F494556

General Info

Members Datasets Scaffolds Average Seq Length
1523 358 3046 350

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0193355|Ga0501073_0193355_112_1344
Length 410
Sequence VTSFGTGLAQWLARKSGSRCAKCATTIRADGPGCESVPHGLPVPRCEGHAAVTRGPEVFGRSRAVVGLDIGSSAVKAVELKGSGKSYKVTAFGIEPVPPDSIVDGAIIDAGAVAESIRRVFEQTAFRTKEVAASLSGNAVIVKKISLPVMTPTELDESIYWEAEQYIPFDIQDVNLDYQILDAGPGGDAKGTMEVLLVAAKKEKIADYTGVISQAGRVPVVVDVDAFALQNAFEVNYGFEPDTVVVLLNAGASAININIISGGQSVFTRDVSIGGNAYTEAVQRELNLPFDAAERLKRGTPVDGATFEDVRPVLRAMTDNVLLEVQKTFDFFKATAASDRIDRIMLSGGASRVDGFAEMLQDRFGTEVEDFDPFKRVAVDPKKFAEDQQALMGPTAAVAVGLALRRAGDR

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
215 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
216 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
217 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
218 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
246 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
306 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
326 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
327 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
328 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.93
Metatranscriptomes 0.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 1.25
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0193355 3300049589 Bacteria 1408
2 SwRhRL2b_contig_193209 2162886007 Bacteria 1521
3 MRS1b_contig_6947448 2162886011 Bacteria 3226
4 JGI24746J21847_1003627 3300001977 Unclassified 2430
5 JGI24737J22298_10047772 3300001990 Bacteria 1304
6 JGI24749J21850_1011257 3300002076 Bacteria 1255
7 JGI25406J46586_10000155 3300003203 Bacteria 30290
8 JGI25406J46586_10003711 3300003203 Bacteria 7156
9 Ga0065704_10002309 3300005289 Bacteria 12631
10 Ga0065704_10010788 3300005289 Bacteria 3036
11 Ga0065712_10006208 3300005290 Bacteria 4540
12 Ga0065712_10010362 3300005290 Bacteria 2377
13 Ga0065712_10012446 3300005290 Bacteria 2257
14 Ga0065712_10016937 3300005290 Bacteria 2506
15 Ga0065712_10069441 3300005290 Bacteria 7299
16 Ga0065712_10074209 3300005290 Bacteria 4157
17 Ga0065712_10077879 3300005290 Unclassified 3427
18 Ga0065712_10099325 3300005290 Unclassified 2094
19 Ga0065712_10116983 3300005290 Bacteria 1723
20 Ga0065715_10005999 3300005293 Bacteria 3385
21 Ga0065715_10007986 3300005293 Bacteria 5169
22 Ga0065715_10008080 3300005293 Bacteria 4736
23 Ga0065715_10015065 3300005293 Unclassified 3605
24 Ga0065715_10091808 3300005293 Bacteria 5525
25 Ga0065715_10132712 3300005293 Bacteria 1985
26 Ga0065715_10144071 3300005293 Bacteria 1806
27 Ga0065715_10178989 3300005293 Bacteria 1490
28 Ga0065707_10002448 3300005295 Bacteria 6187
29 Ga0065707_10003514 3300005295 Bacteria 4057
30 Ga0065707_10005263 3300005295 Bacteria 3881
31 Ga0065707_10006157 3300005295 Bacteria 6930
32 Ga0065707_10083745 3300005295 Bacteria 8334
33 Ga0065707_10130448 3300005295 Bacteria 1929
34 Ga0065707_10148261 3300005295 Bacteria 1688
35 Ga0070676_10005855 3300005328 Bacteria 6560
36 Ga0070676_10021491 3300005328 Bacteria 3613
37 Ga0070676_10090357 3300005328 Bacteria 1875
38 Ga0070683_100129838 3300005329 Bacteria 2384
39 Ga0070690_100004693 3300005330 Bacteria 7613
40 Ga0070690_100006163 3300005330 Bacteria 6795
41 Ga0070690_100015483 3300005330 Bacteria 4551
42 Ga0070690_100062778 3300005330 Bacteria 2396
43 Ga0070690_100076109 3300005330 Bacteria 2189
44 Ga0070690_100094736 3300005330 Bacteria 1970
45 Ga0070670_100008420 3300005331 Bacteria 8793
46 Ga0070670_100010266 3300005331 Bacteria 7991
47 Ga0070670_100014108 3300005331 Bacteria 6854
48 Ga0070670_100015682 3300005331 Bacteria 6504
49 Ga0070670_100018167 3300005331 Bacteria 6033
50 Ga0070670_100058120 3300005331 Bacteria 3320
51 Ga0070670_100072067 3300005331 Bacteria 2967
52 Ga0070670_100111242 3300005331 Unclassified 2360
53 Ga0070670_100133045 3300005331 Bacteria 2148
54 Ga0070670_100158828 3300005331 Bacteria 1959
55 Ga0070677_10023889 3300005333 Bacteria 2267
56 Ga0070677_10085602 3300005333 Bacteria 1360
57 Ga0068869_100006495 3300005334 Bacteria 7421
58 Ga0068869_100033250 3300005334 Bacteria 3640
59 Ga0068869_100053890 3300005334 Bacteria 2926
60 Ga0070666_10000594 3300005335 Bacteria 21783
61 Ga0070666_10003133 3300005335 Bacteria 10048
62 Ga0070666_10022370 3300005335 Bacteria 4106
63 Ga0070666_10022827 3300005335 Bacteria 4066
64 Ga0070666_10035966 3300005335 Bacteria 3285
65 Ga0070680_100026646 3300005336 Bacteria 4623
66 Ga0070680_100056521 3300005336 Bacteria 3207
67 Ga0070680_100081784 3300005336 Unclassified 2665
68 Ga0070682_100010957 3300005337 Bacteria 5166
69 Ga0070682_100043117 3300005337 Bacteria 2789
70 Ga0068868_100001652 3300005338 Bacteria 15233
71 Ga0068868_100008288 3300005338 Bacteria 7443
72 Ga0068868_100082346 3300005338 Bacteria 2581
73 Ga0068868_100117666 3300005338 Unclassified 2165
74 Ga0068868_100162378 3300005338 Bacteria 1846
75 Ga0068868_100208047 3300005338 Bacteria 1634
76 Ga0068868_100273890 3300005338 Bacteria 1427
77 Ga0070689_100020129 3300005340 Bacteria 4947
78 Ga0070689_100025387 3300005340 Bacteria 4450
79 Ga0070689_100030369 3300005340 Bacteria 4102
80 Ga0070689_100033737 3300005340 Bacteria 3902
81 Ga0070689_100206990 3300005340 Unclassified 1604
82 Ga0070689_100218799 3300005340 Bacteria 1561
83 Ga0070689_100280197 3300005340 Bacteria 1383
84 Ga0070689_100326220 3300005340 Bacteria 1283
85 Ga0070691_10001877 3300005341 Bacteria 9186
86 Ga0070687_100055741 3300005343 Bacteria 2065
87 Ga0070687_100056508 3300005343 Bacteria 2053
88 Ga0070687_100093984 3300005343 Bacteria 1664
89 Ga0070661_100151041 3300005344 Bacteria 1756
90 Ga0070661_100172087 3300005344 Bacteria 1645
91 Ga0070661_100267855 3300005344 Unclassified 1322
92 Ga0070668_100005185 3300005347 Bacteria 9664
93 Ga0070668_100012677 3300005347 Bacteria 6275
94 Ga0070668_100104520 3300005347 Bacteria 2248
95 Ga0070668_100230213 3300005347 Bacteria 1532
96 Ga0070669_100001373 3300005353 Bacteria 17563
97 Ga0070669_100002909 3300005353 Bacteria 12341
98 Ga0070669_100003544 3300005353 Bacteria 11256
99 Ga0070669_100099894 3300005353 Bacteria 2187
100 Ga0070669_100103136 3300005353 Bacteria 2154
101 Ga0070669_100126680 3300005353 Bacteria 1955
102 Ga0070669_100159550 3300005353 Bacteria 1751
103 Ga0070669_100218400 3300005353 Bacteria 1506
104 Ga0070675_100000055 3300005354 Bacteria 68147
105 Ga0070675_100001125 3300005354 Bacteria 19310
106 Ga0070675_100001815 3300005354 Bacteria 15795
107 Ga0070675_100004904 3300005354 Bacteria 10206
108 Ga0070675_100005228 3300005354 Bacteria 9906
109 Ga0070675_100007176 3300005354 Bacteria 8589
110 Ga0070675_100008120 3300005354 Bacteria 8139
111 Ga0070675_100008723 3300005354 Bacteria 7874
112 Ga0070675_100028311 3300005354 Bacteria 4510
113 Ga0070675_100032755 3300005354 Bacteria 4207
114 Ga0070675_100056743 3300005354 Bacteria 3228
115 Ga0070675_100079742 3300005354 Bacteria 2728
116 Ga0070675_100126603 3300005354 Bacteria 2174
117 Ga0070675_100132940 3300005354 Bacteria 2122
118 Ga0070675_100196459 3300005354 Bacteria 1750
119 Ga0070671_100001376 3300005355 Bacteria 18220
120 Ga0070671_100006808 3300005355 Bacteria 9148
121 Ga0070671_100007019 3300005355 Bacteria 9022
122 Ga0070671_100017513 3300005355 Bacteria 5805
123 Ga0070671_100031503 3300005355 Bacteria 4381
124 Ga0070671_100035183 3300005355 Bacteria 4149
125 Ga0070671_100053795 3300005355 Bacteria 3347
126 Ga0070671_100060142 3300005355 Bacteria 3163
127 Ga0070671_100184993 3300005355 Bacteria 1765
128 Ga0070671_100199068 3300005355 Bacteria 1698
129 Ga0070671_100203317 3300005355 Bacteria 1680
130 Ga0070674_100001908 3300005356 Bacteria 11335
131 Ga0070674_100003104 3300005356 Bacteria 9248
132 Ga0070674_100016676 3300005356 Bacteria 4608
133 Ga0070674_100030682 3300005356 Bacteria 3555
134 Ga0070674_100238700 3300005356 Unclassified 1422
135 Ga0070673_100002582 3300005364 Bacteria 11061
136 Ga0070673_100004179 3300005364 Bacteria 9107
137 Ga0070673_100005345 3300005364 Bacteria 8204
138 Ga0070673_100006683 3300005364 Bacteria 7518
139 Ga0070673_100014804 3300005364 Bacteria 5452
140 Ga0070673_100017518 3300005364 Bacteria 5098
141 Ga0070673_100031657 3300005364 Bacteria 3973
142 Ga0070673_100044423 3300005364 Bacteria 3440
143 Ga0070673_100087043 3300005364 Bacteria 2546
144 Ga0070673_100098712 3300005364 Bacteria 2401
145 Ga0070673_100141843 3300005364 Unclassified 2027
146 Ga0070673_100154404 3300005364 Bacteria 1947
147 Ga0070673_100193708 3300005364 Bacteria 1747
148 Ga0070673_100217395 3300005364 Bacteria 1652
149 Ga0070673_100252506 3300005364 Bacteria 1538
150 Ga0070688_100002351 3300005365 Bacteria 9538
151 Ga0070688_100003093 3300005365 Bacteria 8507
152 Ga0070688_100012388 3300005365 Bacteria 4777
153 Ga0070688_100017737 3300005365 Bacteria 4091
154 Ga0070688_100075600 3300005365 Bacteria 2165
155 Ga0070688_100078876 3300005365 Bacteria 2125
156 Ga0070688_100089317 3300005365 Bacteria 2010
157 Ga0070688_100176040 3300005365 Bacteria 1480
158 Ga0070659_100062552 3300005366 Bacteria 2943
159 Ga0070659_100128011 3300005366 Bacteria 2061
160 Ga0070659_100158793 3300005366 Bacteria 1848
161 Ga0070667_100003359 3300005367 Bacteria 13656
162 Ga0070667_100014800 3300005367 Bacteria 6444
163 Ga0070667_100077657 3300005367 Bacteria 2836
164 Ga0070667_100151598 3300005367 Bacteria 2037
165 Ga0070703_10000851 3300005406 Bacteria 9856
166 Ga0070703_10006075 3300005406 Bacteria 3380
167 Ga0070709_10000753 3300005434 Bacteria 18310
168 Ga0070709_10142543 3300005434 Bacteria 1648
169 Ga0070714_100004607 3300005435 Bacteria 10396
170 Ga0070713_100005838 3300005436 Bacteria 8464
171 Ga0070713_100061895 3300005436 Bacteria 3133
172 Ga0070701_10003090 3300005438 Bacteria 6523
173 Ga0070701_10004454 3300005438 Bacteria 5679
174 Ga0070701_10007569 3300005438 Bacteria 4649
175 Ga0070701_10010958 3300005438 Bacteria 4030
176 Ga0070701_10021735 3300005438 Unclassified 3067
177 Ga0070701_10032700 3300005438 Bacteria 2593
178 Ga0070701_10151021 3300005438 Bacteria 1338
179 Ga0070711_100000003 3300005439 Bacteria 192172
180 Ga0070705_100000076 3300005440 Bacteria 53948
181 Ga0070705_100000575 3300005440 Bacteria 21304
182 Ga0070705_100012488 3300005440 Bacteria 4319
183 Ga0070705_100030991 3300005440 Bacteria 2957
184 Ga0070705_100040581 3300005440 Bacteria 2647
185 Ga0070705_100077870 3300005440 Unclassified 2026
186 Ga0070700_100018171 3300005441 Bacteria 4038
187 Ga0070700_100019055 3300005441 Bacteria 3955
188 Ga0070700_100029712 3300005441 Bacteria 3260
189 Ga0070700_100037788 3300005441 Bacteria 2938
190 Ga0070700_100039578 3300005441 Bacteria 2881
191 Ga0070700_100050950 3300005441 Bacteria 2575
192 Ga0070694_100005583 3300005444 Bacteria 7625
193 Ga0070694_100010437 3300005444 Bacteria 5731
194 Ga0070694_100012167 3300005444 Bacteria 5346
195 Ga0070694_100030315 3300005444 Bacteria 3536
196 Ga0070694_100034674 3300005444 Bacteria 3330
197 Ga0070694_100043116 3300005444 Bacteria 3015
198 Ga0070694_100049254 3300005444 Unclassified 2837
199 Ga0070694_100056655 3300005444 Bacteria 2662
200 Ga0070694_100071850 3300005444 Unclassified 2386
201 Ga0070694_100171464 3300005444 Bacteria 1599
202 Ga0070708_100000893 3300005445 Bacteria 22576
203 Ga0070708_100098065 3300005445 Bacteria 2680
204 Ga0070708_100416179 3300005445 Bacteria 1268
205 Ga0070663_100050302 3300005455 Bacteria 2963
206 Ga0070678_100044789 3300005456 Bacteria 3162
207 Ga0070678_100072812 3300005456 Bacteria 2577
208 Ga0070678_100089947 3300005456 Bacteria 2351
209 Ga0070678_100097879 3300005456 Bacteria 2267
210 Ga0070678_100152731 3300005456 Bacteria 1862
211 Ga0070662_100012481 3300005457 Bacteria 5634
212 Ga0070662_100021620 3300005457 Unclassified 4395
213 Ga0070662_100206675 3300005457 Bacteria 1560
214 Ga0070662_100213127 3300005457 Bacteria 1538
215 Ga0070681_10000489 3300005458 Bacteria 32333
216 Ga0070681_10005835 3300005458 Bacteria 11920
217 Ga0070681_10061945 3300005458 Bacteria 3715
218 Ga0068867_100000885 3300005459 Bacteria 20261
219 Ga0068867_100004327 3300005459 Bacteria 9996
220 Ga0068867_100010559 3300005459 Bacteria 6515
221 Ga0068867_100066200 3300005459 Bacteria 2691
222 Ga0068867_100125524 3300005459 Bacteria 1988
223 Ga0068867_100302841 3300005459 Bacteria 1318
224 Ga0070685_10004241 3300005466 Bacteria 7229
225 Ga0070685_10006683 3300005466 Bacteria 5886
226 Ga0070685_10016811 3300005466 Bacteria 3904
227 Ga0070685_10029597 3300005466 Bacteria 3044
228 Ga0070685_10105147 3300005466 Bacteria 1730
229 Ga0070706_100015941 3300005467 Bacteria 6940
230 Ga0070706_100051861 3300005467 Bacteria 3787
231 Ga0070706_100140600 3300005467 Bacteria 2254
232 Ga0070706_100250728 3300005467 Bacteria 1653
233 Ga0070706_100274666 3300005467 Bacteria 1572
234 Ga0070706_100311325 3300005467 Unclassified 1469
235 Ga0070706_100315646 3300005467 Bacteria 1458
236 Ga0070707_100000057 3300005468 Bacteria 98930
237 Ga0070707_100000648 3300005468 Bacteria 34812
238 Ga0070707_100007041 3300005468 Bacteria 10426
239 Ga0070707_100012400 3300005468 Bacteria 7960
240 Ga0070707_100053527 3300005468 Bacteria 3869
241 Ga0070707_100151190 3300005468 Unclassified 2260
242 Ga0070698_100001357 3300005471 Bacteria 27226
243 Ga0070698_100003700 3300005471 Bacteria 16783
244 Ga0070698_100006206 3300005471 Bacteria 13013
245 Ga0070698_100015602 3300005471 Bacteria 8023
246 Ga0070698_100016125 3300005471 Bacteria 7889
247 Ga0070698_100092444 3300005471 Bacteria 3006
248 Ga0070698_100119268 3300005471 Bacteria 2599
249 Ga0070698_100169318 3300005471 Bacteria 2126
250 Ga0070698_100334544 3300005471 Bacteria 1445
251 Ga0070699_100000008 3300005518 Bacteria 295702
252 Ga0070699_100000371 3300005518 Bacteria 43874
253 Ga0070699_100005650 3300005518 Bacteria 10949
254 Ga0070699_100007586 3300005518 Bacteria 9431
255 Ga0070699_100013938 3300005518 Bacteria 6914
256 Ga0070699_100106662 3300005518 Bacteria 2458
257 Ga0070699_100229196 3300005518 Bacteria 1656
258 Ga0070699_100397987 3300005518 Bacteria 1245
259 Ga0070679_100000604 3300005530 Bacteria 30555
260 Ga0070679_100003780 3300005530 Bacteria 13889
261 Ga0070679_100014369 3300005530 Bacteria 7603
262 Ga0070679_100027924 3300005530 Bacteria 5560
263 Ga0070679_100049695 3300005530 Bacteria 4177
264 Ga0070679_100117457 3300005530 Bacteria 2645
265 Ga0070679_100411786 3300005530 Unclassified 1297
266 Ga0070684_100008567 3300005535 Bacteria 8006
267 Ga0070684_100037633 3300005535 Bacteria 4152
268 Ga0070684_100065970 3300005535 Bacteria 3178
269 Ga0070697_100011788 3300005536 Bacteria 6840
270 Ga0070697_100025025 3300005536 Bacteria 4757
271 Ga0070697_100054189 3300005536 Unclassified 3260
272 Ga0070697_100054511 3300005536 Bacteria 3250
273 Ga0068853_100021079 3300005539 Bacteria 5426
274 Ga0070672_100000562 3300005543 Bacteria 21739
275 Ga0070672_100003923 3300005543 Bacteria 9693
276 Ga0070672_100020719 3300005543 Bacteria 4799
277 Ga0070672_100021515 3300005543 Bacteria 4722
278 Ga0070672_100041631 3300005543 Bacteria 3533
279 Ga0070686_100000959 3300005544 Bacteria 16611
280 Ga0070686_100002283 3300005544 Bacteria 10588
281 Ga0070686_100003408 3300005544 Bacteria 8720
282 Ga0070686_100063850 3300005544 Bacteria 2387
283 Ga0070686_100069370 3300005544 Bacteria 2302
284 Ga0070686_100100734 3300005544 Unclassified 1951
285 Ga0070695_100000627 3300005545 Bacteria 18740
286 Ga0070695_100003525 3300005545 Bacteria 9136
287 Ga0070695_100014109 3300005545 Bacteria 4811
288 Ga0070695_100017212 3300005545 Bacteria 4382
289 Ga0070695_100032836 3300005545 Bacteria 3245
290 Ga0070695_100040277 3300005545 Bacteria 2957
291 Ga0070696_100003302 3300005546 Bacteria 10767
292 Ga0070696_100012559 3300005546 Bacteria 5687
293 Ga0070696_100012682 3300005546 Bacteria 5659
294 Ga0070696_100017615 3300005546 Bacteria 4823
295 Ga0070696_100018825 3300005546 Bacteria 4674
296 Ga0070696_100034024 3300005546 Bacteria 3505
297 Ga0070696_100039665 3300005546 Bacteria 3251
298 Ga0070696_100162184 3300005546 Bacteria 1648
299 Ga0070693_100000939 3300005547 Bacteria 12910
300 Ga0070693_100008858 3300005547 Bacteria 4988
301 Ga0070693_100009613 3300005547 Bacteria 4814
302 Ga0070665_100008815 3300005548 Bacteria 10210
303 Ga0070665_100028561 3300005548 Bacteria 5617
304 Ga0070665_100097984 3300005548 Bacteria 2937
305 Ga0070665_100187592 3300005548 Bacteria 2069
