F494579

General Info

Members Datasets Scaffolds Average Seq Length
1528 1053 874 212

Family's Representative Sequence

Representative Sequence 2124908027|MRS2a_Contig_34|MRS2a_00237370
Length 240
Sequence VSXCXXXXSVSXSNSNDPVRAGRXXIAPXKVXLTMNYQLNFAAVWRXFDTLLAGLCVIGLLMAFALLSKHRALRXLASVYVTVIRNTPILVLILLIYFALPSLGIRLDKIPSFIITLSLYAGAXXTEVXRGGXLSIPKGXREAGLAIGXGEWQVKAYXTVPVMLRNVLPAXSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVXETWLVTTALYVAACYLIAMMLRYLXQRLAIRR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
10 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
16 2511231004 Pseudomonas sp. GM102 Isolate Nodule
17 2511231007 Pseudomonas sp. GM18 Isolate Nodule
18 2511231010 Pseudomonas sp. GM25 Isolate Nodule
19 2511231011 Pseudomonas sp. GM30 Isolate Nodule
20 2511231012 Pseudomonas sp. GM33 Isolate Nodule
21 2511231014 Pseudomonas sp. GM48 Isolate Nodule
22 2511231015 Pseudomonas sp. GM49 Isolate Nodule
23 2511231016 Pseudomonas sp. GM50 Isolate Nodule
24 2511231017 Pseudomonas sp. GM55 Isolate Nodule
25 2511231018 Pseudomonas sp. GM60 Isolate Nodule
26 2511231019 Pseudomonas sp. GM67 Isolate Nodule
27 2511231020 Pseudomonas sp. GM74 Isolate Nodule
28 2511231022 Pseudomonas sp. GM79 Isolate Nodule
29 2511231023 Pseudomonas sp. GM80 Isolate Nodule
30 2511231031 Pseudomonas sp. GM16 Isolate Nodule
31 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
32 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
33 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
34 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
35 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
36 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
37 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
38 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
39 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
40 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
41 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
42 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
43 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
44 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
45 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
46 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
47 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
48 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
49 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
50 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
51 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
52 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
53 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
54 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
55 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
56 2516143018 Ensifer sp. BR816 Isolate Nodule
57 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
58 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
59 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
60 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
61 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
62 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
63 2519899620 Rhizobium sp. Pop5 Isolate Nodule
64 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
65 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
66 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
67 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
68 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
69 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
70 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
71 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
72 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
73 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
74 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
75 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
76 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
77 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
78 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
79 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
80 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
81 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
82 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
83 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
84 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
85 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
86 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
87 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
88 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
89 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
90 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
91 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
92 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
93 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
94 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
95 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
96 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
97 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
98 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
99 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
100 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
101 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
102 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
103 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
104 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
105 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
106 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
107 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
108 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
109 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
110 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
111 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
112 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
113 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
114 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
115 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
116 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
117 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
118 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
119 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
120 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
121 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
122 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
123 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
124 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
125 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
126 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
127 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
128 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
129 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
130 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
131 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
132 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
133 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
134 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
135 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
136 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
137 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
138 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
139 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
140 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
141 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
142 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
143 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
144 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
145 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
146 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
147 2643221557 Ensifer sp. Root558 Isolate Unclassified
148 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
149 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
150 2643221610 Ensifer sp. Root74 Isolate Unclassified
151 2643221618 Ensifer sp. Root231 Isolate Unclassified
152 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
153 2643221626 Ensifer sp. Root31 Isolate Unclassified
154 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
155 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
156 2643221655 Ensifer sp. Root1252 Isolate Unclassified
157 2643221659 Ensifer sp. Root127 Isolate Unclassified
158 2643221668 Ensifer sp. Root423 Isolate Unclassified
159 2643221675 Ensifer sp. Root1298 Isolate Unclassified
160 2643221680 Ensifer sp. Root1312 Isolate Unclassified
161 2643221688 Rhizobium sp. Root482 Isolate Unclassified
162 2643221698 Ensifer sp. Root142 Isolate Unclassified
163 2643221712 Ensifer sp. Root258 Isolate Unclassified
164 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
165 2643221726 Ensifer sp. Root954 Isolate Unclassified
166 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
167 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
168 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
169 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
170 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
171 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
172 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
173 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
174 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
175 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
176 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
177 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
178 2718217882 Rhizobium sp. N741 Isolate Nodule
179 2718217927 Rhizobium sp. N324 Isolate Nodule
180 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
181 2718218009 Rhizobium sp. N561 Isolate Nodule
182 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
183 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
184 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
185 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
186 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
187 2718218363 Rhizobium sp. N113 Isolate Nodule
188 2718218365 Rhizobium sp. N731 Isolate Nodule
189 2718218366 Rhizobium sp. N621 Isolate Nodule
190 2718218423 Rhizobium sp. N941 Isolate Nodule
191 2721755514 Rhizobium sp. N6212 Isolate Nodule
192 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
193 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
194 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
195 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
196 2721755809 Rhizobium sp. N541 Isolate Nodule
197 2721755810 Rhizobium sp. N871 Isolate Nodule
198 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
199 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
200 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
201 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
202 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
203 2728369365 Rhizobium sp. N1341 Isolate Nodule
204 2728369397 Rhizobium sp. N1314 Isolate Nodule
205 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
206 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
207 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
208 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
209 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
210 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
211 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
212 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
213 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
214 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
215 2738543024 Aminobacter sp. AP02 Isolate Unclassified
216 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
217 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
218 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
219 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
220 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
221 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
222 2773857670 Pseudomonas sp. 478 Isolate Unclassified
223 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
224 2773857673 Pseudomonas sp. 443 Isolate Unclassified
225 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
226 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
227 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
228 2784132063 Pseudomonas sp. 424 Isolate Unclassified
229 2784132072 Pseudomonas sp. 460 Isolate Unclassified
230 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
231 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
232 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
233 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
234 2791355256 Rhizobium sp. M10 Isolate Nodule
235 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
236 2791355260 Rhizobium sp. L9 Isolate Nodule
237 2791355261 Rhizobium sp. J15 Isolate Nodule
238 2791355262 Rhizobium sp. M1 Isolate Nodule
239 2791355263 Rhizobium chutanense C5 Isolate Nodule
240 2791355264 Rhizobium sp. S9 Isolate Nodule
241 2791355265 Rhizobium sp. H4 Isolate Nodule
242 2791355266 Rhizobium sp. L43 Isolate Nodule
243 2791355267 Rhizobium sp. L18 Isolate Nodule
244 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
245 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
246 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
247 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
248 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
249 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
250 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
251 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
252 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
253 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
254 2802429633 Rhizobium anhuiense J3 Isolate Nodule
255 2802429634 Rhizobium anhuiense S10 Isolate Nodule
256 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
257 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
258 2802429637 Rhizobium anhuiense C15 Isolate Nodule
259 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
260 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
261 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
262 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
263 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
264 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
265 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
266 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
267 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
268 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
269 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
270 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
271 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
272 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
273 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
274 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
275 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
276 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
277 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
278 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
279 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
280 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
281 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
282 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
283 2838048938 Rhizobium pisi 27/80 Isolate Nodule
284 2838061910 Rhizobium phaseoli L15 Isolate Nodule
285 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
286 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
287 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
288 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
289 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
290 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
291 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
292 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
293 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
294 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
295 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
296 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
297 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
298 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
299 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
300 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
301 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
302 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
303 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
304 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
305 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
306 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
307 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
308 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
309 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
310 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
311 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
312 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
313 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
314 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
315 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
316 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
317 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
318 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
319 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
320 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
321 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
322 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
323 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
324 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
325 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
326 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
327 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
328 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
329 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
330 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
331 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
332 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
333 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
334 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
335 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
336 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
337 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
338 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
339 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
340 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
341 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
342 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
343 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
344 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
345 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
346 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
347 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
348 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
349 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
350 2844163670 Ensifer sp. 1H6 Isolate Unclassified
351 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
352 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
353 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
354 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
355 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
356 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
357 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
358 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
359 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
360 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
361 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
362 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
363 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
364 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
365 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
366 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
367 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
368 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
369 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
370 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
371 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
372 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
373 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
374 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
375 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
376 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
377 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
378 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
379 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
380 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
381 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
382 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
383 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
384 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
385 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
386 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
387 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
388 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
389 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
390 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
391 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
392 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
393 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
394 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
395 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
396 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
397 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
398 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
399 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
400 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
401 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
402 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
403 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
404 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
405 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
406 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
407 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
408 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
409 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
410 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
411 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
412 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
413 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
414 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
415 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
