1752 Ga0070697_100111046
1753 Ga0070697_100414907
1754 Ga0070697_100430598
1755 Ga0070697_101383730
1756 Ga0068853_100004040
1757 Ga0070672_100003042
1758 Ga0070672_100366589
1759 Ga0070672_100462223
1760 Ga0070686_100008692
1761 Ga0070695_100032361
1762 Ga0070695_100088098
1763 Ga0070695_100192023
1764 Ga0070696_100142696
1765 Ga0070696_100164097
1766 Ga0070696_100196285
1767 Ga0070696_100441270
1768 Ga0070693_100004450
1769 Ga0070693_100034556
1770 Ga0070693_100261979
1771 Ga0070693_100702313
1772 Ga0070693_101079393
1773 Ga0070665_100023323
1774 Ga0070704_100120474
1775 Ga0068855_100010022
1776 Ga0068855_100011722
1777 Ga0068855_100012992
1778 Ga0068855_100074528
1779 Ga0068855_100080699
1780 Ga0068855_100151046
1781 Ga0068855_100248520
1782 Ga0068855_100347599
1783 Ga0068855_100449358
1784 Ga0068855_100487674
1785 Ga0068855_100972414
1786 Ga0070664_100000972
1787 Ga0070664_100008272
1788 Ga0070664_100019355
1789 Ga0068857_100000259
1790 Ga0068857_100000335
1791 Ga0068857_100199313
1792 Ga0068857_100314612
1793 Ga0068857_100475411
1794 Ga0068857_100580462
1795 Ga0068857_100995258
1796 Ga0068854_100011053
1797 Ga0068854_100023615
1798 Ga0068854_100028231
1799 Ga0068854_100033635
1800 Ga0068854_100096525
1801 Ga0068856_100000995
1802 Ga0068856_100002426
1803 Ga0068856_100003097
1804 Ga0068856_100005963
1805 Ga0068856_100006696
1806 Ga0068856_100023013
1807 Ga0068856_100035413
1808 Ga0068856_100387787
1809 Ga0068856_100551276
1810 Ga0068856_100634798
1811 Ga0068856_100646876
1812 Ga0068856_100907641
1813 Ga0068856_102109757
1814 Ga0070702_100000387
1815 Ga0070702_100070013
1816 Ga0070702_100267006
1817 Ga0068852_100009501
1818 Ga0068852_100050228
1819 Ga0068852_100145329
1820 Ga0068852_100206105
1821 Ga0068852_101254597
1822 Ga0068859_100014831
1823 Ga0068859_100015248
1824 Ga0068859_100094432
1825 Ga0068859_100253500
1826 Ga0068859_100298463
1827 Ga0068859_100344748
1828 Ga0068859_101027082
1829 Ga0068864_100003998
1830 Ga0068864_100034805
1831 Ga0068866_10000735
1832 Ga0068866_10003232
1833 Ga0068866_10008403
1834 Ga0068866_10036584
1835 Ga0068866_10044217
1836 Ga0068866_10367819
1837 Ga0068861_100013572
1838 Ga0068861_100086221
1839 Ga0068861_100242727
1840 Ga0068851_10004069
1841 Ga0068851_10006547
1842 Ga0068851_10010242
1843 Ga0068851_10099054
1844 Ga0068870_10026876
1845 Ga0068870_10319471
1846 Ga0068863_100031255
1847 Ga0068863_100058799
1848 Ga0068863_100085787
1849 Ga0068863_100301358
1850 Ga0068863_100338804
1851 Ga0068863_101176067
1852 Ga0068858_100000404
1853 Ga0068858_100004032
1854 Ga0068858_100274148
1855 Ga0068858_100473751
1856 Ga0068860_100012091
1857 Ga0068860_100038625
1858 Ga0068860_100405138
1859 Ga0068862_100151271
1860 Ga0081540_1093264
1861 Ga0070717_10001683
1862 Ga0070717_10004512
1863 Ga0070717_10005108
1864 Ga0070717_10005704
1865 Ga0070717_10011319
1866 Ga0070717_10032487
1867 Ga0070717_10051470
1868 Ga0070717_10064277
1869 Ga0070717_10111341
1870 Ga0070717_10148095
1871 Ga0070717_10207105
1872 Ga0070717_10221443
1873 Ga0070717_10237926
1874 Ga0070717_10255225
1875 Ga0070717_10262381
1876 Ga0070717_10315890
1877 Ga0070717_10342052
1878 Ga0070717_10423608
1879 Ga0070717_10752709
1880 Ga0070717_11288950
1881 Ga0070717_11341997
1882 Ga0070715_10002128
1883 Ga0070715_10013154
1884 Ga0070715_10094090
1885 Ga0070715_10099475
1886 Ga0070715_10112816
1887 Ga0070715_10178923
1888 Ga0070715_10320858
1889 Ga0070715_10480664
1890 Ga0070715_10802027
1891 Ga0070716_100013165
1892 Ga0070716_100015752
1893 Ga0070716_100026282
1894 Ga0070716_100034551
1895 Ga0070716_100039117
1896 Ga0070716_100155544
1897 Ga0070716_100181495
1898 Ga0070716_100215542
1899 Ga0070716_100228980
1900 Ga0070716_100252626
1901 Ga0070716_100272120
1902 Ga0070716_100319623
1903 Ga0070716_100913697
1904 Ga0070712_100000188
1905 Ga0070712_100000723
1906 Ga0070712_100026038
1907 Ga0070712_100026743
1908 Ga0070712_100027377
1909 Ga0070712_100027607
1910 Ga0070712_100040986
1911 Ga0070712_100072539
1912 Ga0070712_100103103
1913 Ga0070712_100260476
1914 Ga0070712_100288502
1915 Ga0070712_100496834
1916 Ga0070712_100624568
1917 Ga0070712_101013852
1918 Ga0097621_100013631