306 Ga0070704_100007286 3300005549 Bacteria 6579
307 Ga0070704_100020854 3300005549 Bacteria 4236
308 Ga0070704_100024662 3300005549 Bacteria 3949
309 Ga0070704_100025566 3300005549 Bacteria 3889
310 Ga0070704_100028213 3300005549 Bacteria 3732
311 Ga0070704_100056374 3300005549 Bacteria 2790
312 Ga0070704_100079978 3300005549 Bacteria 2403
313 Ga0070704_100187802 3300005549 Unclassified 1659
314 Ga0068855_100024107 3300005563 Bacteria 7283
315 Ga0068855_100163846 3300005563 Bacteria 2522
316 Ga0068855_100446007 3300005563 Unclassified 1413
317 Ga0070664_100005905 3300005564 Bacteria 9890
318 Ga0070664_100011776 3300005564 Bacteria 7099
319 Ga0070664_100054873 3300005564 Bacteria 3382
320 Ga0070664_100063695 3300005564 Bacteria 3143
321 Ga0070664_100074820 3300005564 Unclassified 2907
322 Ga0070664_100106812 3300005564 Bacteria 2439
323 Ga0070664_100189405 3300005564 Bacteria 1832
324 Ga0070664_100228105 3300005564 Bacteria 1669
325 Ga0070664_100450410 3300005564 Bacteria 1182
326 Ga0068857_100065125 3300005577 Bacteria 3240
327 Ga0068857_100083449 3300005577 Bacteria 2854
328 Ga0068857_100135944 3300005577 Bacteria 2219
329 Ga0068854_100022324 3300005578 Bacteria 4308
330 Ga0068854_100048297 3300005578 Bacteria 3036
331 Ga0068854_100128056 3300005578 Bacteria 1936
332 Ga0068854_100154158 3300005578 Bacteria 1774
333 Ga0068854_100348855 3300005578 Bacteria 1211
334 Ga0068856_100012203 3300005614 Bacteria 8324
335 Ga0070702_100022354 3300005615 Bacteria 3341
336 Ga0070702_100024575 3300005615 Bacteria 3216
337 Ga0070702_100050642 3300005615 Bacteria 2373
338 Ga0070702_100091751 3300005615 Bacteria 1843
339 Ga0070702_100091825 3300005615 Bacteria 1843
340 Ga0068852_100059883 3300005616 Bacteria 3304
341 Ga0068852_100115052 3300005616 Bacteria 2452
342 Ga0068859_100011646 3300005617 Bacteria 8840
343 Ga0068859_100013973 3300005617 Bacteria 8052
344 Ga0068859_100016256 3300005617 Bacteria 7474
345 Ga0068859_100018030 3300005617 Bacteria 7094
346 Ga0068859_100032365 3300005617 Bacteria 5253
347 Ga0068859_100037402 3300005617 Bacteria 4871
348 Ga0068859_100058899 3300005617 Bacteria 3869
349 Ga0068859_100069229 3300005617 Bacteria 3563
350 Ga0068859_100087977 3300005617 Bacteria 3155
351 Ga0068859_100096514 3300005617 Bacteria 3009
352 Ga0068859_100131733 3300005617 Bacteria 2572
353 Ga0068859_100131770 3300005617 Bacteria 2572
354 Ga0068859_100229694 3300005617 Bacteria 1943
355 Ga0068864_100004431 3300005618 Bacteria 11538
356 Ga0068864_100006425 3300005618 Bacteria 9634
357 Ga0068864_100007053 3300005618 Bacteria 9224
358 Ga0068864_100031425 3300005618 Bacteria 4505
359 Ga0068864_100033342 3300005618 Bacteria 4378
360 Ga0068864_100061014 3300005618 Bacteria 3266
361 Ga0068864_100108487 3300005618 Bacteria 2471
362 Ga0068864_100108583 3300005618 Bacteria 2469
363 Ga0068864_100189919 3300005618 Bacteria 1883
364 Ga0068864_100219206 3300005618 Unclassified 1755
365 Ga0068864_100236603 3300005618 Unclassified 1691
366 Ga0068864_100342262 3300005618 Bacteria 1409
367 Ga0068864_100423339 3300005618 Bacteria 1269
368 Ga0068861_100005216 3300005719 Bacteria 8753
369 Ga0068861_100023958 3300005719 Bacteria 4408
370 Ga0068861_100031678 3300005719 Bacteria 3886
371 Ga0068861_100085804 3300005719 Bacteria 2473
372 Ga0068861_100176890 3300005719 Bacteria 1773
373 Ga0068861_100209582 3300005719 Bacteria 1641
374 Ga0068861_100228187 3300005719 Bacteria 1578
375 Ga0068861_100271417 3300005719 Bacteria 1456
376 Ga0068851_10000602 3300005834 Bacteria 15490
377 Ga0068851_10069132 3300005834 Bacteria 1824
378 Ga0068870_10008497 3300005840 Bacteria 4622
379 Ga0068870_10061924 3300005840 Bacteria 2013
380 Ga0068863_100001095 3300005841 Bacteria 27054
381 Ga0068863_100006615 3300005841 Bacteria 11377
382 Ga0068863_100032909 3300005841 Bacteria 4940
383 Ga0068863_100051018 3300005841 Bacteria 3922
384 Ga0068863_100129723 3300005841 Bacteria 2406
385 Ga0068863_100346431 3300005841 Unclassified 1446
386 Ga0068858_100002620 3300005842 Bacteria 18120
387 Ga0068858_100016743 3300005842 Bacteria 6884
388 Ga0068858_100019742 3300005842 Bacteria 6300
389 Ga0068858_100034186 3300005842 Bacteria 4715
390 Ga0068858_100038174 3300005842 Bacteria 4454
391 Ga0068858_100041782 3300005842 Bacteria 4251
392 Ga0068858_100044197 3300005842 Bacteria 4130
393 Ga0068858_100102788 3300005842 Bacteria 2666
394 Ga0068858_100124262 3300005842 Bacteria 2415
395 Ga0068858_100240208 3300005842 Unclassified 1719
396 Ga0068858_100520239 3300005842 Unclassified 1150
397 Ga0068860_100007521 3300005843 Bacteria 10900
398 Ga0068860_100009363 3300005843 Bacteria 9736
399 Ga0068860_100021507 3300005843 Bacteria 6246
400 Ga0068860_100026334 3300005843 Bacteria 5607
401 Ga0068860_100053735 3300005843 Bacteria 3829
402 Ga0068860_100067149 3300005843 Bacteria 3408
403 Ga0068860_100098039 3300005843 Bacteria 2795
404 Ga0068860_100129800 3300005843 Bacteria 2418
405 Ga0068860_100133263 3300005843 Bacteria 2386
406 Ga0068860_100235510 3300005843 Bacteria 1780
407 Ga0068860_100294326 3300005843 Bacteria 1589
408 Ga0068862_100004280 3300005844 Bacteria 12078
409 Ga0068862_100004302 3300005844 Bacteria 12048
410 Ga0068862_100015653 3300005844 Bacteria 6300
411 Ga0068862_100022682 3300005844 Bacteria 5253
412 Ga0068862_100023648 3300005844 Bacteria 5150
413 Ga0068862_100031365 3300005844 Bacteria 4485
414 Ga0068862_100130731 3300005844 Bacteria 2220
415 Ga0068862_100306037 3300005844 Bacteria 1463
416 Ga0068862_100324731 3300005844 Bacteria 1421
417 Ga0081455_10036346 3300005937 Bacteria 4387
418 Ga0081455_10075941 3300005937 Bacteria 2770
419 Ga0081538_10106946 3300005981 Bacteria 1387
420 Ga0081539_10000090 3300005985 Bacteria 212006
421 Ga0081539_10000558 3300005985 Bacteria 77001
422 Ga0081539_10001150 3300005985 Bacteria 47947
423 Ga0081539_10008913 3300005985 Bacteria 8559
424 Ga0081539_10016120 3300005985 Bacteria 5366
425 Ga0081539_10052459 3300005985 Bacteria 2290
426 Ga0070717_10046294 3300006028 Bacteria 3559
427 Ga0075365_10027453 3300006038 Bacteria 3623
428 Ga0075368_10001456 3300006042 Bacteria 7571
429 Ga0075364_10005240 3300006051 Bacteria 7523
430 Ga0075364_10019407 3300006051 Bacteria 4267
431 Ga0070716_100173213 3300006173 Bacteria 1410
432 Ga0075362_10000334 3300006177 Bacteria 13446
433 Ga0075367_10000838 3300006178 Bacteria 12210
434 Ga0075367_10079155 3300006178 Bacteria 1986
435 Ga0097621_100005469 3300006237 Bacteria 8945
436 Ga0097621_100016558 3300006237 Bacteria 5577
437 Ga0097621_100017472 3300006237 Bacteria 5447
438 Ga0097621_100037128 3300006237 Unclassified 3901
439 Ga0097621_100042767 3300006237 Bacteria 3650
440 Ga0097621_100069820 3300006237 Bacteria 2901
441 Ga0097621_100070007 3300006237 Bacteria 2897
442 Ga0097621_100087138 3300006237 Bacteria 2607
443 Ga0097621_100108789 3300006237 Bacteria 2340
444 Ga0097621_100135803 3300006237 Bacteria 2098
445 Ga0097621_100152969 3300006237 Bacteria 1979
446 Ga0097621_100163823 3300006237 Unclassified 1913
447 Ga0075370_10008931 3300006353 Bacteria 5179
448 Ga0068871_100000170 3300006358 Bacteria 43522
449 Ga0068871_100005249 3300006358 Bacteria 9066
450 Ga0068871_100023487 3300006358 Bacteria 4772
451 Ga0068871_100063172 3300006358 Bacteria 3028
452 Ga0068871_100077078 3300006358 Bacteria 2754
453 Ga0068871_100081886 3300006358 Bacteria 2675
454 Ga0068871_100093720 3300006358 Bacteria 2506
455 Ga0068871_100151588 3300006358 Bacteria 1977
456 Ga0075428_100000003 3300006844 Bacteria 365483
457 Ga0075428_100000340 3300006844 Bacteria 46263
458 Ga0075428_100003237 3300006844 Bacteria 17826
459 Ga0075428_100004033 3300006844 Bacteria 16131
460 Ga0075428_100008413 3300006844 Bacteria 11443
461 Ga0075428_100014182 3300006844 Bacteria 8866
462 Ga0075428_100017395 3300006844 Bacteria 7946
463 Ga0075428_100038832 3300006844 Bacteria 5239
464 Ga0075428_100067580 3300006844 Bacteria 3911
465 Ga0075428_100070610 3300006844 Bacteria 3817
466 Ga0075428_100072720 3300006844 Bacteria 3755
467 Ga0075428_100090250 3300006844 Bacteria 3342
468 Ga0075428_100136860 3300006844 Bacteria 2663
469 Ga0075428_100202559 3300006844 Bacteria 2145
470 Ga0075428_100539556 3300006844 Bacteria 1247
471 Ga0075430_100000379 3300006846 Bacteria 32666
472 Ga0075430_100000569 3300006846 Bacteria 28027
473 Ga0075430_100002777 3300006846 Bacteria 14635
474 Ga0075430_100003418 3300006846 Bacteria 13271
475 Ga0075430_100031246 3300006846 Bacteria 4519
476 Ga0075430_100126357 3300006846 Bacteria 2131
477 Ga0075430_100258668 3300006846 Bacteria 1442
478 Ga0075430_100259956 3300006846 Bacteria 1438
479 Ga0075430_100264608 3300006846 Bacteria 1424
480 Ga0075431_100003313 3300006847 Bacteria 15598
481 Ga0075431_100005813 3300006847 Bacteria 12206
482 Ga0075431_100007804 3300006847 Bacteria 10658
483 Ga0075431_100012561 3300006847 Bacteria 8546
484 Ga0075431_100032884 3300006847 Bacteria 5346
485 Ga0075431_100041032 3300006847 Bacteria 4771
486 Ga0075431_100063209 3300006847 Bacteria 3820
487 Ga0075431_100086256 3300006847 Bacteria 3239
488 Ga0075431_100140717 3300006847 Bacteria 2487
489 Ga0075431_100198981 3300006847 Bacteria 2050
490 Ga0075433_10003473 3300006852 Bacteria 12170
491 Ga0075433_10012254 3300006852 Bacteria 6915
492 Ga0075433_10017123 3300006852 Bacteria 5995
493 Ga0075433_10023108 3300006852 Bacteria 5229
494 Ga0075433_10032349 3300006852 Bacteria 4480
495 Ga0075433_10033737 3300006852 Bacteria 4390
496 Ga0075433_10075217 3300006852 Bacteria 2972
497 Ga0075433_10079359 3300006852 Bacteria 2892
498 Ga0075433_10092176 3300006852 Bacteria 2679
499 Ga0075433_10110853 3300006852 Bacteria 2435
500 Ga0075433_10145380 3300006852 Unclassified 2108
501 Ga0075433_10146520 3300006852 Bacteria 2099
502 Ga0075433_10153068 3300006852 Unclassified 2051
503 Ga0075433_10177200 3300006852 Bacteria 1897
504 Ga0075433_10186892 3300006852 Bacteria 1843
505 Ga0075433_10219842 3300006852 Bacteria 1687
506 Ga0075433_10479776 3300006852 Bacteria 1095
507 Ga0075434_100000096 3300006871 Bacteria 48926
508 Ga0075434_100000260 3300006871 Bacteria 37408
509 Ga0075434_100001319 3300006871 Bacteria 20730
510 Ga0075434_100007147 3300006871 Bacteria 10319
511 Ga0075434_100021193 3300006871 Bacteria 6316
512 Ga0075434_100030428 3300006871 Bacteria 5315
513 Ga0075434_100037300 3300006871 Bacteria 4812
514 Ga0075434_100058065 3300006871 Unclassified 3846
515 Ga0075434_100075546 3300006871 Bacteria 3363
516 Ga0075434_100083779 3300006871 Unclassified 3187
517 Ga0075434_100086146 3300006871 Bacteria 3141
518 Ga0075434_100090203 3300006871 Unclassified 3067
519 Ga0075434_100091266 3300006871 Bacteria 3048
520 Ga0075434_100095911 3300006871 Bacteria 2971
521 Ga0075434_100111684 3300006871 Bacteria 2744
522 Ga0075434_100111941 3300006871 Bacteria 2741
523 Ga0075434_100117217 3300006871 Bacteria 2676
524 Ga0075434_100142532 3300006871 Bacteria 2417
525 Ga0075434_100180670 3300006871 Bacteria 2130
526 Ga0075434_100203020 3300006871 Unclassified 2002
527 Ga0075434_100344799 3300006871 Bacteria 1511
528 Ga0075429_100006960 3300006880 Bacteria 9827
529 Ga0075429_100014249 3300006880 Bacteria 6894
530 Ga0075429_100015626 3300006880 Bacteria 6577
531 Ga0075429_100018543 3300006880 Bacteria 6026
532 Ga0075429_100031433 3300006880 Bacteria 4614
533 Ga0075429_100034797 3300006880 Bacteria 4378
534 Ga0075429_100067470 3300006880 Bacteria 3112
535 Ga0075429_100087535 3300006880 Bacteria 2714
536 Ga0075429_100104158 3300006880 Unclassified 2478
537 Ga0075429_100133683 3300006880 Bacteria 2170
538 Ga0075429_100195990 3300006880 Bacteria 1769
539 Ga0075429_100289760 3300006880 Bacteria 1433
540 Ga0068865_100013019 3300006881 Bacteria 5245
541 Ga0068865_100018256 3300006881 Bacteria 4525
542 Ga0068865_100062579 3300006881 Bacteria 2612
543 Ga0068865_100100704 3300006881 Bacteria 2114
544 Ga0068865_100105264 3300006881 Bacteria 2072
545 Ga0068865_100192169 3300006881 Bacteria 1580
546 Ga0075436_100003261 3300006914 Bacteria 11114
547 Ga0075436_100027690 3300006914 Unclassified 3900
548 Ga0075436_100055284 3300006914 Bacteria 2741
549 Ga0097620_100011646 3300006931 Bacteria 8840
550 Ga0097620_100013973 3300006931 Bacteria 8052
551 Ga0097620_100016258 3300006931 Bacteria 7474
552 Ga0097620_100018031 3300006931 Bacteria 7094
553 Ga0097620_100032365 3300006931 Bacteria 5253
554 Ga0097620_100037402 3300006931 Bacteria 4871
555 Ga0097620_100058901 3300006931 Bacteria 3869
556 Ga0097620_100069226 3300006931 Bacteria 3563
557 Ga0097620_100087973 3300006931 Bacteria 3155
558 Ga0097620_100096516 3300006931 Bacteria 3009
559 Ga0097620_100131737 3300006931 Bacteria 2572
560 Ga0097620_100131768 3300006931 Bacteria 2572
561 Ga0097620_100229683 3300006931 Bacteria 1943
562 Ga0075435_100000064 3300007076 Bacteria 54706
563 Ga0075435_100002101 3300007076 Bacteria 13099
564 Ga0075435_100004297 3300007076 Bacteria 9790
565 Ga0075435_100007633 3300007076 Bacteria 7724
566 Ga0075435_100009317 3300007076 Bacteria 7100
567 Ga0075435_100024492 3300007076 Bacteria 4686
568 Ga0075435_100026220 3300007076 Bacteria 4544
569 Ga0075435_100058198 3300007076 Bacteria 3129
570 Ga0075435_100061240 3300007076 Bacteria 3053
571 Ga0075435_100066701 3300007076 Bacteria 2929
572 Ga0075435_100142332 3300007076 Bacteria 2012
573 Ga0075435_100237614 3300007076 Bacteria 1549
574 Ga0099794_10112321 3300007265 Bacteria 1366
575 Ga0105240_10037067 3300009093 Bacteria 6268
576 Ga0105240_10067650 3300009093 Bacteria 4428
577 Ga0105240_10069478 3300009093 Bacteria 4359
578 Ga0105240_10082952 3300009093 Bacteria 3935
579 Ga0105240_10163631 3300009093 Bacteria 2640
580 Ga0105240_10210439 3300009093 Bacteria 2273
581 Ga0105240_10371568 3300009093 Bacteria 1617
582 Ga0111539_10000001 3300009094 Bacteria 1035431
583 Ga0111539_10000311 3300009094 Bacteria 59311
584 Ga0111539_10000556 3300009094 Bacteria 47801
585 Ga0111539_10001060 3300009094 Bacteria 36230
586 Ga0111539_10001554 3300009094 Bacteria 30569
587 Ga0111539_10002104 3300009094 Bacteria 26607
588 Ga0111539_10002176 3300009094 Bacteria 26185
589 Ga0111539_10003416 3300009094 Bacteria 20919
590 Ga0111539_10005129 3300009094 Bacteria 16987
591 Ga0111539_10006746 3300009094 Bacteria 14773
592 Ga0111539_10010487 3300009094 Bacteria 11660
593 Ga0111539_10012296 3300009094 Bacteria 10728
594 Ga0111539_10024926 3300009094 Bacteria 7332
595 Ga0111539_10026205 3300009094 Bacteria 7133
596 Ga0111539_10045723 3300009094 Bacteria 5240
597 Ga0111539_10048103 3300009094 Bacteria 5094
598 Ga0111539_10053096 3300009094 Bacteria 4824
599 Ga0111539_10053659 3300009094 Bacteria 4798
600 Ga0111539_10127632 3300009094 Bacteria 2979
601 Ga0111539_10151623 3300009094 Bacteria 2713
602 Ga0111539_10169904 3300009094 Bacteria 2548
603 Ga0111539_10295298 3300009094 Bacteria 1886
604 Ga0111539_10492249 3300009094 Bacteria 1428
605 Ga0111539_10520744 3300009094 Bacteria 1385
606 Ga0105245_10007999 3300009098 Bacteria 9247
607 Ga0105245_10022668 3300009098 Bacteria 5511
608 Ga0105245_10440049 3300009098 Bacteria 1310
609 Ga0105247_10059079 3300009101 Bacteria 2373
610 Ga0105247_10158208 3300009101 Bacteria 1498
611 Ga0105247_10164338 3300009101 Bacteria 1472
612 Ga0114129_10000063 3300009147 Bacteria 96268
613 Ga0114129_10000453 3300009147 Bacteria 48900
614 Ga0114129_10001367 3300009147 Bacteria 32804
615 Ga0114129_10001428 3300009147 Bacteria 32267
616 Ga0114129_10001507 3300009147 Bacteria 31514
617 Ga0114129_10006234 3300009147 Bacteria 16903
618 Ga0114129_10007288 3300009147 Bacteria 15747
619 Ga0114129_10008028 3300009147 Bacteria 15034
620 Ga0114129_10012810 3300009147 Bacteria 11935
621 Ga0114129_10014525 3300009147 Bacteria 11222
622 Ga0114129_10026567 3300009147 Bacteria 8199
623 Ga0114129_10032452 3300009147 Bacteria 7380
624 Ga0114129_10032588 3300009147 Bacteria 7363
625 Ga0114129_10043635 3300009147 Bacteria 6309
626 Ga0114129_10044287 3300009147 Bacteria 6260
627 Ga0114129_10048261 3300009147 Bacteria 5983
628 Ga0114129_10053976 3300009147 Bacteria 5636
629 Ga0114129_10054631 3300009147 Bacteria 5599
630 Ga0114129_10058581 3300009147 Bacteria 5387
631 Ga0114129_10122623 3300009147 Unclassified 3576
632 Ga0114129_10122808 3300009147 Bacteria 3573
633 Ga0114129_10134210 3300009147 Bacteria 3397
634 Ga0114129_10151297 3300009147 Unclassified 3176
635 Ga0114129_10181176 3300009147 Bacteria 2866
636 Ga0114129_10235679 3300009147 Bacteria 2462