416 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
417 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
418 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
419 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
420 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
421 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
422 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
423 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
424 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
425 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
426 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
427 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
428 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
429 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
430 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
431 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
432 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
433 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
434 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
435 2933599457 Rhizobium phaseoli M3 Isolate Nodule
436 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
437 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
438 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
439 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
440 2936381700 Rhizobium chutanense C16 Isolate Unclassified
441 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
442 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
443 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
444 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
445 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
446 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
447 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
448 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
449 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
450 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
451 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
452 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
453 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
454 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
455 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
456 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
457 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
458 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
459 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
460 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
461 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
462 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
463 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
464 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
465 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
466 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
467 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
468 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
469 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
470 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
471 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
472 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
473 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
474 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
475 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
476 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
477 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
478 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
479 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
480 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
481 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
482 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
483 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
484 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
485 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
486 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
487 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
488 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
489 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
490 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
491 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
492 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
493 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
494 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
495 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
496 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
497 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
498 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
499 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
500 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
501 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
502 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
503 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
504 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
505 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
506 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
507 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
508 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
509 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
510 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
511 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
512 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
513 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
514 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
515 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
516 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
517 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
518 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
519 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
520 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
521 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
522 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
523 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
524 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
525 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
526 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
527 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
528 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
529 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
530 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
531 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
532 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
533 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
534 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
535 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
536 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
537 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
538 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
539 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
540 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
541 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
542 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
543 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
544 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
545 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
546 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
547 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
548 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
549 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
550 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
551 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
552 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
553 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
554 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
555 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
556 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
557 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
558 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
559 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
560 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
561 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
562 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
563 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
564 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
565 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
566 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
567 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
568 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
569 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
570 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
571 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
572 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
573 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
574 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
575 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
576 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
577 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
578 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
579 2996887358 Rhizobium sp. R711 Isolate Nodule
580 2996893221 Rhizobium sp. R635 Isolate Nodule
581 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
582 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
583 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
584 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
585 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
586 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
587 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
588 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
589 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
590 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
591 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
592 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
593 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
594 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
595 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
596 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
597 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
598 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
599 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
600 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
601 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
602 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
603 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
604 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
605 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
606 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
607 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
608 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
609 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
610 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
611 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
612 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
613 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
614 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
615 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
616 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
617 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
618 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
619 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
620 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
621 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
622 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
623 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
624 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
625 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
626 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
627 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
628 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
629 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
630 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
631 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
632 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
633 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
634 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
635 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
636 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
637 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
638 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
639 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
640 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
641 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
642 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
643 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
644 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
645 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
646 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
647 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
648 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
649 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
650 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
651 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
652 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
653 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
654 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
655 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
656 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
657 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
658 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
659 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
660 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
661 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
662 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
663 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
664 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
665 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
666 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
667 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
668 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
669 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
670 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
671 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
672 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
673 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
674 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
675 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
676 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
677 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
678 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
679 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
680 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
681 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
682 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
683 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
684 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
685 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
686 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
687 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
688 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
689 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
690 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
691 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
692 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
693 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
694 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
695 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
696 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
697 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
698 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
699 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
700 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
701 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
702 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
703 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
704 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
705 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
706 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
707 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
708 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
709 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
710 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
711 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
712 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
713 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
714 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
715 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
716 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
717 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
718 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
719 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
720 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
721 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
722 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
723 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
724 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
725 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
726 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
727 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
728 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
729 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
730 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
731 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
732 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
733 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
734 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
735 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
736 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
737 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
738 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
739 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
740 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
741 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
742 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
743 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
744 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
745 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
746 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
747 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
748 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
749 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
750 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
774 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
775 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
776 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
777 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
778 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
779 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
780 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
781 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
782 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
783 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
784 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
785 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
786 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
788 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
790 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
791 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
792 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
793 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
794 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
795 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
796 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
797 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
798 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
799 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
800 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
801 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
802 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
803 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
804 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
805 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
806 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
807 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
808 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
809 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
810 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
811 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
812 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
813 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
814 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
815 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
816 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
817 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
818 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
819 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
820 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
821 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
822 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
823 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
824 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
825 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
826 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
827 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
828 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
829 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
830 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
831 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
832 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
833 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
834 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
835 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
836 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
837 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
838 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
839 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
840 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
841 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
842 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
843 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