1919 Ga0097621_100024654
1920 Ga0097621_100039766
1921 Ga0097621_100076590
1922 Ga0097621_100121598
1923 Ga0097621_100139551
1924 Ga0097621_100158187
1925 Ga0097621_100459508
1926 Ga0097621_100565154
1927 Ga0097621_100567341
1928 Ga0097621_101100404
1929 Ga0068871_100000389
1930 Ga0068871_100007884
1931 Ga0068871_100034094
1932 Ga0068871_100043390
1933 Ga0068871_100049645
1934 Ga0068871_100049912
1935 Ga0068871_100091844
1936 Ga0068871_100314305
1937 Ga0068871_100541172
1938 Ga0075431_100508146
1939 Ga0075433_10000636
1940 Ga0075433_10777035
1941 Ga0075434_100001288
1942 Ga0075434_100001829
1943 Ga0075434_100035785
1944 Ga0068865_100044263
1945 Ga0068865_100235879
1946 Ga0068865_100441121
1947 Ga0075436_100003222
1948 Ga0075436_100006615
1949 Ga0075436_100007751
1950 Ga0075436_100013183
1951 Ga0075436_100046263
1952 Ga0075436_100088486
1953 Ga0075436_100139706
1954 Ga0075436_100362595
1955 Ga0075436_100448902
1956 Ga0075436_100526995
1957 Ga0097620_100014831
1958 Ga0097620_100015253
1959 Ga0097620_100094426
1960 Ga0097620_100253503
1961 Ga0097620_100298470
1962 Ga0097620_100344743
1963 Ga0097620_101026981
1964 Ga0097620_101680699
1965 Ga0075435_100002192
1966 Ga0075435_100016802
1967 Ga0075435_100101237
1968 Ga0075435_100427608
1969 Ga0075435_101252867
1970 Ga0099794_10044594
1971 Ga0099794_10074135
1972 Ga0099794_10402595
1973 Ga0099795_10030520
1974 Ga0105240_10055750
1975 Ga0105240_10061239
1976 Ga0105240_10098841
1977 Ga0105240_10147828
1978 Ga0105240_10197359
1979 Ga0105240_10205854
1980 Ga0105240_10259198
1981 Ga0105240_10519746
1982 Ga0105240_10580303
1983 Ga0105240_10581698
1984 Ga0105240_10775099
1985 Ga0105240_10819970
1986 Ga0105240_11018321
1987 Ga0105240_11148092
1988 Ga0105240_11780744
1989 Ga0111539_10407355
1990 Ga0111539_11498579
1991 Ga0105245_10003248
1992 Ga0105245_10007752
1993 Ga0105245_10007882
1994 Ga0105245_10018174
1995 Ga0105245_10052722
1996 Ga0105245_10064552
1997 Ga0105245_10093343
1998 Ga0105245_10179724
1999 Ga0105245_10423149
2000 Ga0105245_10481162
2001 Ga0105245_10778165
2002 Ga0105247_10001594
2003 Ga0105247_10017504
2004 Ga0114129_10061374
2005 Ga0114129_10165885
2006 Ga0105243_10626305
2007 Ga0105243_11377270
2008 Ga0105241_10004558
2009 Ga0105241_10024348
2010 Ga0105241_10043109
2011 Ga0105241_10049184
2012 Ga0105241_10070311
2013 Ga0105241_10094522
2014 Ga0105241_10258229
2015 Ga0105241_10397954
2016 Ga0105241_10407320
2017 Ga0105241_11769001
2018 Ga0105242_10006980
2019 Ga0105242_10171301
2020 Ga0105242_10274578
2021 Ga0105242_10449797
2022 Ga0105242_11373422
2023 Ga0105248_10011433
2024 Ga0105248_10026687
2025 Ga0105248_10086566
2026 Ga0105248_10099247
2027 Ga0105248_10283297
2028 Ga0105248_10570011
2029 Ga0105248_10872668
2030 Ga0105237_10006364
2031 Ga0105237_10013796
2032 Ga0105237_10045567
2033 Ga0105237_10072667
2034 Ga0105237_10075837
2035 Ga0105237_10216179
2036 Ga0105237_10273158
2037 Ga0105237_10285608
2038 Ga0105237_10321170
2039 Ga0105237_10410467
2040 Ga0105237_10653280
2041 Ga0105237_10691100
2042 Ga0105237_10723015
2043 Ga0105237_10899599
2044 Ga0105237_11092496
2045 Ga0105237_11725016
2046 Ga0105238_10025430
2047 Ga0105238_10138524
2048 Ga0105238_10157265
2049 Ga0105238_10206998
2050 Ga0105238_10235107
2051 Ga0105238_10249507
2052 Ga0105249_10041603
2053 Ga0105249_10290290
2054 Ga0105249_10308379
2055 Ga0099796_10028145
2056 Ga0105239_10003652
2057 Ga0105239_10066583
2058 Ga0105239_10070525
2059 Ga0105239_10087659
2060 Ga0105239_10095971
2061 Ga0105239_10370397
2062 Ga0105239_10713671
2063 Ga0105239_11270780
2064 Ga0105239_12512498
2065 Ga0105246_10004431
2066 Ga0105246_10251252
2067 Ga0105246_10487443
2068 Ga0105246_10726030
2069 Ga0105246_10810470
2070 Ga0157324_1004648
2071 Ga0157373_10002519
2072 Ga0157373_10007083
2073 Ga0157373_10030097
2074 Ga0157373_10108259
2075 Ga0157373_10116116
2076 Ga0157373_10182073
2077 Ga0157373_10338975
2078 Ga0157373_10470852
2079 Ga0157371_10008414
2080 Ga0157371_10009414
2081 Ga0157371_10049901
2082 Ga0157370_10045645
2083 Ga0157370_10080214
2084 Ga0157370_10108342
2085 Ga0157370_10209613
2086 Ga0157370_10294890
2087 Ga0157370_10692587
2088 Ga0157369_10017191