637 Ga0114129_10271377 3300009147 Bacteria 2269
638 Ga0114129_10349877 3300009147 Bacteria 1958
639 Ga0114129_10521582 3300009147 Bacteria 1549
640 Ga0114129_10631376 3300009147 Unclassified 1384
641 Ga0105243_10005241 3300009148 Bacteria 10144
642 Ga0105243_10049077 3300009148 Bacteria 3329
643 Ga0105243_10151054 3300009148 Bacteria 1992
644 Ga0105242_10013335 3300009176 Bacteria 6349
645 Ga0105242_10065571 3300009176 Bacteria 2996
646 Ga0105242_10070964 3300009176 Bacteria 2889
647 Ga0105242_10073527 3300009176 Bacteria 2842
648 Ga0105242_10290432 3300009176 Unclassified 1488
649 Ga0105248_10010164 3300009177 Bacteria 10365
650 Ga0105248_10014651 3300009177 Bacteria 8629
651 Ga0105248_10019171 3300009177 Bacteria 7568
652 Ga0105248_10021271 3300009177 Bacteria 7188
653 Ga0105248_10038996 3300009177 Bacteria 5319
654 Ga0105248_10045072 3300009177 Unclassified 4945
655 Ga0105248_10050262 3300009177 Bacteria 4675
656 Ga0105248_10061545 3300009177 Bacteria 4215
657 Ga0105248_10079425 3300009177 Bacteria 3687
658 Ga0105248_10103124 3300009177 Bacteria 3215
659 Ga0105248_10125137 3300009177 Bacteria 2900
660 Ga0105248_10148801 3300009177 Bacteria 2642
661 Ga0105248_10184047 3300009177 Bacteria 2354
662 Ga0105248_10191127 3300009177 Bacteria 2307
663 Ga0105248_10194077 3300009177 Bacteria 2288
664 Ga0105248_10267269 3300009177 Bacteria 1925
665 Ga0105248_10560954 3300009177 Bacteria 1288
666 Ga0105237_10004894 3300009545 Bacteria 15336
667 Ga0105237_10417620 3300009545 Bacteria 1347
668 Ga0105238_10010181 3300009551 Bacteria 9429
669 Ga0105238_10037296 3300009551 Bacteria 4941
670 Ga0105249_10000688 3300009553 Bacteria 30761
671 Ga0105249_10001486 3300009553 Bacteria 20547
672 Ga0105249_10007331 3300009553 Bacteria 9615
673 Ga0105249_10172775 3300009553 Bacteria 2097
674 Ga0105249_10201215 3300009553 Bacteria 1949
675 Ga0105249_10358344 3300009553 Bacteria 1479
676 Ga0099796_10053157 3300010159 Bacteria 1412
677 Ga0105239_10148201 3300010375 Bacteria 2618
678 Ga0105246_10019508 3300011119 Unclassified 4334
679 Ga0105246_10024633 3300011119 Bacteria 3912
680 Ga0105246_10134810 3300011119 Bacteria 1849
681 Ga0105246_10333882 3300011119 Bacteria 1236
682 Ga0105246_10354414 3300011119 Bacteria 1203
683 Ga0157373_10007433 3300013100 Bacteria 8149
684 Ga0157374_10202764 3300013296 Bacteria 1943
685 Ga0157378_10011736 3300013297 Bacteria 7670
686 Ga0157378_10015942 3300013297 Bacteria 6582
687 Ga0157378_10059971 3300013297 Bacteria 3395
688 Ga0157378_10080620 3300013297 Bacteria 2940
689 Ga0157378_10103130 3300013297 Bacteria 2606
690 Ga0163162_10001326 3300013306 Bacteria 23120
691 Ga0163162_10016274 3300013306 Bacteria 7271
692 Ga0163162_10048937 3300013306 Bacteria 4236
693 Ga0163162_10078587 3300013306 Bacteria 3365
694 Ga0163162_10092024 3300013306 Bacteria 3116
695 Ga0163162_10542320 3300013306 Bacteria 1292
696 Ga0163162_10578825 3300013306 Bacteria 1250
697 Ga0157372_10005906 3300013307 Bacteria 13032
698 Ga0157372_10095985 3300013307 Bacteria 3378
699 Ga0157372_10154570 3300013307 Bacteria 2649
700 Ga0157372_10190416 3300013307 Bacteria 2376
701 Ga0157375_10099601 3300013308 Bacteria 2986
702 Ga0157375_10199951 3300013308 Bacteria 2154
703 Ga0157375_10294041 3300013308 Bacteria 1787
704 Ga0157375_10352244 3300013308 Bacteria 1638
705 Ga0157375_10383479 3300013308 Bacteria 1572
706 Ga0163163_10006177 3300014325 Bacteria 10444
707 Ga0163163_10006749 3300014325 Bacteria 10061
708 Ga0163163_10008053 3300014325 Bacteria 9336
709 Ga0163163_10008652 3300014325 Bacteria 9053
710 Ga0163163_10023102 3300014325 Bacteria 5898
711 Ga0163163_10042998 3300014325 Bacteria 4427
712 Ga0163163_10043660 3300014325 Bacteria 4395
713 Ga0163163_10044775 3300014325 Unclassified 4342
714 Ga0163163_10108563 3300014325 Unclassified 2802
715 Ga0163163_10108874 3300014325 Bacteria 2798
716 Ga0163163_10128844 3300014325 Bacteria 2570
717 Ga0163163_10212291 3300014325 Unclassified 1985
718 Ga0157380_10006529 3300014326 Bacteria 8225
719 Ga0157380_10012113 3300014326 Bacteria 6242
720 Ga0157380_10025676 3300014326 Bacteria 4469
721 Ga0157380_10035588 3300014326 Bacteria 3846
722 Ga0157380_10131310 3300014326 Bacteria 2137
723 Ga0157380_10226467 3300014326 Bacteria 1676
724 Ga0157380_10553690 3300014326 Bacteria 1129
725 Ga0157377_10005736 3300014745 Bacteria 5857
726 Ga0157377_10029341 3300014745 Bacteria 2969
727 Ga0157379_10016419 3300014968 Bacteria 6513
728 Ga0157379_10025308 3300014968 Bacteria 5272
729 Ga0157379_10080486 3300014968 Unclassified 2918
730 Ga0157379_10114189 3300014968 Bacteria 2427
731 Ga0157376_10012625 3300014969 Bacteria 6277
732 Ga0157376_10019489 3300014969 Bacteria 5231
733 Ga0157376_10052864 3300014969 Bacteria 3380
734 Ga0157376_10067707 3300014969 Unclassified 3021
735 Ga0157376_10086879 3300014969 Bacteria 2697
736 Ga0157376_10095895 3300014969 Unclassified 2580
737 Ga0163161_10013850 3300017792 Bacteria 5616
738 Ga0207673_1004247 3300025290 Bacteria 1705
739 Ga0207697_10001427 3300025315 Bacteria 13067
740 Ga0207697_10009195 3300025315 Bacteria 4276
741 Ga0207656_10001847 3300025321 Bacteria 7034
742 Ga0207653_10000028 3300025885 Bacteria 113033
743 Ga0207653_10004283 3300025885 Bacteria 4483
744 Ga0207682_10005317 3300025893 Bacteria 5259
745 Ga0207682_10008489 3300025893 Bacteria 4060
746 Ga0207682_10020725 3300025893 Bacteria 2582
747 Ga0207682_10025312 3300025893 Bacteria 2353
748 Ga0207642_10054940 3300025899 Bacteria 1819
749 Ga0207710_10005543 3300025900 Bacteria 5430
750 Ga0207688_10007323 3300025901 Bacteria 6007
751 Ga0207688_10022213 3300025901 Bacteria 3470
752 Ga0207688_10033020 3300025901 Bacteria 2861
753 Ga0207688_10064707 3300025901 Bacteria 2065
754 Ga0207680_10004438 3300025903 Bacteria 6655
755 Ga0207680_10009434 3300025903 Bacteria 4841
756 Ga0207680_10076119 3300025903 Bacteria 2095
757 Ga0207680_10124295 3300025903 Bacteria 1691
758 Ga0207647_10010557 3300025904 Bacteria 6518
759 Ga0207647_10094061 3300025904 Bacteria 1786
760 Ga0207647_10115762 3300025904 Bacteria 1583
761 Ga0207699_10000038 3300025906 Bacteria 125079
762 Ga0207699_10028895 3300025906 Bacteria 3087
763 Ga0207645_10006314 3300025907 Bacteria 8524
764 Ga0207645_10006662 3300025907 Bacteria 8248
765 Ga0207645_10038943 3300025907 Bacteria 3047
766 Ga0207645_10074796 3300025907 Bacteria 2169
767 Ga0207645_10085469 3300025907 Bacteria 2026
768 Ga0207645_10149304 3300025907 Bacteria 1525
769 Ga0207643_10001047 3300025908 Bacteria 16402
770 Ga0207643_10008725 3300025908 Bacteria 5438
771 Ga0207643_10011722 3300025908 Bacteria 4736
772 Ga0207643_10023164 3300025908 Bacteria 3425
773 Ga0207643_10041327 3300025908 Unclassified 2598
774 Ga0207643_10141927 3300025908 Bacteria 1435
775 Ga0207643_10181668 3300025908 Bacteria 1273
776 Ga0207705_10050889 3300025909 Bacteria 2982
777 Ga0207684_10000061 3300025910 Bacteria 203286
778 Ga0207707_10000017 3300025912 Bacteria 237068
779 Ga0207707_10007403 3300025912 Bacteria 9561
780 Ga0207707_10047894 3300025912 Bacteria 3723
781 Ga0207695_10042256 3300025913 Bacteria 4871
782 Ga0207695_10060164 3300025913 Bacteria 3933
783 Ga0207695_10137432 3300025913 Bacteria 2396
784 Ga0207695_10216995 3300025913 Bacteria 1821
785 Ga0207671_10002146 3300025914 Bacteria 21525
786 Ga0207693_10117716 3300025915 Bacteria 2086
787 Ga0207663_10000006 3300025916 Bacteria 253740
788 Ga0207660_10020366 3300025917 Bacteria 4450
789 Ga0207660_10027175 3300025917 Bacteria 3902
790 Ga0207660_10032672 3300025917 Unclassified 3593
791 Ga0207660_10069959 3300025917 Bacteria 2550
792 Ga0207662_10001548 3300025918 Bacteria 11228
793 Ga0207662_10005192 3300025918 Bacteria 6912
794 Ga0207662_10060236 3300025918 Bacteria 2276
795 Ga0207662_10070513 3300025918 Bacteria 2114
796 Ga0207662_10079479 3300025918 Bacteria 1998
797 Ga0207662_10203509 3300025918 Bacteria 1282
798 Ga0207649_10008526 3300025920 Bacteria 5591
799 Ga0207649_10012964 3300025920 Bacteria 4645
800 Ga0207652_10000335 3300025921 Bacteria 48903
801 Ga0207652_10004505 3300025921 Bacteria 11315
802 Ga0207652_10043098 3300025921 Bacteria 3842
803 Ga0207652_10083271 3300025921 Bacteria 2801
804 Ga0207652_10108218 3300025921 Bacteria 2463
805 Ga0207652_10130535 3300025921 Bacteria 2241
806 Ga0207652_10312539 3300025921 Bacteria 1418
807 Ga0207646_10000074 3300025922 Bacteria 139758
808 Ga0207646_10035023 3300025922 Bacteria 4537
809 Ga0207646_10036852 3300025922 Bacteria 4413
810 Ga0207646_10060586 3300025922 Bacteria 3379
811 Ga0207646_10141559 3300025922 Bacteria 2167
812 Ga0207646_10258227 3300025922 Unclassified 1575
813 Ga0207681_10002790 3300025923 Bacteria 11054
814 Ga0207681_10005244 3300025923 Bacteria 7961
815 Ga0207681_10016170 3300025923 Bacteria 4661
816 Ga0207681_10030741 3300025923 Bacteria 3503
817 Ga0207681_10043232 3300025923 Bacteria 3014
818 Ga0207681_10048417 3300025923 Bacteria 2869
819 Ga0207694_10009804 3300025924 Bacteria 7230
820 Ga0207650_10009527 3300025925 Bacteria 6637
821 Ga0207650_10010896 3300025925 Bacteria 6249
822 Ga0207650_10012191 3300025925 Bacteria 5929
823 Ga0207650_10017284 3300025925 Bacteria 5048
824 Ga0207650_10026307 3300025925 Bacteria 4149
825 Ga0207650_10027928 3300025925 Bacteria 4042
826 Ga0207650_10032337 3300025925 Bacteria 3783
827 Ga0207650_10042391 3300025925 Bacteria 3339
828 Ga0207650_10073572 3300025925 Unclassified 2574
829 Ga0207650_10249325 3300025925 Bacteria 1437
830 Ga0207650_10329608 3300025925 Bacteria 1252
831 Ga0207659_10000870 3300025926 Bacteria 17967
832 Ga0207659_10001065 3300025926 Bacteria 16264
833 Ga0207659_10001218 3300025926 Bacteria 15394
834 Ga0207659_10002093 3300025926 Bacteria 11819
835 Ga0207659_10002934 3300025926 Bacteria 10162
836 Ga0207659_10003638 3300025926 Bacteria 9282
837 Ga0207659_10019225 3300025926 Bacteria 4491
838 Ga0207659_10020013 3300025926 Bacteria 4416
839 Ga0207659_10032618 3300025926 Bacteria 3577
840 Ga0207659_10050279 3300025926 Bacteria 2961
841 Ga0207659_10108369 3300025926 Bacteria 2107
842 Ga0207659_10221629 3300025926 Bacteria 1521
843 Ga0207659_10269241 3300025926 Bacteria 1389
844 Ga0207687_10011164 3300025927 Bacteria 5868
845 Ga0207664_10044228 3300025929 Bacteria 3486
846 Ga0207644_10006063 3300025931 Bacteria 7884
847 Ga0207644_10011771 3300025931 Bacteria 5792
848 Ga0207644_10030496 3300025931 Bacteria 3751
849 Ga0207644_10056199 3300025931 Bacteria 2839
850 Ga0207644_10058461 3300025931 Bacteria 2787
851 Ga0207644_10077796 3300025931 Bacteria 2444
852 Ga0207690_10084200 3300025932 Bacteria 2228
853 Ga0207706_10005794 3300025933 Bacteria 11493
854 Ga0207706_10008180 3300025933 Bacteria 9647
855 Ga0207706_10023285 3300025933 Bacteria 5563
856 Ga0207706_10110579 3300025933 Bacteria 2417
857 Ga0207706_10119809 3300025933 Archaea 2314
858 Ga0207706_10160751 3300025933 Bacteria 1974
859 Ga0207686_10013730 3300025934 Bacteria 4490
860 Ga0207686_10013839 3300025934 Bacteria 4475
861 Ga0207686_10048368 3300025934 Bacteria 2634
862 Ga0207709_10013854 3300025935 Bacteria 4452
863 Ga0207709_10017989 3300025935 Bacteria 3952
864 Ga0207709_10025043 3300025935 Bacteria 3413
865 Ga0207709_10034453 3300025935 Bacteria 2984
866 Ga0207709_10062496 3300025935 Bacteria 2331
867 Ga0207709_10134792 3300025935 Bacteria 1689
868 Ga0207670_10203309 3300025936 Bacteria 1506
869 Ga0207670_10220429 3300025936 Bacteria 1452
870 Ga0207669_10006694 3300025937 Bacteria 5284
871 Ga0207669_10022389 3300025937 Bacteria 3356
872 Ga0207669_10070180 3300025937 Bacteria 2195
873 Ga0207669_10131717 3300025937 Bacteria 1719
874 Ga0207704_10002986 3300025938 Bacteria 7651
875 Ga0207704_10009507 3300025938 Bacteria 4693
876 Ga0207704_10066842 3300025938 Bacteria 2258
877 Ga0207704_10109573 3300025938 Bacteria 1863
878 Ga0207665_10186198 3300025939 Bacteria 1506
879 Ga0207691_10001469 3300025940 Bacteria 23504
880 Ga0207691_10001775 3300025940 Bacteria 21233
881 Ga0207691_10006261 3300025940 Bacteria 11490
882 Ga0207691_10006746 3300025940 Bacteria 11074
883 Ga0207691_10012366 3300025940 Bacteria 8181
884 Ga0207691_10016837 3300025940 Bacteria 6936
885 Ga0207691_10053120 3300025940 Bacteria 3700
886 Ga0207691_10060818 3300025940 Bacteria 3432
887 Ga0207691_10149327 3300025940 Unclassified 2055
888 Ga0207691_10165615 3300025940 Unclassified 1937
889 Ga0207691_10360047 3300025940 Bacteria 1244
890 Ga0207711_10008875 3300025941 Bacteria 8407
891 Ga0207711_10011278 3300025941 Bacteria 7424
892 Ga0207711_10013476 3300025941 Bacteria 6789
893 Ga0207711_10024013 3300025941 Bacteria 5103
894 Ga0207711_10044514 3300025941 Bacteria 3789
895 Ga0207711_10056566 3300025941 Unclassified 3371
896 Ga0207711_10121038 3300025941 Bacteria 2336
897 Ga0207711_10121233 3300025941 Bacteria 2335
898 Ga0207711_10124446 3300025941 Bacteria 2305
899 Ga0207711_10125461 3300025941 Bacteria 2296
900 Ga0207711_10239967 3300025941 Bacteria 1662
901 Ga0207711_10395239 3300025941 Bacteria 1284
902 Ga0207689_10006066 3300025942 Bacteria 10688
903 Ga0207689_10010463 3300025942 Bacteria 7988
904 Ga0207689_10041349 3300025942 Bacteria 3814
905 Ga0207689_10054602 3300025942 Bacteria 3289
906 Ga0207661_10082495 3300025944 Bacteria 2658
907 Ga0207661_10150808 3300025944 Unclassified 2009
908 Ga0207679_10000885 3300025945 Bacteria 19091
909 Ga0207679_10008779 3300025945 Bacteria 6446
910 Ga0207679_10027538 3300025945 Bacteria 3932
911 Ga0207679_10046668 3300025945 Bacteria 3141
912 Ga0207679_10046980 3300025945 Unclassified 3133
913 Ga0207679_10214952 3300025945 Bacteria 1615
914 Ga0207667_10059715 3300025949 Bacteria 3992
915 Ga0207667_10180811 3300025949 Unclassified 2166
916 Ga0207651_10002115 3300025960 Bacteria 9367
917 Ga0207651_10003587 3300025960 Bacteria 7635
918 Ga0207651_10018429 3300025960 Bacteria 4154
919 Ga0207651_10045265 3300025960 Unclassified 2950
920 Ga0207651_10104965 3300025960 Bacteria 2106
921 Ga0207651_10126596 3300025960 Bacteria 1947
922 Ga0207651_10133894 3300025960 Bacteria 1902
923 Ga0207651_10135953 3300025960 Unclassified 1891
924 Ga0207651_10198721 3300025960 Bacteria 1605
925 Ga0207651_10220138 3300025960 Bacteria 1534
926 Ga0207651_10275520 3300025960 Bacteria 1388
927 Ga0207712_10002524 3300025961 Bacteria 11776
928 Ga0207712_10010680 3300025961 Bacteria 5831
929 Ga0207712_10034691 3300025961 Bacteria 3421
930 Ga0207712_10067772 3300025961 Bacteria 2555
931 Ga0207712_10353260 3300025961 Bacteria 1223
932 Ga0207668_10019392 3300025972 Bacteria 4299
933 Ga0207668_10021261 3300025972 Bacteria 4136
934 Ga0207668_10029456 3300025972 Bacteria 3598
935 Ga0207668_10096865 3300025972 Bacteria 2182
936 Ga0207640_10031894 3300025981 Bacteria 3262
937 Ga0207640_10051881 3300025981 Bacteria 2669
938 Ga0207640_10104514 3300025981 Bacteria 1994
939 Ga0207640_10192633 3300025981 Bacteria 1538
940 Ga0207658_10006860 3300025986 Bacteria 7756
941 Ga0207658_10021630 3300025986 Bacteria 4468
942 Ga0207677_10001205 3300026023 Bacteria 14021
943 Ga0207677_10009590 3300026023 Bacteria 5449
944 Ga0207677_10184552 3300026023 Bacteria 1644
945 Ga0207677_10224350 3300026023 Bacteria 1509
946 Ga0207677_10230998 3300026023 Bacteria 1490
947 Ga0207677_10286578 3300026023 Bacteria 1354
948 Ga0207703_10011601 3300026035 Bacteria 6852
949 Ga0207703_10013978 3300026035 Bacteria 6258
950 Ga0207703_10017715 3300026035 Bacteria 5561
951 Ga0207703_10024937 3300026035 Bacteria 4705
952 Ga0207703_10029099 3300026035 Bacteria 4358
953 Ga0207703_10036382 3300026035 Bacteria 3918
954 Ga0207703_10061144 3300026035 Bacteria 3083
955 Ga0207703_10066926 3300026035 Bacteria 2956
956 Ga0207703_10106316 3300026035 Bacteria 2387
957 Ga0207703_10224763 3300026035 Bacteria 1680
958 Ga0207703_10228056 3300026035 Unclassified 1669
959 Ga0207703_10239183 3300026035 Bacteria 1631
960 Ga0207703_10417864 3300026035 Bacteria 1247
961 Ga0207639_10058846 3300026041 Unclassified 2957
962 Ga0207678_10024166 3300026067 Bacteria 5309
963 Ga0207678_10054646 3300026067 Bacteria 3439
964 Ga0207678_10145705 3300026067 Bacteria 2021
965 Ga0207678_10216902 3300026067 Bacteria 1637
966 Ga0207708_10000967 3300026075 Bacteria 21533
967 Ga0207708_10005277 3300026075 Bacteria 9517
968 Ga0207708_10007629 3300026075 Bacteria 8005
969 Ga0207708_10012845 3300026075 Bacteria 6247
970 Ga0207708_10030957 3300026075 Bacteria 4061
971 Ga0207708_10054670 3300026075 Bacteria 3044
972 Ga0207708_10061343 3300026075 Bacteria 2871