844 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
845 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
846 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
847 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
848 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
849 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
850 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
851 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
852 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
853 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
854 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
855 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
856 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
857 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
858 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
859 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
860 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
861 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
862 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
863 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
864 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
865 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
866 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
867 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
868 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
869 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
870 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
871 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
872 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
873 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
874 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
875 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
876 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
877 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
878 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
879 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
880 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
881 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
882 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
883 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
884 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
885 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
886 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
887 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
888 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
889 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
890 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
891 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
892 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
893 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
894 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
895 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
896 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
897 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
898 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
899 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
900 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
901 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
902 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
903 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
904 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
905 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
906 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
907 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
908 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
909 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
910 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
911 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
912 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
913 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
914 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
915 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
916 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
917 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
918 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
919 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
920 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
921 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
922 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
923 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
924 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
925 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
926 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
927 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
928 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
929 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
930 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
931 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
932 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
933 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
934 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
935 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
936 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
937 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
938 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
939 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
940 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
941 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
942 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
943 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
944 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
945 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
946 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
947 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
948 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
949 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
950 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
951 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
952 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
953 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
954 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
955 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
956 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
957 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
958 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
959 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
960 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
961 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
962 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
963 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
964 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
965 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
966 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
967 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
968 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
969 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
970 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
971 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
972 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
973 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
974 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
975 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
976 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
977 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
978 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
979 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
980 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
981 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
982 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
983 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
984 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
985 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
986 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
987 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
988 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
989 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
990 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
991 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
992 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
993 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
994 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
995 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
996 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
997 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
998 8005258706 Rhizobium sp. R693 Isolate Nodule
999 8005275841 Rhizobium sp. N4311 Isolate Nodule
1000 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1001 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1002 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1003 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1004 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1005 8005321885 Rhizobium sp. R72 Isolate Nodule
1006 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1007 8005382845 Rhizobium sp. R634 Isolate Nodule
1008 8005395548 Rhizobium sp. R339 Isolate Nodule
1009 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1010 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1011 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1012 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1013 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1014 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1015 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1016 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1017 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1018 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1019 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1020 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1021 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1022 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1023 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1024 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1025 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1026 8018176218 Rhizobium sp. N122 Isolate Nodule
1027 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1028 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1029 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1030 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1031 8024501048 Rhizobium sp. H4 Isolate Nodule
1032 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1033 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1034 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1035 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1036 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1037 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1038 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1039 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1040 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1041 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1042 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1043 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1044 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1045 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1046 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1047 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1048 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1049 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1050 8056382006 Rhizobium croatiense 13T Isolate Nodule
1051 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1052 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1053 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.2
Metatranscriptomes 0
Isolates 42.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 11.65
Nodule 27.62
Rhizoplane 3.8
Rhizosphere 43.91
Stem 0
Stem Tuber 0
Unclassified 12.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_34 2124908027 Bacteria 17902
2 SwRhRL2b_contig_1025407 2162886007 Bacteria 1590
3 JGI24740J21852_10007416 3300001979 Bacteria 4461
4 JGI25156J39149_1000468 3300002705 Bacteria 24309
5 JGI25162J39368_1000013 3300002737 Bacteria 343384
6 JGI25154J39366_1000486 3300002738 Bacteria 20483
7 JGI25154J39366_1014315 3300002738 Bacteria 836
8 JGI25157J39369_1000494 3300002741 Bacteria 24309
9 JGI25163J39215_1000525 3300002771 Bacteria 11261
10 JGI25164J39214_1000005 3300002772 Bacteria 343384
11 JGI25152J39213_1000197 3300002773 Bacteria 40490
12 JGI25152J39213_1015488 3300002773 Bacteria 1502
13 JGI25151J46595_10000472 3300003187 Bacteria 38112
14 JGI25165J46597_1000340 3300003214 Bacteria 54174
15 JGI25165J46597_1000610 3300003214 Bacteria 30465
16 JGI25165J46597_1008934 3300003214 Bacteria 1536
17 JGI25153J46596_10000948 3300003215 Bacteria 17603
18 JGI25153J46596_10003407 3300003215 Bacteria 8907
19 JGI25153J46596_10011358 3300003215 Bacteria 3941
20 rootH1_10037537 3300003316 Bacteria 9848
21 rootH2_10073684 3300003320 Bacteria 1395
22 rootH2_10087052 3300003320 Bacteria 1272
23 rootL2_10004929 3300003322 Bacteria 14890
24 rootL2_10182883 3300003322 Bacteria 1081
25 JGI25160J50197_1004711 3300003354 Bacteria 5842
26 JGI25161J50226_1003205 3300003374 Bacteria 3846
27 Ga0055538_1000130 3300003751 Bacteria 54976
28 Ga0055539_1000173 3300003752 Bacteria 55011
29 Ga0055533_1000177 3300003756 Bacteria 55011
30 Ga0055532_1000171 3300003758 Bacteria 55011
31 Ga0055525_1000244 3300003759 Bacteria 55011
32 Ga0055535_1003932 3300003761 Bacteria 3892
33 Ga0055542_1014809 3300003762 Bacteria 1269
34 Ga0055526_1009475 3300003771 Bacteria 4674
35 Ga0055524_1001942 3300003775 Bacteria 11130
36 Ga0055524_1011492 3300003775 Bacteria 3460
37 Ga0055524_1019621 3300003775 Bacteria 2304
38 Ga0055528_1000475 3300003790 Bacteria 32037
39 Ga0055528_1001747 3300003790 Bacteria 12542
40 Ga0055530_10000002 3300003791 Bacteria 300466
41 Ga0055530_10001684 3300003791 Bacteria 15662
42 Ga0055530_10005707 3300003791 Bacteria 5804
43 Ga0055540_1000009 3300003792 Bacteria 300466
44 Ga0055540_1000096 3300003792 Bacteria 96969
45 Ga0055540_1000236 3300003792 Bacteria 50444
46 Ga0055540_1006624 3300003792 Bacteria 4551
47 Ga0055531_10002872 3300003794 Bacteria 11230
48 Ga0055541_1000115 3300003841 Bacteria 55011
49 Ga0058692_1007015 3300003856 Bacteria 3030
50 Ga0055543_1001197 3300004625 Bacteria 10928
51 Ga0065714_10000197 3300005288 Bacteria 7599
52 Ga0065714_10002523 3300005288 Bacteria 28497
53 Ga0065714_10002696 3300005288 Bacteria 24840
54 Ga0065714_10012489 3300005288 Bacteria 1801
55 Ga0065714_10068233 3300005288 Bacteria 4870
56 Ga0065714_10068369 3300005288 Bacteria 4770
57 Ga0065714_10086694 3300005288 Bacteria 2090
58 Ga0065704_10012815 3300005289 Bacteria 4497
59 Ga0065704_10070326 3300005289 Bacteria 32542
60 Ga0065704_10083205 3300005289 Bacteria 3495
61 Ga0065712_10011348 3300005290 Bacteria 2353
62 Ga0065712_10067891 3300005290 Bacteria 22597
63 Ga0070676_10023480 3300005328 Bacteria 3466
64 Ga0070676_10057979 3300005328 Bacteria 2293
65 Ga0070670_100000613 3300005331 Bacteria 27965
66 Ga0070670_100097767 3300005331 Bacteria 2526
67 Ga0068869_100105989 3300005334 Bacteria 2133
68 Ga0070666_10089273 3300005335 Bacteria 2115
69 Ga0070680_100158639 3300005336 Bacteria 1901
70 Ga0070660_100065289 3300005339 Bacteria 2832
71 Ga0070661_100000252 3300005344 Bacteria 43976
72 Ga0070668_100034545 3300005347 Bacteria 3854
73 Ga0070668_100181761 3300005347 Bacteria 1718
74 Ga0070668_100331913 3300005347 Bacteria 1283
75 Ga0070669_100001585 3300005353 Bacteria 16454
76 Ga0070669_100089237 3300005353 Bacteria 2309
77 Ga0070669_100113805 3300005353 Bacteria 2056
78 Ga0070675_100052395 3300005354 Bacteria 3355
79 Ga0070671_100206529 3300005355 Bacteria 1666
80 Ga0070674_100046055 3300005356 Bacteria 2982
81 Ga0070674_100145520 3300005356 Bacteria 1783
82 Ga0070674_100650008 3300005356 Bacteria 896
83 Ga0070673_100097003 3300005364 Bacteria 2420
84 Ga0070673_100107901 3300005364 Bacteria 2304
85 Ga0070673_100536406 3300005364 Bacteria 1062
86 Ga0070667_100230130 3300005367 Bacteria 1652
87 Ga0070663_100114604 3300005455 Bacteria 2029
88 Ga0070678_100504858 3300005456 Bacteria 1067
89 Ga0070662_100000714 3300005457 Bacteria 20379
90 Ga0070662_100152777 3300005457 Bacteria 1799
91 Ga0070681_10013436 3300005458 Bacteria 8135
92 Ga0070706_100006049 3300005467 Bacteria 11436
93 Ga0070707_100155873 3300005468 Bacteria 2224
94 Ga0070679_100205382 3300005530 Bacteria 1934
95 Ga0070672_100287339 3300005543 Bacteria 1392
96 Ga0070665_100022842 3300005548 Bacteria 6298
97 Ga0070665_100250690 3300005548 Bacteria 1771
98 Ga0070665_100433416 3300005548 Bacteria 1324
99 Ga0068855_100170518 3300005563 Bacteria 2465
100 Ga0070664_100000186 3300005564 Bacteria 43976
101 Ga0068857_100063405 3300005577 Bacteria 3285
102 Ga0068856_100019557 3300005614 Bacteria 6574
103 Ga0068852_100711403 3300005616 Bacteria 1015
104 Ga0068859_100457736 3300005617 Bacteria 1372
105 Ga0068864_100844583 3300005618 Bacteria 902
106 Ga0068866_10087678 3300005718 Bacteria 1687
107 Ga0068866_10418444 3300005718 Bacteria 869
108 Ga0068861_100085337 3300005719 Bacteria 2479
109 Ga0068851_10000045 3300005834 Bacteria 80884
110 Ga0068862_100029896 3300005844 Bacteria 4590
111 Ga0075365_10006047 3300006038 Bacteria 6609
112 Ga0075365_10030678 3300006038 Bacteria 3445
113 Ga0075365_10075310 3300006038 Bacteria 2278
114 Ga0075365_10095450 3300006038 Bacteria 2031
115 Ga0075365_10099179 3300006038 Bacteria 1993
116 Ga0075365_10225166 3300006038 Bacteria 1316
117 Ga0075368_10020035 3300006042 Bacteria 2529
118 Ga0075368_10048320 3300006042 Bacteria 1686
119 Ga0075368_10170937 3300006042 Bacteria 913
120 Ga0075363_100051405 3300006048 Bacteria 2198
121 Ga0075363_100089817 3300006048 Bacteria 1689
122 Ga0075364_10009059 3300006051 Bacteria 5962
123 Ga0075364_10019762 3300006051 Bacteria 4231
124 Ga0075364_10041293 3300006051 Bacteria 2995
125 Ga0075364_10222583 3300006051 Bacteria 1281
126 Ga0075364_10392696 3300006051 Bacteria 946
127 Ga0075362_10004078 3300006177 Bacteria 5206
128 Ga0075362_10029894 3300006177 Bacteria 2351
129 Ga0075362_10040780 3300006177 Bacteria 2045
130 Ga0075362_10048102 3300006177 Bacteria 1902
131 Ga0075362_10065743 3300006177 Bacteria 1647
132 Ga0075367_10010717 3300006178 Bacteria 4826
133 Ga0075367_10110330 3300006178 Bacteria 1688
134 Ga0075369_10055904 3300006186 Bacteria 1715
135 Ga0075369_10165369 3300006186 Bacteria 1014
136 Ga0075369_10189409 3300006186 Bacteria 948
137 Ga0075366_10071283 3300006195 Bacteria 2070
138 Ga0075366_10117236 3300006195 Bacteria 1603
139 Ga0075370_10005158 3300006353 Bacteria 6451
140 Ga0075370_10011266 3300006353 Bacteria 4695
141 Ga0075370_10135934 3300006353 Bacteria 1436
142 Ga0075370_10212884 3300006353 Bacteria 1141
143 Ga0075431_100010054 3300006847 Bacteria 9505
144 Ga0068865_100051758 3300006881 Bacteria 2844
145 Ga0068865_100058575 3300006881 Bacteria 2691
146 Ga0068865_100075107 3300006881 Bacteria 2409
147 Ga0097620_100457689 3300006931 Bacteria 1372
148 Ga0079104_1000006 3300006946 Bacteria 396255
149 Ga0079104_1005750 3300006946 Bacteria 4870
150 Ga0079104_1023710 3300006946 Bacteria 1627
151 Ga0099826_10057539 3300006948 Bacteria 2556
152 Ga0105251_10000001 3300009011 Bacteria 466643
153 Ga0105251_10000406 3300009011 Bacteria 41850
154 Ga0105251_10010981 3300009011 Bacteria 5205
155 Ga0105251_10057305 3300009011 Bacteria 1841
156 Ga0105244_10000519 3300009036 Bacteria 34428
157 Ga0105244_10002745 3300009036 Bacteria 13136
158 Ga0105244_10007547 3300009036 Bacteria 6904
159 Ga0105244_10012468 3300009036 Bacteria 5020
160 Ga0105244_10014973 3300009036 Bacteria 4462
161 Ga0105244_10020420 3300009036 Bacteria 3681
162 Ga0105244_10022435 3300009036 Bacteria 3474
163 Ga0105244_10075381 3300009036 Bacteria 1676
164 Ga0105250_10001116 3300009092 Bacteria 15151
165 Ga0105250_10001248 3300009092 Bacteria 14088
166 Ga0105250_10030673 3300009092 Bacteria 2161
167 Ga0105240_10000376 3300009093 Bacteria 83903
168 Ga0105240_10086767 3300009093 Bacteria 3833
169 Ga0105245_10411663 3300009098 Bacteria 1353
170 Ga0105245_10451204 3300009098 Bacteria 1294
171 Ga0114129_10011124 3300009147 Bacteria 12826
172 Ga0105243_10000170 3300009148 Bacteria 74646
173 Ga0105243_10014408 3300009148 Bacteria 5986
174 Ga0105243_10432832 3300009148 Bacteria 1230
175 Ga0105242_10000474 3300009176 Bacteria 31860
176 Ga0105248_10160637 3300009177 Bacteria 2535
177 Ga0105237_10001377 3300009545 Bacteria 32081
178 Ga0105237_10001450 3300009545 Bacteria 31322
179 Ga0105237_10018035 3300009545 Bacteria 7311
180 Ga0105238_10418081 3300009551 Bacteria 1335
181 Ga0105249_10054998 3300009553 Bacteria 3640
182 Ga0105249_10145116 3300009553 Bacteria 2279
183 Ga0123340_1048316 3300009763 Bacteria 1644
184 Ga0123341_1000005 3300009765 Bacteria 150422
185 Ga0123342_1012900 3300009766 Bacteria 8539
186 Ga0105239_10022339 3300010375 Bacteria 6976
187 Ga0105239_10089657 3300010375 Bacteria 3391
188 Ga0105246_10000114 3300011119 Bacteria 36232
189 Ga0105246_10001525 3300011119 Bacteria 13716
190 Ga0105246_10206465 3300011119 Bacteria 1531
191 Ga0157345_1002561 3300012498 Bacteria 1287
192 Ga0157373_10012988 3300013100 Bacteria 6113
193 Ga0157373_10022025 3300013100 Bacteria 4624
194 Ga0157373_10055062 3300013100 Bacteria 2826
195 Ga0157373_10095319 3300013100 Bacteria 2095
196 Ga0157371_10000109 3300013102 Bacteria 124990
197 Ga0157371_10000754 3300013102 Bacteria 37446
198 Ga0157370_10005715 3300013104 Bacteria 13902
199 Ga0157370_10019939 3300013104 Bacteria 6708
200 Ga0157370_10040968 3300013104 Bacteria 4471
201 Ga0157370_10149566 3300013104 Bacteria 2173
202 Ga0157369_10003795 3300013105 Bacteria 17955
203 Ga0157369_10045106 3300013105 Bacteria 4796
204 Ga0157369_10177905 3300013105 Bacteria 2239
205 Ga0157369_10379484 3300013105 Bacteria 1467
206 Ga0157369_10395537 3300013105 Bacteria 1434
207 Ga0157374_10073484 3300013296 Bacteria 3228
208 Ga0157374_10445463 3300013296 Bacteria 1296
209 Ga0163162_10003838 3300013306 Bacteria 14412
210 Ga0163162_10723108 3300013306 Bacteria 1116
211 Ga0163163_10165608 3300014325 Bacteria 2256
212 Ga0157380_10003640 3300014326 Bacteria 10597
213 Ga0157380_10709879 3300014326 Bacteria 1012
214 Ga0182008_10006407 3300014497 Bacteria 6582
215 Ga0182008_10013725 3300014497 Bacteria 4256
216 Ga0182008_10048193 3300014497 Bacteria 2116
217 Ga0182006_1001224 3300015261 Bacteria 16004
218 Ga0182006_1003031 3300015261 Bacteria 8835
219 Ga0182006_1005901 3300015261 Bacteria 5763
220 Ga0182006_1058702 3300015261 Bacteria 1458
221 Ga0182007_10000493 3300015262 Bacteria 23546
222 Ga0182007_10005361 3300015262 Bacteria 5647
223 Ga0182005_1001106 3300015265 Bacteria 11275
224 Ga0182005_1003295 3300015265 Bacteria 5517
225 Ga0182005_1017046 3300015265 Bacteria 2012
226 Ga0182005_1017457 3300015265 Bacteria 1987
227 Ga0182005_1026944 3300015265 Bacteria 1568
228 Ga0214544_1000419 3300021320 Bacteria 76083