2089 Ga0157369_10060408
2090 Ga0157369_10122971
2091 Ga0157369_10127242
2092 Ga0157369_10258603
2093 Ga0157369_10363215
2094 Ga0157369_10515747
2095 Ga0157369_11047837
2096 Ga0157374_10000634
2097 Ga0157374_10001978
2098 Ga0157374_10002353
2099 Ga0157374_10007704
2100 Ga0157374_10020608
2101 Ga0157374_10059771
2102 Ga0157374_10113865
2103 Ga0157374_10140007
2104 Ga0157374_10392430
2105 Ga0157374_10650860
2106 Ga0157374_11987540
2107 Ga0157378_10000202
2108 Ga0157378_10000725
2109 Ga0157378_10001795
2110 Ga0157378_10012660
2111 Ga0157378_10072136
2112 Ga0157378_10090402
2113 Ga0157378_10340913
2114 Ga0157378_10543179
2115 Ga0157378_10717651
2116 Ga0157378_10754322
2117 Ga0157378_11058524
2118 Ga0157378_11443155
2119 Ga0163162_10009643
2120 Ga0163162_10040280
2121 Ga0163162_10055031
2122 Ga0163162_10070409
2123 Ga0163162_10112681
2124 Ga0163162_10152829
2125 Ga0163162_10191003
2126 Ga0163162_10314703
2127 Ga0163162_10759984
2128 Ga0163162_11004324
2129 Ga0163162_11046858
2130 Ga0163162_11072492
2131 Ga0163162_11162495
2132 Ga0163162_12053660
2133 Ga0157372_10000565
2134 Ga0157372_10002050
2135 Ga0157372_10003078
2136 Ga0157372_10015430
2137 Ga0157372_10016466
2138 Ga0157372_10022661
2139 Ga0157372_10030069
2140 Ga0157372_10053833
2141 Ga0157372_10054469
2142 Ga0157372_10059528
2143 Ga0157372_10188739
2144 Ga0157372_10352323
2145 Ga0157372_10390444
2146 Ga0157372_11356269
2147 Ga0157375_10073401
2148 Ga0157375_10248755
2149 Ga0157375_10335458
2150 Ga0157375_10657732
2151 Ga0157375_11383542
2152 Ga0157375_11644918
2153 Ga0163163_10003044
2154 Ga0163163_10040832
2155 Ga0163163_10051769
2156 Ga0163163_10192569
2157 Ga0163163_10340898
2158 Ga0163163_10445884
2159 Ga0163163_10563764
2160 Ga0163163_10937098
2161 Ga0163163_11393492
2162 Ga0163163_11597050
2163 Ga0157380_11681187
2164 Ga0182008_10004678
2165 Ga0182008_10020896
2166 Ga0182008_10158242
2167 Ga0157377_10006706
2168 Ga0157377_10327853
2169 Ga0157377_10354088
2170 Ga0157377_11015507
2171 Ga0157379_10003409
2172 Ga0157379_10034772
2173 Ga0157379_10151447
2174 Ga0157379_10171237
2175 Ga0157379_10349408
2176 Ga0157379_10656943
2177 Ga0157379_11279596
2178 Ga0157376_10004658
2179 Ga0157376_10029519
2180 Ga0157376_10069210
2181 Ga0157376_10247471
2182 Ga0157376_10292498
2183 Ga0157376_10386907
2184 Ga0157376_10564970
2185 Ga0157376_11052914
2186 Ga0182007_10024426
2187 Ga0182007_10227876
2188 Ga0182005_1003699
2189 Ga0182005_1097660
2190 Ga0163161_10032069
2191 Ga0163161_10733077
2192 Ga0213876_10246687
2193 Ga0213875_10004172
2194 Ga0224712_10480315
2195 Ga0224570_100116
2196 Ga0224569_100063
2197 Ga0224569_103169
2198 Ga0224571_100789
2199 Ga0224572_1015389
2200 Ga0224572_1018281
2201 Ga0224572_1063119
2202 Ga0228598_1000002
2203 Ga0228598_1000333
2204 Ga0228598_1005227
2205 Ga0207697_10014218
2206 Ga0207656_10002371
2207 Ga0207692_10024383
2208 Ga0207692_10028069
2209 Ga0207692_10062910
2210 Ga0207692_10176892
2211 Ga0207692_10200597
2212 Ga0207692_10241162
2213 Ga0207692_10598833
2214 Ga0207692_10683838
2215 Ga0207692_10867374
2216 Ga0207642_10004640
2217 Ga0207642_10017427
2218 Ga0207642_10029862
2219 Ga0207642_10475266
2220 Ga0207710_10023501
2221 Ga0207710_10097775
2222 Ga0207710_10113691
2223 Ga0207688_10055000
2224 Ga0207680_10081689
2225 Ga0207680_10236894
2226 Ga0207680_10393459
2227 Ga0207647_10013732
2228 Ga0207647_10017367
2229 Ga0207647_10029904
2230 Ga0207685_10008705
2231 Ga0207685_10036045
2232 Ga0207685_10090705
2233 Ga0207685_10211595
2234 Ga0207685_10385944
2235 Ga0207699_10010406
2236 Ga0207699_10013470
2237 Ga0207699_10026320
2238 Ga0207699_10074634
2239 Ga0207699_10079595
2240 Ga0207699_10120186
2241 Ga0207699_10124813
2242 Ga0207699_10311647
2243 Ga0207699_10463961
2244 Ga0207699_10480103
2245 Ga0207699_10742188
2246 Ga0207645_10000125
2247 Ga0207645_10142836
2248 Ga0207645_10483605
2249 Ga0207643_10000488
2250 Ga0207643_10376564
2251 Ga0207705_10024329
2252 Ga0207705_10449652
2253 Ga0207684_10000223
2254 Ga0207684_10003613
2255 Ga0207684_10005360
2256 Ga0207684_10027576
2257 Ga0207684_10051827
2258 Ga0207684_10503490
2259 Ga0207654_10003381
2260 Ga0207654_10008923
2261 Ga0207654_10012212