973 Ga0207708_10076274 3300026075 Bacteria 2571
974 Ga0207708_10180047 3300026075 Bacteria 1678
975 Ga0207708_10186165 3300026075 Bacteria 1650
976 Ga0207708_10227104 3300026075 Bacteria 1498
977 Ga0207702_10008469 3300026078 Bacteria 8674
978 Ga0207641_10004712 3300026088 Bacteria 11761
979 Ga0207641_10006174 3300026088 Bacteria 10140
980 Ga0207641_10030368 3300026088 Bacteria 4476
981 Ga0207641_10090204 3300026088 Bacteria 2680
982 Ga0207641_10113993 3300026088 Bacteria 2401
983 Ga0207641_10130283 3300026088 Bacteria 2258
984 Ga0207641_10348701 3300026088 Unclassified 1410
985 Ga0207648_10000077 3300026089 Bacteria 93009
986 Ga0207648_10002088 3300026089 Bacteria 21755
987 Ga0207648_10008260 3300026089 Bacteria 10107
988 Ga0207648_10046317 3300026089 Bacteria 3813
989 Ga0207648_10072334 3300026089 Unclassified 3005
990 Ga0207648_10137737 3300026089 Bacteria 2150
991 Ga0207648_10154079 3300026089 Bacteria 2028
992 Ga0207648_10219885 3300026089 Bacteria 1688
993 Ga0207676_10002639 3300026095 Bacteria 12782
994 Ga0207676_10012513 3300026095 Bacteria 6082
995 Ga0207676_10024759 3300026095 Bacteria 4445
996 Ga0207676_10063801 3300026095 Bacteria 2927
997 Ga0207676_10124150 3300026095 Bacteria 2183
998 Ga0207676_10258185 3300026095 Bacteria 1572
999 Ga0207676_10333987 3300026095 Bacteria 1396
1000 Ga0207674_10014127 3300026116 Bacteria 8822
1001 Ga0207674_10054995 3300026116 Bacteria 4050
1002 Ga0207674_10100739 3300026116 Bacteria 2870
1003 Ga0207674_10138592 3300026116 Bacteria 2393
1004 Ga0207674_10240273 3300026116 Bacteria 1758
1005 Ga0207675_100025041 3300026118 Bacteria 5554
1006 Ga0207675_100037149 3300026118 Bacteria 4543
1007 Ga0207675_100041783 3300026118 Bacteria 4281
1008 Ga0207675_100051391 3300026118 Bacteria 3845
1009 Ga0207675_100058391 3300026118 Bacteria 3600
1010 Ga0207675_100067370 3300026118 Bacteria 3347
1011 Ga0207675_100077427 3300026118 Bacteria 3115
1012 Ga0207675_100113512 3300026118 Bacteria 2558
1013 Ga0207675_100142494 3300026118 Bacteria 2277
1014 Ga0207675_100162975 3300026118 Bacteria 2128
1015 Ga0207683_10002387 3300026121 Bacteria 16403
1016 Ga0207683_10006547 3300026121 Bacteria 9975
1017 Ga0207683_10011461 3300026121 Bacteria 7566
1018 Ga0207683_10032921 3300026121 Bacteria 4503
1019 Ga0207683_10039221 3300026121 Bacteria 4132
1020 Ga0207683_10051596 3300026121 Bacteria 3604
1021 Ga0207683_10057306 3300026121 Bacteria 3420
1022 Ga0207683_10085526 3300026121 Bacteria 2803
1023 Ga0207683_10126839 3300026121 Bacteria 2294
1024 Ga0207683_10291465 3300026121 Unclassified 1492
1025 Ga0207683_10293351 3300026121 Bacteria 1487
1026 Ga0207698_10137586 3300026142 Bacteria 2098
1027 Ga0207428_10000002 3300027907 Bacteria 854851
1028 Ga0207428_10000186 3300027907 Bacteria 86221
1029 Ga0207428_10002485 3300027907 Bacteria 18405
1030 Ga0207428_10002952 3300027907 Bacteria 16830
1031 Ga0207428_10009456 3300027907 Bacteria 8734
1032 Ga0207428_10013459 3300027907 Bacteria 7148
1033 Ga0207428_10013656 3300027907 Bacteria 7085
1034 Ga0207428_10021513 3300027907 Bacteria 5461
1035 Ga0207428_10031142 3300027907 Bacteria 4406
1036 Ga0207428_10032046 3300027907 Bacteria 4328
1037 Ga0207428_10033622 3300027907 Bacteria 4209
1038 Ga0207428_10060665 3300027907 Bacteria 2996
1039 Ga0207428_10062242 3300027907 Bacteria 2952
1040 Ga0207428_10168473 3300027907 Bacteria 1660
1041 Ga0207428_10182925 3300027907 Bacteria 1583
1042 Ga0268266_10038090 3300028379 Bacteria 4094
1043 Ga0268266_10070638 3300028379 Bacteria 3026
1044 Ga0268266_10099371 3300028379 Bacteria 2562
1045 Ga0268266_10153554 3300028379 Bacteria 2078
1046 Ga0268265_10002703 3300028380 Bacteria 13127
1047 Ga0268265_10005753 3300028380 Bacteria 8464
1048 Ga0268265_10007329 3300028380 Bacteria 7447
1049 Ga0268265_10008079 3300028380 Bacteria 7110
1050 Ga0268265_10021740 3300028380 Bacteria 4498
1051 Ga0268265_10094226 3300028380 Bacteria 2401
1052 Ga0268265_10101090 3300028380 Unclassified 2329
1053 Ga0268265_10215761 3300028380 Bacteria 1675
1054 Ga0268265_10221770 3300028380 Bacteria 1655
1055 Ga0268265_10222689 3300028380 Bacteria 1652
1056 Ga0268265_10389671 3300028380 Bacteria 1284
1057 Ga0268264_10001062 3300028381 Bacteria 27268
1058 Ga0268264_10009891 3300028381 Bacteria 7895
1059 Ga0268264_10020811 3300028381 Bacteria 5360
1060 Ga0268264_10029034 3300028381 Bacteria 4529
1061 Ga0268264_10054024 3300028381 Bacteria 3353
1062 Ga0268264_10071894 3300028381 Bacteria 2932
1063 Ga0268264_10109139 3300028381 Bacteria 2420
1064 Ga0307408_100008918 3300031548 Bacteria 6627
1065 Ga0307408_100019678 3300031548 Bacteria 4548
1066 Ga0307408_100042257 3300031548 Bacteria 3237
1067 Ga0307408_100047915 3300031548 Bacteria 3063
1068 Ga0307408_100079104 3300031548 Bacteria 2452
1069 Ga0307405_10003661 3300031731 Bacteria 7120
1070 Ga0307405_10004553 3300031731 Bacteria 6569
1071 Ga0316577_10117317 3300031733 Bacteria 1495
1072 Ga0316577_10170230 3300031733 Bacteria 1229
1073 Ga0307413_10001364 3300031824 Bacteria 9163
1074 Ga0307413_10009818 3300031824 Bacteria 4604
1075 Ga0307410_10000918 3300031852 Bacteria 12579
1076 Ga0307410_10011385 3300031852 Bacteria 5084
1077 Ga0307410_10041939 3300031852 Bacteria 3021
1078 Ga0307406_10013139 3300031901 Bacteria 4736
1079 Ga0307407_10000966 3300031903 Bacteria 9805
1080 Ga0307407_10021060 3300031903 Bacteria 3354
1081 Ga0307407_10052523 3300031903 Bacteria 2341
1082 Ga0307407_10118295 3300031903 Bacteria 1675
1083 Ga0307412_10004388 3300031911 Bacteria 7864
1084 Ga0307412_10060765 3300031911 Bacteria 2537
1085 Ga0307409_100006265 3300031995 Bacteria 6968
1086 Ga0307409_100006759 3300031995 Bacteria 6783
1087 Ga0307409_100078548 3300031995 Bacteria 2655
1088 Ga0307409_100236665 3300031995 Bacteria 1659
1089 Ga0307416_100046423 3300032002 Bacteria 3427
1090 Ga0307416_100078292 3300032002 Bacteria 2781
1091 Ga0307416_100080524 3300032002 Bacteria 2749
1092 Ga0307416_100205943 3300032002 Bacteria 1871
1093 Ga0307416_100216821 3300032002 Bacteria 1831
1094 Ga0307416_100271163 3300032002 Bacteria 1666
1095 Ga0307416_100397373 3300032002 Bacteria 1415
1096 Ga0307414_10013912 3300032004 Bacteria 4804
1097 Ga0307414_10025934 3300032004 Bacteria 3764
1098 Ga0307414_10049217 3300032004 Bacteria 2913
1099 Ga0307414_10071076 3300032004 Bacteria 2509
1100 Ga0307411_10058044 3300032005 Bacteria 2559
1101 Ga0307411_10096522 3300032005 Bacteria 2078
1102 Ga0307411_10125445 3300032005 Unclassified 1866
1103 Ga0307415_100004186 3300032126 Bacteria 7451
1104 Ga0307415_100010404 3300032126 Bacteria 5269
1105 Ga0316587_1003502 3300033529 Bacteria 2207
1106 Ga0373930_0000775 3300034816 Bacteria 4549
1107 Ga0373948_0001027 3300034817 Bacteria 3757
1108 Ga0373958_0001519 3300034819 Bacteria 3125
1109 Ga0373959_0006781 3300034820 Bacteria 1911
1110 Ga0373938_0018933 3300034957 Bacteria 1372
1111 Ga0373928_0006499 3300035084 Bacteria 2247
1112 Ga0373929_0000268 3300035085 Bacteria 9647
1113 Ga0373940_0000626 3300035088 Bacteria 5648
1114 Ga0373944_0005029 3300035089 Bacteria 3469
1115 Ga0373949_0000608 3300035090 Bacteria 11690
1116 Ga0373949_0005486 3300035090 Bacteria 2828
1117 Ga0373951_0001375 3300035091 Bacteria 6381
1118 Ga0373952_0009610 3300035092 Bacteria 1856
1119 Ga0373932_0000945 3300035112 Bacteria 8512
1120 Ga0373939_0000488 3300035114 Bacteria 10011
1121 Ga0373941_0011507 3300035115 Bacteria 2287
1122 Ga0373960_0005000 3300035121 Bacteria 3055
1123 Ga0373960_0036588 3300035121 Bacteria 1399
1124 Ga0373943_0028224 3300035170 Bacteria 2643
1125 Ga0373943_0038890 3300035170 Bacteria 2289
1126 Ga0373955_0033643 3300035172 Bacteria 2701
1127 Ga0373942_0003222 3300035207 Bacteria 3856
1128 Ga0373961_0001097 3300035241 Bacteria 8607
1129 Ga0373961_0007485 3300035241 Bacteria 2642
1130 Ga0373962_0000586 3300035242 Bacteria 8220
1131 Ga0316574_0012892 3300035398 Bacteria 4793
1132 Ga0373924_0047434 3300035410 Unclassified 1772
1133 Ga0373931_0000769 3300035691 Bacteria 13414
1134 Ga0373935_0144190 3300035692 Unclassified 1611
1135 Ga0373935_0255684 3300035692 Bacteria 1227
1136 Ga0373927_0036513 3300035695 Bacteria 3196
1137 Ga0373927_0038090 3300035695 Bacteria 3123
1138 Ga0373947_0004193 3300035725 Bacteria 8460
1139 Ga0373947_0039146 3300035725 Bacteria 2820
1140 Ga0373947_0129290 3300035725 Bacteria 1611
1141 Ga0373937_0020639 3300036401 Bacteria 5907
1142 Ga0373937_0051591 3300036401 Bacteria 3770
1143 Ga0373937_0058578 3300036401 Bacteria 3539
1144 Ga0373937_0064766 3300036401 Unclassified 3363
1145 Ga0373937_0066157 3300036401 Bacteria 3328
1146 Ga0373937_0068548 3300036401 Bacteria 3271
1147 Ga0373937_0116794 3300036401 Unclassified 2485
1148 Ga0373937_0146971 3300036401 Unclassified 2207
1149 Ga0373937_0182645 3300036401 Bacteria 1970
1150 Ga0373937_0193978 3300036401 Unclassified 1909
1151 Ga0316584_0046028 3300036712 Bacteria 3258
1152 Ga0395905_0398674 3300037471 Bacteria 1271
1153 Ga0436365_0924777 3300039437 Bacteria 1479
1154 Ga0436365_1831975 3300039437 Bacteria 4820
1155 Ga0439433_0008725 3300041999 Unclassified 2202
1156 Ga0439433_0019308 3300041999 Bacteria 1518
1157 Ga0439433_0019930 3300041999 Bacteria 1496
1158 Ga0439450_003067 3300042008 Bacteria 2718
1159 Ga0450923_003478 3300042125 Bacteria 2383
1160 Ga0450898_012910 3300042134 Bacteria 1386
1161 Ga0439446_0035851 3300042156 Bacteria 1448
1162 Ga0450908_000692 3300042184 Bacteria 6459
1163 Ga0450908_003896 3300042184 Bacteria 2888
1164 Ga0439435_0031125 3300042436 Bacteria 1449
1165 Ga0450916_008483 3300042530 Bacteria 1251
1166 Ga0450918_006749 3300042531 Bacteria 2044
1167 Ga0451577_0000040 3300042876 Bacteria 346755
1168 Ga0451577_0494267 3300042876 Bacteria 1111
1169 Ga0439440_0024281 3300042993 Bacteria 1389
1170 Ga0453683_0000220 3300044673 Bacteria 76196
1171 Ga0453683_0043866 3300044673 Unclassified 2806
1172 Ga0453683_0069843 3300044673 Bacteria 2196
1173 Ga0453683_0207936 3300044673 Bacteria 1243
1174 Ga0453684_0000179 3300044712 Bacteria 280195
1175 Ga0453684_0030372 3300044712 Bacteria 7635
1176 Ga0453684_0366512 3300044712 Unclassified 1621
1177 Ga0451576_0012703 3300045051 Bacteria 9454
1178 Ga0451576_0045741 3300045051 Bacteria 4608
1179 Ga0451576_0069955 3300045051 Bacteria 3653
1180 Ga0451576_0072179 3300045051 Bacteria 3593
1181 Ga0451576_0140999 3300045051 Bacteria 2513
1182 Ga0451576_0171343 3300045051 Bacteria 2266
1183 Ga0495592_0063787 3300046454 Bacteria 2702
1184 Ga0495603_0060981 3300046455 Unclassified 2228
1185 Ga0495603_0141811 3300046455 Unclassified 1397
1186 Ga0495603_0171042 3300046455 Unclassified 1258
1187 Ga0495629_0030839 3300046459 Bacteria 3798
1188 Ga0495629_0209636 3300046459 Unclassified 1346
1189 Ga0495638_0022261 3300046460 Bacteria 4161
1190 Ga0495580_0058232 3300046472 Bacteria 2718
1191 Ga0495580_0157645 3300046472 Bacteria 1572
1192 Ga0495582_0209601 3300046473 Unclassified 1114
1193 Ga0495639_0013753 3300046475 Bacteria 3500
1194 Ga0495662_0089897 3300046476 Bacteria 1497
1195 Ga0495584_0040964 3300046491 Bacteria 2338
1196 Ga0495594_0015783 3300046499 Bacteria 3972
1197 Ga0495594_0134153 3300046499 Bacteria 1403
1198 Ga0495608_0004917 3300046511 Bacteria 9573
1199 Ga0495608_0012120 3300046511 Bacteria 5994
1200 Ga0495608_0202720 3300046511 Unclassified 1249
1201 Ga0495628_0029181 3300046516 Bacteria 4475
1202 Ga0495628_0296934 3300046516 Unclassified 1197
1203 Ga0495643_0003264 3300046522 Bacteria 12001
1204 Ga0495644_0057181 3300046523 Bacteria 1466
1205 Ga0495642_0027332 3300046528 Bacteria 2270
1206 Ga0495665_0026207 3300046531 Bacteria 3132
1207 Ga0495587_0011763 3300046536 Bacteria 5534
1208 Ga0495587_0049996 3300046536 Unclassified 2474
1209 Ga0495598_0009860 3300046537 Bacteria 2271
1210 Ga0495598_0012154 3300046537 Unclassified 2105
1211 Ga0495609_0032513 3300046538 Bacteria 2369
1212 Ga0495609_0042275 3300046538 Bacteria 2047
1213 Ga0495621_0001834 3300046539 Bacteria 5592
1214 Ga0495621_0019061 3300046539 Bacteria 2236
1215 Ga0495621_0074697 3300046539 Bacteria 1254
1216 Ga0495633_0055196 3300046558 Bacteria 1868
1217 Ga0495667_0003890 3300046559 Bacteria 10022
1218 Ga0495667_0042802 3300046559 Unclassified 3003
1219 Ga0495667_0091317 3300046559 Bacteria 1972
1220 Ga0495667_0168173 3300046559 Bacteria 1409
1221 Ga0495635_0205267 3300046663 Unclassified 1336
1222 Ga0495659_0006070 3300046664 Bacteria 3819
1223 Ga0495659_0008454 3300046664 Bacteria 3276
1224 Ga0495659_0027674 3300046664 Bacteria 1957
1225 Ga0495659_0066133 3300046664 Bacteria 1346
1226 Ga0495657_0002051 3300046675 Bacteria 17166
1227 Ga0495599_0015176 3300046678 Bacteria 4778
1228 Ga0495647_0019200 3300046681 Bacteria 2443
1229 Ga0495658_0141011 3300046683 Bacteria 1474
1230 Ga0495658_0177631 3300046683 Bacteria 1320
1231 Ga0495658_0178636 3300046683 Bacteria 1316
1232 Ga0495669_0005426 3300046684 Bacteria 5321
1233 Ga0495669_0021180 3300046684 Bacteria 2819
1234 Ga0495669_0031742 3300046684 Unclassified 2320
1235 Ga0495669_0049843 3300046684 Bacteria 1876
1236 Ga0495613_0005402 3300046689 Bacteria 9599
1237 Ga0495613_0012840 3300046689 Bacteria 6227
1238 Ga0495613_0049241 3300046689 Bacteria 3110
1239 Ga0495613_0157733 3300046689 Bacteria 1616
1240 Ga0495670_0054184 3300046691 Bacteria 2009
1241 Ga0495604_0087870 3300047317 Unclassified 2314
1242 Ga0495636_0026059 3300047318 Bacteria 2376
1243 Ga0495636_0029152 3300047318 Bacteria 2252
1244 Ga0495674_0008427 3300047319 Bacteria 9821
1245 Ga0495674_0055916 3300047319 Bacteria 3459
1246 Ga0495674_0121132 3300047319 Bacteria 2210
1247 Ga0495674_0163557 3300047319 Bacteria 1861
1248 Ga0495674_0264675 3300047319 Unclassified 1412
1249 Ga0495684_0000698 3300047471 Bacteria 26972
1250 Ga0495684_0183265 3300047471 Bacteria 1551
1251 Ga0496100_0004497 3300048903 Bacteria 7399
1252 Ga0496101_0000222 3300048904 Bacteria 42490
1253 Ga0496104_0026075 3300048907 Bacteria 5392
1254 Ga0496105_0030097 3300048908 Bacteria 4448
1255 Ga0496106_0169703 3300048909 Bacteria 1729
1256 Ga0496108_0202651 3300048911 Bacteria 1722
1257 Ga0496109_0337071 3300048912 Bacteria 1424
1258 Ga0496110_0061102 3300048913 Bacteria 3325
1259 Ga0496110_0067484 3300048913 Bacteria 3165
1260 Ga0496112_0058309 3300048915 Bacteria 3802
1261 Ga0496112_0060942 3300048915 Bacteria 3718
1262 Ga0496112_0163152 3300048915 Bacteria 2194
1263 Ga0496112_0240509 3300048915 Bacteria 1763
1264 Ga0496112_0279115 3300048915 Bacteria 1618
1265 Ga0496113_0024540 3300048916 Bacteria 4287
1266 Ga0496113_0024552 3300048916 Bacteria 4286
1267 Ga0496113_0243315 3300048916 Bacteria 1436
1268 Ga0496114_0000409 3300048917 Bacteria 31807
1269 Ga0496114_0287336 3300048917 Unclassified 1451
1270 Ga0501291_011831 3300049514 Bacteria 1265
1271 Ga0501298_014197 3300049521 Bacteria 1420
1272 Ga0501031_0053819 3300049568 Bacteria 2623
1273 Ga0501034_0084522 3300049571 Bacteria 3175
1274 Ga0501034_0191212 3300049571 Bacteria 2009
1275 Ga0501036_0119896 3300049572 Bacteria 2222
1276 Ga0501038_0042470 3300049574 Bacteria 3960
1277 Ga0501038_0045056 3300049574 Bacteria 3830
1278 Ga0501038_0342471 3300049574 Bacteria 1166
1279 Ga0501039_0374744 3300049575 Bacteria 1118
1280 Ga0501040_0012756 3300049576 Bacteria 5516
1281 Ga0501040_0082363 3300049576 Bacteria 2231
1282 Ga0501040_0116681 3300049576 Bacteria 1870
1283 Ga0501040_0149926 3300049576 Bacteria 1645
1284 Ga0501041_0002542 3300049577 Bacteria 10396
1285 Ga0501041_0017442 3300049577 Bacteria 4272
1286 Ga0501041_0045204 3300049577 Bacteria 2676
1287 Ga0501041_0083959 3300049577 Bacteria 1963
1288 Ga0501041_0116611 3300049577 Bacteria 1658
1289 Ga0501042_0005735 3300049578 Bacteria 8020
1290 Ga0501042_0017095 3300049578 Bacteria 4997
1291 Ga0501042_0112352 3300049578 Bacteria 1962
1292 Ga0501042_0131518 3300049578 Bacteria 1804
1293 Ga0501046_0045279 3300049580 Bacteria 3496
1294 Ga0501046_0124415 3300049580 Unclassified 1960
1295 Ga0501046_0169542 3300049580 Bacteria 1639
1296 Ga0501046_0230637 3300049580 Bacteria 1368
1297 Ga0501047_0148538 3300049581 Unclassified 2220
1298 Ga0501048_0082570 3300049582 Bacteria 2267
1299 Ga0501067_0043736 3300049583 Bacteria 2488
1300 Ga0501068_0150636 3300049584 Bacteria 1462
1301 Ga0501071_0074461 3300049587 Bacteria 2478
1302 Ga0501071_0083597 3300049587 Unclassified 2339
1303 Ga0501071_0106004 3300049587 Bacteria 2075
1304 Ga0501071_0118991 3300049587 Bacteria 1957
1305 Ga0501071_0284061 3300049587 Bacteria 1252