229 Ga0214542_1000027 3300021321 Bacteria 175107
230 Ga0214542_1033155 3300021321 Bacteria 1764
231 Ga0214543_1000025 3300021327 Bacteria 225351
232 Ga0214543_1000047 3300021327 Bacteria 150894
233 Ga0213872_10072961 3300021361 Bacteria 1546
234 Ga0213876_10144143 3300021384 Bacteria 1267
235 Ga0213875_10072901 3300021388 Bacteria 1602
236 Ga0228711_1010219 3300022739 Bacteria 12433
237 Ga0228710_1010420 3300022740 Bacteria 12432
238 Ga0209435_100127 3300025206 Bacteria 27151
239 Ga0209435_101270 3300025206 Bacteria 3319
240 Ga0209760_100007 3300025207 Bacteria 211381
241 Ga0209784_100065 3300025224 Bacteria 155963
242 Ga0209566_100081 3300025225 Bacteria 155963
243 Ga0209674_100101 3300025226 Bacteria 155963
244 Ga0209147_100234 3300025229 Bacteria 55130
245 Ga0209563_100098 3300025230 Bacteria 155963
246 Ga0207427_100018 3300025231 Bacteria 530735
247 Ga0209437_100031 3300025233 Bacteria 530871
248 Ga0209437_100475 3300025233 Bacteria 30517
249 Ga0209437_104097 3300025233 Bacteria 2583
250 Ga0209437_105162 3300025233 Bacteria 2239
251 Ga0209258_100752 3300025242 Bacteria 20637
252 Ga0209258_104672 3300025242 Bacteria 2524
253 Ga0207425_1008276 3300025245 Bacteria 2675
254 Ga0209646_1000390 3300025246 Bacteria 27151
255 Ga0209646_1005847 3300025246 Bacteria 2112
256 Ga0209026_1000520 3300025250 Bacteria 27151
257 Ga0209677_100059 3300025253 Bacteria 155963
258 Ga0209677_100218 3300025253 Bacteria 41903
259 Ga0209148_1000420 3300025254 Bacteria 47555
260 Ga0209759_1000769 3300025256 Bacteria 27151
261 Ga0209129_1000997 3300025258 Bacteria 16895
262 Ga0209129_1002487 3300025258 Bacteria 8991
263 Ga0209129_1026470 3300025258 Bacteria 1002
264 Ga0209233_1000012 3300025261 Bacteria 1019519
265 Ga0209233_1000097 3300025261 Bacteria 295452
266 Ga0209233_1000429 3300025261 Bacteria 30517
267 Ga0209455_1000290 3300025272 Bacteria 53526
268 Ga0209455_1016997 3300025272 Bacteria 1543
269 Ga0209673_1000117 3300025273 Bacteria 172081
270 Ga0209673_1000452 3300025273 Bacteria 69726
271 Ga0209673_1002317 3300025273 Bacteria 13498
272 Ga0209130_1025020 3300025284 Bacteria 1297
273 Ga0209675_1003905 3300025291 Bacteria 6852
274 Ga0209675_1023459 3300025291 Bacteria 1598
275 Ga0209676_1000002 3300025292 Bacteria 1732948
276 Ga0209676_1000020 3300025292 Bacteria 617256
277 Ga0209676_1002950 3300025292 Bacteria 11109
278 Ga0209676_1009137 3300025292 Bacteria 4314
279 Ga0209025_1000121 3300025294 Bacteria 208700
280 Ga0209025_1000228 3300025294 Bacteria 132088
281 Ga0209025_1000558 3300025294 Bacteria 68589
282 Ga0209025_1003556 3300025294 Bacteria 14615
283 Ga0209564_1000581 3300025295 Bacteria 57912
284 Ga0209564_1000763 3300025295 Bacteria 45281
285 Ga0209758_1000113 3300025297 Bacteria 202528
286 Ga0209758_1000503 3300025297 Bacteria 63354
287 Ga0209758_1005135 3300025297 Bacteria 10334
288 Ga0209758_1006104 3300025297 Bacteria 8845
289 Ga0209050_1000006 3300025298 Bacteria 1359702
290 Ga0209050_1000009 3300025298 Bacteria 1047265
291 Ga0209050_1000775 3300025298 Bacteria 45682
292 Ga0209050_1005867 3300025298 Bacteria 7516
293 Ga0209256_1000164 3300025299 Bacteria 135612
294 Ga0209256_1002844 3300025299 Bacteria 13202
295 Ga0209256_1003510 3300025299 Bacteria 10924
296 Ga0209256_1012618 3300025299 Bacteria 3209
297 Ga0207426_1000307 3300025302 Bacteria 96085
298 Ga0209051_1000001 3300025303 Bacteria 1732974
299 Ga0209051_1000008 3300025303 Bacteria 706935
300 Ga0209051_1000027 3300025303 Bacteria 412172
301 Ga0209051_1002046 3300025303 Bacteria 15317
302 Ga0209051_1024359 3300025303 Bacteria 2490
303 Ga0209257_1000269 3300025304 Bacteria 119726
304 Ga0209257_1019019 3300025304 Bacteria 2608
305 Ga0207696_1000002 3300025711 Bacteria 1098043
306 Ga0207696_1000115 3300025711 Bacteria 150739
307 Ga0207696_1002575 3300025711 Bacteria 8817
308 Ga0207696_1007412 3300025711 Bacteria 4298
309 Ga0207655_1000022 3300025728 Bacteria 483933
310 Ga0207655_1000167 3300025728 Bacteria 119650
311 Ga0207655_1000270 3300025728 Bacteria 81429
312 Ga0207655_1000419 3300025728 Bacteria 58031
313 Ga0207655_1001481 3300025728 Bacteria 21559
314 Ga0207655_1008041 3300025728 Bacteria 6760
315 Ga0207655_1009048 3300025728 Bacteria 6236
316 Ga0207655_1064092 3300025728 Bacteria 1404
317 Ga0207655_1075769 3300025728 Bacteria 1233
318 Ga0207655_1085486 3300025728 Bacteria 1125
319 Ga0207713_1000117 3300025735 Bacteria 129339
320 Ga0207713_1000455 3300025735 Bacteria 42889
321 Ga0207713_1000827 3300025735 Bacteria 28559
322 Ga0207713_1003174 3300025735 Bacteria 11381
323 Ga0207713_1006126 3300025735 Bacteria 7392
324 Ga0207713_1006127 3300025735 Bacteria 7392
325 Ga0207713_1013462 3300025735 Bacteria 4307
326 Ga0207713_1015971 3300025735 Bacteria 3830
327 Ga0207713_1024116 3300025735 Bacteria 2844
328 Ga0207713_1033940 3300025735 Bacteria 2222
329 Ga0207680_10116281 3300025903 Bacteria 1743
330 Ga0207645_10037406 3300025907 Bacteria 3114
331 Ga0207645_10084606 3300025907 Bacteria 2036
332 Ga0207684_10012548 3300025910 Bacteria 7364
333 Ga0207695_10000495 3300025913 Bacteria 83911
334 Ga0207695_10072809 3300025913 Bacteria 3504
335 Ga0207671_10000568 3300025914 Bacteria 49545
336 Ga0207671_10001314 3300025914 Bacteria 29075
337 Ga0207671_10041667 3300025914 Bacteria 3398
338 Ga0207649_10000217 3300025920 Bacteria 47461
339 Ga0207681_10008201 3300025923 Bacteria 6390
340 Ga0207681_10247613 3300025923 Bacteria 1390
341 Ga0207694_10249301 3300025924 Bacteria 1453
342 Ga0207650_10000205 3300025925 Bacteria 67905
343 Ga0207650_10000942 3300025925 Bacteria 21884
344 Ga0207687_10127911 3300025927 Bacteria 1910
345 Ga0207687_10305706 3300025927 Bacteria 1282
346 Ga0207644_10103475 3300025931 Bacteria 2143
347 Ga0207706_10005103 3300025933 Bacteria 12257
348 Ga0207706_10010353 3300025933 Bacteria 8518
349 Ga0207686_10005559 3300025934 Bacteria 6756
350 Ga0207709_10000004 3300025935 Bacteria 825156
351 Ga0207709_10258890 3300025935 Bacteria 1275
352 Ga0207709_10466144 3300025935 Bacteria 979
353 Ga0207669_10021091 3300025937 Bacteria 3431
354 Ga0207669_10181166 3300025937 Bacteria 1510
355 Ga0207704_10303876 3300025938 Bacteria 1223
356 Ga0207691_10671910 3300025940 Bacteria 874
357 Ga0207689_10023203 3300025942 Bacteria 5209
358 Ga0207679_10000109 3300025945 Bacteria 67430
359 Ga0207667_10139375 3300025949 Bacteria 2497
360 Ga0207651_10284339 3300025960 Bacteria 1368
361 Ga0207651_10646988 3300025960 Bacteria 928
362 Ga0207712_10085813 3300025961 Bacteria 2305
363 Ga0207712_10115856 3300025961 Bacteria 2018
364 Ga0207668_10024637 3300025972 Bacteria 3887
365 Ga0207678_10098511 3300026067 Bacteria 2498
366 Ga0207702_10047716 3300026078 Bacteria 3610
367 Ga0207648_10237869 3300026089 Bacteria 1621
368 Ga0207674_10010723 3300026116 Bacteria 10346
369 Ga0207675_100001039 3300026118 Bacteria 27532
370 Ga0207675_100285137 3300026118 Bacteria 1605
371 Ga0207683_10469601 3300026121 Bacteria 1161
372 Ga0207683_10528422 3300026121 Bacteria 1090
373 Ga0207698_10016450 3300026142 Bacteria 4986
374 Ga0209281_1000011 3300027111 Bacteria 695292
375 Ga0209281_1000314 3300027111 Bacteria 86424
376 Ga0209281_1000463 3300027111 Bacteria 57136
377 Ga0209281_1003764 3300027111 Bacteria 4826
378 Ga0209371_1001425 3300027312 Bacteria 16286
379 Ga0209999_1048711 3300027543 Bacteria 799
380 Ga0209282_1000068 3300027666 Bacteria 85817
381 Ga0209282_1192036 3300027666 Bacteria 948
382 Ga0209813_10069115 3300027866 Bacteria 1144
383 Ga0207428_10000098 3300027907 Bacteria 120181
384 Ga0207428_10045742 3300027907 Bacteria 3523
385 Ga0207428_10200020 3300027907 Bacteria 1504
386 Ga0207428_10204214 3300027907 Bacteria 1486
387 Ga0268266_10468457 3300028379 Bacteria 1199
388 Ga0268265_10058252 3300028380 Bacteria 2948
389 Ga0268264_10300480 3300028381 Bacteria 1511
390 Ga0307515_10006683 3300028794 Bacteria 22971
391 Ga0307515_10097680 3300028794 Bacteria 3586
392 Ga0268256_1001855 3300030500 Bacteria 11750
393 Ga0307511_10084883 3300030521 Bacteria 2194
394 Ga0307512_10046883 3300030522 Bacteria 3519
395 Ga0314311_1003930 3300030733 Bacteria 3254
396 Ga0316179_1019939 3300030734 Bacteria 2450
397 Ga0316178_1142514 3300030735 Bacteria 13262
398 Ga0265330_10063920 3300031235 Bacteria 1599
399 Ga0265339_10037873 3300031249 Bacteria 2693
400 Ga0307513_10000259 3300031456 Bacteria 76155
401 Ga0307513_10184150 3300031456 Bacteria 1948
402 Ga0307408_100332515 3300031548 Bacteria 1283
403 Ga0307408_100605538 3300031548 Bacteria 974
404 Ga0307516_10274752 3300031730 Bacteria 1369
405 Ga0307405_10042440 3300031731 Bacteria 2769
406 Ga0307412_10700786 3300031911 Bacteria 869
407 Ga0307409_101178847 3300031995 Bacteria 789
408 Ga0307507_10295229 3300033179 Bacteria 999
409 Ga0307510_10000904 3300033180 Bacteria 31347
410 Ga0307510_10140416 3300033180 Bacteria 2061
411 Ga0315913_1002536 3300033430 Bacteria 21509
412 Ga0315915_1000007 3300033464 Bacteria 319225
413 Ga0373943_0219716 3300035170 Bacteria 1058
414 Ga0373935_0306116 3300035692 Bacteria 1124
415 Ga0373925_0000771 3300037068 Bacteria 29425
416 Ga0395905_0022998 3300037471 Bacteria 5891
417 Ga0395905_0037462 3300037471 Bacteria 4553
418 Ga0395905_0241463 3300037471 Bacteria 1688
419 Ga0237819_00367 3300038705 Bacteria 16023
420 Ga0436365_1612465 3300039437 Bacteria 1359
421 Ga0436361_0928105 3300039447 Bacteria 1426
422 Ga0439436_0023912 3300041404 Bacteria 1806
423 Ga0439436_0048333 3300041404 Bacteria 1207
424 Ga0439438_029644 3300041405 Bacteria 1463
425 Ga0439447_000379 3300041407 Bacteria 16202
426 Ga0439447_028651 3300041407 Bacteria 1413
427 Ga0439466_0000125 3300041411 Bacteria 30280
428 Ga0439466_0030986 3300041411 Bacteria 1831
429 Ga0439466_0031687 3300041411 Bacteria 1806
430 Ga0439465_0007366 3300041413 Bacteria 3496
431 Ga0439465_0034550 3300041413 Bacteria 1619
432 Ga0439465_0036768 3300041413 Bacteria 1573
433 Ga0451798_0048890 3300041458 Bacteria 1029
434 Ga0451804_0978079 3300041463 Bacteria 1122
435 Ga0451835_0984855 3300041492 Bacteria 2220
436 Ga0451845_0935886 3300041501 Bacteria 918
437 Ga0451847_0024524 3300041503 Bacteria 1868
438 Ga0451851_0582068 3300041507 Bacteria 769
439 Ga0451855_0354570 3300041511 Bacteria 1140
440 Ga0439432_000588 3300042006 Bacteria 13718
441 Ga0439432_002973 3300042006 Bacteria 6313
442 Ga0439449_0026652 3300042007 Bacteria 2157
443 Ga0439449_0120861 3300042007 Bacteria 972
444 Ga0439451_010453 3300042009 Bacteria 1870
445 Ga0439451_021005 3300042009 Bacteria 1316
446 Ga0439452_000274 3300042010 Bacteria 34135
447 Ga0439452_003833 3300042010 Bacteria 5165
448 Ga0439452_012209 3300042010 Bacteria 2450
449 Ga0439452_016156 3300042010 Bacteria 2031
450 Ga0439456_004086 3300042013 Bacteria 2959
451 Ga0439463_000824 3300042016 Bacteria 8518
452 Ga0439463_004733 3300042016 Bacteria 3398
453 Ga0450911_007211 3300042115 Bacteria 1621
454 Ga0450919_009519 3300042121 Bacteria 1115
455 Ga0450906_000930 3300042145 Bacteria 6406
456 Ga0450907_000043 3300042146 Bacteria 55843
457 Ga0450909_001700 3300042185 Bacteria 3083
458 Ga0439460_0004605 3300042461 Bacteria 3367
459 Ga0439460_0006604 3300042461 Bacteria 2884
460 Ga0439440_0000499 3300042993 Bacteria 6581
461 Ga0466966_0046273 3300044684 Bacteria 2779
462 Ga0466963_0011584 3300044694 Bacteria 5369
463 Ga0466971_0171191 3300044719 Bacteria 1019
464 Ga0466970_0000136 3300044765 Bacteria 33881
465 Ga0466970_0105673 3300044765 Bacteria 1536
466 Ga0466957_0011830 3300044842 Bacteria 5045
467 Ga0466959_0456278 3300045049 Bacteria 866
468 Ga0451576_0008377 3300045051 Bacteria 12141
469 Ga0451576_0290625 3300045051 Bacteria 1709
470 Ga0466958_0093997 3300045836 Bacteria 1857
471 Ga0466967_0065100 3300045976 Bacteria 3244
472 Ga0495617_000121 3300046452 Bacteria 51958
473 Ga0495617_011317 3300046452 Bacteria 3044
474 Ga0495617_070018 3300046452 Bacteria 1154
475 Ga0495627_001717 3300046453 Bacteria 11957
476 Ga0495627_046391 3300046453 Bacteria 1320
477 Ga0495590_0001126 3300046457 Bacteria 11710
478 Ga0495591_000086 3300046458 Bacteria 104667
479 Ga0495591_000125 3300046458 Bacteria 83668
480 Ga0495591_000260 3300046458 Bacteria 50308
481 Ga0495591_001495 3300046458 Bacteria 14432
482 Ga0495591_001994 3300046458 Bacteria 11898
483 Ga0495591_002103 3300046458 Bacteria 11463
484 Ga0495591_014302 3300046458 Bacteria 2859
485 Ga0495591_047982 3300046458 Bacteria 1179
486 Ga0495591_057901 3300046458 Bacteria 1037
487 Ga0495629_0008153 3300046459 Bacteria 7705
488 Ga0495638_0000622 3300046460 Bacteria 39303
489 Ga0495638_0040688 3300046460 Bacteria 2944
490 Ga0495638_0045328 3300046460 Bacteria 2766
491 Ga0495638_0290071 3300046460 Bacteria 886
492 Ga0495651_0243875 3300046462 Bacteria 1231
493 Ga0495650_0000362 3300046471 Bacteria 80025
494 Ga0495650_0002865 3300046471 Bacteria 13168
495 Ga0495650_0019272 3300046471 Bacteria 3366
496 Ga0495650_0019926 3300046471 Bacteria 3284
497 Ga0495650_0045429 3300046471 Bacteria 1849
498 Ga0495582_0269574 3300046473 Bacteria 977
499 Ga0495605_0000001 3300046474 Bacteria 614538
500 Ga0495605_0000025 3300046474 Bacteria 223594
501 Ga0495605_0000346 3300046474 Bacteria 45641
502 Ga0495605_0003188 3300046474 Bacteria 9844
503 Ga0495605_0020734 3300046474 Bacteria 3490
504 Ga0495605_0023315 3300046474 Bacteria 3257
505 Ga0495605_0027855 3300046474 Bacteria 2922
506 Ga0495605_0087023 3300046474 Bacteria 1453
507 Ga0495605_0131386 3300046474 Bacteria 1129
508 Ga0495639_0000996 3300046475 Bacteria 12769
509 Ga0495662_0007315 3300046476 Bacteria 5463
510 Ga0495584_0001257 3300046491 Bacteria 15465
511 Ga0495584_0049354 3300046491 Bacteria 2120
512 Ga0495584_0050165 3300046491 Bacteria 2102
513 Ga0495584_0066940 3300046491 Bacteria 1807
514 Ga0495585_0000149 3300046492 Bacteria 75947
515 Ga0495585_0115687 3300046492 Bacteria 1422
516 Ga0495594_0013205 3300046499 Bacteria 4308
517 Ga0495596_0000027 3300046500 Bacteria 104155
518 Ga0495596_0110877 3300046500 Bacteria 1065
519 Ga0495607_0000036 3300046501 Bacteria 140259
520 Ga0495607_0000167 3300046501 Bacteria 69947
521 Ga0495607_0001042 3300046501 Bacteria 25419
522 Ga0495607_0005883 3300046501 Bacteria 8711
523 Ga0495607_0009965 3300046501 Bacteria 6399
524 Ga0495607_0042895 3300046501 Bacteria 2678
525 Ga0495607_0067349 3300046501 Bacteria 2012
526 Ga0495607_0129440 3300046501 Bacteria 1315
527 Ga0495607_0133662 3300046501 Bacteria 1287
528 Ga0495607_0152662 3300046501 Bacteria 1180
529 Ga0495583_0000070 3300046506 Bacteria 185226
530 Ga0495583_0001762 3300046506 Bacteria 20649
531 Ga0495583_0002032 3300046506 Bacteria 18425
532 Ga0495583_0002891 3300046506 Bacteria 13899
533 Ga0495583_0006127 3300046506 Bacteria 7930
534 Ga0495583_0008378 3300046506 Bacteria 6328
535 Ga0495583_0100447 3300046506 Bacteria 1235
536 Ga0495606_0000079 3300046507 Bacteria 164788
537 Ga0495606_0002580 3300046507 Bacteria 20743
538 Ga0495606_0010880 3300046507 Bacteria 7490
539 Ga0495606_0011881 3300046507 Bacteria 7043
540 Ga0495606_0070130 3300046507 Bacteria 2211
541 Ga0495606_0203403 3300046507 Bacteria 1127
542 Ga0495610_0011337 3300046512 Bacteria 5457
543 Ga0495610_0021168 3300046512 Bacteria 3582
544 Ga0495610_0041249 3300046512 Bacteria 2318
545 Ga0495610_0073016 3300046512 Bacteria 1595
546 Ga0495610_0085546 3300046512 Bacteria 1438
547 Ga0495616_0000079 3300046513 Bacteria 81296
548 Ga0495616_0000425 3300046513 Bacteria 32300
549 Ga0495616_0027250 3300046513 Bacteria 3034
550 Ga0495616_0029472 3300046513 Bacteria 2897
551 Ga0495616_0056248 3300046513 Bacteria 1943
552 Ga0495616_0066638 3300046513 Bacteria 1751
553 Ga0495620_0000009 3300046515 Bacteria 174473
554 Ga0495620_0009058 3300046515 Bacteria 5314
555 Ga0495620_0010750 3300046515 Bacteria 4815
556 Ga0495620_0011527 3300046515 Bacteria 4609
557 Ga0495620_0022194 3300046515 Bacteria 3064
558 Ga0495620_0029113 3300046515 Bacteria 2560
559 Ga0495620_0048012 3300046515 Bacteria 1834
560 Ga0495631_0000126 3300046518 Bacteria 51226
561 Ga0495631_0006438 3300046518 Bacteria 6059
562 Ga0495631_0024815 3300046518 Bacteria 2765
563 Ga0495632_0000802 3300046519 Bacteria 27836
564 Ga0495632_0008573 3300046519 Bacteria 6251
565 Ga0495632_0030503 3300046519 Bacteria 2797
566 Ga0495632_0112330 3300046519 Bacteria 1278
567 Ga0495632_0193809 3300046519 Bacteria 927
568 Ga0495637_0000075 3300046520 Bacteria 79690
569 Ga0495637_0002202 3300046520 Bacteria 10895
570 Ga0495637_0015218 3300046520 Bacteria 3610
571 Ga0495637_0090293 3300046520 Bacteria 1209
572 Ga0495637_0093780 3300046520 Bacteria 1181
573 Ga0495643_0001828 3300046522 Bacteria 18093
574 Ga0495644_0000477 3300046523 Bacteria 17333
575 Ga0495644_0003929 3300046523 Bacteria 5849
576 Ga0495648_0010903 3300046524 Bacteria 6893
577 Ga0495648_0012695 3300046524 Bacteria 6263
578 Ga0495648_0013902 3300046524 Bacteria 5925
579 Ga0495648_0015893 3300046524 Bacteria 5440
580 Ga0495648_0020720 3300046524 Bacteria 4576
581 Ga0495648_0117409 3300046524 Bacteria 1436
582 Ga0495666_0014693 3300046526 Bacteria 3896
583 Ga0495666_0058173 3300046526 Bacteria 1850
584 Ga0495642_0000402 3300046528 Bacteria 23250
585 Ga0495642_0000571 3300046528 Bacteria 18499
586 Ga0495652_0471174 3300046529 Bacteria 876
587 Ga0495654_0000470 3300046530 Bacteria 33575
588 Ga0495654_0001097 3300046530 Bacteria 19609
589 Ga0495654_0008212 3300046530 Bacteria 5779
590 Ga0495654_0011909 3300046530 Bacteria 4690
591 Ga0495654_0014489 3300046530 Bacteria 4196
592 Ga0495654_0047804 3300046530 Bacteria 2101
593 Ga0495654_0076284 3300046530 Bacteria 1579
594 Ga0495654_0098190 3300046530 Bacteria 1351
595 Ga0495654_0191161 3300046530 Bacteria 881
596 Ga0495640_0132830 3300046533 Bacteria 1609
597 Ga0495587_0010225 3300046536 Bacteria 5981
598 Ga0495609_0000014 3300046538 Bacteria 326023
599 Ga0495609_0000016 3300046538 Bacteria 312882
600 Ga0495609_0001549 3300046538 Bacteria 15056
601 Ga0495609_0010463 3300046538 Bacteria 4446
602 Ga0495609_0024324 3300046538 Bacteria 2779
603 Ga0495609_0094174 3300046538 Bacteria 1301
604 Ga0495609_0124205 3300046538 Bacteria 1108
605 Ga0495597_0007901 3300046542 Bacteria 5360
606 Ga0495597_0009335 3300046542 Bacteria 4852
607 Ga0495597_0009540 3300046542 Bacteria 4788
608 Ga0495597_0014559 3300046542 Bacteria 3741
609 Ga0495622_0000708 3300046557 Bacteria 18867
610 Ga0495622_0001279 3300046557 Bacteria 12912
611 Ga0495622_0007393 3300046557 Bacteria 5096
612 Ga0495633_0000010 3300046558 Bacteria 280844
613 Ga0495633_0000525 3300046558 Bacteria 38410
614 Ga0495656_0000902 3300046615 Bacteria 9599
615 Ga0495668_0003496 3300046616 Bacteria 11713
616 Ga0495668_0054619 3300046616 Bacteria 2207
617 Ga0495668_0131197 3300046616 Bacteria 1371
618 Ga0495668_0376538 3300046616 Bacteria 779
619 Ga0495611_0000048 3300046648 Bacteria 85172
620 Ga0495611_0000152 3300046648 Bacteria 49622
621 Ga0495611_0025448 3300046648 Bacteria 2579
622 Ga0495611_0058018 3300046648 Bacteria 1755
623 Ga0495625_0000084 3300046660 Bacteria 151895
624 Ga0495625_0002299 3300046660 Bacteria 20925
625 Ga0495625_0002568 3300046660 Bacteria 19498
626 Ga0495625_0010597 3300046660 Bacteria 7608
627 Ga0495625_0044245 3300046660 Bacteria 3224
628 Ga0495625_0045296 3300046660 Bacteria 3180
629 Ga0495625_0088336 3300046660 Bacteria 2147
630 Ga0495625_0144184 3300046660 Bacteria 1605
631 Ga0495625_0183784 3300046660 Bacteria 1388
632 Ga0495625_0265970 3300046660 Bacteria 1108
633 Ga0495625_0364773 3300046660 Bacteria 910
634 Ga0495635_0000973 3300046663 Bacteria 18853
635 Ga0495635_0240372 3300046663 Bacteria 1222
636 Ga0495659_0000392 3300046664 Bacteria 16750
637 Ga0495661_0000008 3300046665 Bacteria 317971
638 Ga0495661_0000191 3300046665 Bacteria 71123
639 Ga0495661_0001498 3300046665 Bacteria 19446
640 Ga0495661_0003071 3300046665 Bacteria 12557
641 Ga0495661_0017906 3300046665 Bacteria 4669
642 Ga0495661_0062167 3300046665 Bacteria 2213
643 Ga0495657_0020397 3300046675 Bacteria 4764
644 Ga0495623_0091743 3300046679 Bacteria 1863
645 Ga0495658_0211393 3300046683 Bacteria 1212
646 Ga0495669_0016104 3300046684 Bacteria 3201
647 Ga0495670_0001804 3300046691 Bacteria 10525
648 Ga0495670_0012534 3300046691 Bacteria 4171
649 Ga0495670_0175616 3300046691 Bacteria 1129
650 Ga0495670_0184536 3300046691 Bacteria 1102
651 Ga0495670_0204537 3300046691 Bacteria 1046
652 Ga0495671_0000853 3300046692 Bacteria 21807
653 Ga0495671_0008768 3300046692 Bacteria 5680
654 Ga0495671_0012449 3300046692 Bacteria 4646
655 Ga0495671_0054971 3300046692 Bacteria 1972
656 Ga0495671_0065921 3300046692 Bacteria 1782
657 Ga0495649_0000257 3300046694 Bacteria 47325
658 Ga0495649_0019003 3300046694 Bacteria 3861
659 Ga0495649_0020457 3300046694 Bacteria 3712
660 Ga0495649_0066761 3300046694 Bacteria 1930
661 Ga0495649_0265784 3300046694 Bacteria 878
662 Ga0495589_0000415 3300046794 Bacteria 32054
663 Ga0495589_0082046 3300046794 Bacteria 1568
664 Ga0495589_0099905 3300046794 Bacteria 1404
665 Ga0495600_0031896 3300046809 Bacteria 3416
666 Ga0495600_0046755 3300046809 Bacteria 2822
667 Ga0495660_0008599 3300046810 Bacteria 5974
668 Ga0495660_0052407 3300046810 Bacteria 2216
669 Ga0495660_0113146 3300046810 Bacteria 1382
670 Ga0495660_0122406 3300046810 Bacteria 1314
671 Ga0495660_0132940 3300046810 Bacteria 1246
672 Ga0495660_0151824 3300046810 Bacteria 1143
673 Ga0495660_0224643 3300046810 Bacteria 883
674 Ga0495604_0005508 3300047317 Bacteria 10037
675 Ga0495604_0055591 3300047317 Bacteria 3050
676 Ga0495636_0012242 3300047318 Bacteria 3396
677 Ga0495636_0096144 3300047318 Bacteria 1291
678 Ga0495636_0287316 3300047318 Bacteria 767
679 Ga0495674_0308786 3300047319 Bacteria 1291
680 Ga0495672_0002860 3300047320 Bacteria 15334
681 Ga0495672_0013706 3300047320 Bacteria 5578
682 Ga0495672_0027794 3300047320 Bacteria 3589
683 Ga0495672_0029995 3300047320 Bacteria 3418
684 Ga0495672_0063445 3300047320 Bacteria 2120
685 Ga0495672_0169014 3300047320 Bacteria 1117
686 Ga0495676_0000039 3300047321 Bacteria 111011
687 Ga0495680_0009250 3300047322 Bacteria 8877
688 Ga0495683_0000002 3300047323 Bacteria 638279
689 Ga0495683_0000231 3300047323 Bacteria 51177
690 Ga0495683_0000358 3300047323 Bacteria 37677
691 Ga0495683_0033779 3300047323 Bacteria 2601
692 Ga0495683_0057525 3300047323 Bacteria 1933
693 Ga0495683_0179221 3300047323 Bacteria 969
694 Ga0495687_000232 3300047443 Bacteria 77572
695 Ga0495687_002451 3300047443 Bacteria 14881
696 Ga0495687_005527 3300047443 Bacteria 8021
697 Ga0495687_009154 3300047443 Bacteria 5572
698 Ga0495687_015074 3300047443 Bacteria 3944
699 Ga0495675_0065462 3300047444 Bacteria 2298
700 Ga0495679_000086 3300047446 Bacteria 85895
701 Ga0495679_000133 3300047446 Bacteria 66052
702 Ga0495679_025427 3300047446 Bacteria 1979
703 Ga0495673_0000077 3300047469 Bacteria 204403
704 Ga0495673_0000281 3300047469 Bacteria 68886
705 Ga0495673_0000656 3300047469 Bacteria 34029
706 Ga0495673_0000966 3300047469 Bacteria 25951
707 Ga0495673_0001880 3300047469 Bacteria 15759
708 Ga0495673_0005342 3300047469 Bacteria 7789
709 Ga0495673_0009546 3300047469 Bacteria 5366
710 Ga0495673_0012894 3300047469 Bacteria 4408
711 Ga0495673_0027832 3300047469 Bacteria 2684
712 Ga0495673_0076687 3300047469 Bacteria 1393
713 Ga0495681_0000031 3300047470 Bacteria 128177
714 Ga0495681_0008454 3300047470 Bacteria 6457
715 Ga0495681_0017000 3300047470 Bacteria 4054
716 Ga0495681_0018044 3300047470 Bacteria 3898
717 Ga0495686_0000418 3300047472 Bacteria 67274
718 Ga0495686_0032054 3300047472 Bacteria 3403
719 Ga0495686_0103431 3300047472 Bacteria 1716
720 Ga0495686_0224665 3300047472 Bacteria 1066