2262 Ga0207654_10018603
2263 Ga0207654_10057660
2264 Ga0207654_10059531
2265 Ga0207654_10078327
2266 Ga0207654_10473775
2267 Ga0207654_10597928
2268 Ga0207707_10011464
2269 Ga0207707_10014133
2270 Ga0207707_10054384
2271 Ga0207707_10063047
2272 Ga0207707_10429255
2273 Ga0207695_10006382
2274 Ga0207695_10006994
2275 Ga0207695_10018543
2276 Ga0207695_10074781
2277 Ga0207695_10131230
2278 Ga0207695_10134629
2279 Ga0207695_10136999
2280 Ga0207695_10143928
2281 Ga0207695_10276584
2282 Ga0207695_10501488
2283 Ga0207695_10556484
2284 Ga0207695_10652576
2285 Ga0207695_10754790
2286 Ga0207671_10006781
2287 Ga0207671_10011713
2288 Ga0207671_10016797
2289 Ga0207671_10346429
2290 Ga0207671_10926364
2291 Ga0207693_10000524
2292 Ga0207693_10000961
2293 Ga0207693_10008223
2294 Ga0207693_10013230
2295 Ga0207693_10014832
2296 Ga0207693_10023945
2297 Ga0207693_10075765
2298 Ga0207693_10119681
2299 Ga0207693_10171491
2300 Ga0207693_10938887
2301 Ga0207663_10001734
2302 Ga0207663_10001859
2303 Ga0207663_10004743
2304 Ga0207663_10015680
2305 Ga0207663_10026236
2306 Ga0207663_10028036
2307 Ga0207663_10125516
2308 Ga0207663_10138418
2309 Ga0207663_10155129
2310 Ga0207663_10210328
2311 Ga0207663_10270634
2312 Ga0207663_10593226
2313 Ga0207663_10688618
2314 Ga0207660_10098507
2315 Ga0207660_10449225
2316 Ga0207660_10607143
2317 Ga0207660_10607628
2318 Ga0207657_10000242
2319 Ga0207657_10004544
2320 Ga0207657_10540098
2321 Ga0207649_10000177
2322 Ga0207649_10017954
2323 Ga0207649_10135827
2324 Ga0207652_10051559
2325 Ga0207652_10085723
2326 Ga0207652_10178854
2327 Ga0207652_10204269
2328 Ga0207652_10229348
2329 Ga0207652_10300171
2330 Ga0207652_11013346
2331 Ga0207646_10000348
2332 Ga0207646_10001267
2333 Ga0207646_10033930
2334 Ga0207646_10180094
2335 Ga0207646_10519122
2336 Ga0207681_10137815
2337 Ga0207681_10274769
2338 Ga0207694_10019580
2339 Ga0207694_10078313
2340 Ga0207694_10152856
2341 Ga0207694_10158395
2342 Ga0207694_10164503
2343 Ga0207694_10333271
2344 Ga0207650_10000072
2345 Ga0207650_10000078
2346 Ga0207650_10020813
2347 Ga0207650_10259650
2348 Ga0207650_10376014
2349 Ga0207659_10092620
2350 Ga0207659_10138410
2351 Ga0207659_10143413
2352 Ga0207659_10683307
2353 Ga0207659_11067929
2354 Ga0207687_10001734
2355 Ga0207687_10004355
2356 Ga0207687_10042892
2357 Ga0207687_10211196
2358 Ga0207687_10335612
2359 Ga0207687_10557002
2360 Ga0207700_10001427
2361 Ga0207700_10021787
2362 Ga0207700_10022935
2363 Ga0207700_10027238
2364 Ga0207700_10028863
2365 Ga0207700_10034336
2366 Ga0207700_10041527
2367 Ga0207700_10063437
2368 Ga0207700_10104271
2369 Ga0207700_10104872
2370 Ga0207700_10106753
2371 Ga0207700_10191786
2372 Ga0207700_10206384
2373 Ga0207700_10207494
2374 Ga0207700_10221360
2375 Ga0207700_10259524
2376 Ga0207700_10428458
2377 Ga0207700_10483438
2378 Ga0207700_10562919
2379 Ga0207700_10652505
2380 Ga0207700_11002775
2381 Ga0207700_11480480
2382 Ga0207700_11604665
2383 Ga0207664_10035117
2384 Ga0207664_10049398
2385 Ga0207664_10055328
2386 Ga0207664_10064901
2387 Ga0207664_10073009
2388 Ga0207664_10119385
2389 Ga0207664_10120971
2390 Ga0207664_10125915
2391 Ga0207664_10145912
2392 Ga0207664_10206778
2393 Ga0207664_10267429
2394 Ga0207664_10280458
2395 Ga0207664_10322698
2396 Ga0207664_10408277
2397 Ga0207664_10575630
2398 Ga0207664_10810414
2399 Ga0207664_10874765
2400 Ga0207664_10920441
2401 Ga0207644_10088536
2402 Ga0207644_11014172
2403 Ga0207690_10022280
2404 Ga0207690_10655260
2405 Ga0207706_10003412
2406 Ga0207706_10020486
2407 Ga0207706_10022082
2408 Ga0207686_10060006
2409 Ga0207686_10084322
2410 Ga0207686_10095150
2411 Ga0207709_10277959
2412 Ga0207670_10035848
2413 Ga0207670_10290118
2414 Ga0207670_11168690
2415 Ga0207669_10871523
2416 Ga0207704_10016976
2417 Ga0207704_10077655
2418 Ga0207704_10162300
2419 Ga0207704_10313466
2420 Ga0207665_10008885
2421 Ga0207665_10011904
2422 Ga0207665_10026521
2423 Ga0207665_10029957
2424 Ga0207665_10059495
2425 Ga0207665_10062057
2426 Ga0207665_10102172
2427 Ga0207665_10151101
2428 Ga0207665_10152393
2429 Ga0207665_10222969
2430 Ga0207665_10310186
2431 Ga0207665_10435044
2432 Ga0207665_10518534
2433 Ga0207665_10661700