1306 Ga0501072_0003814 3300049588 Bacteria 11378
1307 Ga0501073_0001250 3300049589 Bacteria 18592
1308 Ga0501073_0211531 3300049589 Bacteria 1340
1309 Ga0501074_0057222 3300049590 Bacteria 2809
1310 Ga0501074_0098164 3300049590 Unclassified 2097
1311 Ga0501075_0063929 3300049591 Bacteria 2775
1312 Ga0501075_0068315 3300049591 Bacteria 2684
1313 Ga0501075_0086533 3300049591 Bacteria 2375
1314 Ga0501075_0096978 3300049591 Bacteria 2237
1315 Ga0501075_0179369 3300049591 Bacteria 1616
1316 Ga0501075_0192164 3300049591 Bacteria 1557
1317 Ga0501075_0310910 3300049591 Bacteria 1201
1318 Ga0501076_0003582 3300049592 Bacteria 10907
1319 Ga0501076_0004842 3300049592 Bacteria 9611
1320 Ga0501076_0010721 3300049592 Bacteria 6812
1321 Ga0501076_0023194 3300049592 Bacteria 4781
1322 Ga0501076_0024714 3300049592 Bacteria 4645
1323 Ga0501076_0056749 3300049592 Unclassified 3108
1324 Ga0501076_0165206 3300049592 Bacteria 1804
1325 Ga0501076_0167920 3300049592 Unclassified 1788
1326 Ga0501076_0181561 3300049592 Bacteria 1716
1327 Ga0501076_0214204 3300049592 Unclassified 1574
1328 Ga0501076_0272221 3300049592 Bacteria 1387
1329 Ga0501216_013790 3300049660 Bacteria 1345
1330 Ga0501217_001064 3300049661 Bacteria 4996
1331 Ga0501233_024582 3300049668 Bacteria 1319
1332 Ga0501235_004372 3300049669 Bacteria 3058
1333 Ga0501079_0001657 3300049741 Bacteria 15851
1334 Ga0501079_0021145 3300049741 Bacteria 4975
1335 Ga0501080_0118547 3300049742 Unclassified 2454
1336 Ga0501080_0170389 3300049742 Bacteria 2008
1337 Ga0501081_0006494 3300049743 Bacteria 7595
1338 Ga0501081_0011708 3300049743 Bacteria 5741
1339 Ga0501083_0168039 3300049744 Bacteria 1434
1340 Ga0501035_0156536 3300049822 Bacteria 1975
1341 Ga0501045_0022578 3300049824 Bacteria 4506
1342 Ga0501045_0049676 3300049824 Unclassified 3059
1343 Ga0501045_0049693 3300049824 Bacteria 3058
1344 Ga0501045_0166023 3300049824 Bacteria 1644
1345 nmdc:mga03683_4502_c1 3300050489 Bacteria 4229
1346 nmdc:mga00v17_1598_c1 3300050491 Bacteria 11830
1347 nmdc:mga00v17_21804_c1 3300050491 Bacteria 3048
1348 nmdc:mga0yw44_49336_c1 3300050492 Bacteria 2540
1349 nmdc:mga0yw44_717_c1 3300050492 Bacteria 12158
1350 nmdc:mga0k408_6274_c1 3300050493 Bacteria 6342
1351 nmdc:mga06z11_8028_c1 3300050494 Bacteria 4376
1352 nmdc:mga05p37_1036_c1 3300050507 Bacteria 31681
1353 nmdc:mga05p37_109852_c1 3300050507 Bacteria 3392
1354 nmdc:mga05p37_115391_c1 3300050507 Bacteria 3301
1355 nmdc:mga05p37_116790_c1 3300050507 Bacteria 3279
1356 nmdc:mga05p37_12059_c1 3300050507 Bacteria 10315
1357 nmdc:mga05p37_13371_c1 3300050507 Bacteria 9835
1358 nmdc:mga05p37_13677_c1 3300050507 Bacteria 9725
1359 nmdc:mga05p37_13826_c1 3300050507 Bacteria 9670
1360 nmdc:mga05p37_1467_c1 3300050507 Bacteria 21512
1361 nmdc:mga05p37_1640_c1 3300050507 Bacteria 25964
1362 nmdc:mga05p37_17849_c1 3300050507 Bacteria 8565
1363 nmdc:mga05p37_181392_c1 3300050507 Bacteria 2561
1364 nmdc:mga05p37_2052_c1 3300050507 Bacteria 23470
1365 nmdc:mga05p37_214844_c1 3300050507 Bacteria 2323
1366 nmdc:mga05p37_229303_c1 3300050507 Bacteria 2238
1367 nmdc:mga05p37_308679_c1 3300050507 Bacteria 1876
1368 nmdc:mga05p37_45707_c1 3300050507 Bacteria 5384
1369 nmdc:mga05p37_48474_c1 3300050507 Bacteria 5224
1370 nmdc:mga05p37_515301_c1 3300050507 Bacteria 1369
1371 nmdc:mga05p37_51628_c1 3300050507 Bacteria 5056
1372 nmdc:mga05p37_56869_c1 3300050507 Bacteria 4817
1373 nmdc:mga05p37_58091_c1 3300050507 Bacteria 4764
1374 nmdc:mga05p37_59229_c1 3300050507 Bacteria 4716
1375 nmdc:mga05p37_65672_c1 3300050507 Bacteria 4464
1376 nmdc:mga05p37_764_c1 3300050507 Bacteria 35766
1377 nmdc:mga05p37_78598_c1 3300050507 Bacteria 4063
1378 nmdc:mga05p37_84604_c1 3300050507 Bacteria 3908
1379 nmdc:mga09592_108378_c1 3300050508 Bacteria 2382
1380 nmdc:mga09592_114006_c1 3300050508 Bacteria 2320
1381 nmdc:mga09592_14369_c1 3300050508 Bacteria 6463
1382 nmdc:mga09592_162581_c1 3300050508 Bacteria 1929
1383 nmdc:mga09592_16597_c1 3300050508 Bacteria 6026
1384 nmdc:mga09592_1746_c1 3300050508 Bacteria 17461
1385 nmdc:mga09592_324389_c1 3300050508 Bacteria 1334
1386 nmdc:mga09592_341077_c1 3300050508 Bacteria 1297
1387 nmdc:mga09592_446496_c1 3300050508 Bacteria 1116
1388 nmdc:mga09592_46379_c1 3300050508 Bacteria 3661
1389 nmdc:mga09592_50704_c1 3300050508 Bacteria 2488
1390 nmdc:mga09592_81041_c1 3300050508 Unclassified 2765
1391 nmdc:mga09592_86481_c1 3300050508 Bacteria 2675
1392 nmdc:mga09592_97011_c1 3300050508 Unclassified 2522
1393 nmdc:mga09592_9883_c1 3300050508 Bacteria 7759
1394 nmdc:mga0qj67_130297_c1 3300050509 Bacteria 2037
1395 nmdc:mga0qj67_1398_c1 3300050509 Bacteria 16934
1396 nmdc:mga0qj67_174540_c1 3300050509 Unclassified 1745
1397 nmdc:mga0qj67_299363_c1 3300050509 Bacteria 1303
1398 nmdc:mga0qj67_536_c1 3300050509 Bacteria 25813
1399 nmdc:mga0qj67_71049_c1 3300050509 Bacteria 2778
1400 nmdc:mga0qj67_8668_c1 3300050509 Bacteria 7549
1401 nmdc:mga0qj67_8727_c1 3300050509 Bacteria 7529
1402 nmdc:mga06r32_129030_c1 3300050510 Bacteria 2498
1403 nmdc:mga06r32_1394_c1 3300050510 Bacteria 21834
1404 nmdc:mga06r32_207042_c1 3300050510 Bacteria 1950
1405 nmdc:mga06r32_249444_c1 3300050510 Bacteria 1763
1406 nmdc:mga06r32_271906_c1 3300050510 Bacteria 1682
1407 nmdc:mga06r32_424475_c1 3300050510 Bacteria 1311
1408 nmdc:mga06r32_494694_c1 3300050510 Bacteria 1200
1409 nmdc:mga06r32_54379_c1 3300050510 Bacteria 3839
1410 nmdc:mga06r32_77410_c1 3300050510 Bacteria 3231
1411 nmdc:mga06r32_93539_c1 3300050510 Bacteria 2940
1412 nmdc:mga08y16_10084_c1 3300050511 Bacteria 9918
1413 nmdc:mga08y16_100886_c1 3300050511 Bacteria 3005
1414 nmdc:mga08y16_11913_c1 3300050511 Bacteria 9135
1415 nmdc:mga08y16_129093_c1 3300050511 Bacteria 2629
1416 nmdc:mga08y16_174442_c1 3300050511 Bacteria 2232
1417 nmdc:mga08y16_176906_c1 3300050511 Bacteria 2216
1418 nmdc:mga08y16_1826_c1 3300050511 Bacteria 21596
1419 nmdc:mga08y16_20782_c1 3300050511 Bacteria 6929
1420 nmdc:mga08y16_215108_c1 3300050511 Bacteria 1990
1421 nmdc:mga08y16_219875_c1 3300050511 Bacteria 1967
1422 nmdc:mga08y16_224855_c1 3300050511 Bacteria 1942
1423 nmdc:mga08y16_2262_c1 3300050511 Bacteria 19741
1424 nmdc:mga08y16_2313_c1 3300050511 Bacteria 19509
1425 nmdc:mga08y16_24146_c1 3300050511 Bacteria 6419
1426 nmdc:mga08y16_33474_c1 3300050511 Bacteria 5397
1427 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
1428 nmdc:mga08y16_51089_c1 3300050511 Bacteria 4325
1429 nmdc:mga08y16_516816_c1 3300050511 Bacteria 1211
1430 nmdc:mga08y16_7076_c1 3300050511 Bacteria 11776
1431 nmdc:mga08y16_842_c1 3300050511 Bacteria 29430
1432 nmdc:mga08y16_87022_c1 3300050511 Bacteria 3256
1433 nmdc:mga08y16_9481_c1 3300050511 Bacteria 10218
1434 nmdc:mga08y16_9550_c1 3300050511 Bacteria 10181
1435 nmdc:mga08y16_9590_c1 3300050511 Bacteria 10164
1436 nmdc:mga0n895_11531_c1 3300050512 Bacteria 7892
1437 nmdc:mga0n895_12860_c1 3300050512 Bacteria 7521
1438 nmdc:mga0n895_130_c1 3300050512 Bacteria 44769
1439 nmdc:mga0n895_13319_c1 3300050512 Bacteria 7415
1440 nmdc:mga0n895_160037_c1 3300050512 Bacteria 2283
1441 nmdc:mga0n895_1701_c1 3300050512 Bacteria 16622
1442 nmdc:mga0n895_246673_c1 3300050512 Bacteria 1812
1443 nmdc:mga0n895_255173_c1 3300050512 Unclassified 1779
1444 nmdc:mga0n895_255434_c1 3300050512 Bacteria 1778
1445 nmdc:mga0n895_28636_c1 3300050512 Bacteria 5301
1446 nmdc:mga0n895_330417_c1 3300050512 Bacteria 1545
1447 nmdc:mga0n895_341389_c1 3300050512 Unclassified 1517
1448 nmdc:mga0n895_379784_c1 3300050512 Unclassified 1430
1449 nmdc:mga0n895_5254_c1 3300050512 Bacteria 10788
1450 nmdc:mga0n895_5693_c1 3300050512 Bacteria 10448
1451 nmdc:mga0n895_57722_c1 3300050512 Bacteria 3827
1452 nmdc:mga0n895_91467_c1 3300050512 Bacteria 3045
1453 nmdc:mga0rr50_102882_c1 3300050513 Bacteria 2247
1454 nmdc:mga0rr50_131147_c1 3300050513 Bacteria 2007
1455 nmdc:mga0rr50_213981_c1 3300050513 Bacteria 1589
1456 nmdc:mga0rr50_30066_c1 3300050513 Bacteria 3841
1457 nmdc:mga0rr50_4139_c1 3300050513 Bacteria 8122
1458 nmdc:mga0rr50_43177_c1 3300050513 Bacteria 3297
1459 nmdc:mga0rr50_43673_c1 3300050513 Unclassified 3282
1460 nmdc:mga0rr50_47417_c1 3300050513 Unclassified 3169
1461 nmdc:mga0rr50_504_c1 3300050513 Bacteria 20788
1462 nmdc:mga0rr50_58980_c1 3300050513 Bacteria 2879
1463 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
1464 nmdc:mga0rr50_88542_c1 3300050513 Bacteria 2405
1465 nmdc:mga08x19_15408_c1 3300050514 Bacteria 4652
1466 nmdc:mga08x19_270_c1 3300050514 Bacteria 39380
1467 nmdc:mga08x19_27840_c1 3300050514 Bacteria 3537
1468 nmdc:mga08x19_34033_c1 3300050514 Bacteria 3218
1469 nmdc:mga08x19_45_c1 3300050514 Bacteria 147507
1470 nmdc:mga08x19_48475_c1 3300050514 Unclassified 2722
1471 nmdc:mga08x19_83627_c1 3300050514 Bacteria 2099
1472 nmdc:mga0a205_107329_c1 3300050515 Bacteria 2690
1473 nmdc:mga0a205_111326_c1 3300050515 Bacteria 2637
1474 nmdc:mga0a205_129435_c1 3300050515 Bacteria 2425
1475 nmdc:mga0a205_141381_c1 3300050515 Unclassified 2307
1476 nmdc:mga0a205_259_c1 3300050515 Bacteria 38100
1477 nmdc:mga0a205_28936_c1 3300050515 Bacteria 5299
1478 nmdc:mga0a205_344671_c1 3300050515 Bacteria 1358
1479 nmdc:mga0a205_34649_c1 3300050515 Unclassified 4844
1480 nmdc:mga0a205_3512_c1 3300050515 Bacteria 14003
1481 nmdc:mga0a205_434239_c1 3300050515 Bacteria 1174
1482 nmdc:mga0a205_44276_c1 3300050515 Bacteria 4289
1483 nmdc:mga0a205_50629_c1 3300050515 Bacteria 4010
1484 nmdc:mga0a205_5180_c2 3300050515 Bacteria 9138
1485 nmdc:mga0a205_55199_c1 3300050515 Bacteria 3837
1486 nmdc:mga0a205_68469_c1 3300050515 Unclassified 3428
1487 nmdc:mga0a205_7012_c1 3300050515 Bacteria 10175
1488 nmdc:mga0a205_84731_c1 3300050515 Bacteria 3062
1489 nmdc:mga0a205_88392_c1 3300050515 Bacteria 2995
1490 nmdc:mga0a205_98442_c1 3300050515 Bacteria 2823
1491 Ga0495601_0017272 3300053077 Bacteria 4378
1492 Ga0495595_0052602 3300053084 Unclassified 1890
1493 Ga0495619_0053335 3300053085 Bacteria 2675
1494 Ga0495619_0054318 3300053085 Unclassified 2651
1495 Ga0501084_0005832 3300054114 Bacteria 10138
1496 Ga0501084_0038583 3300054114 Bacteria 3992
1497 Ga0501084_0057774 3300054114 Bacteria 3246
1498 Ga0501084_0174510 3300054114 Bacteria 1814
1499 Ga0501084_0273534 3300054114 Bacteria 1426
1500 Ga0590071_000041 3300059421 Bacteria 32697
1501 Ga0590071_000580 3300059421 Bacteria 10531
1502 Ga0590071_000846 3300059421 Bacteria 8524
1503 Ga0590071_024460 3300059421 Bacteria 1431
1504 Ga0590074_000103 3300059423 Bacteria 9537
1505 Ga0590074_000776 3300059423 Bacteria 4895
1506 Ga0590074_005338 3300059423 Bacteria 2126
1507 Ga0590075_000191 3300059424 Bacteria 17028
1508 Ga0590075_000438 3300059424 Bacteria 11305
1509 Ga0590075_000837 3300059424 Bacteria 8088
1510 Ga0590077_000066 3300059426 Bacteria 26485
1511 Ga0590077_000903 3300059426 Bacteria 7581
1512 Ga0501082_0003745 3300060353 Bacteria 13293
1513 Ga0501082_0026861 3300060353 Unclassified 4960
1514 Ga0501082_0032878 3300060353 Bacteria 4474
1515 Ga0501082_0106801 3300060353 Bacteria 2422
1516 Ga0501082_0184949 3300060353 Unclassified 1813
1517 Ga0501082_0220257 3300060353 Bacteria 1651
1518 Ga0530510_0020879 3300061734 Bacteria 4658
1519 Ga0530510_0036737 3300061734 Bacteria 3530
1520 Ga0530510_0040980 3300061734 Bacteria 3344
1521 Ga0530510_0047956 3300061734 Bacteria 3087
1522 Ga0530510_0176097 3300061734 Bacteria 1585
1523 Ga0530510_0279981 3300061734 Bacteria 1246
1524 Ga0501073_0193355
1525 SwRhRL2b_contig_193209
1526 MRS1b_contig_6947448
1527 JGI24746J21847_1003627
1528 JGI24737J22298_10047772
1529 JGI24749J21850_1011257
1530 JGI25406J46586_10000155
1531 JGI25406J46586_10003711
1532 Ga0065704_10002309
1533 Ga0065704_10010788
1534 Ga0065712_10006208
1535 Ga0065712_10010362
1536 Ga0065712_10012446
1537 Ga0065712_10016937
1538 Ga0065712_10069441
1539 Ga0065712_10074209
1540 Ga0065712_10077879
1541 Ga0065712_10099325
1542 Ga0065712_10116983
1543 Ga0065715_10005999
1544 Ga0065715_10007986
1545 Ga0065715_10008080
1546 Ga0065715_10015065
1547 Ga0065715_10091808
1548 Ga0065715_10132712
1549 Ga0065715_10144071
1550 Ga0065715_10178989
1551 Ga0065707_10002448
1552 Ga0065707_10003514
1553 Ga0065707_10005263
1554 Ga0065707_10006157
1555 Ga0065707_10083745
1556 Ga0065707_10130448
1557 Ga0065707_10148261
1558 Ga0070676_10005855
1559 Ga0070676_10021491
1560 Ga0070676_10090357
1561 Ga0070683_100129838
1562 Ga0070690_100004693
1563 Ga0070690_100006163
1564 Ga0070690_100015483
1565 Ga0070690_100062778
1566 Ga0070690_100076109
1567 Ga0070690_100094736
1568 Ga0070670_100008420
1569 Ga0070670_100010266
1570 Ga0070670_100014108
1571 Ga0070670_100015682
1572 Ga0070670_100018167
1573 Ga0070670_100058120
1574 Ga0070670_100072067
1575 Ga0070670_100111242
1576 Ga0070670_100133045
1577 Ga0070670_100158828
1578 Ga0070677_10023889
1579 Ga0070677_10085602
1580 Ga0068869_100006495
1581 Ga0068869_100033250
1582 Ga0068869_100053890
1583 Ga0070666_10000594
1584 Ga0070666_10003133
1585 Ga0070666_10022370
1586 Ga0070666_10022827
1587 Ga0070666_10035966
1588 Ga0070680_100026646
1589 Ga0070680_100056521
1590 Ga0070680_100081784
1591 Ga0070682_100010957
1592 Ga0070682_100043117
1593 Ga0068868_100001652
1594 Ga0068868_100008288
1595 Ga0068868_100082346
1596 Ga0068868_100117666
1597 Ga0068868_100162378
1598 Ga0068868_100208047
1599 Ga0068868_100273890
1600 Ga0070689_100020129
1601 Ga0070689_100025387
1602 Ga0070689_100030369
1603 Ga0070689_100033737
1604 Ga0070689_100206990
1605 Ga0070689_100218799
1606 Ga0070689_100280197
1607 Ga0070689_100326220
1608 Ga0070691_10001877
1609 Ga0070687_100055741
1610 Ga0070687_100056508
1611 Ga0070687_100093984
1612 Ga0070661_100151041
1613 Ga0070661_100172087
1614 Ga0070661_100267855
1615 Ga0070668_100005185
1616 Ga0070668_100012677
1617 Ga0070668_100104520
1618 Ga0070668_100230213
1619 Ga0070669_100001373
1620 Ga0070669_100002909
1621 Ga0070669_100003544
1622 Ga0070669_100099894
1623 Ga0070669_100103136
1624 Ga0070669_100126680
1625 Ga0070669_100159550
1626 Ga0070669_100218400
1627 Ga0070675_100000055
1628 Ga0070675_100001125
1629 Ga0070675_100001815
1630 Ga0070675_100004904
1631 Ga0070675_100005228
1632 Ga0070675_100007176
1633 Ga0070675_100008120
1634 Ga0070675_100008723
1635 Ga0070675_100028311
1636 Ga0070675_100032755
1637 Ga0070675_100056743
1638 Ga0070675_100079742
1639 Ga0070675_100126603
1640 Ga0070675_100132940
1641 Ga0070675_100196459
1642 Ga0070671_100001376
1643 Ga0070671_100006808
1644 Ga0070671_100007019
1645 Ga0070671_100017513
1646 Ga0070671_100031503
1647 Ga0070671_100035183
1648 Ga0070671_100053795
1649 Ga0070671_100060142
1650 Ga0070671_100184993
1651 Ga0070671_100199068
1652 Ga0070671_100203317
1653 Ga0070674_100001908
1654 Ga0070674_100003104
1655 Ga0070674_100016676
1656 Ga0070674_100030682
1657 Ga0070674_100238700
1658 Ga0070673_100002582
1659 Ga0070673_100004179
1660 Ga0070673_100005345
1661 Ga0070673_100006683
1662 Ga0070673_100014804
1663 Ga0070673_100017518
1664 Ga0070673_100031657
1665 Ga0070673_100044423
1666 Ga0070673_100087043
1667 Ga0070673_100098712
1668 Ga0070673_100141843
1669 Ga0070673_100154404
1670 Ga0070673_100193708
1671 Ga0070673_100217395
1672 Ga0070673_100252506
1673 Ga0070688_100002351
1674 Ga0070688_100003093
1675 Ga0070688_100012388
1676 Ga0070688_100017737
1677 Ga0070688_100075600
1678 Ga0070688_100078876
1679 Ga0070688_100089317
1680 Ga0070688_100176040
1681 Ga0070659_100062552
1682 Ga0070659_100128011
1683 Ga0070659_100158793
1684 Ga0070667_100003359
1685 Ga0070667_100014800
1686 Ga0070667_100077657
1687 Ga0070667_100151598
1688 Ga0070703_10000851
1689 Ga0070703_10006075
1690 Ga0070709_10000753
1691 Ga0070709_10142543
1692 Ga0070714_100004607
1693 Ga0070713_100005838
1694 Ga0070713_100061895
1695 Ga0070701_10003090
1696 Ga0070701_10004454
1697 Ga0070701_10007569
1698 Ga0070701_10010958
1699 Ga0070701_10021735
1700 Ga0070701_10032700
1701 Ga0070701_10151021
1702 Ga0070711_100000003
1703 Ga0070705_100000076
1704 Ga0070705_100000575
1705 Ga0070705_100012488
1706 Ga0070705_100030991
1707 Ga0070705_100040581
1708 Ga0070705_100077870
1709 Ga0070700_100018171
1710 Ga0070700_100019055
1711 Ga0070700_100029712
1712 Ga0070700_100037788
1713 Ga0070700_100039578
1714 Ga0070700_100050950
1715 Ga0070694_100005583
1716 Ga0070694_100010437
1717 Ga0070694_100012167
1718 Ga0070694_100030315
1719 Ga0070694_100034674
1720 Ga0070694_100043116
1721 Ga0070694_100049254