721 Ga0495686_0387828 3300047472 Bacteria 752
722 Ga0495602_0084832 3300048088 Bacteria 2649
723 Ga0495626_0000002 3300048091 Bacteria 436012
724 Ga0495626_0000451 3300048091 Bacteria 41891
725 Ga0495626_0000748 3300048091 Bacteria 29994
726 Ga0495626_0001395 3300048091 Bacteria 19359
727 Ga0495626_0002100 3300048091 Bacteria 14488
728 Ga0495626_0059482 3300048091 Bacteria 1743
729 Ga0495626_0078118 3300048091 Bacteria 1474
730 Ga0496101_0076974 3300048904 Bacteria 2458
731 Ga0496102_0000475 3300048905 Bacteria 44485
732 Ga0496102_0051450 3300048905 Bacteria 3752
733 Ga0496103_0018945 3300048906 Bacteria 4132
734 Ga0496106_0329371 3300048909 Bacteria 1226
735 Ga0496113_0017486 3300048916 Bacteria 4978
736 Ga0496114_0383799 3300048917 Bacteria 1244
737 Ga0496115_0113582 3300048918 Bacteria 2226
738 Ga0496116_0003732 3300048919 Bacteria 14894
739 Ga0496116_0028731 3300048919 Bacteria 4022
740 Ga0496116_0191739 3300048919 Bacteria 1081
741 Ga0496117_0000246 3300048920 Bacteria 102783
742 Ga0496117_0002266 3300048920 Bacteria 24847
743 Ga0496117_0015728 3300048920 Bacteria 6426
744 Ga0496117_0116632 3300048920 Bacteria 1650
745 Ga0496117_0207220 3300048920 Bacteria 1102
746 Ga0496118_0004214 3300048921 Bacteria 17265
747 Ga0496118_0015631 3300048921 Bacteria 7013
748 Ga0496118_0146221 3300048921 Bacteria 1488
749 Ga0496118_0194586 3300048921 Bacteria 1208
750 Ga0496119_0004102 3300048922 Bacteria 14685
751 Ga0496119_0029831 3300048922 Bacteria 3687
752 Ga0496119_0056253 3300048922 Bacteria 2384
753 Ga0496120_0043574 3300048923 Bacteria 2613
754 Ga0496120_0049134 3300048923 Bacteria 2423
755 Ga0496121_0000005 3300048924 Bacteria 1034486
756 Ga0496121_0003531 3300048924 Bacteria 22194
757 Ga0496121_0003988 3300048924 Bacteria 20364
758 Ga0496121_0008277 3300048924 Bacteria 12302
759 Ga0496121_0009440 3300048924 Bacteria 11214
760 Ga0496121_0014636 3300048924 Bacteria 8298
761 Ga0496121_0228514 3300048924 Bacteria 1305
762 Ga0496122_0000565 3300048925 Bacteria 75875
763 Ga0496122_0001036 3300048925 Bacteria 48813
764 Ga0496122_0005625 3300048925 Bacteria 14821
765 Ga0496122_0007679 3300048925 Bacteria 11888
766 Ga0496122_0023009 3300048925 Bacteria 5514
767 Ga0496122_0048469 3300048925 Bacteria 3266
768 Ga0496122_0075317 3300048925 Bacteria 2381
769 Ga0496122_0282790 3300048925 Bacteria 905
770 Ga0496123_0000055 3300048926 Bacteria 233626
771 Ga0496123_0000247 3300048926 Bacteria 109186
772 Ga0496123_0002102 3300048926 Bacteria 25606
773 Ga0496123_0008936 3300048926 Bacteria 9111
774 Ga0496123_0040314 3300048926 Bacteria 3255
775 Ga0496123_0054773 3300048926 Bacteria 2622
776 Ga0496123_0061406 3300048926 Bacteria 2415
777 Ga0496124_0000035 3300048927 Bacteria 318099
778 Ga0496124_0008204 3300048927 Bacteria 10957
779 Ga0496124_0009778 3300048927 Bacteria 9814
780 Ga0496124_0017485 3300048927 Bacteria 6754
781 Ga0496124_0052504 3300048927 Bacteria 3462
782 Ga0496124_0120840 3300048927 Bacteria 2093
783 Ga0496124_0233405 3300048927 Bacteria 1373
784 Ga0496125_0000034 3300048928 Bacteria 348231
785 Ga0496125_0000161 3300048928 Bacteria 150707
786 Ga0496125_0000266 3300048928 Bacteria 107204
787 Ga0496125_0008970 3300048928 Bacteria 10372
788 Ga0496126_0013447 3300048929 Bacteria 8321
789 Ga0496126_0022221 3300048929 Bacteria 6176
790 Ga0496126_0058087 3300048929 Bacteria 3488
791 Ga0496126_0086223 3300048929 Bacteria 2767
792 Ga0495678_000005 3300049459 Bacteria 522958
793 Ga0495678_001061 3300049459 Bacteria 23289
794 Ga0495678_003876 3300049459 Bacteria 8979
795 Ga0495678_005542 3300049459 Bacteria 6934
796 Ga0495678_093102 3300049459 Bacteria 1057
797 Ga0495682_0000393 3300049460 Bacteria 31581
798 Ga0495682_0001543 3300049460 Bacteria 12094
799 Ga0495682_0030792 3300049460 Bacteria 1984
800 Ga0495682_0031766 3300049460 Bacteria 1951
801 Ga0495682_0053446 3300049460 Bacteria 1466
802 Ga0495682_0079108 3300049460 Bacteria 1183
803 Ga0501031_0213518 3300049568 Unclassified 1257
804 Ga0501033_0188868 3300049570 Bacteria 1475
805 Ga0501034_0040564 3300049571 Bacteria 4712
806 Ga0501036_0209961 3300049572 Bacteria 1636
807 Ga0501037_0209353 3300049573 Bacteria 1376
808 Ga0501038_0090129 3300049574 Bacteria 2571
809 Ga0501040_0029490 3300049576 Bacteria 3704
810 Ga0501043_0186491 3300049579 Bacteria 1615
811 Ga0501046_0064317 3300049580 Bacteria 2864
812 Ga0501071_0065219 3300049587 Bacteria 2644
813 Ga0501072_0037498 3300049588 Bacteria 3802
814 Ga0501074_0212353 3300049590 Unclassified 1378
815 Ga0501075_0034514 3300049591 Bacteria 3767
816 Ga0501076_0051094 3300049592 Bacteria 3271
817 Ga0501077_0019800 3300049593 Bacteria 4256
818 Ga0501079_0094277 3300049741 Bacteria 2319
819 Ga0501080_0064762 3300049742 Bacteria 3400
820 Ga0501081_0020717 3300049743 Bacteria 4385
821 Ga0501045_0002223 3300049824 Bacteria 13178
822 nmdc:mga03683_126274_c1 3300050489 Bacteria 1141
823 nmdc:mga03683_41700_c1 3300050489 Bacteria 1886
824 nmdc:mga03683_50458_c1 3300050489 Bacteria 1735
825 nmdc:mga03683_5053_c1 3300050489 Bacteria 4422
826 nmdc:mga03n38_62468_c1 3300050490 Bacteria 1699
827 nmdc:mga00v17_22877_c1 3300050491 Bacteria 3612
828 nmdc:mga00v17_245805_c1 3300050491 Bacteria 1160
829 nmdc:mga0yw44_34560_c1 3300050492 Bacteria 2963
830 nmdc:mga0yw44_45400_c1 3300050492 Bacteria 2634
831 nmdc:mga0k408_153059_c1 3300050493 Bacteria 1374
832 nmdc:mga0k408_193476_c1 3300050493 Bacteria 1214
833 nmdc:mga0k408_290201_c1 3300050493 Bacteria 976
834 nmdc:mga0k408_43645_c1 3300050493 Bacteria 2584
835 nmdc:mga0k408_55925_c1 3300050493 Bacteria 2289
836 nmdc:mga0k408_6388_c1 3300050493 Bacteria 6292
837 nmdc:mga06z11_22523_c1 3300050494 Bacteria 2944
838 nmdc:mga06z11_9219_c1 3300050494 Bacteria 4150
839 nmdc:mga04h51_52650_c1 3300050495 Bacteria 1371
840 nmdc:mga07m45_1812_c1 3300050496 Bacteria 9847
841 nmdc:mga07m45_20536_c1 3300050496 Bacteria 3588
842 nmdc:mga07m45_6130_c1 3300050496 Bacteria 6061
843 nmdc:mga07m45_70564_c1 3300050496 Bacteria 1517
844 nmdc:mga0qj67_169175_c1 3300050509 Bacteria 1774
845 nmdc:mga06r32_40858_c1 3300050510 Bacteria 4405
846 nmdc:mga08y16_71_c1 3300050511 Bacteria 84502
847 nmdc:mga0sz30_12176_c1 3300050516 Bacteria 3340
848 nmdc:mga0sz30_297_c1 3300050516 Bacteria 12453
849 Ga0500610_0004448 3300053079 Bacteria 5570
850 Ga0500578_0129235 3300053086 Bacteria 1585
851 Ga0500578_0164099 3300053086 Bacteria 1376
852 Ga0500644_0009483 3300053088 Bacteria 2605
853 Ga0500651_0065608 3300053093 Bacteria 2262
854 Ga0500651_0176470 3300053093 Bacteria 1271
855 Ga0500650_0089569 3300053098 Bacteria 1440
856 Ga0500555_001653 3300053103 Bacteria 6737
857 Ga0500556_0000200 3300053104 Bacteria 49207
858 Ga0500556_0081647 3300053104 Bacteria 1223
859 Ga0500557_011251 3300053105 Bacteria 2273
860 Ga0500569_003341 3300053109 Bacteria 3268
861 Ga0500594_0000551 3300053118 Bacteria 8097
862 Ga0500658_0007852 3300053134 Bacteria 3942
863 Ga0500568_0000612 3300053139 Bacteria 25826
864 Ga0500588_0054248 3300053146 Bacteria 1262
865 Ga0500590_000323 3300053148 Bacteria 15356
866 Ga0500616_0001106 3300053153 Bacteria 27889
867 Ga0500616_0035069 3300053153 Bacteria 2729
868 Ga0500622_0145694 3300053156 Bacteria 1125
869 Ga0500627_0068506 3300053158 Bacteria 1569
870 Ga0500636_0169942 3300053177 Bacteria 1180
871 Ga0500611_158100 3300053727 Bacteria 626
872 Ga0501084_0004231 3300054114 Bacteria 11692
873 Ga0501082_0007932 3300060353 Bacteria 9172
874 Ga0530510_0149257 3300061734 Bacteria 1725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0456278 Ga0466959_0456278_16_618 176
2 3300044765 Ga0466970_0105673 Ga0466970_0105673_20_619 185
3 3300006038 Ga0075365_10095450 Ga0075365_100954503 187
4 3300006048 Ga0075363_100051405 Ga0075363_1000514053 187
5 3300027866 Ga0209813_10069115 Ga0209813_100691152 187
6 3300006946 Ga0079104_1005750 Ga0079104_10057503 188
7 3300027111 Ga0209281_1000463 Ga0209281_100046347 188
8 3300006038 Ga0075365_10075310 Ga0075365_100753103 189
9 3300006042 Ga0075368_10048320 Ga0075368_100483202 189
10 3300006177 Ga0075362_10004078 Ga0075362_100040785 189
11 3300006353 Ga0075370_10135934 Ga0075370_101359342 189
12 3300009036 Ga0105244_10000519 Ga0105244_1000051919 189
13 3300009098 Ga0105245_10451204 Ga0105245_104512042 189
14 3300009148 Ga0105243_10432832 Ga0105243_104328322 189
15 3300014326 Ga0157380_10709879 Ga0157380_107098792 189
16 3300025935 Ga0207709_10258890 Ga0207709_102588901 189
17 3300031730 Ga0307516_10274752 Ga0307516_102747522 189
18 3300033180 Ga0307510_10140416 Ga0307510_101404162 189
19 3300046660 Ga0495625_0364773 Ga0495625_0364773_58_717 189
20 3300050494 nmdc:mga06z11_22523_c1 nmdc:mga06z11_22523_c1_530_1189 189
21 3300050496 nmdc:mga07m45_20536_c1 nmdc:mga07m45_20536_c1_1434_2093 189
22 3300053093 Ga0500651_0176470 Ga0500651_0176470_101_760 189
23 3300006038 Ga0075365_10099179 Ga0075365_100991793 190
24 3300021320 Ga0214544_1000419 Ga0214544_100041962 190
25 3300021321 Ga0214542_1000027 Ga0214542_100002774 190
26 3300021321 Ga0214542_1033155 Ga0214542_10331552 190
27 3300021327 Ga0214543_1000025 Ga0214543_1000025142 190
28 3300021327 Ga0214543_1000047 Ga0214543_100004748 190
29 3300048909 Ga0496106_0329371 Ga0496106_0329371_430_1098 190
30 3300053727 Ga0500611_158100 Ga0500611_158100_26_601 190
31 3300005718 Ga0068866_10418444 Ga0068866_104184441 191
32 3300006847 Ga0075431_100010054 Ga0075431_1000100546 191
33 3300009147 Ga0114129_10011124 Ga0114129_1001112416 191
34 3300042006 Ga0439432_000588 Ga0439432_000588_12518_13180 191
35 3300049568 Ga0501031_0213518 Ga0501031_0213518_81_740 191
36 3300049570 Ga0501033_0188868 Ga0501033_0188868_413_1072 191
37 3300049572 Ga0501036_0209961 Ga0501036_0209961_266_925 191
38 3300049573 Ga0501037_0209353 Ga0501037_0209353_145_804 191
39 3300049574 Ga0501038_0090129 Ga0501038_0090129_739_1398 191
40 3300049576 Ga0501040_0029490 Ga0501040_0029490_446_1105 191
41 3300049579 Ga0501043_0186491 Ga0501043_0186491_577_1236 191
42 3300049580 Ga0501046_0064317 Ga0501046_0064317_417_1076 191
43 3300049587 Ga0501071_0065219 Ga0501071_0065219_1679_2338 191
44 3300049588 Ga0501072_0037498 Ga0501072_0037498_1349_2008 191
45 3300049590 Ga0501074_0212353 Ga0501074_0212353_107_766 191
46 3300049591 Ga0501075_0034514 Ga0501075_0034514_2407_3066 191
47 3300049592 Ga0501076_0051094 Ga0501076_0051094_2334_2993 191
48 3300049593 Ga0501077_0019800 Ga0501077_0019800_2436_3095 191
49 3300049741 Ga0501079_0094277 Ga0501079_0094277_656_1315 191
50 3300049742 Ga0501080_0064762 Ga0501080_0064762_243_902 191
51 3300049743 Ga0501081_0020717 Ga0501081_0020717_2571_3230 191
52 3300049824 Ga0501045_0002223 Ga0501045_0002223_7003_7662 191
53 3300050509 nmdc:mga0qj67_169175_c1 nmdc:mga0qj67_169175_c1_381_1040 191
54 3300050510 nmdc:mga06r32_40858_c1 nmdc:mga06r32_40858_c1_3666_4325 191
55 3300054114 Ga0501084_0004231 Ga0501084_0004231_8969_9628 191
56 3300060353 Ga0501082_0007932 Ga0501082_0007932_1628_2287 191
57 3300061734 Ga0530510_0149257 Ga0530510_0149257_298_957 191
58 3300003775 Ga0055524_1001942 Ga0055524_10019426 192
59 3300025728 Ga0207655_1000022 Ga0207655_100002277 192
60 3300046460 Ga0495638_0040688 Ga0495638_0040688_1153_1812 192
61 3300047472 Ga0495686_0387828 Ga0495686_0387828_45_704 192
62 3300049571 Ga0501034_0040564 Ga0501034_0040564_1026_1685 192
63 3300025299 Ga0209256_1000164 Ga0209256_1000164120 193
64 3300021388 Ga0213875_10072901 Ga0213875_100729011 194
65 3300025735 Ga0207713_1000827 Ga0207713_10008275 194
66 3300048922 Ga0496119_0004102 Ga0496119_0004102_8289_8951 194
67 3300048925 Ga0496122_0005625 Ga0496122_0005625_106_768 194
68 3300048926 Ga0496123_0002102 Ga0496123_0002102_14077_14739 194
69 3300053104 Ga0500556_0000200 Ga0500556_0000200_3070_3732 194
70 3300006177 Ga0075362_10029894 Ga0075362_100298941 195
71 3300025927 Ga0207687_10305706 Ga0207687_103057062 195
72 3300030522 Ga0307512_10046883 Ga0307512_100468834 195
73 3300031911 Ga0307412_10700786 Ga0307412_107007862 195
74 3300033179 Ga0307507_10295229 Ga0307507_102952292 195
75 3300037471 Ga0395905_0022998 Ga0395905_0022998_1516_2178 195
76 3300037471 Ga0395905_0037462 Ga0395905_0037462_545_1204 195
77 3300044684 Ga0466966_0046273 Ga0466966_0046273_548_1210 195
78 3300044694 Ga0466963_0011584 Ga0466963_0011584_2476_3138 195
79 3300044719 Ga0466971_0171191 Ga0466971_0171191_336_998 195
80 3300044765 Ga0466970_0000136 Ga0466970_0000136_29940_30602 195
81 3300044842 Ga0466957_0011830 Ga0466957_0011830_2087_2749 195
82 3300045836 Ga0466958_0093997 Ga0466958_0093997_799_1461 195
83 3300046507 Ga0495606_0203403 Ga0495606_0203403_72_734 195
84 3300046526 Ga0495666_0058173 Ga0495666_0058173_625_1287 195
85 3300047472 Ga0495686_0103431 Ga0495686_0103431_1012_1683 195
86 3300050489 nmdc:mga03683_5053_c1 nmdc:mga03683_5053_c1_2739_3398 195
87 3300050496 nmdc:mga07m45_6130_c1 nmdc:mga07m45_6130_c1_5168_5830 195
88 3300053088 Ga0500644_0009483 Ga0500644_0009483_878_1540 195
89 2162886007 SwRhRL2b_contig_1025407 SwRhRL2b_0351.00007230 196
90 3300003215 JGI25153J46596_10000948 JGI25153J46596_1000094811 196
91 3300003791 Ga0055530_10000002 Ga0055530_10000002178 196
92 3300003792 Ga0055540_1000009 Ga0055540_1000009178 196
93 3300003856 Ga0058692_1007015 Ga0058692_10070152 196
94 3300005288 Ga0065714_10002696 Ga0065714_100026966 196
95 3300005289 Ga0065704_10070326 Ga0065704_1007032623 196
96 3300005328 Ga0070676_10057979 Ga0070676_100579793 196
97 3300005334 Ga0068869_100105989 Ga0068869_1001059892 196
98 3300005335 Ga0070666_10089273 Ga0070666_100892732 196
99 3300005353 Ga0070669_100113805 Ga0070669_1001138052 196
100 3300005355 Ga0070671_100206529 Ga0070671_1002065292 196
101 3300005356 Ga0070674_100650008 Ga0070674_1006500082 196
102 3300005364 Ga0070673_100097003 Ga0070673_1000970032 196
103 3300005367 Ga0070667_100230130 Ga0070667_1002301302 196
104 3300005455 Ga0070663_100114604 Ga0070663_1001146042 196
105 3300005467 Ga0070706_100006049 Ga0070706_1000060496 196
106 3300005468 Ga0070707_100155873 Ga0070707_1001558732 196
107 3300005577 Ga0068857_100063405 Ga0068857_1000634053 196
108 3300005616 Ga0068852_100711403 Ga0068852_1007114032 196
109 3300005617 Ga0068859_100457736 Ga0068859_1004577362 196
110 3300005618 Ga0068864_100844583 Ga0068864_1008445832 196
111 3300006038 Ga0075365_10225166 Ga0075365_102251662 196
112 3300006042 Ga0075368_10020035 Ga0075368_100200353 196
113 3300006051 Ga0075364_10222583 Ga0075364_102225832 196
114 3300006051 Ga0075364_10392696 Ga0075364_103926962 196
115 3300006178 Ga0075367_10110330 Ga0075367_101103302 196
116 3300006186 Ga0075369_10165369 Ga0075369_101653692 196
117 3300006195 Ga0075366_10117236 Ga0075366_101172362 196
118 3300006881 Ga0068865_100051758 Ga0068865_1000517583 196
119 3300006931 Ga0097620_100457689 Ga0097620_1004576892 196
120 3300009093 Ga0105240_10086767 Ga0105240_100867674 196
121 3300009098 Ga0105245_10411663 Ga0105245_104116632 196
122 3300009545 Ga0105237_10018035 Ga0105237_100180359 196
123 3300009551 Ga0105238_10418081 Ga0105238_104180811 196
124 3300009553 Ga0105249_10054998 Ga0105249_100549984 196
125 3300010375 Ga0105239_10022339 Ga0105239_100223395 196
126 3300013100 Ga0157373_10012988 Ga0157373_100129886 196
127 3300025292 Ga0209676_1009137 Ga0209676_10091375 196
128 3300025294 Ga0209025_1000121 Ga0209025_100012164 196
129 3300025297 Ga0209758_1005135 Ga0209758_10051354 196
130 3300025298 Ga0209050_1000009 Ga0209050_1000009790 196
131 3300025303 Ga0209051_1000008 Ga0209051_1000008547 196
132 3300025304 Ga0209257_1019019 Ga0209257_10190193 196
133 3300025903 Ga0207680_10116281 Ga0207680_101162812 196
134 3300025907 Ga0207645_10084606 Ga0207645_100846063 196
135 3300025910 Ga0207684_10012548 Ga0207684_100125487 196
136 3300025913 Ga0207695_10072809 Ga0207695_100728092 196
137 3300025914 Ga0207671_10041667 Ga0207671_100416674 196
138 3300025927 Ga0207687_10127911 Ga0207687_101279112 196
139 3300025931 Ga0207644_10103475 Ga0207644_101034752 196
140 3300025933 Ga0207706_10010353 Ga0207706_100103537 196
141 3300025942 Ga0207689_10023203 Ga0207689_100232035 196
142 3300025961 Ga0207712_10115856 Ga0207712_101158562 196
143 3300026067 Ga0207678_10098511 Ga0207678_100985112 196
144 3300026089 Ga0207648_10237869 Ga0207648_102378692 196
145 3300026116 Ga0207674_10010723 Ga0207674_100107238 196
146 3300026118 Ga0207675_100285137 Ga0207675_1002851372 196
147 3300026121 Ga0207683_10528422 Ga0207683_105284222 196
148 3300027312 Ga0209371_1001425 Ga0209371_10014255 196
149 3300028381 Ga0268264_10300480 Ga0268264_103004802 196
150 3300028794 Ga0307515_10006683 Ga0307515_1000668318 196
151 3300030500 Ga0268256_1001855 Ga0268256_10018555 196
152 3300030733 Ga0314311_1003930 Ga0314311_10039304 196
153 3300031548 Ga0307408_100332515 Ga0307408_1003325152 196
154 3300041413 Ga0439465_0034550 Ga0439465_0034550_202_861 196
155 3300045976 Ga0466967_0065100 Ga0466967_0065100_1445_2107 196
156 3300046459 Ga0495629_0008153 Ga0495629_0008153_4713_5375 196
157 3300046462 Ga0495651_0243875 Ga0495651_0243875_280_942 196
158 3300046473 Ga0495582_0269574 Ga0495582_0269574_224_886 196
159 3300046476 Ga0495662_0007315 Ga0495662_0007315_598_1260 196
160 3300046524 Ga0495648_0117409 Ga0495648_0117409_53_715 196
161 3300046529 Ga0495652_0471174 Ga0495652_0471174_121_783 196
162 3300046533 Ga0495640_0132830 Ga0495640_0132830_544_1206 196
163 3300046557 Ga0495622_0007393 Ga0495622_0007393_368_1030 196
164 3300046663 Ga0495635_0240372 Ga0495635_0240372_82_744 196
165 3300046675 Ga0495657_0020397 Ga0495657_0020397_3564_4226 196
166 3300046683 Ga0495658_0211393 Ga0495658_0211393_73_735 196
167 3300046809 Ga0495600_0031896 Ga0495600_0031896_561_1223 196
168 3300047317 Ga0495604_0055591 Ga0495604_0055591_455_1117 196
169 3300047319 Ga0495674_0308786 Ga0495674_0308786_83_745 196
170 3300047443 Ga0495687_000232 Ga0495687_000232_72217_72879 196
171 3300048088 Ga0495602_0084832 Ga0495602_0084832_1415_2077 196
172 3300048920 Ga0496117_0002266 Ga0496117_0002266_10110_10772 196
173 3300048925 Ga0496122_0000565 Ga0496122_0000565_20602_21264 196
174 3300048926 Ga0496123_0000247 Ga0496123_0000247_86948_87610 196
175 3300048928 Ga0496125_0000161 Ga0496125_0000161_139545_140207 196
176 3300050489 nmdc:mga03683_41700_c1 nmdc:mga03683_41700_c1_194_856 196
177 3300050493 nmdc:mga0k408_153059_c1 nmdc:mga0k408_153059_c1_579_1241 196
178 3300050493 nmdc:mga0k408_193476_c1 nmdc:mga0k408_193476_c1_280_942 196
179 3300050493 nmdc:mga0k408_55925_c1 nmdc:mga0k408_55925_c1_680_1342 196
180 3300053093 Ga0500651_0065608 Ga0500651_0065608_414_1076 196
181 3300053148 Ga0500590_000323 Ga0500590_000323_4333_4995 196
182 3300053177 Ga0500636_0169942 Ga0500636_0169942_169_831 196
183 3300006051 Ga0075364_10009059 Ga0075364_100090594 197
184 3300028794 Ga0307515_10097680 Ga0307515_100976802 197
185 3300046460 Ga0495638_0000622 Ga0495638_0000622_14896_15558 197
186 3300047318 Ga0495636_0096144 Ga0495636_0096144_470_1132 197
187 3300047323 Ga0495683_0179221 Ga0495683_0179221_226_888 197
188 3300048920 Ga0496117_0207220 Ga0496117_0207220_241_903 197
189 3300048923 Ga0496120_0043574 Ga0496120_0043574_536_1198 197
190 3300048924 Ga0496121_0000005 Ga0496121_0000005_101338_102000 197
191 3300048925 Ga0496122_0075317 Ga0496122_0075317_564_1226 197
192 3300048925 Ga0496122_0282790 Ga0496122_0282790_137_799 197
193 3300048927 Ga0496124_0120840 Ga0496124_0120840_943_1605 197
194 3300048928 Ga0496125_0000034 Ga0496125_0000034_100692_101354 197
195 3300048929 Ga0496126_0013447 Ga0496126_0013447_142_804 197
196 3300048929 Ga0496126_0022221 Ga0496126_0022221_725_1387 197
197 3300050491 nmdc:mga00v17_22877_c1 nmdc:mga00v17_22877_c1_423_1085 197
198 3300053139 Ga0500568_0000612 Ga0500568_0000612_560_1222 197
199 3300053153 Ga0500616_0001106 Ga0500616_0001106_1634_2296 197
200 3300006353 Ga0075370_10011266 Ga0075370_100112663 198
201 3300009765 Ga0123341_1000005 Ga0123341_1000005124 198
202 3300009766 Ga0123342_1012900 Ga0123342_10129003 198
203 3300001979 JGI24740J21852_10007416 JGI24740J21852_100074166 199
204 3300002773 JGI25152J39213_1015488 JGI25152J39213_10154882 199
205 3300003187 JGI25151J46595_10000472 JGI25151J46595_100004728 199
206 3300003354 JGI25160J50197_1004711 JGI25160J50197_10047115 199
207 3300003374 JGI25161J50226_1003205 JGI25161J50226_10032053 199
208 3300003771 Ga0055526_1009475 Ga0055526_10094755 199
209 3300003775 Ga0055524_1011492 Ga0055524_10114923 199
210 3300003790 Ga0055528_1001747 Ga0055528_100174712 199
211 3300003792 Ga0055540_1006624 Ga0055540_10066242 199
212 3300004625 Ga0055543_1001197 Ga0055543_10011974 199
213 3300006038 Ga0075365_10030678 Ga0075365_100306782 199
214 3300006177 Ga0075362_10040780 Ga0075362_100407803 199
215 3300006178 Ga0075367_10010717 Ga0075367_100107172 199
216 3300006186 Ga0075369_10055904 Ga0075369_100559042 199
217 3300006195 Ga0075366_10071283 Ga0075366_100712832 199
218 3300006353 Ga0075370_10005158 Ga0075370_100051582 199
219 3300014497 Ga0182008_10006407 Ga0182008_100064074 199
220 3300025245 Ga0207425_1008276 Ga0207425_10082763 199
221 3300025258 Ga0209129_1000997 Ga0209129_10009976 199
222 3300025272 Ga0209455_1016997 Ga0209455_10169972 199
223 3300025273 Ga0209673_1002317 Ga0209673_100231711 199
224 3300025284 Ga0209130_1025020 Ga0209130_10250201 199
225 3300025291 Ga0209675_1023459 Ga0209675_10234593 199
226 3300025294 Ga0209025_1000228 Ga0209025_100022861 199
227 3300025295 Ga0209564_1000763 Ga0209564_10007635 199
228 3300025297 Ga0209758_1000113 Ga0209758_1000113169 199
229 3300025299 Ga0209256_1002844 Ga0209256_10028443 199
230 3300025302 Ga0207426_1000307 Ga0207426_100030738 199
231 3300025303 Ga0209051_1002046 Ga0209051_100204614 199
232 3300031548 Ga0307408_100605538 Ga0307408_1006055382 199
233 3300031731 Ga0307405_10042440 Ga0307405_100424402 199
234 3300042007 Ga0439449_0120861 Ga0439449_0120861_120_836 199
235 3300046474 Ga0495605_0020734 Ga0495605_0020734_2062_2724 199
236 3300046513 Ga0495616_0027250 Ga0495616_0027250_1867_2529 199
237 3300046518 Ga0495631_0006438 Ga0495631_0006438_4711_5373 199
238 3300046530 Ga0495654_0191161 Ga0495654_0191161_143_805 199
239 3300046538 Ga0495609_0024324 Ga0495609_0024324_23_685 199
240 3300046616 Ga0495668_0054619 Ga0495668_0054619_307_969 199
241 3300046648 Ga0495611_0058018 Ga0495611_0058018_480_1142 199
242 3300046660 Ga0495625_0088336 Ga0495625_0088336_650_1312 199
243 3300046691 Ga0495670_0175616 Ga0495670_0175616_355_1017 199
244 3300046810 Ga0495660_0224643 Ga0495660_0224643_48_710 199
245 3300048921 Ga0496118_0146221 Ga0496118_0146221_132_794 199
246 3300048922 Ga0496119_0056253 Ga0496119_0056253_808_1470 199
247 3300048923 Ga0496120_0049134 Ga0496120_0049134_175_837 199
248 3300048927 Ga0496124_0017485 Ga0496124_0017485_3534_4196 199
249 3300048927 Ga0496124_0233405 Ga0496124_0233405_646_1308 199
250 3300049459 Ga0495678_093102 Ga0495678_093102_148_810 199
251 3300049460 Ga0495682_0079108 Ga0495682_0079108_485_1147 199
252 3300050489 nmdc:mga03683_50458_c1 nmdc:mga03683_50458_c1_256_918 199
253 3300050490 nmdc:mga03n38_62468_c1 nmdc:mga03n38_62468_c1_588_1250 199
254 3300050492 nmdc:mga0yw44_34560_c1 nmdc:mga0yw44_34560_c1_2158_2820 199
255 3300050493 nmdc:mga0k408_6388_c1 nmdc:mga0k408_6388_c1_516_1178 199
256 3300050494 nmdc:mga06z11_9219_c1 nmdc:mga06z11_9219_c1_2763_3425 199
257 3300050496 nmdc:mga07m45_1812_c1 nmdc:mga07m45_1812_c1_7891_8553 199
258 3300050516 nmdc:mga0sz30_12176_c1 nmdc:mga0sz30_12176_c1_2413_3075 199
259 3300053079 Ga0500610_0004448 Ga0500610_0004448_77_739 199