2434 Ga0207665_10883712
2435 Ga0207691_10000853
2436 Ga0207691_10386750
2437 Ga0207691_10769395
2438 Ga0207711_10006085
2439 Ga0207711_10020209
2440 Ga0207711_10025091
2441 Ga0207711_10031024
2442 Ga0207711_10486305
2443 Ga0207711_10705534
2444 Ga0207711_11238307
2445 Ga0207711_11251049
2446 Ga0207689_10000495
2447 Ga0207689_10000707
2448 Ga0207689_10020706
2449 Ga0207661_10000008
2450 Ga0207661_10001451
2451 Ga0207661_10159466
2452 Ga0207661_10840439
2453 Ga0207661_11007782
2454 Ga0207679_10000177
2455 Ga0207679_10038189
2456 Ga0207667_10002400
2457 Ga0207667_10016688
2458 Ga0207667_10046866
2459 Ga0207667_10064709
2460 Ga0207667_10121862
2461 Ga0207667_10317984
2462 Ga0207667_10331765
2463 Ga0207667_10493290
2464 Ga0207667_10544159
2465 Ga0207651_10004381
2466 Ga0207651_10037247
2467 Ga0207651_10569137
2468 Ga0207651_10569485
2469 Ga0207712_11015935
2470 Ga0207668_10019365
2471 Ga0207640_10000843
2472 Ga0207640_10002817
2473 Ga0207640_10048913
2474 Ga0207640_10068120
2475 Ga0207640_10079331
2476 Ga0207640_10625896
2477 Ga0207658_10127573
2478 Ga0207658_10367425
2479 Ga0207658_10477139
2480 Ga0207677_10001146
2481 Ga0207677_10004684
2482 Ga0207677_10039291
2483 Ga0207677_10111614
2484 Ga0207677_10136790
2485 Ga0207677_10860316
2486 Ga0207677_10970364
2487 Ga0207703_10007481
2488 Ga0207703_10014707
2489 Ga0207703_10029526
2490 Ga0207703_10071736
2491 Ga0207703_10253027
2492 Ga0207703_10690093
2493 Ga0207703_10852301
2494 Ga0207703_11341010
2495 Ga0207639_10298587
2496 Ga0207639_10464596
2497 Ga0207639_10566526
2498 Ga0207678_10001196
2499 Ga0207678_10001295
2500 Ga0207708_10323073
2501 Ga0207702_10001116
2502 Ga0207702_10006348
2503 Ga0207702_10027482
2504 Ga0207702_10030402
2505 Ga0207702_10118325
2506 Ga0207702_10173068
2507 Ga0207702_10256585
2508 Ga0207702_10579191
2509 Ga0207702_10600752
2510 Ga0207702_10606411
2511 Ga0207702_10698639
2512 Ga0207641_10000237
2513 Ga0207641_10022076
2514 Ga0207641_10052884
2515 Ga0207641_10071506
2516 Ga0207641_10132612
2517 Ga0207641_10199655
2518 Ga0207641_10224754
2519 Ga0207641_10286867
2520 Ga0207641_10404294
2521 Ga0207648_10010733
2522 Ga0207648_10014004
2523 Ga0207648_10731050
2524 Ga0207648_11660121
2525 Ga0207676_10000050
2526 Ga0207676_10012503
2527 Ga0207676_10081753
2528 Ga0207674_10000130
2529 Ga0207674_10000269
2530 Ga0207674_10048042
2531 Ga0207674_10238253
2532 Ga0207674_10358129
2533 Ga0207674_10538057
2534 Ga0207674_10898673
2535 Ga0207675_100191788
2536 Ga0207675_100715655
2537 Ga0207683_10000139
2538 Ga0207683_10082676
2539 Ga0207683_10112642
2540 Ga0207683_10187805
2541 Ga0207683_10294985
2542 Ga0207698_10055373
2543 Ga0207698_10060280
2544 Ga0207698_10080622
2545 Ga0207698_10696240
2546 Ga0207698_10717698
2547 Ga0265354_1007310
2548 Ga0265356_1000067
2549 Ga0265356_1007396
2550 Ga0265355_1002063
2551 Ga0265355_1008363
2552 Ga0268266_10004469
2553 Ga0268266_10079038
2554 Ga0268266_10614477
2555 Ga0268265_10022237
2556 Ga0268265_10593707
2557 Ga0268264_10004223
2558 Ga0268264_10171272
2559 Ga0268264_10238198
2560 Ga0268264_10453458
2561 Ga0265326_10102496
2562 Ga0265319_1042553
2563 Ga0265318_10030718
2564 Ga0265338_10003647
2565 Ga0265338_10062736
2566 Ga0265338_10068968
2567 Ga0265338_10094425
2568 Ga0265338_10160055
2569 Ga0265338_10191003
2570 Ga0265324_10008993
2571 Ga0265762_1004268
2572 Ga0265770_1010176
2573 Ga0265765_1000153
2574 Ga0265760_10002485
2575 Ga0265760_10005151
2576 Ga0265760_10014930
2577 Ga0265760_10048912
2578 Ga0265330_10033168
2579 Ga0265330_10163731
2580 Ga0265332_10028089
2581 Ga0265332_10072165
2582 Ga0265332_10072223
2583 Ga0265328_10005736
2584 Ga0265328_10047778
2585 Ga0265320_10009889
2586 Ga0265325_10000515
2587 Ga0265325_10056890
2588 Ga0265325_10095371
2589 Ga0265325_10131863
2590 Ga0265325_10184316
2591 Ga0265329_10048292
2592 Ga0265340_10001090
2593 Ga0265340_10024598
2594 Ga0265340_10069313
2595 Ga0265339_10026663
2596 Ga0265339_10027470
2597 Ga0265339_10034507
2598 Ga0265339_10072131
2599 Ga0265339_10234287
2600 Ga0265331_10003381
2601 Ga0265331_10006153
2602 Ga0265331_10048760
2603 Ga0265331_10105229
2604 Ga0265316_10001130
2605 Ga0265316_10003692