1722 Ga0070694_100056655
1723 Ga0070694_100071850
1724 Ga0070694_100171464
1725 Ga0070708_100000893
1726 Ga0070708_100098065
1727 Ga0070708_100416179
1728 Ga0070663_100050302
1729 Ga0070678_100044789
1730 Ga0070678_100072812
1731 Ga0070678_100089947
1732 Ga0070678_100097879
1733 Ga0070678_100152731
1734 Ga0070662_100012481
1735 Ga0070662_100021620
1736 Ga0070662_100206675
1737 Ga0070662_100213127
1738 Ga0070681_10000489
1739 Ga0070681_10005835
1740 Ga0070681_10061945
1741 Ga0068867_100000885
1742 Ga0068867_100004327
1743 Ga0068867_100010559
1744 Ga0068867_100066200
1745 Ga0068867_100125524
1746 Ga0068867_100302841
1747 Ga0070685_10004241
1748 Ga0070685_10006683
1749 Ga0070685_10016811
1750 Ga0070685_10029597
1751 Ga0070685_10105147
1752 Ga0070706_100015941
1753 Ga0070706_100051861
1754 Ga0070706_100140600
1755 Ga0070706_100250728
1756 Ga0070706_100274666
1757 Ga0070706_100311325
1758 Ga0070706_100315646
1759 Ga0070707_100000057
1760 Ga0070707_100000648
1761 Ga0070707_100007041
1762 Ga0070707_100012400
1763 Ga0070707_100053527
1764 Ga0070707_100151190
1765 Ga0070698_100001357
1766 Ga0070698_100003700
1767 Ga0070698_100006206
1768 Ga0070698_100015602
1769 Ga0070698_100016125
1770 Ga0070698_100092444
1771 Ga0070698_100119268
1772 Ga0070698_100169318
1773 Ga0070698_100334544
1774 Ga0070699_100000008
1775 Ga0070699_100000371
1776 Ga0070699_100005650
1777 Ga0070699_100007586
1778 Ga0070699_100013938
1779 Ga0070699_100106662
1780 Ga0070699_100229196
1781 Ga0070699_100397987
1782 Ga0070679_100000604
1783 Ga0070679_100003780
1784 Ga0070679_100014369
1785 Ga0070679_100027924
1786 Ga0070679_100049695
1787 Ga0070679_100117457
1788 Ga0070679_100411786
1789 Ga0070684_100008567
1790 Ga0070684_100037633
1791 Ga0070684_100065970
1792 Ga0070697_100011788
1793 Ga0070697_100025025
1794 Ga0070697_100054189
1795 Ga0070697_100054511
1796 Ga0068853_100021079
1797 Ga0070672_100000562
1798 Ga0070672_100003923
1799 Ga0070672_100020719
1800 Ga0070672_100021515
1801 Ga0070672_100041631
1802 Ga0070686_100000959
1803 Ga0070686_100002283
1804 Ga0070686_100003408
1805 Ga0070686_100063850
1806 Ga0070686_100069370
1807 Ga0070686_100100734
1808 Ga0070695_100000627
1809 Ga0070695_100003525
1810 Ga0070695_100014109
1811 Ga0070695_100017212
1812 Ga0070695_100032836
1813 Ga0070695_100040277
1814 Ga0070696_100003302
1815 Ga0070696_100012559
1816 Ga0070696_100012682
1817 Ga0070696_100017615
1818 Ga0070696_100018825
1819 Ga0070696_100034024
1820 Ga0070696_100039665
1821 Ga0070696_100162184
1822 Ga0070693_100000939
1823 Ga0070693_100008858
1824 Ga0070693_100009613
1825 Ga0070665_100008815
1826 Ga0070665_100028561
1827 Ga0070665_100097984
1828 Ga0070665_100187592
1829 Ga0070704_100007286
1830 Ga0070704_100020854
1831 Ga0070704_100024662
1832 Ga0070704_100025566
1833 Ga0070704_100028213
1834 Ga0070704_100056374
1835 Ga0070704_100079978
1836 Ga0070704_100187802
1837 Ga0068855_100024107
1838 Ga0068855_100163846
1839 Ga0068855_100446007
1840 Ga0070664_100005905
1841 Ga0070664_100011776
1842 Ga0070664_100054873
1843 Ga0070664_100063695
1844 Ga0070664_100074820
1845 Ga0070664_100106812
1846 Ga0070664_100189405
1847 Ga0070664_100228105
1848 Ga0070664_100450410
1849 Ga0068857_100065125
1850 Ga0068857_100083449
1851 Ga0068857_100135944
1852 Ga0068854_100022324
1853 Ga0068854_100048297
1854 Ga0068854_100128056
1855 Ga0068854_100154158
1856 Ga0068854_100348855
1857 Ga0068856_100012203
1858 Ga0070702_100022354
1859 Ga0070702_100024575
1860 Ga0070702_100050642
1861 Ga0070702_100091751
1862 Ga0070702_100091825
1863 Ga0068852_100059883
1864 Ga0068852_100115052
1865 Ga0068859_100011646
1866 Ga0068859_100013973
1867 Ga0068859_100016256
1868 Ga0068859_100018030
1869 Ga0068859_100032365
1870 Ga0068859_100037402
1871 Ga0068859_100058899
1872 Ga0068859_100069229
1873 Ga0068859_100087977
1874 Ga0068859_100096514
1875 Ga0068859_100131733
1876 Ga0068859_100131770
1877 Ga0068859_100229694
1878 Ga0068864_100004431
1879 Ga0068864_100006425
1880 Ga0068864_100007053
1881 Ga0068864_100031425
1882 Ga0068864_100033342
1883 Ga0068864_100061014
1884 Ga0068864_100108487
1885 Ga0068864_100108583
1886 Ga0068864_100189919
1887 Ga0068864_100219206
1888 Ga0068864_100236603
1889 Ga0068864_100342262
1890 Ga0068864_100423339
1891 Ga0068861_100005216
1892 Ga0068861_100023958
1893 Ga0068861_100031678
1894 Ga0068861_100085804
1895 Ga0068861_100176890
1896 Ga0068861_100209582
1897 Ga0068861_100228187
1898 Ga0068861_100271417
1899 Ga0068851_10000602
1900 Ga0068851_10069132
1901 Ga0068870_10008497
1902 Ga0068870_10061924
1903 Ga0068863_100001095
1904 Ga0068863_100006615
1905 Ga0068863_100032909
1906 Ga0068863_100051018
1907 Ga0068863_100129723
1908 Ga0068863_100346431
1909 Ga0068858_100002620
1910 Ga0068858_100016743
1911 Ga0068858_100019742
1912 Ga0068858_100034186
1913 Ga0068858_100038174
1914 Ga0068858_100041782
1915 Ga0068858_100044197
1916 Ga0068858_100102788
1917 Ga0068858_100124262
1918 Ga0068858_100240208
1919 Ga0068858_100520239
1920 Ga0068860_100007521
1921 Ga0068860_100009363
1922 Ga0068860_100021507
1923 Ga0068860_100026334
1924 Ga0068860_100053735
1925 Ga0068860_100067149
1926 Ga0068860_100098039
1927 Ga0068860_100129800
1928 Ga0068860_100133263
1929 Ga0068860_100235510
1930 Ga0068860_100294326
1931 Ga0068862_100004280
1932 Ga0068862_100004302
1933 Ga0068862_100015653
1934 Ga0068862_100022682
1935 Ga0068862_100023648
1936 Ga0068862_100031365
1937 Ga0068862_100130731
1938 Ga0068862_100306037
1939 Ga0068862_100324731
1940 Ga0081455_10036346
1941 Ga0081455_10075941
1942 Ga0081538_10106946
1943 Ga0081539_10000090
1944 Ga0081539_10000558
1945 Ga0081539_10001150
1946 Ga0081539_10008913
1947 Ga0081539_10016120
1948 Ga0081539_10052459
1949 Ga0070717_10046294
1950 Ga0075365_10027453
1951 Ga0075368_10001456
1952 Ga0075364_10005240
1953 Ga0075364_10019407
1954 Ga0070716_100173213
1955 Ga0075362_10000334
1956 Ga0075367_10000838
1957 Ga0075367_10079155
1958 Ga0097621_100005469
1959 Ga0097621_100016558
1960 Ga0097621_100017472
1961 Ga0097621_100037128
1962 Ga0097621_100042767
1963 Ga0097621_100069820
1964 Ga0097621_100070007
1965 Ga0097621_100087138
1966 Ga0097621_100108789
1967 Ga0097621_100135803
1968 Ga0097621_100152969
1969 Ga0097621_100163823
1970 Ga0075370_10008931
1971 Ga0068871_100000170
1972 Ga0068871_100005249
1973 Ga0068871_100023487
1974 Ga0068871_100063172
1975 Ga0068871_100077078
1976 Ga0068871_100081886
1977 Ga0068871_100093720
1978 Ga0068871_100151588
1979 Ga0075428_100000003
1980 Ga0075428_100000340
1981 Ga0075428_100003237
1982 Ga0075428_100004033
1983 Ga0075428_100008413
1984 Ga0075428_100014182
1985 Ga0075428_100017395
1986 Ga0075428_100038832
1987 Ga0075428_100067580
1988 Ga0075428_100070610
1989 Ga0075428_100072720
1990 Ga0075428_100090250
1991 Ga0075428_100136860
1992 Ga0075428_100202559
1993 Ga0075428_100539556
1994 Ga0075430_100000379
1995 Ga0075430_100000569
1996 Ga0075430_100002777
1997 Ga0075430_100003418
1998 Ga0075430_100031246
1999 Ga0075430_100126357
2000 Ga0075430_100258668
2001 Ga0075430_100259956
2002 Ga0075430_100264608
2003 Ga0075431_100003313
2004 Ga0075431_100005813
2005 Ga0075431_100007804
2006 Ga0075431_100012561
2007 Ga0075431_100032884
2008 Ga0075431_100041032
2009 Ga0075431_100063209
2010 Ga0075431_100086256
2011 Ga0075431_100140717
2012 Ga0075431_100198981
2013 Ga0075433_10003473
2014 Ga0075433_10012254
2015 Ga0075433_10017123
2016 Ga0075433_10023108
2017 Ga0075433_10032349
2018 Ga0075433_10033737
2019 Ga0075433_10075217
2020 Ga0075433_10079359
2021 Ga0075433_10092176
2022 Ga0075433_10110853
2023 Ga0075433_10145380
2024 Ga0075433_10146520
2025 Ga0075433_10153068
2026 Ga0075433_10177200
2027 Ga0075433_10186892
2028 Ga0075433_10219842
2029 Ga0075433_10479776
2030 Ga0075434_100000096
2031 Ga0075434_100000260
2032 Ga0075434_100001319
2033 Ga0075434_100007147
2034 Ga0075434_100021193
2035 Ga0075434_100030428
2036 Ga0075434_100037300
2037 Ga0075434_100058065
2038 Ga0075434_100075546
2039 Ga0075434_100083779
2040 Ga0075434_100086146
2041 Ga0075434_100090203
2042 Ga0075434_100091266
2043 Ga0075434_100095911
2044 Ga0075434_100111684
2045 Ga0075434_100111941
2046 Ga0075434_100117217
2047 Ga0075434_100142532
2048 Ga0075434_100180670
2049 Ga0075434_100203020
2050 Ga0075434_100344799
2051 Ga0075429_100006960
2052 Ga0075429_100014249
2053 Ga0075429_100015626
2054 Ga0075429_100018543
2055 Ga0075429_100031433
2056 Ga0075429_100034797
2057 Ga0075429_100067470
2058 Ga0075429_100087535
2059 Ga0075429_100104158
2060 Ga0075429_100133683
2061 Ga0075429_100195990
2062 Ga0075429_100289760
2063 Ga0068865_100013019
2064 Ga0068865_100018256
2065 Ga0068865_100062579
2066 Ga0068865_100100704
2067 Ga0068865_100105264
2068 Ga0068865_100192169
2069 Ga0075436_100003261
2070 Ga0075436_100027690
2071 Ga0075436_100055284
2072 Ga0097620_100011646
2073 Ga0097620_100013973
2074 Ga0097620_100016258
2075 Ga0097620_100018031
2076 Ga0097620_100032365
2077 Ga0097620_100037402
2078 Ga0097620_100058901
2079 Ga0097620_100069226
2080 Ga0097620_100087973
2081 Ga0097620_100096516
2082 Ga0097620_100131737
2083 Ga0097620_100131768
2084 Ga0097620_100229683
2085 Ga0075435_100000064
2086 Ga0075435_100002101
2087 Ga0075435_100004297
2088 Ga0075435_100007633
2089 Ga0075435_100009317
2090 Ga0075435_100024492
2091 Ga0075435_100026220
2092 Ga0075435_100058198
2093 Ga0075435_100061240
2094 Ga0075435_100066701
2095 Ga0075435_100142332
2096 Ga0075435_100237614
2097 Ga0099794_10112321
2098 Ga0105240_10037067
2099 Ga0105240_10067650
2100 Ga0105240_10069478
2101 Ga0105240_10082952
2102 Ga0105240_10163631
2103 Ga0105240_10210439
2104 Ga0105240_10371568
2105 Ga0111539_10000001
2106 Ga0111539_10000311
2107 Ga0111539_10000556
2108 Ga0111539_10001060
2109 Ga0111539_10001554
2110 Ga0111539_10002104
2111 Ga0111539_10002176
2112 Ga0111539_10003416
2113 Ga0111539_10005129
2114 Ga0111539_10006746
2115 Ga0111539_10010487
2116 Ga0111539_10012296
2117 Ga0111539_10024926
2118 Ga0111539_10026205
2119 Ga0111539_10045723
2120 Ga0111539_10048103
2121 Ga0111539_10053096
2122 Ga0111539_10053659
2123 Ga0111539_10127632
2124 Ga0111539_10151623
2125 Ga0111539_10169904
2126 Ga0111539_10295298
2127 Ga0111539_10492249
2128 Ga0111539_10520744
2129 Ga0105245_10007999
2130 Ga0105245_10022668
2131 Ga0105245_10440049
2132 Ga0105247_10059079
2133 Ga0105247_10158208
2134 Ga0105247_10164338
2135 Ga0114129_10000063
2136 Ga0114129_10000453
2137 Ga0114129_10001367
2138 Ga0114129_10001428
2139 Ga0114129_10001507
2140 Ga0114129_10006234
2141 Ga0114129_10007288
2142 Ga0114129_10008028
2143 Ga0114129_10012810
2144 Ga0114129_10014525
2145 Ga0114129_10026567
2146 Ga0114129_10032452
2147 Ga0114129_10032588
2148 Ga0114129_10043635
2149 Ga0114129_10044287
2150 Ga0114129_10048261
2151 Ga0114129_10053976
2152 Ga0114129_10054631
2153 Ga0114129_10058581
2154 Ga0114129_10122623
2155 Ga0114129_10122808
2156 Ga0114129_10134210
2157 Ga0114129_10151297
2158 Ga0114129_10181176
2159 Ga0114129_10235679
2160 Ga0114129_10271377
2161 Ga0114129_10349877
2162 Ga0114129_10521582
2163 Ga0114129_10631376
2164 Ga0105243_10005241
2165 Ga0105243_10049077
2166 Ga0105243_10151054
2167 Ga0105242_10013335
2168 Ga0105242_10065571
2169 Ga0105242_10070964
2170 Ga0105242_10073527
2171 Ga0105242_10290432
2172 Ga0105248_10010164
2173 Ga0105248_10014651
2174 Ga0105248_10019171
2175 Ga0105248_10021271
2176 Ga0105248_10038996
2177 Ga0105248_10045072
2178 Ga0105248_10050262
2179 Ga0105248_10061545
2180 Ga0105248_10079425
2181 Ga0105248_10103124
2182 Ga0105248_10125137
2183 Ga0105248_10148801
2184 Ga0105248_10184047
2185 Ga0105248_10191127
2186 Ga0105248_10194077
2187 Ga0105248_10267269
2188 Ga0105248_10560954
2189 Ga0105237_10004894
2190 Ga0105237_10417620
2191 Ga0105238_10010181
2192 Ga0105238_10037296
2193 Ga0105249_10000688
2194 Ga0105249_10001486
2195 Ga0105249_10007331
2196 Ga0105249_10172775
2197 Ga0105249_10201215
2198 Ga0105249_10358344
2199 Ga0099796_10053157
2200 Ga0105239_10148201
2201 Ga0105246_10019508
2202 Ga0105246_10024633
2203 Ga0105246_10134810
2204 Ga0105246_10333882
2205 Ga0105246_10354414
2206 Ga0157373_10007433
2207 Ga0157374_10202764
2208 Ga0157378_10011736
2209 Ga0157378_10015942
2210 Ga0157378_10059971
2211 Ga0157378_10080620
2212 Ga0157378_10103130
2213 Ga0163162_10001326
2214 Ga0163162_10016274
2215 Ga0163162_10048937
2216 Ga0163162_10078587
2217 Ga0163162_10092024
2218 Ga0163162_10542320
2219 Ga0163162_10578825
2220 Ga0157372_10005906
2221 Ga0157372_10095985
2222 Ga0157372_10154570
2223 Ga0157372_10190416
2224 Ga0157375_10099601
2225 Ga0157375_10199951
2226 Ga0157375_10294041
2227 Ga0157375_10352244
2228 Ga0157375_10383479
2229 Ga0163163_10006177
2230 Ga0163163_10006749
2231 Ga0163163_10008053
2232 Ga0163163_10008652
2233 Ga0163163_10023102
2234 Ga0163163_10042998
2235 Ga0163163_10043660
2236 Ga0163163_10044775
2237 Ga0163163_10108563
2238 Ga0163163_10108874
2239 Ga0163163_10128844
2240 Ga0163163_10212291
2241 Ga0157380_10006529
2242 Ga0157380_10012113
2243 Ga0157380_10025676
2244 Ga0157380_10035588
2245 Ga0157380_10131310
2246 Ga0157380_10226467
2247 Ga0157380_10553690
2248 Ga0157377_10005736
2249 Ga0157377_10029341
2250 Ga0157379_10016419
2251 Ga0157379_10025308
2252 Ga0157379_10080486
2253 Ga0157379_10114189
2254 Ga0157376_10012625
2255 Ga0157376_10019489
2256 Ga0157376_10052864
2257 Ga0157376_10067707
2258 Ga0157376_10086879
2259 Ga0157376_10095895
2260 Ga0163161_10013850
2261 Ga0207673_1004247
2262 Ga0207697_10001427
2263 Ga0207697_10009195
2264 Ga0207656_10001847
2265 Ga0207653_10000028
2266 Ga0207653_10004283
2267 Ga0207682_10005317
2268 Ga0207682_10008489
2269 Ga0207682_10020725
2270 Ga0207682_10025312
2271 Ga0207642_10054940
2272 Ga0207710_10005543
2273 Ga0207688_10007323
2274 Ga0207688_10022213
2275 Ga0207688_10033020
2276 Ga0207688_10064707
2277 Ga0207680_10004438
2278 Ga0207680_10009434
2279 Ga0207680_10076119
2280 Ga0207680_10124295
2281 Ga0207647_10010557
2282 Ga0207647_10094061
2283 Ga0207647_10115762
2284 Ga0207699_10000038
2285 Ga0207699_10028895
2286 Ga0207645_10006314
2287 Ga0207645_10006662
2288 Ga0207645_10038943
2289 Ga0207645_10074796
2290 Ga0207645_10085469
2291 Ga0207645_10149304
2292 Ga0207643_10001047
2293 Ga0207643_10008725
2294 Ga0207643_10011722
2295 Ga0207643_10023164
2296 Ga0207643_10041327
2297 Ga0207643_10141927
2298 Ga0207643_10181668
2299 Ga0207705_10050889
2300 Ga0207684_10000061
2301 Ga0207707_10000017
2302 Ga0207707_10007403
2303 Ga0207707_10047894
2304 Ga0207695_10042256
2305 Ga0207695_10060164
2306 Ga0207695_10137432
2307 Ga0207695_10216995
2308 Ga0207671_10002146
2309 Ga0207693_10117716
2310 Ga0207663_10000006
2311 Ga0207660_10020366
2312 Ga0207660_10027175
2313 Ga0207660_10032672
2314 Ga0207660_10069959
2315 Ga0207662_10001548
2316 Ga0207662_10005192
2317 Ga0207662_10060236
2318 Ga0207662_10070513
2319 Ga0207662_10079479
2320 Ga0207662_10203509
2321 Ga0207649_10008526
2322 Ga0207649_10012964
2323 Ga0207652_10000335
2324 Ga0207652_10004505
2325 Ga0207652_10043098
2326 Ga0207652_10083271
2327 Ga0207652_10108218
2328 Ga0207652_10130535
2329 Ga0207652_10312539
2330 Ga0207646_10000074
2331 Ga0207646_10035023
2332 Ga0207646_10036852
2333 Ga0207646_10060586
2334 Ga0207646_10141559
2335 Ga0207646_10258227
2336 Ga0207681_10002790
2337 Ga0207681_10005244
2338 Ga0207681_10016170
2339 Ga0207681_10030741
2340 Ga0207681_10043232
2341 Ga0207681_10048417
2342 Ga0207694_10009804
2343 Ga0207650_10009527
2344 Ga0207650_10010896
2345 Ga0207650_10012191
2346 Ga0207650_10017284
2347 Ga0207650_10026307
2348 Ga0207650_10027928
2349 Ga0207650_10032337
2350 Ga0207650_10042391
2351 Ga0207650_10073572
2352 Ga0207650_10249325
2353 Ga0207650_10329608
2354 Ga0207659_10000870
2355 Ga0207659_10001065
2356 Ga0207659_10001218
2357 Ga0207659_10002093
2358 Ga0207659_10002934
2359 Ga0207659_10003638
2360 Ga0207659_10019225
2361 Ga0207659_10020013
2362 Ga0207659_10032618
2363 Ga0207659_10050279
2364 Ga0207659_10108369
2365 Ga0207659_10221629
2366 Ga0207659_10269241
2367 Ga0207687_10011164
2368 Ga0207664_10044228
2369 Ga0207644_10006063
2370 Ga0207644_10011771
2371 Ga0207644_10030496
2372 Ga0207644_10056199
2373 Ga0207644_10058461
2374 Ga0207644_10077796
2375 Ga0207690_10084200
2376 Ga0207706_10005794
2377 Ga0207706_10008180
2378 Ga0207706_10023285
2379 Ga0207706_10110579
2380 Ga0207706_10119809
2381 Ga0207706_10160751
2382 Ga0207686_10013730
2383 Ga0207686_10013839
2384 Ga0207686_10048368