260 3300053086 Ga0500578_0129235 Ga0500578_0129235_175_837 199
261 3300053103 Ga0500555_001653 Ga0500555_001653_601_1260 199
262 3300053104 Ga0500556_0081647 Ga0500556_0081647_192_854 199
263 3300053105 Ga0500557_011251 Ga0500557_011251_297_959 199
264 3300053118 Ga0500594_0000551 Ga0500594_0000551_541_1203 199
265 3300053146 Ga0500588_0054248 Ga0500588_0054248_397_1059 199
266 3300025935 Ga0207709_10466144 Ga0207709_104661441 200
267 iso_pu_bacteria 2508501114 2509074650 200
268 iso_pu_bacteria 2687453129 2687579157 200
269 iso_pu_bacteria 8057529695 8057529717 200
270 3300003762 Ga0055542_1014809 Ga0055542_10148092 201
271 3300005328 Ga0070676_10023480 Ga0070676_100234803 201
272 3300005339 Ga0070660_100065289 Ga0070660_1000652892 201
273 3300005347 Ga0070668_100034545 Ga0070668_1000345456 201
274 3300005354 Ga0070675_100052395 Ga0070675_1000523954 201
275 3300005356 Ga0070674_100145520 Ga0070674_1001455202 201
276 3300005364 Ga0070673_100107901 Ga0070673_1001079013 201
277 3300005364 Ga0070673_100536406 Ga0070673_1005364062 201
278 3300005456 Ga0070678_100504858 Ga0070678_1005048582 201
279 3300005543 Ga0070672_100287339 Ga0070672_1002873392 201
280 3300005548 Ga0070665_100250690 Ga0070665_1002506902 201
281 3300005718 Ga0068866_10087678 Ga0068866_100876782 201
282 3300006881 Ga0068865_100075107 Ga0068865_1000751073 201
283 3300009011 Ga0105251_10010981 Ga0105251_100109813 201
284 3300009036 Ga0105244_10007547 Ga0105244_100075473 201
285 3300013100 Ga0157373_10095319 Ga0157373_100953193 201
286 3300013105 Ga0157369_10003795 Ga0157369_1000379511 201
287 3300014325 Ga0163163_10165608 Ga0163163_101656082 201
288 3300025242 Ga0209258_104672 Ga0209258_1046723 201
289 3300025254 Ga0209148_1000420 Ga0209148_100042020 201
290 3300025272 Ga0209455_1000290 Ga0209455_100029036 201
291 3300025728 Ga0207655_1075769 Ga0207655_10757691 201
292 3300025735 Ga0207713_1024116 Ga0207713_10241163 201
293 3300025907 Ga0207645_10037406 Ga0207645_100374063 201
294 3300025937 Ga0207669_10021091 Ga0207669_100210913 201
295 3300025938 Ga0207704_10303876 Ga0207704_103038761 201
296 3300025940 Ga0207691_10671910 Ga0207691_106719102 201
297 3300025960 Ga0207651_10284339 Ga0207651_102843392 201
298 3300025960 Ga0207651_10646988 Ga0207651_106469881 201
299 3300025972 Ga0207668_10024637 Ga0207668_100246375 201
300 3300026121 Ga0207683_10469601 Ga0207683_104696012 201
301 3300028379 Ga0268266_10468457 Ga0268266_104684572 201
302 3300005336 Ga0070680_100158639 Ga0070680_1001586392 202
303 3300005344 Ga0070661_100000252 Ga0070661_1000002524 202
304 3300005458 Ga0070681_10013436 Ga0070681_100134363 202
305 3300005530 Ga0070679_100205382 Ga0070679_1002053823 202
306 3300005564 Ga0070664_100000186 Ga0070664_1000001864 202
307 3300009036 Ga0105244_10020420 Ga0105244_100204204 202
308 3300009176 Ga0105242_10000474 Ga0105242_100004744 202
309 3300009545 Ga0105237_10001450 Ga0105237_100014506 202
310 3300011119 Ga0105246_10206465 Ga0105246_102064652 202
311 3300013104 Ga0157370_10040968 Ga0157370_100409683 202
312 3300013104 Ga0157370_10149566 Ga0157370_101495662 202
313 3300013105 Ga0157369_10177905 Ga0157369_101779052 202
314 3300025728 Ga0207655_1000419 Ga0207655_100041918 202
315 3300025914 Ga0207671_10001314 Ga0207671_1000131425 202
316 3300025920 Ga0207649_10000217 Ga0207649_1000021723 202
317 3300025934 Ga0207686_10005559 Ga0207686_100055598 202
318 3300025945 Ga0207679_10000109 Ga0207679_1000010918 202
319 iso_pu_bacteria 2508501122 2509112287 202
320 iso_pu_bacteria 2509276019 2509379412 202
321 iso_pu_bacteria 2509276021 2509390760 202
322 iso_pu_bacteria 2509276033 2509441805 202
323 iso_pu_bacteria 2510065019 2510136360 202
324 iso_pu_bacteria 2510065053 2510284821 202
325 iso_pu_bacteria 2510065055 2510295131 202
326 iso_pu_bacteria 2510065057 2510308676 202
327 iso_pu_bacteria 2510065058 2510312199 202
328 iso_pu_bacteria 2510461076 2510892615 202
329 iso_pu_bacteria 2510917022 2511132834 202
330 iso_pu_bacteria 2510917028 2511186029 202
331 iso_pu_bacteria 2511231004 2511254271 202
332 iso_pu_bacteria 2511231007 2511274521 202
333 iso_pu_bacteria 2511231010 2511293059 202
334 iso_pu_bacteria 2511231011 2511296145 202
335 iso_pu_bacteria 2511231016 2511327176 202
336 iso_pu_bacteria 2511231017 2511330064 202
337 iso_pu_bacteria 2511231018 2511340405 202
338 iso_pu_bacteria 2511231019 2511342475 202
339 iso_pu_bacteria 2511231022 2511360283 202
340 iso_pu_bacteria 2511231031 2511412691 202
341 iso_pu_bacteria 2511231052 2511498209 202
342 iso_pu_bacteria 2511231156 2511825242 202
343 iso_pu_bacteria 2512047086 2512529365 202
344 iso_pu_bacteria 2512875026 2512969522 202
345 iso_pu_bacteria 2513237084 2513568656 202
346 iso_pu_bacteria 2513237085 2513579865 202
347 iso_pu_bacteria 2513237086 2513587912 202
348 iso_pu_bacteria 2513237089 2513606254 202
349 iso_pu_bacteria 2513237091 2513619677 202
350 iso_pu_bacteria 2513237093 2513630481 202
351 iso_pu_bacteria 2513237103 2513711234 202
352 iso_pu_bacteria 2513237144 2513909472 202
353 iso_pu_bacteria 2513237146 2513923787 202
354 iso_pu_bacteria 2513237156 2513985038 202
355 iso_pu_bacteria 2513237159 2513999040 202
356 iso_pu_bacteria 2513237160 2514007969 202
357 iso_pu_bacteria 2513237162 2514018513 202
358 iso_pu_bacteria 2515075009 2515108696 202
359 iso_pu_bacteria 2515154113 2515632552 202
360 iso_pu_bacteria 2515154114 2515640483 202
361 iso_pu_bacteria 2515154116 2515656597 202
362 iso_pu_bacteria 2515154134 2515738169 202
363 iso_pu_bacteria 2516143018 2516207527 202
364 iso_pu_bacteria 2516653046 2516896148 202
365 iso_pu_bacteria 2516653077 2517040618 202
366 iso_pu_bacteria 2516653085 2517080231 202
367 iso_pu_bacteria 2517093000 2517098249 202
368 iso_pu_bacteria 2517287029 2517409754 202
369 iso_pu_bacteria 2517487022 2517565600 202
370 iso_pu_bacteria 2519899620 2520380544 202
371 iso_pu_bacteria 2523231067 2523469309 202
372 iso_pu_bacteria 2529292951 2530648528 202
373 iso_pu_bacteria 2551306084 2551674951 202
374 iso_pu_bacteria 2551306085 2551687267 202
375 iso_pu_bacteria 2551306086 2551692443 202
376 iso_pu_bacteria 2551306087 2551697821 202
377 iso_pu_bacteria 2551306089 2551708279 202
378 iso_pu_bacteria 2551306090 2551721584 202
379 iso_pu_bacteria 2551306091 2551728197 202
380 iso_pu_bacteria 2551306092 2551734443 202
381 iso_pu_bacteria 2551306093 2551743254 202
382 iso_pu_bacteria 2558860100 2558861459 202
383 iso_pu_bacteria 2582581304 2585255578 202
384 iso_pu_bacteria 2582581307 2585272450 202
385 iso_pu_bacteria 2582581308 2585277716 202
386 iso_pu_bacteria 2582581865 2585389412 202
387 iso_pu_bacteria 2582581866 2585397666 202
388 iso_pu_bacteria 2582581867 2585403117 202
389 iso_pu_bacteria 2585427526 2585530023 202
390 iso_pu_bacteria 2585427527 2585533416 202
391 iso_pu_bacteria 2585427528 2585537366 202
392 iso_pu_bacteria 2585427530 2585557250 202
393 iso_pu_bacteria 2585427531 2585561486 202
394 iso_pu_bacteria 2585427590 2585823939 202
395 iso_pu_bacteria 2585427593 2585840228 202
396 iso_pu_bacteria 2585427608 2585901901 202
397 iso_pu_bacteria 2585427609 2585906714 202
398 iso_pu_bacteria 2585428125 2587982135 202
399 iso_pu_bacteria 2597489888 2597864357 202
400 iso_pu_bacteria 2597489889 2597870178 202
401 iso_pu_bacteria 2599185155 2599329875 202
402 iso_pu_bacteria 2599185167 2599398686 202
403 iso_pu_bacteria 2599185170 2599415819 202
404 iso_pu_bacteria 2599185179 2599450741 202
405 iso_pu_bacteria 2599185188 2599504745 202
406 iso_pu_bacteria 2599185189 2599509049 202
407 iso_pu_bacteria 2599185190 2599513175 202
408 iso_pu_bacteria 2599185191 2599520863 202
409 iso_pu_bacteria 2599185212 2599612150 202
410 iso_pu_bacteria 2599185248 2599771708 202
411 iso_pu_bacteria 2599185288 2599880176 202
412 iso_pu_bacteria 2599185289 2599884245 202
413 iso_pu_bacteria 2599185290 2599891851 202
414 iso_pu_bacteria 2599185291 2599899250 202
415 iso_pu_bacteria 2599185300 2599931168 202
416 iso_pu_bacteria 2599185302 2599941420 202
417 iso_pu_bacteria 2599185303 2599947114 202
418 iso_pu_bacteria 2599185304 2599953060 202
419 iso_pu_bacteria 2599185305 2599958615 202
420 iso_pu_bacteria 2599185306 2599968290 202
421 iso_pu_bacteria 2599185307 2599970178 202
422 iso_pu_bacteria 2599185308 2599979476 202
423 iso_pu_bacteria 2599185309 2599982686 202
424 iso_pu_bacteria 2599185310 2599989713 202
425 iso_pu_bacteria 2599185311 2599993064 202
426 iso_pu_bacteria 2599185312 2599998610 202
427 iso_pu_bacteria 2599185313 2600003522 202
428 iso_pu_bacteria 2599185314 2600010015 202
429 iso_pu_bacteria 2599185315 2600018099 202
430 iso_pu_bacteria 2599185316 2600022947 202
431 iso_pu_bacteria 2599185317 2600028913 202
432 iso_pu_bacteria 2599185318 2600036777 202
433 iso_pu_bacteria 2599185319 2600042999 202
434 iso_pu_bacteria 2599185320 2600047288 202
435 iso_pu_bacteria 2599185321 2600052618 202
436 iso_pu_bacteria 2599185322 2600058040 202
437 iso_pu_bacteria 2599185323 2600066285 202
438 iso_pu_bacteria 2599185324 2600069455 202
439 iso_pu_bacteria 2599185325 2600076315 202
440 iso_pu_bacteria 2600254930 2600358080 202
441 iso_pu_bacteria 2600255283 2601624505 202
442 iso_pu_bacteria 2600255296 2601691579 202
443 iso_pu_bacteria 2600255318 2601798804 202
444 iso_pu_bacteria 2603880185 2606077699 202
445 iso_pu_bacteria 2603880199 2606130126 202
446 iso_pu_bacteria 2615840624 2616297834 202
447 iso_pu_bacteria 2615840626 2616310605 202
448 iso_pu_bacteria 2615840698 2616553139 202
449 iso_pu_bacteria 2617270742 2617384460 202
450 iso_pu_bacteria 2619619299 2621299255 202
451 iso_pu_bacteria 2623620443 2624481041 202
452 iso_pu_bacteria 2623620446 2624491621 202
453 iso_pu_bacteria 2643221557 2643808956 202
454 iso_pu_bacteria 2643221565 2643841558 202
455 iso_pu_bacteria 2643221571 2643870538 202
456 iso_pu_bacteria 2643221610 2644069199 202
457 iso_pu_bacteria 2643221618 2644104848 202
458 iso_pu_bacteria 2643221623 2644129972 202
459 iso_pu_bacteria 2643221626 2644151279 202
460 iso_pu_bacteria 2643221633 2644186503 202
461 iso_pu_bacteria 2643221650 2644280837 202
462 iso_pu_bacteria 2643221655 2644313267 202
463 iso_pu_bacteria 2643221659 2644336353 202
464 iso_pu_bacteria 2643221668 2644378548 202
465 iso_pu_bacteria 2643221675 2644420270 202
466 iso_pu_bacteria 2643221680 2644453677 202
467 iso_pu_bacteria 2643221688 2644494919 202
468 iso_pu_bacteria 2643221698 2644547189 202
469 iso_pu_bacteria 2643221712 2644612890 202
470 iso_pu_bacteria 2643221713 2644622861 202
471 iso_pu_bacteria 2643221726 2644692376 202
472 iso_pu_bacteria 2657244999 2657684296 202
473 iso_pu_bacteria 2667528170 2671091319 202
474 iso_pu_bacteria 2667528174 2671116991 202
475 iso_pu_bacteria 2667528176 2671129372 202
476 iso_pu_bacteria 2675903420 2677896066 202
477 iso_pu_bacteria 2675903515 2678263191 202
478 iso_pu_bacteria 2690316117 2692318428 202
479 iso_pu_bacteria 2713897148 2715750579 202
480 iso_pu_bacteria 2713897149 2715757084 202
481 iso_pu_bacteria 2718217725 2718633938 202
482 iso_pu_bacteria 2718217882 2719184670 202
483 iso_pu_bacteria 2718217927 2719389294 202
484 iso_pu_bacteria 2718217997 2719668650 202
485 iso_pu_bacteria 2718218009 2719728690 202
486 iso_pu_bacteria 2718218199 2720489343 202
487 iso_pu_bacteria 2718218232 2720610025 202
488 iso_pu_bacteria 2718218233 2720617448 202
489 iso_pu_bacteria 2718218235 2720628594 202
490 iso_pu_bacteria 2718218269 2720772544 202
491 iso_pu_bacteria 2718218363 2721144381 202
492 iso_pu_bacteria 2718218365 2721156325 202
493 iso_pu_bacteria 2718218366 2721161751 202
494 iso_pu_bacteria 2718218423 2721402060 202
495 iso_pu_bacteria 2721755514 2722842896 202
496 iso_pu_bacteria 2721755556 2723029983 202
497 iso_pu_bacteria 2721755607 2723248400 202
498 iso_pu_bacteria 2721755684 2723564388 202
499 iso_pu_bacteria 2721755685 2723569970 202
500 iso_pu_bacteria 2721755809 2724035893 202
501 iso_pu_bacteria 2721755810 2724041715 202
502 iso_pu_bacteria 2721755819 2724092573 202
503 iso_pu_bacteria 2721755822 2724101517 202
504 iso_pu_bacteria 2721755823 2724112949 202
505 iso_pu_bacteria 2724679232 2725949625 202
506 iso_pu_bacteria 2728369352 2730110516 202
507 iso_pu_bacteria 2728369365 2730160785 202
508 iso_pu_bacteria 2728369397 2730295858 202
509 iso_pu_bacteria 2738541265 2738674797 202
510 iso_pu_bacteria 2738541271 2738687997 202
511 iso_pu_bacteria 2738541282 2738753190 202
512 iso_pu_bacteria 2738541294 2738806396 202
513 iso_pu_bacteria 2738541303 2738862101 202
514 iso_pu_bacteria 2738541309 2738893756 202
515 iso_pu_bacteria 2738541333 2739036151 202
516 iso_pu_bacteria 2738543004 2739199236 202
517 iso_pu_bacteria 2738543015 2739257081 202
518 iso_pu_bacteria 2738543016 2739263568 202
519 iso_pu_bacteria 2738543024 2739309963 202
520 iso_pu_bacteria 2738543025 2739314620 202
521 iso_pu_bacteria 2738543031 2739349593 202
522 iso_pu_bacteria 2744054620 2745009523 202
523 iso_pu_bacteria 2751185821 2753463552 202
524 iso_pu_bacteria 2765235802 2765467273 202
525 iso_pu_bacteria 2765235942 2766069125 202
526 iso_pu_bacteria 2773857670 2774120154 202
527 iso_pu_bacteria 2773857672 2774131323 202
528 iso_pu_bacteria 2773857673 2774134008 202
529 iso_pu_bacteria 2775506902 2776273061 202
530 iso_pu_bacteria 2775506904 2776282096 202
531 iso_pu_bacteria 2775507266 2778177884 202
532 iso_pu_bacteria 2784132063 2784264224 202
533 iso_pu_bacteria 2784132072 2784311915 202
534 iso_pu_bacteria 2791355082 2792580481 202
535 iso_pu_bacteria 2791355091 2792619488 202
536 iso_pu_bacteria 2791355092 2792627259 202
537 iso_pu_bacteria 2791355094 2792639844 202
538 iso_pu_bacteria 2791355256 2793297810 202
539 iso_pu_bacteria 2791355259 2793312862 202
540 iso_pu_bacteria 2791355260 2793322468 202
541 iso_pu_bacteria 2791355261 2793331904 202
542 iso_pu_bacteria 2791355262 2793337540 202
543 iso_pu_bacteria 2791355263 2793344412 202
544 iso_pu_bacteria 2791355264 2793345560 202
545 iso_pu_bacteria 2791355265 2793354968 202
546 iso_pu_bacteria 2791355266 2793363699 202
547 iso_pu_bacteria 2791355267 2793370366 202
548 iso_pu_bacteria 2802428858 2802722043 202
549 iso_pu_bacteria 2802428859 2802723024 202
550 iso_pu_bacteria 2802428860 2802728843 202
551 iso_pu_bacteria 2802428861 2802735210 202
552 iso_pu_bacteria 2802428862 2802742186 202
553 iso_pu_bacteria 2802428863 2802748633 202
554 iso_pu_bacteria 2802429268 2804754702 202
555 iso_pu_bacteria 2802429605 2805927229 202
556 iso_pu_bacteria 2802429606 2805934343 202
557 iso_pu_bacteria 2802429633 2806046273 202
558 iso_pu_bacteria 2802429634 2806053193 202
559 iso_pu_bacteria 2802429635 2806059599 202
560 iso_pu_bacteria 2802429636 2806068661 202
561 iso_pu_bacteria 2802429637 2806075083 202
562 iso_pu_bacteria 2808606361 2808855302 202
563 iso_pu_bacteria 2808606376 2808923024 202
564 iso_pu_bacteria 2808606377 2808932921 202
565 iso_pu_bacteria 2808606378 2808935122 202
566 iso_pu_bacteria 2808606380 2808945102 202
567 iso_pu_bacteria 2808606381 2808955010 202
568 iso_pu_bacteria 2808606382 2808956378 202
569 iso_pu_bacteria 2808606383 2808963807 202
570 iso_pu_bacteria 2808606385 2808978732 202
571 iso_pu_bacteria 2808606388 2808994464 202
572 iso_pu_bacteria 2808606389 2808998695 202
573 iso_pu_bacteria 2808606445 2809214633 202
574 iso_pu_bacteria 2816332298 2817491643 202
575 iso_pu_bacteria 2818991448 2819613728 202
576 iso_pu_bacteria 2818991453 2819643091 202
577 iso_pu_bacteria 2818991456 2819659453 202
578 iso_pu_bacteria 2825651385 2825652579 202
579 iso_pu_bacteria 2826581358 2826583813 202
580 iso_pu_bacteria 2834028612 2834030196 202
581 iso_pu_bacteria 2838016132 2838016144 202
582 iso_pu_bacteria 2838022645 2838025327 202
583 iso_pu_bacteria 2838029111 2838032842 202
584 iso_pu_bacteria 2838035591 2838035936 202
585 iso_pu_bacteria 2838042994 2838044263 202
586 iso_pu_bacteria 2838048938 2838049766 202
587 iso_pu_bacteria 2838061910 2838062033 202
588 iso_pu_bacteria 2838068647 2838068676 202
589 iso_pu_bacteria 2838074704 2838077728 202
590 iso_pu_bacteria 2838661181 2838665054 202
591 iso_pu_bacteria 2838668709 2838669456 202
592 iso_pu_bacteria 2838680041 2838684543 202
593 iso_pu_bacteria 2838686498 2838690754 202
594 iso_pu_bacteria 2838694306 2838698704 202
595 iso_pu_bacteria 2838701080 2838701827 202
596 iso_pu_bacteria 2838707686 2838712415 202
597 iso_pu_bacteria 2838729681 2838735800 202
598 iso_pu_bacteria 2838742623 2838748704 202
599 iso_pu_bacteria 2839993093 2839996473 202
600 iso_pu_bacteria 2840764183 2840770414 202
601 iso_pu_bacteria 2841851746 2841858325 202
602 iso_pu_bacteria 2841864319 2841865926 202
603 iso_pu_bacteria 2842110456 2842116801 202
604 iso_pu_bacteria 2842118031 2842122814 202
605 iso_pu_bacteria 2842156927 2842160620 202
606 iso_pu_bacteria 2842163707 2842164115 202
607 iso_pu_bacteria 2842180545 2842184236 202
608 iso_pu_bacteria 2842192696 2842196096 202
609 iso_pu_bacteria 2842198810 2842200893 202
610 iso_pu_bacteria 2842205361 2842209735 202
611 iso_pu_bacteria 2842217011 2842219921 202
612 iso_pu_bacteria 2842229732 2842231818 202
613 iso_pu_bacteria 2842237096 2842241827 202
614 iso_pu_bacteria 2842243621 2842249506 202
615 iso_pu_bacteria 2842250916 2842251749 202
616 iso_pu_bacteria 2842257432 2842263614 202
617 iso_pu_bacteria 2842264693 2842265014 202
618 iso_pu_bacteria 2842271015 2842274931 202
619 iso_pu_bacteria 2842278818 2842283189 202
620 iso_pu_bacteria 2842291075 2842295662 202
621 iso_pu_bacteria 2842304105 2842307621 202
622 iso_pu_bacteria 2842311132 2842315633 202
623 iso_pu_bacteria 2842317721 2842320149 202
624 iso_pu_bacteria 2842341865 2842347710 202
625 iso_pu_bacteria 2842363717 2842364171 202
626 iso_pu_bacteria 2842370503 2842374456 202
627 iso_pu_bacteria 2842377471 2842382066 202
628 iso_pu_bacteria 2842384541 2842389362 202
629 iso_pu_bacteria 2842395702 2842397204 202
630 iso_pu_bacteria 2842402390 2842405768 202
631 iso_pu_bacteria 2842409023 2842412352 202
632 iso_pu_bacteria 2842415677 2842418998 202
633 iso_pu_bacteria 2842422224 2842422822 202
634 iso_pu_bacteria 2842428310 2842428932 202
635 iso_pu_bacteria 2842434925 2842435545 202
636 iso_pu_bacteria 2842441272 2842441592 202
637 iso_pu_bacteria 2842447887 2842448366 202
638 iso_pu_bacteria 2842462802 2842463356 202
639 iso_pu_bacteria 2842469257 2842469876 202
640 iso_pu_bacteria 2842475841 2842479575 202
641 iso_pu_bacteria 2842482326 2842486648 202
642 iso_pu_bacteria 2842489311 2842489725 202
643 iso_pu_bacteria 2842495871 2842498231 202
644 iso_pu_bacteria 2842502639 2842506760 202
645 iso_pu_bacteria 2842521101 2842524784 202
646 iso_pu_bacteria 2842815866 2842816073 202
647 iso_pu_bacteria 2842826826 2842830847 202
648 iso_pu_bacteria 2842837860 2842840265 202
649 iso_pu_bacteria 2842843487 2842846754 202
650 iso_pu_bacteria 2842849001 2842851120 202
651 iso_pu_bacteria 2842854478 2842855121 202
652 iso_pu_bacteria 2844163670 2844169599 202
653 iso_pu_bacteria 2844454524 2844460408 202
654 iso_pu_bacteria 2847417321 2847423070 202
655 iso_pu_bacteria 2848992105 2848997537 202
656 iso_pu_bacteria 2850079185 2850084573 202
657 iso_pu_bacteria 2852612431 2852614119 202
658 iso_pu_bacteria 2852657418 2852657691 202
659 iso_pu_bacteria 2852667396 2852668144 202
660 iso_pu_bacteria 2855825444 2855829027 202
661 iso_pu_bacteria 2855839649 2855844145 202
662 iso_pu_bacteria 2855872281 2855874057 202
663 iso_pu_bacteria 2857516855 2857517953 202
664 iso_pu_bacteria 2858800743 2858806605 202
665 iso_pu_bacteria 2860339153 2860342949 202
666 iso_pu_bacteria 2860867994 2860870276 202
667 iso_pu_bacteria 2878029506 2878032966 202
668 iso_pu_bacteria 2880230671 2880233697 202
669 iso_pu_bacteria 2891373044 2891374313 202
670 iso_pu_bacteria 2894652903 2894656881 202
671 iso_pu_bacteria 2896384573 2896391841 202
672 iso_pu_bacteria 2899803654 2899806986 202
673 iso_pu_bacteria 2904518522 2904519890 202
674 iso_pu_bacteria 2904578770 2904582606 202
675 iso_pu_bacteria 2908446538 2908450309 202
676 iso_pu_bacteria 2913036834 2913038966 202
677 iso_pu_bacteria 2913295892 2913296783 202
678 iso_pu_bacteria 2915980308 2915983617 202
679 iso_pu_bacteria 2915986958 2915992193 202
680 iso_pu_bacteria 2915993759 2915999267 202
681 iso_pu_bacteria 2916000859 2916001352 202
682 iso_pu_bacteria 2916007675 2916011596 202
683 iso_pu_bacteria 2916014648 2916018871 202
684 iso_pu_bacteria 2916021584 2916026078 202
685 iso_pu_bacteria 2916028427 2916032095 202
686 iso_pu_bacteria 2916035215 2916039041 202
687 iso_pu_bacteria 2916041962 2916046168 202
688 iso_pu_bacteria 2916048683 2916051903 202
689 iso_pu_bacteria 2916055098 2916060892 202
690 iso_pu_bacteria 2916061851 2916065315 202
691 iso_pu_bacteria 2916068649 2916070117 202
692 iso_pu_bacteria 2916076590 2916077900 202
693 iso_pu_bacteria 2917832318 2917834192 202
694 iso_pu_bacteria 2919063839 2919064722 202
695 iso_pu_bacteria 2919119836 2919124086 202
696 iso_pu_bacteria 2919125081 2919127746 202
697 iso_pu_bacteria 2919385768 2919390237 202
698 iso_pu_bacteria 2919450847 2919451764 202
699 iso_pu_bacteria 2919456309 2919460530 202
700 iso_pu_bacteria 2919481497 2919483978 202
701 iso_pu_bacteria 2919487758 2919489268 202
702 iso_pu_bacteria 2919697872 2919703384 202
703 iso_pu_bacteria 2920760137 2920765018 202
704 iso_pu_bacteria 2921201388 2921203572 202
705 iso_pu_bacteria 2921208531 2921209968 202
706 iso_pu_bacteria 2921237296 2921237772 202
707 iso_pu_bacteria 2921244191 2921248305 202
708 iso_pu_bacteria 2921250672 2921256856 202
709 iso_pu_bacteria 2921257292 2921260996 202
710 iso_pu_bacteria 2921263974 2921267911 202
711 iso_pu_bacteria 2921282425 2921283710 202
712 iso_pu_bacteria 2921289301 2921289715 202
713 iso_pu_bacteria 2921296804 2921297832 202
714 iso_pu_bacteria 2923586266 2923586825 202
715 iso_pu_bacteria 2924144063 2924145728 202
716 iso_pu_bacteria 2924150972 2924155830 202
717 iso_pu_bacteria 2924158325 2924162431 202
718 iso_pu_bacteria 2924165586 2924166684 202
719 iso_pu_bacteria 2924172951 2924179581 202
720 iso_pu_bacteria 2924179722 2924183384 202
721 iso_pu_bacteria 2924186466 2924186849 202
722 iso_pu_bacteria 2924200457 2924204577 202
723 iso_pu_bacteria 2924207177 2924213692 202
724 iso_pu_bacteria 2924214083 2924217236 202
725 iso_pu_bacteria 2924221636 2924222615 202
726 iso_pu_bacteria 2924228884 2924233890 202
727 iso_pu_bacteria 2929138655 2929142571 202
728 iso_pu_bacteria 2929144301 2929147912 202
729 iso_pu_bacteria 2929189879 2929192963 202
730 iso_pu_bacteria 2931369376 2931370180 202
731 iso_pu_bacteria 2931390751 2931393572 202
732 iso_pu_bacteria 2931396565 2931401563 202
733 iso_pu_bacteria 2933016740 2933020129 202
734 iso_pu_bacteria 2933570622 2933573724 202
735 iso_pu_bacteria 2933586486 2933593017 202
736 iso_pu_bacteria 2933599457 2933600294 202
737 iso_pu_bacteria 2935894831 2935898622 202
738 iso_pu_bacteria 2935901341 2935903216 202
739 iso_pu_bacteria 2936367885 2936374455 202
740 iso_pu_bacteria 2936375103 2936378703 202
741 iso_pu_bacteria 2936381700 2936384427 202
742 iso_pu_bacteria 2937002841 2937007241 202
743 iso_pu_bacteria 2937009748 2937016035 202
744 iso_pu_bacteria 2937016420 2937020762 202
745 iso_pu_bacteria 2937023124 2937026934 202
746 iso_pu_bacteria 2937029754 2937034969 202
747 iso_pu_bacteria 2937036028 2937039200 202
748 iso_pu_bacteria 2937042894 2937048046 202
749 iso_pu_bacteria 2937049772 2937054141 202
750 iso_pu_bacteria 2937056579 2937060596 202
751 iso_pu_bacteria 2937063883 2937068030 202