2606 Ga0265316_10006205
2607 Ga0265316_10009598
2608 Ga0265316_10030197
2609 Ga0265316_10041585
2610 Ga0265316_10144087
2611 Ga0265316_10203343
2612 Ga0265316_10523500
2613 Ga0265313_10002383
2614 Ga0265314_10001611
2615 Ga0265314_10008835
2616 Ga0265314_10103896
2617 Ga0265342_10056404
2618 Ga0307405_10251639
2619 Ga0307405_10365018
2620 Ga0307410_10001021
2621 Ga0307406_10037832
2622 Ga0307406_10445054
2623 Ga0307407_10307731
2624 Ga0307416_100093784
2625 Ga0307416_100224104
2626 Ga0307414_10074236
2627 Ga0307415_101099249
2628 Ga0373930_0002114
2629 Ga0373926_0007641
2630 Ga0373926_0020857
2631 Ga0373926_0028374
2632 Ga0373926_0187838
2633 Ga0373928_0028357
2634 Ga0373934_0031847
2635 Ga0373934_0232490
2636 Ga0373940_0056696
2637 Ga0373944_0011305
2638 Ga0373923_0068497
2639 Ga0373923_0085489
2640 Ga0373923_0194956
2641 Ga0373932_0091587
2642 Ga0373936_0000172
2643 Ga0373936_0012995
2644 Ga0373936_0102549
2645 Ga0373936_0410490
2646 Ga0373939_0123489
2647 Ga0373941_0074815
2648 Ga0373945_0001375
2649 Ga0373945_0002395
2650 Ga0373945_0128264
2651 Ga0373945_0134718
2652 Ga0373953_0003772
2653 Ga0373953_0192043
2654 Ga0373954_0007793
2655 Ga0373954_0013276
2656 Ga0373954_0169065
2657 Ga0373956_0036548
2658 Ga0373956_0039447
2659 Ga0373956_0054467
2660 Ga0373957_0017752
2661 Ga0373943_0000055
2662 Ga0373943_0003910
2663 Ga0373943_0020297
2664 Ga0373943_0226425
2665 Ga0373943_0344765
2666 Ga0373946_0029038
2667 Ga0373946_0194772
2668 Ga0373955_0008998
2669 Ga0373955_0420749
2670 Ga0373955_0429442
2671 Ga0373961_0008159
2672 Ga0373961_0025165
2673 Ga0373924_0000091
2674 Ga0373924_0014882
2675 Ga0373924_0026543
2676 Ga0373924_0090317
2677 Ga0373931_0053587
2678 Ga0373931_0059959
2679 Ga0373931_0081062
2680 Ga0373931_0084890
2681 Ga0373931_0504067
2682 Ga0373931_0602238
2683 Ga0373935_0002091
2684 Ga0373935_0010861
2685 Ga0373935_0020803
2686 Ga0373935_0052573
2687 Ga0373935_0082770
2688 Ga0373935_0108297
2689 Ga0373935_0126285
2690 Ga0373935_0199832
2691 Ga0373935_0218085
2692 Ga0373935_0309731
2693 Ga0373935_0423798
2694 Ga0373935_1157644
2695 Ga0373927_0000378
2696 Ga0373927_0001571
2697 Ga0373927_0005079
2698 Ga0373927_0013728
2699 Ga0373927_0096748
2700 Ga0373927_0153053
2701 Ga0373927_0198094
2702 Ga0373927_0416032
2703 Ga0373927_0499868
2704 Ga0373927_0621639
2705 Ga0373933_0016430
2706 Ga0373933_0192365
2707 Ga0373933_0331569
2708 Ga0373933_0359390
2709 Ga0373933_0506434
2710 Ga0373933_0680214
2711 Ga0373947_0000167
2712 Ga0373947_0001658
2713 Ga0373947_0008836
2714 Ga0373947_0050887
2715 Ga0373947_0057197
2716 Ga0373947_0061444
2717 Ga0373947_0100146
2718 Ga0373947_0471052
2719 Ga0373947_0530924
2720 Ga0373947_0668456
2721 Ga0373947_0989113
2722 Ga0373937_0000027
2723 Ga0373937_0014721
2724 Ga0373937_0018754
2725 Ga0373937_0020676
2726 Ga0373937_0041141
2727 Ga0373937_0047249
2728 Ga0373937_0076681
2729 Ga0373937_0094328
2730 Ga0373937_0105712
2731 Ga0373937_0238504
2732 Ga0373937_0310966
2733 Ga0373937_0360043
2734 Ga0373937_0374832
2735 Ga0373937_0832647
2736 Ga0373937_1055870
2737 Ga0373937_1312534
2738 Ga0373925_0000224
2739 Ga0373925_0015611
2740 Ga0373925_0030136
2741 Ga0373925_0034052
2742 Ga0373925_0038481
2743 Ga0373925_0073647
2744 Ga0373925_0085587
2745 Ga0373925_0111187
2746 Ga0373925_0122640
2747 Ga0373925_0124740
2748 Ga0373925_0176346
2749 Ga0373925_0180170
2750 Ga0373925_0280191
2751 Ga0373925_1142123
2752 Ga0436364_0135933
2753 Ga0436364_1194151
2754 Ga0395901_0380383
2755 Ga0436365_1136717
2756 Ga0436365_1311817
2757 Ga0436365_1314150
2758 Ga0436365_1559181
2759 Ga0436365_1751127
2760 Ga0436360_0673759
2761 Ga0436361_0293375
2762 Ga0436363_0356673
2763 Ga0436363_0862048
2764 Ga0436363_1295381
2765 Ga0436362_1047223
2766 Ga0451849_1404825
2767 Ga0451853_1241128
2768 Ga0451577_1169536
2769 Ga0466969_0257031
2770 Ga0466966_0147888
2771 Ga0466966_0228892
2772 Ga0466961_0263248
2773 Ga0466963_0003772
2774 Ga0466963_0039609
2775 Ga0466963_0147368
2776 Ga0466964_0060019
2777 Ga0466964_0130794
2778 Ga0466971_0314619
2779 Ga0466957_0076950
2780 Ga0466957_0314525
2781 Ga0466959_0183933
2782 Ga0451576_0097819
2783 Ga0451576_0220984