2385 Ga0207709_10013854
2386 Ga0207709_10017989
2387 Ga0207709_10025043
2388 Ga0207709_10034453
2389 Ga0207709_10062496
2390 Ga0207709_10134792
2391 Ga0207670_10203309
2392 Ga0207670_10220429
2393 Ga0207669_10006694
2394 Ga0207669_10022389
2395 Ga0207669_10070180
2396 Ga0207669_10131717
2397 Ga0207704_10002986
2398 Ga0207704_10009507
2399 Ga0207704_10066842
2400 Ga0207704_10109573
2401 Ga0207665_10186198
2402 Ga0207691_10001469
2403 Ga0207691_10001775
2404 Ga0207691_10006261
2405 Ga0207691_10006746
2406 Ga0207691_10012366
2407 Ga0207691_10016837
2408 Ga0207691_10053120
2409 Ga0207691_10060818
2410 Ga0207691_10149327
2411 Ga0207691_10165615
2412 Ga0207691_10360047
2413 Ga0207711_10008875
2414 Ga0207711_10011278
2415 Ga0207711_10013476
2416 Ga0207711_10024013
2417 Ga0207711_10044514
2418 Ga0207711_10056566
2419 Ga0207711_10121038
2420 Ga0207711_10121233
2421 Ga0207711_10124446
2422 Ga0207711_10125461
2423 Ga0207711_10239967
2424 Ga0207711_10395239
2425 Ga0207689_10006066
2426 Ga0207689_10010463
2427 Ga0207689_10041349
2428 Ga0207689_10054602
2429 Ga0207661_10082495
2430 Ga0207661_10150808
2431 Ga0207679_10000885
2432 Ga0207679_10008779
2433 Ga0207679_10027538
2434 Ga0207679_10046668
2435 Ga0207679_10046980
2436 Ga0207679_10214952
2437 Ga0207667_10059715
2438 Ga0207667_10180811
2439 Ga0207651_10002115
2440 Ga0207651_10003587
2441 Ga0207651_10018429
2442 Ga0207651_10045265
2443 Ga0207651_10104965
2444 Ga0207651_10126596
2445 Ga0207651_10133894
2446 Ga0207651_10135953
2447 Ga0207651_10198721
2448 Ga0207651_10220138
2449 Ga0207651_10275520
2450 Ga0207712_10002524
2451 Ga0207712_10010680
2452 Ga0207712_10034691
2453 Ga0207712_10067772
2454 Ga0207712_10353260
2455 Ga0207668_10019392
2456 Ga0207668_10021261
2457 Ga0207668_10029456
2458 Ga0207668_10096865
2459 Ga0207640_10031894
2460 Ga0207640_10051881
2461 Ga0207640_10104514
2462 Ga0207640_10192633
2463 Ga0207658_10006860
2464 Ga0207658_10021630
2465 Ga0207677_10001205
2466 Ga0207677_10009590
2467 Ga0207677_10184552
2468 Ga0207677_10224350
2469 Ga0207677_10230998
2470 Ga0207677_10286578
2471 Ga0207703_10011601
2472 Ga0207703_10013978
2473 Ga0207703_10017715
2474 Ga0207703_10024937
2475 Ga0207703_10029099
2476 Ga0207703_10036382
2477 Ga0207703_10061144
2478 Ga0207703_10066926
2479 Ga0207703_10106316
2480 Ga0207703_10224763
2481 Ga0207703_10228056
2482 Ga0207703_10239183
2483 Ga0207703_10417864
2484 Ga0207639_10058846
2485 Ga0207678_10024166
2486 Ga0207678_10054646
2487 Ga0207678_10145705
2488 Ga0207678_10216902
2489 Ga0207708_10000967
2490 Ga0207708_10005277
2491 Ga0207708_10007629
2492 Ga0207708_10012845
2493 Ga0207708_10030957
2494 Ga0207708_10054670
2495 Ga0207708_10061343
2496 Ga0207708_10076274
2497 Ga0207708_10180047
2498 Ga0207708_10186165
2499 Ga0207708_10227104
2500 Ga0207702_10008469
2501 Ga0207641_10004712
2502 Ga0207641_10006174
2503 Ga0207641_10030368
2504 Ga0207641_10090204
2505 Ga0207641_10113993
2506 Ga0207641_10130283
2507 Ga0207641_10348701
2508 Ga0207648_10000077
2509 Ga0207648_10002088
2510 Ga0207648_10008260
2511 Ga0207648_10046317
2512 Ga0207648_10072334
2513 Ga0207648_10137737
2514 Ga0207648_10154079
2515 Ga0207648_10219885
2516 Ga0207676_10002639
2517 Ga0207676_10012513
2518 Ga0207676_10024759
2519 Ga0207676_10063801
2520 Ga0207676_10124150
2521 Ga0207676_10258185
2522 Ga0207676_10333987
2523 Ga0207674_10014127
2524 Ga0207674_10054995
2525 Ga0207674_10100739
2526 Ga0207674_10138592
2527 Ga0207674_10240273
2528 Ga0207675_100025041
2529 Ga0207675_100037149
2530 Ga0207675_100041783
2531 Ga0207675_100051391
2532 Ga0207675_100058391
2533 Ga0207675_100067370
2534 Ga0207675_100077427
2535 Ga0207675_100113512
2536 Ga0207675_100142494
2537 Ga0207675_100162975
2538 Ga0207683_10002387
2539 Ga0207683_10006547
2540 Ga0207683_10011461
2541 Ga0207683_10032921
2542 Ga0207683_10039221
2543 Ga0207683_10051596
2544 Ga0207683_10057306
2545 Ga0207683_10085526
2546 Ga0207683_10126839
2547 Ga0207683_10291465
2548 Ga0207683_10293351
2549 Ga0207698_10137586
2550 Ga0207428_10000002
2551 Ga0207428_10000186
2552 Ga0207428_10002485
2553 Ga0207428_10002952
2554 Ga0207428_10009456
2555 Ga0207428_10013459
2556 Ga0207428_10013656
2557 Ga0207428_10021513
2558 Ga0207428_10031142
2559 Ga0207428_10032046
2560 Ga0207428_10033622
2561 Ga0207428_10060665
2562 Ga0207428_10062242
2563 Ga0207428_10168473
2564 Ga0207428_10182925
2565 Ga0268266_10038090
2566 Ga0268266_10070638
2567 Ga0268266_10099371
2568 Ga0268266_10153554
2569 Ga0268265_10002703
2570 Ga0268265_10005753
2571 Ga0268265_10007329
2572 Ga0268265_10008079
2573 Ga0268265_10021740
2574 Ga0268265_10094226
2575 Ga0268265_10101090
2576 Ga0268265_10215761
2577 Ga0268265_10221770
2578 Ga0268265_10222689
2579 Ga0268265_10389671
2580 Ga0268264_10001062
2581 Ga0268264_10009891
2582 Ga0268264_10020811
2583 Ga0268264_10029034
2584 Ga0268264_10054024
2585 Ga0268264_10071894
2586 Ga0268264_10109139
2587 Ga0307408_100008918
2588 Ga0307408_100019678
2589 Ga0307408_100042257
2590 Ga0307408_100047915
2591 Ga0307408_100079104
2592 Ga0307405_10003661
2593 Ga0307405_10004553
2594 Ga0316577_10117317
2595 Ga0316577_10170230
2596 Ga0307413_10001364
2597 Ga0307413_10009818
2598 Ga0307410_10000918
2599 Ga0307410_10011385
2600 Ga0307410_10041939
2601 Ga0307406_10013139
2602 Ga0307407_10000966
2603 Ga0307407_10021060
2604 Ga0307407_10052523
2605 Ga0307407_10118295
2606 Ga0307412_10004388
2607 Ga0307412_10060765
2608 Ga0307409_100006265
2609 Ga0307409_100006759
2610 Ga0307409_100078548
2611 Ga0307409_100236665
2612 Ga0307416_100046423
2613 Ga0307416_100078292
2614 Ga0307416_100080524
2615 Ga0307416_100205943
2616 Ga0307416_100216821
2617 Ga0307416_100271163
2618 Ga0307416_100397373
2619 Ga0307414_10013912
2620 Ga0307414_10025934
2621 Ga0307414_10049217
2622 Ga0307414_10071076
2623 Ga0307411_10058044
2624 Ga0307411_10096522
2625 Ga0307411_10125445
2626 Ga0307415_100004186
2627 Ga0307415_100010404
2628 Ga0316587_1003502
2629 Ga0373930_0000775
2630 Ga0373948_0001027
2631 Ga0373958_0001519
2632 Ga0373959_0006781
2633 Ga0373938_0018933
2634 Ga0373928_0006499
2635 Ga0373929_0000268
2636 Ga0373940_0000626
2637 Ga0373944_0005029
2638 Ga0373949_0000608
2639 Ga0373949_0005486
2640 Ga0373951_0001375
2641 Ga0373952_0009610
2642 Ga0373932_0000945
2643 Ga0373939_0000488
2644 Ga0373941_0011507
2645 Ga0373960_0005000
2646 Ga0373960_0036588
2647 Ga0373943_0028224
2648 Ga0373943_0038890
2649 Ga0373955_0033643
2650 Ga0373942_0003222
2651 Ga0373961_0001097
2652 Ga0373961_0007485
2653 Ga0373962_0000586
2654 Ga0316574_0012892
2655 Ga0373924_0047434
2656 Ga0373931_0000769
2657 Ga0373935_0144190
2658 Ga0373935_0255684
2659 Ga0373927_0036513
2660 Ga0373927_0038090
2661 Ga0373947_0004193
2662 Ga0373947_0039146
2663 Ga0373947_0129290
2664 Ga0373937_0020639
2665 Ga0373937_0051591
2666 Ga0373937_0058578
2667 Ga0373937_0064766
2668 Ga0373937_0066157
2669 Ga0373937_0068548
2670 Ga0373937_0116794
2671 Ga0373937_0146971
2672 Ga0373937_0182645
2673 Ga0373937_0193978
2674 Ga0316584_0046028
2675 Ga0395905_0398674
2676 Ga0436365_0924777
2677 Ga0436365_1831975
2678 Ga0439433_0008725
2679 Ga0439433_0019308
2680 Ga0439433_0019930
2681 Ga0439450_003067
2682 Ga0450923_003478
2683 Ga0450898_012910
2684 Ga0439446_0035851
2685 Ga0450908_000692
2686 Ga0450908_003896
2687 Ga0439435_0031125
2688 Ga0450916_008483
2689 Ga0450918_006749
2690 Ga0451577_0000040
2691 Ga0451577_0494267
2692 Ga0439440_0024281
2693 Ga0453683_0000220
2694 Ga0453683_0043866
2695 Ga0453683_0069843
2696 Ga0453683_0207936
2697 Ga0453684_0000179
2698 Ga0453684_0030372
2699 Ga0453684_0366512
2700 Ga0451576_0012703
2701 Ga0451576_0045741
2702 Ga0451576_0069955
2703 Ga0451576_0072179
2704 Ga0451576_0140999
2705 Ga0451576_0171343
2706 Ga0495592_0063787
2707 Ga0495603_0060981
2708 Ga0495603_0141811
2709 Ga0495603_0171042
2710 Ga0495629_0030839
2711 Ga0495629_0209636
2712 Ga0495638_0022261
2713 Ga0495580_0058232
2714 Ga0495580_0157645
2715 Ga0495582_0209601
2716 Ga0495639_0013753
2717 Ga0495662_0089897
2718 Ga0495584_0040964
2719 Ga0495594_0015783
2720 Ga0495594_0134153
2721 Ga0495608_0004917
2722 Ga0495608_0012120
2723 Ga0495608_0202720
2724 Ga0495628_0029181
2725 Ga0495628_0296934
2726 Ga0495643_0003264
2727 Ga0495644_0057181
2728 Ga0495642_0027332
2729 Ga0495665_0026207
2730 Ga0495587_0011763
2731 Ga0495587_0049996
2732 Ga0495598_0009860
2733 Ga0495598_0012154
2734 Ga0495609_0032513
2735 Ga0495609_0042275
2736 Ga0495621_0001834
2737 Ga0495621_0019061
2738 Ga0495621_0074697
2739 Ga0495633_0055196
2740 Ga0495667_0003890
2741 Ga0495667_0042802
2742 Ga0495667_0091317
2743 Ga0495667_0168173
2744 Ga0495635_0205267
2745 Ga0495659_0006070
2746 Ga0495659_0008454
2747 Ga0495659_0027674
2748 Ga0495659_0066133
2749 Ga0495657_0002051
2750 Ga0495599_0015176
2751 Ga0495647_0019200
2752 Ga0495658_0141011
2753 Ga0495658_0177631
2754 Ga0495658_0178636
2755 Ga0495669_0005426
2756 Ga0495669_0021180
2757 Ga0495669_0031742
2758 Ga0495669_0049843
2759 Ga0495613_0005402
2760 Ga0495613_0012840
2761 Ga0495613_0049241
2762 Ga0495613_0157733
2763 Ga0495670_0054184
2764 Ga0495604_0087870
2765 Ga0495636_0026059
2766 Ga0495636_0029152
2767 Ga0495674_0008427
2768 Ga0495674_0055916
2769 Ga0495674_0121132
2770 Ga0495674_0163557
2771 Ga0495674_0264675
2772 Ga0495684_0000698
2773 Ga0495684_0183265
2774 Ga0496100_0004497
2775 Ga0496101_0000222
2776 Ga0496104_0026075
2777 Ga0496105_0030097
2778 Ga0496106_0169703
2779 Ga0496108_0202651
2780 Ga0496109_0337071
2781 Ga0496110_0061102
2782 Ga0496110_0067484
2783 Ga0496112_0058309
2784 Ga0496112_0060942
2785 Ga0496112_0163152
2786 Ga0496112_0240509
2787 Ga0496112_0279115
2788 Ga0496113_0024540
2789 Ga0496113_0024552
2790 Ga0496113_0243315
2791 Ga0496114_0000409
2792 Ga0496114_0287336
2793 Ga0501291_011831
2794 Ga0501298_014197
2795 Ga0501031_0053819
2796 Ga0501034_0084522
2797 Ga0501034_0191212
2798 Ga0501036_0119896
2799 Ga0501038_0042470
2800 Ga0501038_0045056
2801 Ga0501038_0342471
2802 Ga0501039_0374744
2803 Ga0501040_0012756
2804 Ga0501040_0082363
2805 Ga0501040_0116681
2806 Ga0501040_0149926
2807 Ga0501041_0002542
2808 Ga0501041_0017442
2809 Ga0501041_0045204
2810 Ga0501041_0083959
2811 Ga0501041_0116611
2812 Ga0501042_0005735
2813 Ga0501042_0017095
2814 Ga0501042_0112352
2815 Ga0501042_0131518
2816 Ga0501046_0045279
2817 Ga0501046_0124415
2818 Ga0501046_0169542
2819 Ga0501046_0230637
2820 Ga0501047_0148538
2821 Ga0501048_0082570
2822 Ga0501067_0043736
2823 Ga0501068_0150636
2824 Ga0501071_0074461
2825 Ga0501071_0083597
2826 Ga0501071_0106004
2827 Ga0501071_0118991
2828 Ga0501071_0284061
2829 Ga0501072_0003814
2830 Ga0501073_0001250
2831 Ga0501073_0211531
2832 Ga0501074_0057222
2833 Ga0501074_0098164
2834 Ga0501075_0063929
2835 Ga0501075_0068315
2836 Ga0501075_0086533
2837 Ga0501075_0096978
2838 Ga0501075_0179369
2839 Ga0501075_0192164
2840 Ga0501075_0310910
2841 Ga0501076_0003582
2842 Ga0501076_0004842
2843 Ga0501076_0010721
2844 Ga0501076_0023194
2845 Ga0501076_0024714
2846 Ga0501076_0056749
2847 Ga0501076_0165206
2848 Ga0501076_0167920
2849 Ga0501076_0181561
2850 Ga0501076_0214204
2851 Ga0501076_0272221
2852 Ga0501216_013790
2853 Ga0501217_001064
2854 Ga0501233_024582
2855 Ga0501235_004372
2856 Ga0501079_0001657
2857 Ga0501079_0021145
2858 Ga0501080_0118547
2859 Ga0501080_0170389
2860 Ga0501081_0006494
2861 Ga0501081_0011708
2862 Ga0501083_0168039
2863 Ga0501035_0156536
2864 Ga0501045_0022578
2865 Ga0501045_0049676
2866 Ga0501045_0049693
2867 Ga0501045_0166023
2868 nmdc:mga03683_4502_c1
2869 nmdc:mga00v17_1598_c1
2870 nmdc:mga00v17_21804_c1
2871 nmdc:mga0yw44_49336_c1
2872 nmdc:mga0yw44_717_c1
2873 nmdc:mga0k408_6274_c1
2874 nmdc:mga06z11_8028_c1
2875 nmdc:mga05p37_1036_c1
2876 nmdc:mga05p37_109852_c1
2877 nmdc:mga05p37_115391_c1
2878 nmdc:mga05p37_116790_c1
2879 nmdc:mga05p37_12059_c1
2880 nmdc:mga05p37_13371_c1
2881 nmdc:mga05p37_13677_c1
2882 nmdc:mga05p37_13826_c1
2883 nmdc:mga05p37_1467_c1
2884 nmdc:mga05p37_1640_c1
2885 nmdc:mga05p37_17849_c1
2886 nmdc:mga05p37_181392_c1
2887 nmdc:mga05p37_2052_c1
2888 nmdc:mga05p37_214844_c1
2889 nmdc:mga05p37_229303_c1
2890 nmdc:mga05p37_308679_c1
2891 nmdc:mga05p37_45707_c1
2892 nmdc:mga05p37_48474_c1
2893 nmdc:mga05p37_515301_c1
2894 nmdc:mga05p37_51628_c1
2895 nmdc:mga05p37_56869_c1
2896 nmdc:mga05p37_58091_c1
2897 nmdc:mga05p37_59229_c1
2898 nmdc:mga05p37_65672_c1
2899 nmdc:mga05p37_764_c1
2900 nmdc:mga05p37_78598_c1
2901 nmdc:mga05p37_84604_c1
2902 nmdc:mga09592_108378_c1
2903 nmdc:mga09592_114006_c1
2904 nmdc:mga09592_14369_c1
2905 nmdc:mga09592_162581_c1
2906 nmdc:mga09592_16597_c1
2907 nmdc:mga09592_1746_c1
2908 nmdc:mga09592_324389_c1
2909 nmdc:mga09592_341077_c1
2910 nmdc:mga09592_446496_c1
2911 nmdc:mga09592_46379_c1
2912 nmdc:mga09592_50704_c1
2913 nmdc:mga09592_81041_c1
2914 nmdc:mga09592_86481_c1
2915 nmdc:mga09592_97011_c1
2916 nmdc:mga09592_9883_c1
2917 nmdc:mga0qj67_130297_c1
2918 nmdc:mga0qj67_1398_c1
2919 nmdc:mga0qj67_174540_c1
2920 nmdc:mga0qj67_299363_c1
2921 nmdc:mga0qj67_536_c1
2922 nmdc:mga0qj67_71049_c1
2923 nmdc:mga0qj67_8668_c1
2924 nmdc:mga0qj67_8727_c1
2925 nmdc:mga06r32_129030_c1
2926 nmdc:mga06r32_1394_c1
2927 nmdc:mga06r32_207042_c1
2928 nmdc:mga06r32_249444_c1
2929 nmdc:mga06r32_271906_c1
2930 nmdc:mga06r32_424475_c1
2931 nmdc:mga06r32_494694_c1
2932 nmdc:mga06r32_54379_c1
2933 nmdc:mga06r32_77410_c1
2934 nmdc:mga06r32_93539_c1
2935 nmdc:mga08y16_10084_c1
2936 nmdc:mga08y16_100886_c1
2937 nmdc:mga08y16_11913_c1
2938 nmdc:mga08y16_129093_c1
2939 nmdc:mga08y16_174442_c1
2940 nmdc:mga08y16_176906_c1
2941 nmdc:mga08y16_1826_c1
2942 nmdc:mga08y16_20782_c1
2943 nmdc:mga08y16_215108_c1
2944 nmdc:mga08y16_219875_c1
2945 nmdc:mga08y16_224855_c1
2946 nmdc:mga08y16_2262_c1
2947 nmdc:mga08y16_2313_c1
2948 nmdc:mga08y16_24146_c1
2949 nmdc:mga08y16_33474_c1
2950 nmdc:mga08y16_3_c1
2951 nmdc:mga08y16_51089_c1
2952 nmdc:mga08y16_516816_c1
2953 nmdc:mga08y16_7076_c1
2954 nmdc:mga08y16_842_c1
2955 nmdc:mga08y16_87022_c1
2956 nmdc:mga08y16_9481_c1
2957 nmdc:mga08y16_9550_c1
2958 nmdc:mga08y16_9590_c1
2959 nmdc:mga0n895_11531_c1
2960 nmdc:mga0n895_12860_c1
2961 nmdc:mga0n895_130_c1
2962 nmdc:mga0n895_13319_c1
2963 nmdc:mga0n895_160037_c1
2964 nmdc:mga0n895_1701_c1
2965 nmdc:mga0n895_246673_c1
2966 nmdc:mga0n895_255173_c1
2967 nmdc:mga0n895_255434_c1
2968 nmdc:mga0n895_28636_c1
2969 nmdc:mga0n895_330417_c1
2970 nmdc:mga0n895_341389_c1
2971 nmdc:mga0n895_379784_c1
2972 nmdc:mga0n895_5254_c1
2973 nmdc:mga0n895_5693_c1
2974 nmdc:mga0n895_57722_c1
2975 nmdc:mga0n895_91467_c1
2976 nmdc:mga0rr50_102882_c1
2977 nmdc:mga0rr50_131147_c1
2978 nmdc:mga0rr50_213981_c1
2979 nmdc:mga0rr50_30066_c1
2980 nmdc:mga0rr50_4139_c1
2981 nmdc:mga0rr50_43177_c1
2982 nmdc:mga0rr50_43673_c1
2983 nmdc:mga0rr50_47417_c1
2984 nmdc:mga0rr50_504_c1
2985 nmdc:mga0rr50_58980_c1
2986 nmdc:mga0rr50_5_c1
2987 nmdc:mga0rr50_88542_c1
2988 nmdc:mga08x19_15408_c1
2989 nmdc:mga08x19_270_c1
2990 nmdc:mga08x19_27840_c1
2991 nmdc:mga08x19_34033_c1
2992 nmdc:mga08x19_45_c1
2993 nmdc:mga08x19_48475_c1
2994 nmdc:mga08x19_83627_c1
2995 nmdc:mga0a205_107329_c1
2996 nmdc:mga0a205_111326_c1
2997 nmdc:mga0a205_129435_c1
2998 nmdc:mga0a205_141381_c1
2999 nmdc:mga0a205_259_c1
3000 nmdc:mga0a205_28936_c1
3001 nmdc:mga0a205_344671_c1
3002 nmdc:mga0a205_34649_c1
3003 nmdc:mga0a205_3512_c1
3004 nmdc:mga0a205_434239_c1
3005 nmdc:mga0a205_44276_c1
3006 nmdc:mga0a205_50629_c1
3007 nmdc:mga0a205_5180_c2
3008 nmdc:mga0a205_55199_c1
3009 nmdc:mga0a205_68469_c1
3010 nmdc:mga0a205_7012_c1
3011 nmdc:mga0a205_84731_c1
3012 nmdc:mga0a205_88392_c1
3013 nmdc:mga0a205_98442_c1
3014 Ga0495601_0017272
3015 Ga0495595_0052602
3016 Ga0495619_0053335
3017 Ga0495619_0054318
3018 Ga0501084_0005832
3019 Ga0501084_0038583
3020 Ga0501084_0057774
3021 Ga0501084_0174510
3022 Ga0501084_0273534
3023 Ga0590071_000041
3024 Ga0590071_000580
3025 Ga0590071_000846
3026 Ga0590071_024460
3027 Ga0590074_000103
3028 Ga0590074_000776
3029 Ga0590074_005338
3030 Ga0590075_000191
3031 Ga0590075_000438
3032 Ga0590075_000837
3033 Ga0590077_000066
3034 Ga0590077_000903
3035 Ga0501082_0003745
3036 Ga0501082_0026861
3037 Ga0501082_0032878
3038 Ga0501082_0106801
3039 Ga0501082_0184949
3040 Ga0501082_0220257
3041 Ga0530510_0020879
3042 Ga0530510_0036737
3043 Ga0530510_0040980
3044 Ga0530510_0047956
3045 Ga0530510_0176097
3046 Ga0530510_0279981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11104