752 iso_pu_bacteria 2937071275 2937071598 202
753 iso_pu_bacteria 2937078374 2937084387 202
754 iso_pu_bacteria 2937084907 2937091408 202
755 iso_pu_bacteria 2937091812 2937095319 202
756 iso_pu_bacteria 2937098957 2937103584 202
757 iso_pu_bacteria 2937106411 2937110317 202
758 iso_pu_bacteria 2937113482 2937117176 202
759 iso_pu_bacteria 2937119839 2937123603 202
760 iso_pu_bacteria 2937126314 2937130538 202
761 iso_pu_bacteria 2941499720 2941504485 202
762 iso_pu_bacteria 2945928738 2945933110 202
763 iso_pu_bacteria 2945961074 2945964335 202
764 iso_pu_bacteria 2946006987 2946010410 202
765 iso_pu_bacteria 2946027586 2946030511 202
766 iso_pu_bacteria 2947233263 2947238164 202
767 iso_pu_bacteria 2957375807 2957379116 202
768 iso_pu_bacteria 2957382221 2957386350 202
769 iso_pu_bacteria 2957388812 2957392771 202
770 iso_pu_bacteria 2957395598 2957401463 202
771 iso_pu_bacteria 2957402308 2957406662 202
772 iso_pu_bacteria 2957408893 2957414649 202
773 iso_pu_bacteria 2957415311 2957415719 202
774 iso_pu_bacteria 2957422303 2957427370 202
775 iso_pu_bacteria 2957437181 2957437915 202
776 iso_pu_bacteria 2957450854 2957457521 202
777 iso_pu_bacteria 2957457609 2957461459 202
778 iso_pu_bacteria 2957464669 2957468597 202
779 iso_pu_bacteria 2957471148 2957471586 202
780 iso_pu_bacteria 2957478035 2957484254 202
781 iso_pu_bacteria 2957484790 2957488621 202
782 iso_pu_bacteria 2957491536 2957497262 202
783 iso_pu_bacteria 2957498199 2957505329 202
784 iso_pu_bacteria 2957505466 2957509676 202
785 iso_pu_bacteria 2960584000 2960585878 202
786 iso_pu_bacteria 2960591022 2960596432 202
787 iso_pu_bacteria 2960597568 2960601095 202
788 iso_pu_bacteria 2960603979 2960608829 202
789 iso_pu_bacteria 2960610863 2960617139 202
790 iso_pu_bacteria 2960624210 2960625719 202
791 iso_pu_bacteria 2960631154 2960634336 202
792 iso_pu_bacteria 2960637947 2960645317 202
793 iso_pu_bacteria 2960645483 2960649769 202
794 iso_pu_bacteria 2960652885 2960654722 202
795 iso_pu_bacteria 2960667422 2960671626 202
796 iso_pu_bacteria 2960674078 2960679881 202
797 iso_pu_bacteria 2960680706 2960683435 202
798 iso_pu_bacteria 2960687367 2960693832 202
799 iso_pu_bacteria 2960693952 2960695287 202
800 iso_pu_bacteria 2964607997 2964611951 202
801 iso_pu_bacteria 2964615318 2964619642 202
802 iso_pu_bacteria 2964621998 2964623583 202
803 iso_pu_bacteria 2964628898 2964636007 202
804 iso_pu_bacteria 2964636051 2964640065 202
805 iso_pu_bacteria 2964643177 2964647444 202
806 iso_pu_bacteria 2964649959 2964653801 202
807 iso_pu_bacteria 2964656573 2964663397 202
808 iso_pu_bacteria 2964663802 2964670540 202
809 iso_pu_bacteria 2964670856 2964673141 202
810 iso_pu_bacteria 2964678106 2964682782 202
811 iso_pu_bacteria 2964685014 2964690168 202
812 iso_pu_bacteria 2964691889 2964695597 202
813 iso_pu_bacteria 2964698721 2964703763 202
814 iso_pu_bacteria 2964705432 2964712625 202
815 iso_pu_bacteria 2964712639 2964716267 202
816 iso_pu_bacteria 2964719344 2964720625 202
817 iso_pu_bacteria 2967664464 2967665763 202
818 iso_pu_bacteria 2967671571 2967672515 202
819 iso_pu_bacteria 2967678726 2967683339 202
820 iso_pu_bacteria 2967686174 2967688008 202
821 iso_pu_bacteria 2967693043 2967696993 202
822 iso_pu_bacteria 2967699805 2967703942 202
823 iso_pu_bacteria 2967706974 2967711173 202
824 iso_pu_bacteria 2967714385 2967718418 202
825 iso_pu_bacteria 2967721400 2967727007 202
826 iso_pu_bacteria 2967728569 2967734056 202
827 iso_pu_bacteria 2967735183 2967738813 202
828 iso_pu_bacteria 2967742019 2967747978 202
829 iso_pu_bacteria 2967755722 2967759418 202
830 iso_pu_bacteria 2967762386 2967766277 202
831 iso_pu_bacteria 2967769361 2967773556 202
832 iso_pu_bacteria 2967775926 2967780797 202
833 iso_pu_bacteria 2969304461 2969307881 202
834 iso_pu_bacteria 2970019648 2970020129 202
835 iso_pu_bacteria 2970026789 2970028930 202
836 iso_pu_bacteria 2970033650 2970034226 202
837 iso_pu_bacteria 2970040964 2970042409 202
838 iso_pu_bacteria 2970047711 2970051672 202
839 iso_pu_bacteria 2970054988 2970059189 202
840 iso_pu_bacteria 2970061556 2970065406 202
841 iso_pu_bacteria 2970068827 2970074089 202
842 iso_pu_bacteria 2970076120 2970080732 202
843 iso_pu_bacteria 2970082768 2970087098 202
844 iso_pu_bacteria 2970088815 2970093138 202
845 iso_pu_bacteria 2970095765 2970099666 202
846 iso_pu_bacteria 2970102677 2970106507 202
847 iso_pu_bacteria 2970109326 2970113698 202
848 iso_pu_bacteria 2970116247 2970120066 202
849 iso_pu_bacteria 2970122695 2970128481 202
850 iso_pu_bacteria 2970129317 2970135708 202
851 iso_pu_bacteria 2970136068 2970141918 202
852 iso_pu_bacteria 2970143518 2970147812 202
853 iso_pu_bacteria 2970149975 2970154086 202
854 iso_pu_bacteria 2970156795 2970161916 202
855 iso_pu_bacteria 2970164137 2970168101 202
856 iso_pu_bacteria 2970170962 2970171607 202
857 iso_pu_bacteria 2970177841 2970184547 202
858 iso_pu_bacteria 2970184632 2970190232 202
859 iso_pu_bacteria 2970191845 2970195935 202
860 iso_pu_bacteria 2974289157 2974291258 202
861 iso_pu_bacteria 2974298342 2974298662 202
862 iso_pu_bacteria 2977516862 2977517617 202
863 iso_pu_bacteria 2977523885 2977530685 202
864 iso_pu_bacteria 2977530762 2977533933 202
865 iso_pu_bacteria 2977537788 2977541596 202
866 iso_pu_bacteria 2977544691 2977548021 202
867 iso_pu_bacteria 2977551784 2977556296 202
868 iso_pu_bacteria 2977558990 2977565764 202
869 iso_pu_bacteria 2977565890 2977570189 202
870 iso_pu_bacteria 2977572785 2977576928 202
871 iso_pu_bacteria 2977579622 2977583429 202
872 iso_pu_bacteria 2980125574 2980127607 202
873 iso_pu_bacteria 2984499530 2984500905 202
874 iso_pu_bacteria 2984504281 2984505653 202
875 iso_pu_bacteria 2988728565 2988733952 202
876 iso_pu_bacteria 2996887358 2996891197 202
877 iso_pu_bacteria 2996893221 2996894397 202
878 iso_pu_bacteria 2998139840 2998142520 202
879 iso_pu_bacteria 3002141150 3002142153 202
880 iso_pu_bacteria 3003930520 3003935637 202
881 iso_pu_bacteria 3005409236 3005414876 202
882 iso_pu_bacteria 3005416602 3005419809 202
883 iso_pu_bacteria 3005445848 3005447474 202
884 iso_pu_bacteria 3007419365 3007422990 202
885 iso_pu_bacteria 3007511990 3007514020 202
886 iso_pu_bacteria 3007614139 3007616164 202
887 iso_pu_bacteria 3007619802 3007623407 202
888 iso_pu_bacteria 3007718800 3007722579 202
889 iso_pu_bacteria 3007855910 3007856672 202
890 iso_pu_bacteria 3007861166 3007861805 202
891 iso_pu_bacteria 3007866637 3007868605 202
892 iso_pu_bacteria 648276728 648738313 202
893 iso_pu_bacteria 8002285264 8002288445 202
894 iso_pu_bacteria 8003992118 8003996725 202
895 iso_pu_bacteria 8003999396 8004004077 202
896 iso_pu_bacteria 8005258706 8005261860 202
897 iso_pu_bacteria 8005275841 8005277637 202
898 iso_pu_bacteria 8005282627 8005288519 202
899 iso_pu_bacteria 8005289223 8005290500 202
900 iso_pu_bacteria 8005307578 8005307985 202
901 iso_pu_bacteria 8005314921 8005316375 202
902 iso_pu_bacteria 8005321885 8005325724 202
903 iso_pu_bacteria 8005376324 8005379741 202
904 iso_pu_bacteria 8005382845 8005385257 202
905 iso_pu_bacteria 8005395548 8005396174 202
906 iso_pu_bacteria 8005430974 8005431439 202
907 iso_pu_bacteria 8005460587 8005467129 202
908 iso_pu_bacteria 8005484373 8005487539 202
909 iso_pu_bacteria 8005497431 8005502898 202
910 iso_pu_bacteria 8005556819 8005562426 202
911 iso_pu_bacteria 8005563573 8005566199 202
912 iso_pu_bacteria 8005570704 8005572275 202
913 iso_pu_bacteria 8005619151 8005624048 202
914 iso_pu_bacteria 8005626139 8005629313 202
915 iso_pu_bacteria 8005645114 8005651727 202
916 iso_pu_bacteria 8005668836 8005674328 202
917 iso_pu_bacteria 8005682033 8005683462 202
918 iso_pu_bacteria 8005695170 8005697832 202
919 iso_pu_bacteria 8016728285 8016732414 202
920 iso_pu_bacteria 8018163183 8018163473 202
921 iso_pu_bacteria 8018176218 8018180502 202
922 iso_pu_bacteria 8019775933 8019778465 202
923 iso_pu_bacteria 8023680758 8023681850 202
924 iso_pu_bacteria 8024479707 8024482347 202
925 iso_pu_bacteria 8024486573 8024488872 202
926 iso_pu_bacteria 8024501048 8024507252 202
927 iso_pu_bacteria 8029995093 8029998174 202
928 iso_pu_bacteria 8045864390 8045868664 202
929 iso_pu_bacteria 8046767195 8046772864 202
930 iso_pu_bacteria 8049293176 8049298480 202
931 iso_pu_bacteria 8054285046 8054289494 202
932 iso_pu_bacteria 8054347763 8054351453 202
933 iso_pu_bacteria 8054503363 8054506682 202
934 iso_pu_bacteria 8054558443 8054561498 202
935 iso_pu_bacteria 8055817908 8055821469 202
936 iso_pu_bacteria 8056131705 8056134414 202
937 iso_pu_bacteria 8056143049 8056146864 202
938 iso_pu_bacteria 8056148874 8056154953 202
939 iso_pu_bacteria 8056155041 8056159127 202
940 iso_pu_bacteria 8056161164 8056165755 202
941 iso_pu_bacteria 8056177738 8056177980 202
942 iso_pu_bacteria 8056375014 8056377859 202
943 iso_pu_bacteria 8056382006 8056382535 202
944 iso_pu_bacteria 8056569372 8056571327 202
945 iso_pu_bacteria 8057874678 8057878153 202
946 3300013296 Ga0157374_10073484 Ga0157374_100734843 203
947 3300047320 Ga0495672_0169014 Ga0495672_0169014_78_737 204
948 3300048924 Ga0496121_0228514 Ga0496121_0228514_506_1165 204
949 3300003320 rootH2_10073684 rootH2_100736842 205
950 3300005289 Ga0065704_10083205 Ga0065704_100832053 205
951 3300005347 Ga0070668_100331913 Ga0070668_1003319131 205
952 3300005353 Ga0070669_100089237 Ga0070669_1000892372 205
953 3300005356 Ga0070674_100046055 Ga0070674_1000460551 205
954 3300005719 Ga0068861_100085337 Ga0068861_1000853372 205
955 3300005844 Ga0068862_100029896 Ga0068862_1000298965 205
956 3300006881 Ga0068865_100058575 Ga0068865_1000585752 205
957 3300009553 Ga0105249_10145116 Ga0105249_101451162 205
958 3300013306 Ga0163162_10723108 Ga0163162_107231082 205
959 3300014326 Ga0157380_10003640 Ga0157380_100036402 205
960 3300025923 Ga0207681_10247613 Ga0207681_102476131 205
961 3300025937 Ga0207669_10181166 Ga0207669_101811662 205
962 3300025961 Ga0207712_10085813 Ga0207712_100858132 205
963 3300026118 Ga0207675_100001039 Ga0207675_10000103912 205
964 3300028380 Ga0268265_10058252 Ga0268265_100582525 205
965 3300041411 Ga0439466_0000125 Ga0439466_0000125_17913_18575 205
966 3300042010 Ga0439452_003833 Ga0439452_003833_4068_4730 205
967 3300046810 Ga0495660_0122406 Ga0495660_0122406_281_943 205
968 3300048905 Ga0496102_0000475 Ga0496102_0000475_522_1184 205
969 3300002705 JGI25156J39149_1000468 JGI25156J39149_100046821 206
970 3300002737 JGI25162J39368_1000013 JGI25162J39368_100001321 206
971 3300002738 JGI25154J39366_1000486 JGI25154J39366_10004867 206
972 3300002738 JGI25154J39366_1014315 JGI25154J39366_10143151 206
973 3300002741 JGI25157J39369_1000494 JGI25157J39369_100049421 206
974 3300002771 JGI25163J39215_1000525 JGI25163J39215_10005259 206
975 3300002772 JGI25164J39214_1000005 JGI25164J39214_100000521 206
976 3300002773 JGI25152J39213_1000197 JGI25152J39213_10001978 206
977 3300003214 JGI25165J46597_1000340 JGI25165J46597_100034029 206
978 3300003214 JGI25165J46597_1000610 JGI25165J46597_100061019 206
979 3300003214 JGI25165J46597_1008934 JGI25165J46597_10089342 206
980 3300003215 JGI25153J46596_10003407 JGI25153J46596_100034077 206
981 3300003316 rootH1_10037537 rootH1_100375376 206
982 3300003320 rootH2_10087052 rootH2_100870521 206
983 3300003322 rootL2_10004929 rootL2_100049297 206
984 3300003322 rootL2_10182883 rootL2_101828831 206
985 3300003751 Ga0055538_1000130 Ga0055538_100013027 206
986 3300003752 Ga0055539_1000173 Ga0055539_100017319 206
987 3300003756 Ga0055533_1000177 Ga0055533_100017719 206
988 3300003758 Ga0055532_1000171 Ga0055532_100017127 206
989 3300003759 Ga0055525_1000244 Ga0055525_100024419 206
990 3300003761 Ga0055535_1003932 Ga0055535_10039321 206
991 3300003775 Ga0055524_1019621 Ga0055524_10196212 206
992 3300003790 Ga0055528_1000475 Ga0055528_100047522 206
993 3300003791 Ga0055530_10001684 Ga0055530_100016847 206
994 3300003792 Ga0055540_1000096 Ga0055540_100009658 206
995 3300003792 Ga0055540_1000236 Ga0055540_100023630 206
996 3300003794 Ga0055531_10002872 Ga0055531_1000287210 206
997 3300003841 Ga0055541_1000115 Ga0055541_100011528 206
998 3300005288 Ga0065714_10000197 Ga0065714_100001977 206
999 3300005288 Ga0065714_10002523 Ga0065714_100025238 206
1000 3300005288 Ga0065714_10012489 Ga0065714_100124892 206
1001 3300005288 Ga0065714_10068233 Ga0065714_100682335 206
1002 3300005288 Ga0065714_10068369 Ga0065714_100683695 206
1003 3300005288 Ga0065714_10086694 Ga0065714_100866942 206
1004 3300005289 Ga0065704_10012815 Ga0065704_100128154 206
1005 3300005290 Ga0065712_10011348 Ga0065712_100113482 206
1006 3300005290 Ga0065712_10067891 Ga0065712_100678917 206
1007 3300005331 Ga0070670_100000613 Ga0070670_10000061324 206
1008 3300005331 Ga0070670_100097767 Ga0070670_1000977672 206
1009 3300005347 Ga0070668_100181761 Ga0070668_1001817613 206
1010 3300005353 Ga0070669_100001585 Ga0070669_10000158513 206
1011 3300005457 Ga0070662_100000714 Ga0070662_10000071411 206
1012 3300005457 Ga0070662_100152777 Ga0070662_1001527774 206
1013 3300005548 Ga0070665_100022842 Ga0070665_1000228422 206
1014 3300005548 Ga0070665_100433416 Ga0070665_1004334162 206
1015 3300005563 Ga0068855_100170518 Ga0068855_1001705182 206
1016 3300005614 Ga0068856_100019557 Ga0068856_1000195575 206
1017 3300005834 Ga0068851_10000045 Ga0068851_1000004553 206
1018 3300006038 Ga0075365_10006047 Ga0075365_100060477 206
1019 3300006042 Ga0075368_10170937 Ga0075368_101709372 206
1020 3300006051 Ga0075364_10019762 Ga0075364_100197624 206
1021 3300006051 Ga0075364_10041293 Ga0075364_100412934 206
1022 3300006177 Ga0075362_10048102 Ga0075362_100481022 206
1023 3300006177 Ga0075362_10065743 Ga0075362_100657432 206
1024 3300006353 Ga0075370_10212884 Ga0075370_102128842 206
1025 3300006946 Ga0079104_1023710 Ga0079104_10237102 206
1026 3300009011 Ga0105251_10000001 Ga0105251_10000001251 206
1027 3300009011 Ga0105251_10000406 Ga0105251_1000040624 206
1028 3300009011 Ga0105251_10057305 Ga0105251_100573052 206
1029 3300009036 Ga0105244_10002745 Ga0105244_100027457 206
1030 3300009036 Ga0105244_10012468 Ga0105244_100124687 206
1031 3300009036 Ga0105244_10014973 Ga0105244_100149734 206
1032 3300009036 Ga0105244_10022435 Ga0105244_100224354 206
1033 3300009036 Ga0105244_10075381 Ga0105244_100753811 206
1034 3300009092 Ga0105250_10001116 Ga0105250_100011165 206
1035 3300009092 Ga0105250_10001248 Ga0105250_1000124813 206
1036 3300009092 Ga0105250_10030673 Ga0105250_100306733 206
1037 3300009093 Ga0105240_10000376 Ga0105240_1000037665 206
1038 3300009148 Ga0105243_10000170 Ga0105243_1000017066 206
1039 3300009148 Ga0105243_10014408 Ga0105243_100144087 206
1040 3300009177 Ga0105248_10160637 Ga0105248_101606372 206
1041 3300009545 Ga0105237_10001377 Ga0105237_100013777 206
1042 3300009763 Ga0123340_1048316 Ga0123340_10483163 206
1043 3300010375 Ga0105239_10089657 Ga0105239_100896573 206
1044 3300011119 Ga0105246_10000114 Ga0105246_100001142 206
1045 3300011119 Ga0105246_10001525 Ga0105246_1000152511 206
1046 3300013100 Ga0157373_10022025 Ga0157373_100220255 206
1047 3300013100 Ga0157373_10055062 Ga0157373_100550622 206
1048 3300013102 Ga0157371_10000109 Ga0157371_10000109102 206
1049 3300013102 Ga0157371_10000754 Ga0157371_1000075421 206
1050 3300013104 Ga0157370_10005715 Ga0157370_100057157 206
1051 3300013104 Ga0157370_10019939 Ga0157370_100199396 206
1052 3300013105 Ga0157369_10379484 Ga0157369_103794841 206
1053 3300013105 Ga0157369_10395537 Ga0157369_103955372 206
1054 3300013296 Ga0157374_10445463 Ga0157374_104454632 206
1055 3300013306 Ga0163162_10003838 Ga0163162_100038384 206
1056 3300014497 Ga0182008_10013725 Ga0182008_100137252 206
1057 3300014497 Ga0182008_10048193 Ga0182008_100481932 206
1058 3300015261 Ga0182006_1001224 Ga0182006_10012246 206
1059 3300015261 Ga0182006_1003031 Ga0182006_10030317 206
1060 3300015261 Ga0182006_1005901 Ga0182006_10059017 206
1061 3300015261 Ga0182006_1058702 Ga0182006_10587022 206
1062 3300015262 Ga0182007_10000493 Ga0182007_100004938 206
1063 3300015262 Ga0182007_10005361 Ga0182007_100053617 206
1064 3300015265 Ga0182005_1001106 Ga0182005_10011062 206
1065 3300015265 Ga0182005_1003295 Ga0182005_10032955 206
1066 3300015265 Ga0182005_1017046 Ga0182005_10170463 206
1067 3300015265 Ga0182005_1017457 Ga0182005_10174572 206
1068 3300015265 Ga0182005_1026944 Ga0182005_10269442 206
1069 3300021361 Ga0213872_10072961 Ga0213872_100729611 206
1070 3300021384 Ga0213876_10144143 Ga0213876_101441431 206
1071 3300022739 Ga0228711_1010219 Ga0228711_10102192 206
1072 3300022740 Ga0228710_1010420 Ga0228710_101042013 206
1073 3300025206 Ga0209435_100127 Ga0209435_10012724 206
1074 3300025206 Ga0209435_101270 Ga0209435_1012704 206
1075 3300025207 Ga0209760_100007 Ga0209760_10000719 206
1076 3300025224 Ga0209784_100065 Ga0209784_10006520 206
1077 3300025225 Ga0209566_100081 Ga0209566_10008120 206
1078 3300025226 Ga0209674_100101 Ga0209674_10010120 206
1079 3300025229 Ga0209147_100234 Ga0209147_10023420 206
1080 3300025230 Ga0209563_100098 Ga0209563_10009820 206
1081 3300025231 Ga0207427_100018 Ga0207427_100018196 206
1082 3300025233 Ga0209437_100031 Ga0209437_100031196 206
1083 3300025233 Ga0209437_100475 Ga0209437_10047520 206
1084 3300025233 Ga0209437_104097 Ga0209437_1040972 206
1085 3300025233 Ga0209437_105162 Ga0209437_1051623 206
1086 3300025242 Ga0209258_100752 Ga0209258_1007526 206
1087 3300025246 Ga0209646_1000390 Ga0209646_100039024 206
1088 3300025246 Ga0209646_1005847 Ga0209646_10058473 206
1089 3300025250 Ga0209026_1000520 Ga0209026_100052024 206
1090 3300025253 Ga0209677_100059 Ga0209677_10005920 206
1091 3300025253 Ga0209677_100218 Ga0209677_10021816 206
1092 3300025256 Ga0209759_1000769 Ga0209759_100076924 206
1093 3300025258 Ga0209129_1002487 Ga0209129_10024877 206
1094 3300025261 Ga0209233_1000012 Ga0209233_1000012194 206
1095 3300025261 Ga0209233_1000097 Ga0209233_1000097236 206
1096 3300025261 Ga0209233_1000429 Ga0209233_100042920 206
1097 3300025273 Ga0209673_1000117 Ga0209673_1000117141 206
1098 3300025273 Ga0209673_1000452 Ga0209673_100045244 206
1099 3300025291 Ga0209675_1003905 Ga0209675_10039055 206
1100 3300025292 Ga0209676_1000002 Ga0209676_1000002855 206
1101 3300025292 Ga0209676_1000020 Ga0209676_1000020137 206
1102 3300025294 Ga0209025_1000558 Ga0209025_100055874 206
1103 3300025294 Ga0209025_1003556 Ga0209025_10035566 206
1104 3300025295 Ga0209564_1000581 Ga0209564_10005817 206
1105 3300025297 Ga0209758_1000503 Ga0209758_100050372 206
1106 3300025297 Ga0209758_1006104 Ga0209758_10061042 206
1107 3300025298 Ga0209050_1000006 Ga0209050_1000006715 206
1108 3300025298 Ga0209050_1005867 Ga0209050_10058674 206
1109 3300025299 Ga0209256_1003510 Ga0209256_10035104 206
1110 3300025303 Ga0209051_1000001 Ga0209051_1000001855 206
1111 3300025303 Ga0209051_1000027 Ga0209051_1000027104 206
1112 3300025304 Ga0209257_1000269 Ga0209257_1000269100 206
1113 3300025711 Ga0207696_1000002 Ga0207696_1000002536 206
1114 3300025711 Ga0207696_1000115 Ga0207696_1000115124 206
1115 3300025711 Ga0207696_1002575 Ga0207696_10025757 206
1116 3300025711 Ga0207696_1007412 Ga0207696_10074123 206
1117 3300025728 Ga0207655_1000167 Ga0207655_100016793 206
1118 3300025728 Ga0207655_1000270 Ga0207655_100027011 206
1119 3300025728 Ga0207655_1001481 Ga0207655_100148114 206
1120 3300025728 Ga0207655_1008041 Ga0207655_10080413 206
1121 3300025728 Ga0207655_1009048 Ga0207655_10090483 206
1122 3300025728 Ga0207655_1064092 Ga0207655_10640922 206
1123 3300025735 Ga0207713_1000117 Ga0207713_100011772 206
1124 3300025735 Ga0207713_1000455 Ga0207713_100045521 206
1125 3300025735 Ga0207713_1003174 Ga0207713_10031744 206
1126 3300025735 Ga0207713_1006126 Ga0207713_10061263 206
1127 3300025735 Ga0207713_1006127 Ga0207713_10061277 206
1128 3300025735 Ga0207713_1015971 Ga0207713_10159711 206
1129 3300025735 Ga0207713_1033940 Ga0207713_10339402 206
1130 3300025913 Ga0207695_10000495 Ga0207695_1000049515 206
1131 3300025914 Ga0207671_10000568 Ga0207671_1000056826 206
1132 3300025923 Ga0207681_10008201 Ga0207681_100082016 206
1133 3300025924 Ga0207694_10249301 Ga0207694_102493012 206
1134 3300025925 Ga0207650_10000205 Ga0207650_1000020524 206
1135 3300025925 Ga0207650_10000942 Ga0207650_100009427 206
1136 3300025933 Ga0207706_10005103 Ga0207706_100051037 206
1137 3300025935 Ga0207709_10000004 Ga0207709_10000004650 206
1138 3300025949 Ga0207667_10139375 Ga0207667_101393752 206
1139 3300026078 Ga0207702_10047716 Ga0207702_100477164 206
1140 3300026142 Ga0207698_10016450 Ga0207698_100164504 206
1141 3300027111 Ga0209281_1000314 Ga0209281_100031470 206
1142 3300027543 Ga0209999_1048711 Ga0209999_10487111 206
1143 3300027666 Ga0209282_1000068 Ga0209282_100006870 206
1144 3300027907 Ga0207428_10000098 Ga0207428_1000009879 206
1145 3300027907 Ga0207428_10045742 Ga0207428_100457424 206
1146 3300027907 Ga0207428_10200020 Ga0207428_102000202 206
1147 3300027907 Ga0207428_10204214 Ga0207428_102042142 206
1148 3300030521 Ga0307511_10084883 Ga0307511_100848832 206
1149 3300031235 Ga0265330_10063920 Ga0265330_100639202 206
1150 3300031249 Ga0265339_10037873 Ga0265339_100378733 206
1151 3300031456 Ga0307513_10000259 Ga0307513_1000025969 206
1152 3300031456 Ga0307513_10184150 Ga0307513_101841502 206
1153 3300031995 Ga0307409_101178847 Ga0307409_1011788471 206
1154 3300033180 Ga0307510_10000904 Ga0307510_100009042 206
1155 3300033430 Ga0315913_1002536 Ga0315913_100253622 206
1156 3300033464 Ga0315915_1000007 Ga0315915_1000007311 206
1157 3300035170 Ga0373943_0219716 Ga0373943_0219716_108_770 206
1158 3300035692 Ga0373935_0306116 Ga0373935_0306116_292_954 206
1159 3300037068 Ga0373925_0000771 Ga0373925_0000771_11494_12156 206
1160 3300037471 Ga0395905_0241463 Ga0395905_0241463_824_1486 206
1161 3300038705 Ga0237819_00367 Ga0237819_00367_12272_12934 206
1162 3300039437 Ga0436365_1612465 Ga0436365_1612465_163_825 206
1163 3300039447 Ga0436361_0928105 Ga0436361_0928105_297_959 206
1164 3300041404 Ga0439436_0023912 Ga0439436_0023912_1040_1702 206
1165 3300041404 Ga0439436_0048333 Ga0439436_0048333_228_890 206
1166 3300041405 Ga0439438_029644 Ga0439438_029644_649_1311 206
1167 3300041407 Ga0439447_000379 Ga0439447_000379_650_1312 206
1168 3300041407 Ga0439447_028651 Ga0439447_028651_137_799 206
1169 3300041411 Ga0439466_0030986 Ga0439466_0030986_273_935 206
1170 3300041411 Ga0439466_0031687 Ga0439466_0031687_304_966 206
1171 3300041413 Ga0439465_0007366 Ga0439465_0007366_2796_3458 206
1172 3300041413 Ga0439465_0036768 Ga0439465_0036768_36_698 206
1173 3300041458 Ga0451798_0048890 Ga0451798_0048890_164_826 206
1174 3300041492 Ga0451835_0984855 Ga0451835_0984855_883_1545 206
1175 3300041501 Ga0451845_0935886 Ga0451845_0935886_223_885 206
1176 3300041503 Ga0451847_0024524 Ga0451847_0024524_612_1274 206
1177 3300041507 Ga0451851_0582068 Ga0451851_0582068_87_749 206
1178 3300041511 Ga0451855_0354570 Ga0451855_0354570_311_973 206
1179 3300042006 Ga0439432_002973 Ga0439432_002973_934_1596 206
1180 3300042007 Ga0439449_0026652 Ga0439449_0026652_1330_1992 206
1181 3300042009 Ga0439451_010453 Ga0439451_010453_428_1090 206
1182 3300042009 Ga0439451_021005 Ga0439451_021005_213_875 206
1183 3300042010 Ga0439452_000274 Ga0439452_000274_21442_22104 206
1184 3300042010 Ga0439452_012209 Ga0439452_012209_304_966 206
1185 3300042010 Ga0439452_016156 Ga0439452_016156_1080_1742 206
1186 3300042013 Ga0439456_004086 Ga0439456_004086_1681_2343 206
1187 3300042016 Ga0439463_000824 Ga0439463_000824_7380_8042 206