2784 Ga0451576_0288790
2785 Ga0451576_1428665
2786 Ga0466967_0017316
2787 Ga0466967_0046110
2788 Ga0466967_0055367
2789 Ga0466967_0093669
2790 Ga0466967_0105221
2791 Ga0466967_0338174
2792 Ga0466967_0678854
2793 Ga0495629_0256515
2794 Ga0495629_0698185
2795 Ga0495651_0008434
2796 Ga0495651_0050799
2797 Ga0495651_0119950
2798 Ga0495651_0140835
2799 Ga0495651_0265564
2800 Ga0495651_0449636
2801 Ga0495653_0045879
2802 Ga0495653_0107349
2803 Ga0495653_0427750
2804 Ga0495580_0001464
2805 Ga0495580_0003534
2806 Ga0495580_0006199
2807 Ga0495580_0006438
2808 Ga0495580_0017479
2809 Ga0495580_0017970
2810 Ga0495580_0018597
2811 Ga0495580_0022698
2812 Ga0495580_0026438
2813 Ga0495580_0046088
2814 Ga0495580_0056536
2815 Ga0495580_0063028
2816 Ga0495580_0063517
2817 Ga0495580_0089990
2818 Ga0495580_0111264
2819 Ga0495580_0161973
2820 Ga0495580_0224717
2821 Ga0495580_0262763
2822 Ga0495580_0286305
2823 Ga0495580_0362672
2824 Ga0495580_0416062
2825 Ga0495582_0012871
2826 Ga0495582_0074764
2827 Ga0495582_0101868
2828 Ga0495582_0214216
2829 Ga0495582_0521101
2830 Ga0495605_0166527
2831 Ga0495639_0074315
2832 Ga0495662_0030179
2833 Ga0495662_0245639
2834 Ga0495664_0003847
2835 Ga0495664_0094774
2836 Ga0495664_0164274
2837 Ga0495664_0212461
2838 Ga0495664_0333026
2839 Ga0495585_0441807
2840 Ga0495594_0152024
2841 Ga0495608_0082532
2842 Ga0495608_0108032
2843 Ga0495608_0159226
2844 Ga0495618_0221675
2845 Ga0495618_0253768
2846 Ga0495628_0023575
2847 Ga0495628_0244132
2848 Ga0495628_0428850
2849 Ga0495628_0489103
2850 Ga0495628_0748032
2851 Ga0495630_0013505
2852 Ga0495630_0051815
2853 Ga0495630_0058816
2854 Ga0495630_0109713
2855 Ga0495630_0299420
2856 Ga0495666_0208869
2857 Ga0495666_0227609
2858 Ga0495642_0237719
2859 Ga0495642_0340052
2860 Ga0495652_0168939
2861 Ga0495652_0349477
2862 Ga0495652_0395440
2863 Ga0495665_0021545
2864 Ga0495665_0025270
2865 Ga0495665_0034989
2866 Ga0495665_0088377
2867 Ga0495665_0203784
2868 Ga0495665_0236414
2869 Ga0495665_0428360
2870 Ga0495640_0058921
2871 Ga0495640_0085863
2872 Ga0495640_0433249
2873 Ga0495640_0583376
2874 Ga0495586_0133604
2875 Ga0495587_0066973
2876 Ga0495587_0072064
2877 Ga0495587_0292904
2878 Ga0495587_0373681
2879 Ga0495645_0022167
2880 Ga0495645_0035649
2881 Ga0495645_0071844
2882 Ga0495645_0096994
2883 Ga0495645_0170135
2884 Ga0495645_0171349
2885 Ga0495645_0210936
2886 Ga0495645_0239024
2887 Ga0495667_0024521
2888 Ga0495667_0052413
2889 Ga0495667_0069290
2890 Ga0495667_0080351
2891 Ga0495667_0249252
2892 Ga0495668_0097647
2893 Ga0495634_0029185
2894 Ga0495634_0093797
2895 Ga0495635_0033329
2896 Ga0495635_0073100
2897 Ga0495635_0128451
2898 Ga0495635_0380479
2899 Ga0495635_0429997
2900 Ga0495635_0539678
2901 Ga0495635_0540406
2902 Ga0495588_0051739
2903 Ga0495657_0338759
2904 Ga0495657_0361939
2905 Ga0495657_0417701
2906 Ga0495657_0733268
2907 Ga0495599_0223933
2908 Ga0495599_0358715
2909 Ga0495599_0367222
2910 Ga0495623_0030436
2911 Ga0495623_0049156
2912 Ga0495623_0053782
2913 Ga0495623_0053948
2914 Ga0495623_0092747
2915 Ga0495623_0157856
2916 Ga0495646_0216913
2917 Ga0495646_0472851
2918 Ga0495658_0148169
2919 Ga0495658_0293942
2920 Ga0495669_0093846
2921 Ga0495669_0096014
2922 Ga0495669_0235678
2923 Ga0495613_0129225
2924 Ga0495613_0219233
2925 Ga0495613_0252098
2926 Ga0495624_0079166
2927 Ga0495624_0207276
2928 Ga0495624_0482240
2929 Ga0495600_0105863
2930 Ga0495600_0209420
2931 Ga0495581_0346156
2932 Ga0495581_0448424
2933 Ga0495604_0028727
2934 Ga0495604_0223775
2935 Ga0495604_0315374
2936 Ga0495604_0328327
2937 Ga0495604_0378280
2938 Ga0495604_0463835
2939 Ga0495674_0018563
2940 Ga0495674_0049400
2941 Ga0495674_0053968
2942 Ga0495674_0076241
2943 Ga0495674_0214478
2944 Ga0495674_0299726
2945 Ga0495674_0334738
2946 Ga0495674_0578558
2947 Ga0495676_0152757
2948 Ga0495675_0015725
2949 Ga0495675_0034121
2950 Ga0495675_0116060
2951 Ga0495675_0128649
2952 Ga0495675_0204648
2953 Ga0495675_0208231
2954 Ga0495675_0383412
2955 Ga0495675_0414371
2956 Ga0495675_0760431
2957 Ga0495677_0034216
2958 Ga0495684_0016103
2959 Ga0495684_0054549
2960 Ga0495684_0083283
2961 Ga0495684_0112561
2962 Ga0495684_0220029
2963 Ga0495684_0460381