PilM_2

Type IV pilus assembly protein PilM;

67

407

0.93

PF14450

FtsA

Cell division protein FtsA

246

401

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ych-assembly1.cif.gz_A pilm-piln type iv pilus biogenesis complex 0.9157 10 353
2ych-assembly1.cif.gz_A pilm-piln type iv pilus biogenesis complex 0.9053 10 353
3jc8-assembly1.cif.gz_Ma architectural model of the type iva pilus machine in a piliated state 0.8954 7 350
5eou-assembly1.cif.gz_A pseudomonas aeruginosa pilm:piln1-12 bound to atp 0.8731 10 350
5eou-assembly2.cif.gz_B pseudomonas aeruginosa pilm:piln1-12 bound to atp 0.8716 10 353
ID Description Score Start End Superfamily
2ychA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9257 181 313 3.30.420.40
2ychA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9111 181 313 3.30.420.40
5eoyB03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.864 181 314 3.30.420.40
5eoyB03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8579 181 314 3.30.420.40
5eoyB02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.8326 87 142 3.30.1490.300
ID Description Score Start End GO Terms
AF-A0A7C3EJ67-F1-model_v4 Type IV pilus assembly protein PilM 0.9655 7 212 GO:0051301
AF-A0A349EJH3-F1-model_v4 Pilus assembly protein PilM 0.9572 165 349
AF-A0A661Q3A3-F1-model_v4 Pilus assembly protein PilM 0.9514 1 353
AF-X1IXT2-F1-model_v4 SHS2 domain-containing protein 0.9485 11 162
AF-A0A661Q3A3-F1-model_v4 Pilus assembly protein PilM 0.9461 1 353

Map