1188 3300042016 Ga0439463_004733 Ga0439463_004733_1551_2213 206
1189 3300042115 Ga0450911_007211 Ga0450911_007211_177_839 206
1190 3300042121 Ga0450919_009519 Ga0450919_009519_291_953 206
1191 3300042145 Ga0450906_000930 Ga0450906_000930_4768_5430 206
1192 3300042146 Ga0450907_000043 Ga0450907_000043_24164_24826 206
1193 3300042185 Ga0450909_001700 Ga0450909_001700_1678_2340 206
1194 3300042461 Ga0439460_0004605 Ga0439460_0004605_1551_2213 206
1195 3300042461 Ga0439460_0006604 Ga0439460_0006604_628_1290 206
1196 3300042993 Ga0439440_0000499 Ga0439440_0000499_4422_5084 206
1197 3300045051 Ga0451576_0008377 Ga0451576_0008377_838_1500 206
1198 3300045051 Ga0451576_0290625 Ga0451576_0290625_706_1368 206
1199 3300046452 Ga0495617_000121 Ga0495617_000121_33266_33928 206
1200 3300046452 Ga0495617_011317 Ga0495617_011317_2357_3019 206
1201 3300046452 Ga0495617_070018 Ga0495617_070018_25_687 206
1202 3300046453 Ga0495627_001717 Ga0495627_001717_397_1059 206
1203 3300046453 Ga0495627_046391 Ga0495627_046391_204_866 206
1204 3300046457 Ga0495590_0001126 Ga0495590_0001126_1170_1832 206
1205 3300046458 Ga0495591_000086 Ga0495591_000086_82950_83612 206
1206 3300046458 Ga0495591_000125 Ga0495591_000125_2837_3499 206
1207 3300046458 Ga0495591_000260 Ga0495591_000260_20113_20775 206
1208 3300046458 Ga0495591_001495 Ga0495591_001495_4870_5532 206
1209 3300046458 Ga0495591_001994 Ga0495591_001994_11014_11676 206
1210 3300046458 Ga0495591_002103 Ga0495591_002103_3896_4558 206
1211 3300046460 Ga0495638_0045328 Ga0495638_0045328_711_1373 206
1212 3300046460 Ga0495638_0290071 Ga0495638_0290071_105_767 206
1213 3300046471 Ga0495650_0000362 Ga0495650_0000362_46204_46866 206
1214 3300046471 Ga0495650_0002865 Ga0495650_0002865_4754_5416 206
1215 3300046471 Ga0495650_0019272 Ga0495650_0019272_824_1486 206
1216 3300046471 Ga0495650_0019926 Ga0495650_0019926_2205_2867 206
1217 3300046471 Ga0495650_0045429 Ga0495650_0045429_979_1641 206
1218 3300046474 Ga0495605_0000001 Ga0495605_0000001_608944_609606 206
1219 3300046474 Ga0495605_0000346 Ga0495605_0000346_17393_18055 206
1220 3300046474 Ga0495605_0003188 Ga0495605_0003188_5095_5757 206
1221 3300046474 Ga0495605_0023315 Ga0495605_0023315_1774_2436 206
1222 3300046474 Ga0495605_0027855 Ga0495605_0027855_1722_2384 206
1223 3300046474 Ga0495605_0087023 Ga0495605_0087023_505_1167 206
1224 3300046474 Ga0495605_0131386 Ga0495605_0131386_360_1022 206
1225 3300046475 Ga0495639_0000996 Ga0495639_0000996_7127_7789 206
1226 3300046491 Ga0495584_0001257 Ga0495584_0001257_680_1342 206
1227 3300046491 Ga0495584_0049354 Ga0495584_0049354_1050_1712 206
1228 3300046491 Ga0495584_0050165 Ga0495584_0050165_1255_1917 206
1229 3300046491 Ga0495584_0066940 Ga0495584_0066940_821_1483 206
1230 3300046492 Ga0495585_0115687 Ga0495585_0115687_695_1357 206
1231 3300046500 Ga0495596_0000027 Ga0495596_0000027_82493_83155 206
1232 3300046500 Ga0495596_0110877 Ga0495596_0110877_365_1027 206
1233 3300046501 Ga0495607_0000036 Ga0495607_0000036_136584_137246 206
1234 3300046501 Ga0495607_0000167 Ga0495607_0000167_18443_19105 206
1235 3300046501 Ga0495607_0005883 Ga0495607_0005883_36_698 206
1236 3300046501 Ga0495607_0009965 Ga0495607_0009965_1859_2521 206
1237 3300046501 Ga0495607_0042895 Ga0495607_0042895_1991_2653 206
1238 3300046501 Ga0495607_0067349 Ga0495607_0067349_1110_1772 206
1239 3300046501 Ga0495607_0129440 Ga0495607_0129440_437_1099 206
1240 3300046501 Ga0495607_0133662 Ga0495607_0133662_104_766 206
1241 3300046501 Ga0495607_0152662 Ga0495607_0152662_31_693 206
1242 3300046506 Ga0495583_0001762 Ga0495583_0001762_7282_7944 206
1243 3300046506 Ga0495583_0002032 Ga0495583_0002032_12663_13325 206
1244 3300046506 Ga0495583_0002891 Ga0495583_0002891_12698_13360 206
1245 3300046506 Ga0495583_0006127 Ga0495583_0006127_228_890 206
1246 3300046506 Ga0495583_0008378 Ga0495583_0008378_1060_1722 206
1247 3300046506 Ga0495583_0100447 Ga0495583_0100447_384_1046 206
1248 3300046507 Ga0495606_0000079 Ga0495606_0000079_2924_3586 206
1249 3300046507 Ga0495606_0002580 Ga0495606_0002580_1699_2361 206
1250 3300046507 Ga0495606_0010880 Ga0495606_0010880_1497_2159 206
1251 3300046507 Ga0495606_0011881 Ga0495606_0011881_425_1087 206
1252 3300046512 Ga0495610_0011337 Ga0495610_0011337_3340_4002 206
1253 3300046513 Ga0495616_0000079 Ga0495616_0000079_51435_52097 206
1254 3300046513 Ga0495616_0000425 Ga0495616_0000425_3844_4506 206
1255 3300046513 Ga0495616_0029472 Ga0495616_0029472_1131_1793 206
1256 3300046513 Ga0495616_0056248 Ga0495616_0056248_1174_1836 206
1257 3300046513 Ga0495616_0066638 Ga0495616_0066638_439_1101 206
1258 3300046515 Ga0495620_0009058 Ga0495620_0009058_2348_3010 206
1259 3300046515 Ga0495620_0010750 Ga0495620_0010750_3210_3872 206
1260 3300046515 Ga0495620_0011527 Ga0495620_0011527_433_1095 206
1261 3300046515 Ga0495620_0022194 Ga0495620_0022194_362_1024 206
1262 3300046515 Ga0495620_0029113 Ga0495620_0029113_1602_2264 206
1263 3300046515 Ga0495620_0048012 Ga0495620_0048012_239_901 206
1264 3300046518 Ga0495631_0000126 Ga0495631_0000126_21575_22237 206
1265 3300046518 Ga0495631_0024815 Ga0495631_0024815_2008_2670 206
1266 3300046519 Ga0495632_0000802 Ga0495632_0000802_9342_10004 206
1267 3300046519 Ga0495632_0008573 Ga0495632_0008573_5516_6178 206
1268 3300046519 Ga0495632_0030503 Ga0495632_0030503_426_1088 206
1269 3300046519 Ga0495632_0112330 Ga0495632_0112330_191_853 206
1270 3300046519 Ga0495632_0193809 Ga0495632_0193809_111_773 206
1271 3300046520 Ga0495637_0000075 Ga0495637_0000075_74770_75432 206
1272 3300046520 Ga0495637_0002202 Ga0495637_0002202_6868_7530 206
1273 3300046520 Ga0495637_0015218 Ga0495637_0015218_901_1563 206
1274 3300046520 Ga0495637_0090293 Ga0495637_0090293_202_864 206
1275 3300046522 Ga0495643_0001828 Ga0495643_0001828_1141_1803 206
1276 3300046523 Ga0495644_0000477 Ga0495644_0000477_378_1040 206
1277 3300046523 Ga0495644_0003929 Ga0495644_0003929_1991_2653 206
1278 3300046524 Ga0495648_0010903 Ga0495648_0010903_184_846 206
1279 3300046524 Ga0495648_0012695 Ga0495648_0012695_4901_5563 206
1280 3300046524 Ga0495648_0013902 Ga0495648_0013902_3752_4414 206
1281 3300046524 Ga0495648_0015893 Ga0495648_0015893_825_1487 206
1282 3300046526 Ga0495666_0014693 Ga0495666_0014693_2203_2865 206
1283 3300046528 Ga0495642_0000402 Ga0495642_0000402_22575_23237 206
1284 3300046528 Ga0495642_0000571 Ga0495642_0000571_8363_9025 206
1285 3300046530 Ga0495654_0000470 Ga0495654_0000470_12000_12662 206
1286 3300046530 Ga0495654_0008212 Ga0495654_0008212_3427_4089 206
1287 3300046530 Ga0495654_0011909 Ga0495654_0011909_825_1487 206
1288 3300046530 Ga0495654_0014489 Ga0495654_0014489_776_1438 206
1289 3300046530 Ga0495654_0047804 Ga0495654_0047804_92_754 206
1290 3300046530 Ga0495654_0076284 Ga0495654_0076284_382_1044 206
1291 3300046530 Ga0495654_0098190 Ga0495654_0098190_436_1098 206
1292 3300046536 Ga0495587_0010225 Ga0495587_0010225_2109_2771 206
1293 3300046538 Ga0495609_0000014 Ga0495609_0000014_5057_5719 206
1294 3300046538 Ga0495609_0000016 Ga0495609_0000016_308488_309150 206
1295 3300046538 Ga0495609_0010463 Ga0495609_0010463_3138_3800 206
1296 3300046538 Ga0495609_0094174 Ga0495609_0094174_309_971 206
1297 3300046542 Ga0495597_0007901 Ga0495597_0007901_4667_5329 206
1298 3300046542 Ga0495597_0009335 Ga0495597_0009335_594_1256 206
1299 3300046542 Ga0495597_0014559 Ga0495597_0014559_938_1600 206
1300 3300046557 Ga0495622_0000708 Ga0495622_0000708_17881_18543 206
1301 3300046557 Ga0495622_0001279 Ga0495622_0001279_1200_1862 206
1302 3300046558 Ga0495633_0000525 Ga0495633_0000525_24431_25093 206
1303 3300046615 Ga0495656_0000902 Ga0495656_0000902_5010_5672 206
1304 3300046616 Ga0495668_0003496 Ga0495668_0003496_885_1547 206
1305 3300046616 Ga0495668_0131197 Ga0495668_0131197_363_1025 206
1306 3300046616 Ga0495668_0376538 Ga0495668_0376538_28_690 206
1307 3300046648 Ga0495611_0000048 Ga0495611_0000048_70710_71372 206
1308 3300046648 Ga0495611_0000152 Ga0495611_0000152_2473_3135 206
1309 3300046660 Ga0495625_0000084 Ga0495625_0000084_147359_148021 206
1310 3300046660 Ga0495625_0002299 Ga0495625_0002299_5518_6180 206
1311 3300046660 Ga0495625_0002568 Ga0495625_0002568_18110_18772 206
1312 3300046660 Ga0495625_0044245 Ga0495625_0044245_1917_2579 206
1313 3300046660 Ga0495625_0045296 Ga0495625_0045296_2451_3113 206
1314 3300046660 Ga0495625_0144184 Ga0495625_0144184_121_783 206
1315 3300046660 Ga0495625_0183784 Ga0495625_0183784_319_981 206
1316 3300046660 Ga0495625_0265970 Ga0495625_0265970_332_994 206
1317 3300046663 Ga0495635_0000973 Ga0495635_0000973_11983_12645 206
1318 3300046664 Ga0495659_0000392 Ga0495659_0000392_2392_3054 206
1319 3300046665 Ga0495661_0000191 Ga0495661_0000191_5726_6388 206
1320 3300046665 Ga0495661_0001498 Ga0495661_0001498_3941_4603 206
1321 3300046665 Ga0495661_0003071 Ga0495661_0003071_850_1512 206
1322 3300046665 Ga0495661_0017906 Ga0495661_0017906_592_1254 206
1323 3300046665 Ga0495661_0062167 Ga0495661_0062167_1311_1973 206
1324 3300046679 Ga0495623_0091743 Ga0495623_0091743_687_1349 206
1325 3300046684 Ga0495669_0016104 Ga0495669_0016104_1902_2564 206
1326 3300046691 Ga0495670_0001804 Ga0495670_0001804_26_688 206
1327 3300046691 Ga0495670_0184536 Ga0495670_0184536_81_743 206
1328 3300046691 Ga0495670_0204537 Ga0495670_0204537_160_822 206
1329 3300046692 Ga0495671_0000853 Ga0495671_0000853_1289_1951 206
1330 3300046692 Ga0495671_0008768 Ga0495671_0008768_399_1061 206
1331 3300046692 Ga0495671_0054971 Ga0495671_0054971_1164_1826 206
1332 3300046692 Ga0495671_0065921 Ga0495671_0065921_157_819 206
1333 3300046694 Ga0495649_0000257 Ga0495649_0000257_35545_36207 206
1334 3300046694 Ga0495649_0019003 Ga0495649_0019003_190_852 206
1335 3300046694 Ga0495649_0066761 Ga0495649_0066761_591_1253 206
1336 3300046694 Ga0495649_0265784 Ga0495649_0265784_175_837 206
1337 3300046794 Ga0495589_0000415 Ga0495589_0000415_18120_18782 206
1338 3300046794 Ga0495589_0099905 Ga0495589_0099905_68_730 206
1339 3300046809 Ga0495600_0046755 Ga0495600_0046755_2051_2713 206
1340 3300046810 Ga0495660_0052407 Ga0495660_0052407_1181_1843 206
1341 3300046810 Ga0495660_0113146 Ga0495660_0113146_168_830 206
1342 3300046810 Ga0495660_0132940 Ga0495660_0132940_349_1011 206
1343 3300046810 Ga0495660_0151824 Ga0495660_0151824_187_849 206
1344 3300047317 Ga0495604_0005508 Ga0495604_0005508_852_1514 206
1345 3300047318 Ga0495636_0012242 Ga0495636_0012242_976_1638 206
1346 3300047318 Ga0495636_0287316 Ga0495636_0287316_20_682 206
1347 3300047320 Ga0495672_0002860 Ga0495672_0002860_2384_3046 206
1348 3300047320 Ga0495672_0013706 Ga0495672_0013706_3826_4488 206
1349 3300047320 Ga0495672_0027794 Ga0495672_0027794_1909_2571 206
1350 3300047320 Ga0495672_0029995 Ga0495672_0029995_572_1234 206
1351 3300047320 Ga0495672_0063445 Ga0495672_0063445_1070_1732 206
1352 3300047321 Ga0495676_0000039 Ga0495676_0000039_43892_44554 206
1353 3300047322 Ga0495680_0009250 Ga0495680_0009250_706_1368 206
1354 3300047323 Ga0495683_0000231 Ga0495683_0000231_21509_22171 206
1355 3300047323 Ga0495683_0033779 Ga0495683_0033779_261_923 206
1356 3300047323 Ga0495683_0057525 Ga0495683_0057525_958_1620 206
1357 3300047443 Ga0495687_002451 Ga0495687_002451_12273_12935 206
1358 3300047443 Ga0495687_005527 Ga0495687_005527_4816_5478 206
1359 3300047443 Ga0495687_009154 Ga0495687_009154_2123_2785 206
1360 3300047443 Ga0495687_015074 Ga0495687_015074_2105_2767 206
1361 3300047444 Ga0495675_0065462 Ga0495675_0065462_995_1657 206
1362 3300047446 Ga0495679_000086 Ga0495679_000086_13702_14364 206
1363 3300047446 Ga0495679_025427 Ga0495679_025427_677_1339 206
1364 3300047469 Ga0495673_0000077 Ga0495673_0000077_18325_18987 206
1365 3300047469 Ga0495673_0000281 Ga0495673_0000281_3653_4315 206
1366 3300047469 Ga0495673_0000966 Ga0495673_0000966_1309_1971 206
1367 3300047469 Ga0495673_0001880 Ga0495673_0001880_3523_4185 206
1368 3300047469 Ga0495673_0005342 Ga0495673_0005342_2082_2744 206
1369 3300047469 Ga0495673_0009546 Ga0495673_0009546_3729_4391 206
1370 3300047469 Ga0495673_0027832 Ga0495673_0027832_1864_2526 206
1371 3300047469 Ga0495673_0076687 Ga0495673_0076687_353_1015 206
1372 3300047470 Ga0495681_0000031 Ga0495681_0000031_15533_16195 206
1373 3300047470 Ga0495681_0008454 Ga0495681_0008454_983_1645 206
1374 3300047470 Ga0495681_0017000 Ga0495681_0017000_1378_2040 206
1375 3300047470 Ga0495681_0018044 Ga0495681_0018044_1103_1765 206
1376 3300047472 Ga0495686_0000418 Ga0495686_0000418_26410_27072 206
1377 3300047472 Ga0495686_0032054 Ga0495686_0032054_2190_2852 206
1378 3300047472 Ga0495686_0224665 Ga0495686_0224665_175_837 206
1379 3300048091 Ga0495626_0000002 Ga0495626_0000002_3870_4532 206
1380 3300048091 Ga0495626_0000451 Ga0495626_0000451_10896_11558 206
1381 3300048091 Ga0495626_0000748 Ga0495626_0000748_21058_21720 206
1382 3300048091 Ga0495626_0001395 Ga0495626_0001395_17966_18628 206
1383 3300048091 Ga0495626_0059482 Ga0495626_0059482_660_1322 206
1384 3300048091 Ga0495626_0078118 Ga0495626_0078118_682_1344 206
1385 3300048904 Ga0496101_0076974 Ga0496101_0076974_504_1166 206
1386 3300048905 Ga0496102_0051450 Ga0496102_0051450_114_776 206
1387 3300048906 Ga0496103_0018945 Ga0496103_0018945_169_831 206
1388 3300048916 Ga0496113_0017486 Ga0496113_0017486_4160_4822 206
1389 3300048917 Ga0496114_0383799 Ga0496114_0383799_86_754 206
1390 3300048918 Ga0496115_0113582 Ga0496115_0113582_1045_1707 206
1391 3300048919 Ga0496116_0003732 Ga0496116_0003732_3694_4356 206
1392 3300048919 Ga0496116_0028731 Ga0496116_0028731_3331_3993 206
1393 3300048919 Ga0496116_0191739 Ga0496116_0191739_219_881 206
1394 3300048920 Ga0496117_0000246 Ga0496117_0000246_86719_87381 206
1395 3300048920 Ga0496117_0015728 Ga0496117_0015728_2708_3370 206
1396 3300048920 Ga0496117_0116632 Ga0496117_0116632_389_1051 206
1397 3300048921 Ga0496118_0004214 Ga0496118_0004214_7918_8580 206
1398 3300048921 Ga0496118_0015631 Ga0496118_0015631_3295_3957 206
1399 3300048921 Ga0496118_0194586 Ga0496118_0194586_285_947 206
1400 3300048922 Ga0496119_0029831 Ga0496119_0029831_1646_2308 206
1401 3300048924 Ga0496121_0003531 Ga0496121_0003531_562_1224 206
1402 3300048924 Ga0496121_0003988 Ga0496121_0003988_12993_13655 206
1403 3300048924 Ga0496121_0008277 Ga0496121_0008277_8157_8819 206
1404 3300048924 Ga0496121_0009440 Ga0496121_0009440_2731_3393 206
1405 3300048924 Ga0496121_0014636 Ga0496121_0014636_112_774 206
1406 3300048925 Ga0496122_0001036 Ga0496122_0001036_42248_42910 206
1407 3300048925 Ga0496122_0007679 Ga0496122_0007679_7849_8511 206
1408 3300048925 Ga0496122_0048469 Ga0496122_0048469_412_1074 206
1409 3300048926 Ga0496123_0000055 Ga0496123_0000055_5436_6098 206
1410 3300048926 Ga0496123_0008936 Ga0496123_0008936_7144_7806 206
1411 3300048926 Ga0496123_0040314 Ga0496123_0040314_2185_2847 206
1412 3300048926 Ga0496123_0061406 Ga0496123_0061406_797_1459 206
1413 3300048927 Ga0496124_0000035 Ga0496124_0000035_5827_6489 206
1414 3300048927 Ga0496124_0008204 Ga0496124_0008204_3165_3827 206
1415 3300048927 Ga0496124_0009778 Ga0496124_0009778_8677_9339 206
1416 3300048927 Ga0496124_0052504 Ga0496124_0052504_2585_3247 206
1417 3300048928 Ga0496125_0000266 Ga0496125_0000266_594_1256 206
1418 3300048928 Ga0496125_0008970 Ga0496125_0008970_3201_3863 206
1419 3300048929 Ga0496126_0058087 Ga0496126_0058087_2259_2921 206
1420 3300048929 Ga0496126_0086223 Ga0496126_0086223_1578_2240 206
1421 3300049459 Ga0495678_001061 Ga0495678_001061_11917_12579 206
1422 3300049459 Ga0495678_003876 Ga0495678_003876_5825_6487 206
1423 3300049459 Ga0495678_005542 Ga0495678_005542_2810_3472 206
1424 3300049460 Ga0495682_0000393 Ga0495682_0000393_30565_31227 206
1425 3300049460 Ga0495682_0001543 Ga0495682_0001543_2992_3654 206
1426 3300049460 Ga0495682_0030792 Ga0495682_0030792_422_1084 206
1427 3300049460 Ga0495682_0031766 Ga0495682_0031766_730_1392 206
1428 3300049460 Ga0495682_0053446 Ga0495682_0053446_674_1336 206
1429 3300050491 nmdc:mga00v17_245805_c1 nmdc:mga00v17_245805_c1_249_911 206
1430 3300050492 nmdc:mga0yw44_45400_c1 nmdc:mga0yw44_45400_c1_1174_1836 206
1431 3300050493 nmdc:mga0k408_290201_c1 nmdc:mga0k408_290201_c1_258_920 206
1432 3300050493 nmdc:mga0k408_43645_c1 nmdc:mga0k408_43645_c1_989_1651 206
1433 3300050495 nmdc:mga04h51_52650_c1 nmdc:mga04h51_52650_c1_166_828 206
1434 3300050496 nmdc:mga07m45_70564_c1 nmdc:mga07m45_70564_c1_837_1499 206
1435 3300050511 nmdc:mga08y16_71_c1 nmdc:mga08y16_71_c1_34866_35528 206
1436 3300050516 nmdc:mga0sz30_297_c1 nmdc:mga0sz30_297_c1_6200_6862 206
1437 3300053086 Ga0500578_0164099 Ga0500578_0164099_32_694 206
1438 3300053098 Ga0500650_0089569 Ga0500650_0089569_541_1203 206
1439 3300053109 Ga0500569_003341 Ga0500569_003341_894_1556 206
1440 3300053134 Ga0500658_0007852 Ga0500658_0007852_2265_2927 206
1441 3300053153 Ga0500616_0035069 Ga0500616_0035069_971_1633 206
1442 3300053156 Ga0500622_0145694 Ga0500622_0145694_26_688 206
1443 3300053158 Ga0500627_0068506 Ga0500627_0068506_343_1005 206
1444 iso_pu_bacteria 643692032 643823033 206
1445 iso_pu_bacteria 2791355520 2794597644 208
1446 3300006946 Ga0079104_1000006 Ga0079104_1000006174 209
1447 3300006948 Ga0099826_10057539 Ga0099826_100575392 209
1448 3300027111 Ga0209281_1000011 Ga0209281_1000011362 209
1449 3300027666 Ga0209282_1192036 Ga0209282_11920361 209
1450 3300013105 Ga0157369_10045106 Ga0157369_100451062 210
1451 3300046501 Ga0495607_0001042 Ga0495607_0001042_3426_4100 210
1452 iso_pu_bacteria 2524023207 2524449582 210
1453 iso_pu_bacteria 8005301065 8005301078 210
1454 iso_pu_bacteria 8005688590 8005689108 210
1455 iso_pu_bacteria 8018127388 8018132106 210
1456 3300003215 JGI25153J46596_10011358 JGI25153J46596_100113582 211
1457 3300006048 Ga0075363_100089817 Ga0075363_1000898172 211
1458 3300025258 Ga0209129_1026470 Ga0209129_10264701 211
1459 3300025299 Ga0209256_1012618 Ga0209256_10126183 211
1460 3300025303 Ga0209051_1024359 Ga0209051_10243593 211
1461 3300041463 Ga0451804_0978079 Ga0451804_0978079_164_853 211
1462 iso_pu_bacteria 639633055 639644844 211
1463 iso_pu_bacteria 2511231012 2511301727 212
1464 iso_pu_bacteria 2511231014 2511312832 212
1465 iso_pu_bacteria 2511231015 2511321204 212
1466 iso_pu_bacteria 2511231020 2511351634 212
1467 iso_pu_bacteria 2904550169 2904554442 212
1468 iso_pu_bacteria 2511231023 2511367051 213
1469 iso_pu_bacteria 2513237140 2513885170 213
1470 iso_pu_bacteria 2513237143 2513906241 213
1471 iso_pu_bacteria 2515154107 2515610782 213
1472 iso_pu_bacteria 2842832357 2842835017 213
1473 iso_pu_bacteria 2936996657 2937002249 213
1474 iso_pu_bacteria 2957443900 2957450482 213
1475 iso_pu_bacteria 2960617483 2960623588 213
1476 iso_pu_bacteria 2960660292 2960667286 213
1477 iso_pu_bacteria 8056166840 8056168564 213
1478 iso_pu_bacteria 8056172158 8056174577 213
1479 iso_pu_bacteria 2651869719 2652547715 215
1480 3300003791 Ga0055530_10005707 Ga0055530_100057076 216
1481 3300006186 Ga0075369_10189409 Ga0075369_101894091 216
1482 3300012498 Ga0157345_1002561 Ga0157345_10025612 216
1483 3300025292 Ga0209676_1002950 Ga0209676_10029506 216
1484 3300025298 Ga0209050_1000775 Ga0209050_10007759 216
1485 3300025728 Ga0207655_1085486 Ga0207655_10854862 216
1486 3300025735 Ga0207713_1013462 Ga0207713_10134625 216
1487 3300046458 Ga0495591_057901 Ga0495591_057901_134_826 216
1488 3300046507 Ga0495606_0070130 Ga0495606_0070130_813_1505 216
1489 3300046512 Ga0495610_0021168 Ga0495610_0021168_2006_2698 216
1490 3300046660 Ga0495625_0010597 Ga0495625_0010597_2042_2734 216
1491 3300047323 Ga0495683_0000358 Ga0495683_0000358_25888_26580 216
1492 3300048091 Ga0495626_0002100 Ga0495626_0002100_13174_13866 216
1493 3300050489 nmdc:mga03683_126274_c1 nmdc:mga03683_126274_c1_317_1009 216
1494 3300027111 Ga0209281_1003764 Ga0209281_10037643 217
1495 3300030734 Ga0316179_1019939 Ga0316179_10199393 217
1496 3300030735 Ga0316178_1142514 Ga0316178_11425149 217
1497 3300046512 Ga0495610_0041249 Ga0495610_0041249_951_1646 217
1498 3300046694 Ga0495649_0020457 Ga0495649_0020457_676_1371 217
1499 3300046458 Ga0495591_014302 Ga0495591_014302_2036_2737 219
1500 3300046458 Ga0495591_047982 Ga0495591_047982_123_824 219
1501 3300046474 Ga0495605_0000025 Ga0495605_0000025_217546_218247 219
1502 3300046499 Ga0495594_0013205 Ga0495594_0013205_1976_2677 219
1503 3300046506 Ga0495583_0000070 Ga0495583_0000070_5354_6055 219
1504 3300046512 Ga0495610_0073016 Ga0495610_0073016_188_889 219
1505 3300046512 Ga0495610_0085546 Ga0495610_0085546_348_1049 219
1506 3300046515 Ga0495620_0000009 Ga0495620_0000009_168448_169149 219
1507 3300046520 Ga0495637_0093780 Ga0495637_0093780_280_981 219
1508 3300046524 Ga0495648_0020720 Ga0495648_0020720_1780_2481 219
1509 3300046530 Ga0495654_0001097 Ga0495654_0001097_5352_6053 219
1510 3300046538 Ga0495609_0001549 Ga0495609_0001549_5349_6050 219
1511 3300046538 Ga0495609_0124205 Ga0495609_0124205_25_726 219
1512 3300046542 Ga0495597_0009540 Ga0495597_0009540_324_1025 219
1513 3300046558 Ga0495633_0000010 Ga0495633_0000010_274921_275622 219
1514 3300046648 Ga0495611_0025448 Ga0495611_0025448_842_1543 219
1515 3300046665 Ga0495661_0000008 Ga0495661_0000008_5414_6115 219
1516 3300046691 Ga0495670_0012534 Ga0495670_0012534_1979_2680 219
1517 3300046692 Ga0495671_0012449 Ga0495671_0012449_595_1296 219
1518 3300046794 Ga0495589_0082046 Ga0495589_0082046_447_1148 219
1519 3300046810 Ga0495660_0008599 Ga0495660_0008599_1983_2684 219
1520 3300047323 Ga0495683_0000002 Ga0495683_0000002_633529_634230 219
1521 3300047446 Ga0495679_000133 Ga0495679_000133_60332_61033 219
1522 3300047469 Ga0495673_0012894 Ga0495673_0012894_808_1509 219
1523 3300048925 Ga0496122_0023009 Ga0496122_0023009_1103_1804 219
1524 3300048926 Ga0496123_0054773 Ga0496123_0054773_1103_1804 219
1525 3300049459 Ga0495678_000005 Ga0495678_000005_5327_6028 219
1526 3300047469 Ga0495673_0000656 Ga0495673_0000656_11521_12225 220
1527 3300046492 Ga0495585_0000149 Ga0495585_0000149_54628_55338 222
1528 2124908027 MRS2a_Contig_34 MRS2a_00237370 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

56

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6656 16 213
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.6368 29 202
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.621 16 213
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.6075 21 208
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.596 27 207
ID Description Score Start End Superfamily
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6665 16 213 1.10.3720.10
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6553 25 213 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6495 22 214 1.10.3720.10
3tujB00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6374 26 210 1.10.3720.10
af_P0AFR9_7_261_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6328 39 206 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7Y5X0F8-F1-model_v4 ABC transporter permease subunit 0.851 31 114 GO:0006865
GO:0022857
GO:0043190
AF-A0A258LAW9-F1-model_v4 Amino acid ABC transporter permease 0.8118 27 118 GO:0006865
GO:0022857
GO:0043190
AF-A0A435XAJ2-F1-model_v4 ABC transporter permease subunit 0.7845 21 131 GO:0006865
GO:0022857
GO:0043190
AF-F3GBZ0-F1-model_v4 Amino acid ABC transporter permease 0.7835 21 111 GO:0006865
GO:0022857
GO:0043190
AF-A0A4Q3J9C9-F1-model_v4 Amino acid ABC transporter permease 0.7804 29 131 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
69.31 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map