2964 Ga0495593_0018737
2965 Ga0495593_0050171
2966 Ga0495602_0087286
2967 Ga0495602_0104306
2968 Ga0495602_0185006
2969 Ga0495602_0233374
2970 Ga0495602_0310671
2971 Ga0495602_0496241
2972 Ga0495602_0630559
2973 Ga0495614_0111573
2974 Ga0495614_0339422
2975 Ga0496100_0090533
2976 Ga0496100_0121910
2977 Ga0496100_0172721
2978 Ga0496100_0208629
2979 Ga0496100_0335090
2980 Ga0496100_0495284
2981 Ga0496101_0032991
2982 Ga0496101_0120052
2983 Ga0496101_0275424
2984 Ga0496101_0390554
2985 Ga0496101_0650150
2986 Ga0496102_0020175
2987 Ga0496102_0089212
2988 Ga0496102_0152540
2989 Ga0496102_0203032
2990 Ga0496102_0335279
2991 Ga0496102_0503319
2992 Ga0496102_0611992
2993 Ga0496103_0022488
2994 Ga0496103_0032022
2995 Ga0496103_0061583
2996 Ga0496103_0616247
2997 Ga0496104_0003663
2998 Ga0496104_0017687
2999 Ga0496104_0093755
3000 Ga0496104_0209709
3001 Ga0496104_0325362
3002 Ga0496104_0338449
3003 Ga0496104_0777467
3004 Ga0496105_0008105
3005 Ga0496105_0040114
3006 Ga0496105_0603685
3007 Ga0496105_0666460
3008 Ga0496106_0034342
3009 Ga0496106_0063470
3010 Ga0496106_0641193
3011 Ga0496107_0223273
3012 Ga0496108_0000106
3013 Ga0496108_0216047
3014 Ga0496109_0000133
3015 Ga0496109_0167149
3016 Ga0496109_0332953
3017 Ga0496109_0370111
3018 Ga0496109_1041215
3019 Ga0496110_0002218
3020 Ga0496110_0186389
3021 Ga0496110_0890889
3022 Ga0496111_0004591
3023 Ga0496112_0000028
3024 Ga0496112_0014386
3025 Ga0496112_0030600
3026 Ga0496112_0043741
3027 Ga0496112_0055340
3028 Ga0496112_0099017
3029 Ga0496112_0162289
3030 Ga0496112_0217038
3031 Ga0496112_0331081
3032 Ga0496112_0368375
3033 Ga0496112_1137669
3034 Ga0496112_1320429
3035 Ga0496113_0000179
3036 Ga0496113_0013416
3037 Ga0496113_0091882
3038 Ga0496113_0326988
3039 Ga0496114_0062374
3040 Ga0496115_0030865
3041 Ga0496115_1078642
3042 Ga0501292_039726
3043 Ga0501299_013919
3044 Ga0501073_0087107
3045 Ga0501216_060176
3046 Ga0501217_115749
3047 Ga0501261_021495
3048 Ga0501221_038951
3049 Ga0501225_0030165
3050 Ga0501083_0114773
3051 Ga0501268_083469
3052 nmdc:mga05p37_668048_c1
3053 nmdc:mga05p37_887748_c1
3054 nmdc:mga08y16_962509_c1
3055 nmdc:mga0n895_1051089_c1
3056 nmdc:mga0n895_123435_c1
3057 nmdc:mga0n895_1547_c1
3058 nmdc:mga0n895_4579_c1
3059 nmdc:mga0rr50_16895_c1
3060 nmdc:mga0rr50_433943_c1
3061 nmdc:mga08x19_14306_c1
3062 nmdc:mga08x19_178361_c1
3063 nmdc:mga08x19_191779_c1
3064 nmdc:mga08x19_2368_c1
3065 nmdc:mga08x19_27172_c1
3066 nmdc:mga08x19_6108_c1
3067 nmdc:mga08x19_761213_c1
3068 nmdc:mga08x19_7696_c1
3069 nmdc:mga0a205_806225_c1
3070 nmdc:mga0a205_947_c1
3071 Ga0495601_0217699
3072 Ga0495619_0064914
3073 Ga0495619_0596418
3074 Ga0495619_0597208
3075 Ga0495619_0615705
3076 Ga0495619_0899215
3077 Ga0500590_059292
3078 Ga0501084_0080902
3079 Ga0501082_0002389
3080 Ga0501082_0129551

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

2

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9698 1 149
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9597 1 149
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9477 2 160
6jf5-assembly1.cif.gz_A k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9464 1 146
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9444 1 165
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9698 1 149 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9595 1 149 3.90.45.10
af_A0A0R0ELH1_60_189_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9543 3 105 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9404 1 149 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9322 1 149 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A1G7GEZ1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9971 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V9AZN5-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9965 2 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V9T8P9-F1-model_v4 Peptide deformylase 0.9961 72 169 GO:0042586
GO:0043686
GO:0046872
AF-A0A2W0B433-F1-model_v4 Peptide deformylase 0.9951 25 169 GO:0042586
GO:0043686
AF-A0A7D8BBN9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9944 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map