F494418
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1502 | 405 | 3004 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300061734|Ga0530510_0158472|Ga0530510_0158472_514_1341 |
| Length | 275 |
| Sequence | LVLLWHRPESTIARVDAKGLIAAGGEATRLGELTRVANKHLLPVGRWPMIYYPLQLLQLAGVREVLIVTGQGHAGQLIDLLGDGRMAARGGDEPLFELDLTYKVQTEPGGIAQVVGMAEAFAAGGKLVVCLGDNLFEFAEVSAIRSWADAGNGAQIFVKEVPDPERFGVVVYGEDGRVADVVEKAGVVDTRYDAPPTADAVVGLYCYDATVYEIIRGLEPSSRGELEITDVNRRYAENGRLSVARVQGWWHDAGAHEALAELGARVEETGANKLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 244 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 250 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 251 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 252 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 255 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 256 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 257 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 260 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 261 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 262 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 263 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 264 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 265 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 266 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 267 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 268 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 269 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 279 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 280 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 403 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 8.72 |
| Rhizosphere | 90.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0530510_0158472 | 3300061734 | Bacteria | 1674 |
| 2 | ARcpr5oldR_c003182 | 3300000041 | Bacteria | 1468 |
| 3 | JGI24739J22299_10032072 | 3300001989 | Bacteria | 1811 |
| 4 | JGI24743J22301_10004088 | 3300001991 | Bacteria | 2352 |
| 5 | JGI24738J21930_10013484 | 3300002075 | Bacteria | 1766 |
| 6 | JGI24744J21845_10010742 | 3300002077 | Bacteria | 1874 |
| 7 | JGI24744J21845_10015692 | 3300002077 | Bacteria | 1512 |
| 8 | JGI24033J26618_1009698 | 3300002155 | Bacteria | 1125 |
| 9 | JGI24751J29686_10002390 | 3300002459 | Bacteria | 3782 |
| 10 | JGI25407J50210_10002200 | 3300003373 | Bacteria | 4565 |
| 11 | JGI25407J50210_10012870 | 3300003373 | Bacteria | 2146 |
| 12 | JGI25407J50210_10019135 | 3300003373 | Unclassified | 1780 |
| 13 | JGI25407J50210_10040997 | 3300003373 | Bacteria | 1186 |
| 14 | JGI25407J50210_10070894 | 3300003373 | Bacteria | 870 |
| 15 | Ga0070658_10177926 | 3300005327 | Bacteria | 1789 |
| 16 | Ga0070658_10227673 | 3300005327 | Bacteria | 1578 |
| 17 | Ga0070658_10555359 | 3300005327 | Bacteria | 994 |
| 18 | Ga0070658_10601447 | 3300005327 | Bacteria | 953 |
| 19 | Ga0070676_10105811 | 3300005328 | Bacteria | 1745 |
| 20 | Ga0070683_100022112 | 3300005329 | Bacteria | 5681 |
| 21 | Ga0070683_100040560 | 3300005329 | Bacteria | 4281 |
| 22 | Ga0070683_100048201 | 3300005329 | Bacteria | 3938 |
| 23 | Ga0070683_100057210 | 3300005329 | Bacteria | 3622 |
| 24 | Ga0070683_100082560 | 3300005329 | Bacteria | 3010 |
| 25 | Ga0070683_100135504 | 3300005329 | Bacteria | 2332 |
| 26 | Ga0070683_100144012 | 3300005329 | Bacteria | 2258 |
| 27 | Ga0070683_100200893 | 3300005329 | Unclassified | 1893 |
| 28 | Ga0070683_100270508 | 3300005329 | Bacteria | 1616 |
| 29 | Ga0070683_100344858 | 3300005329 | Bacteria | 1418 |
| 30 | Ga0070683_100463967 | 3300005329 | Bacteria | 1209 |
| 31 | Ga0070683_100485687 | 3300005329 | Bacteria | 1179 |
| 32 | Ga0070683_100500406 | 3300005329 | Bacteria | 1161 |
| 33 | Ga0070683_100649423 | 3300005329 | Bacteria | 1010 |
| 34 | Ga0070690_100131236 | 3300005330 | Bacteria | 1692 |
| 35 | Ga0068869_100088600 | 3300005334 | Bacteria | 2323 |
| 36 | Ga0068869_100473325 | 3300005334 | Bacteria | 1042 |
| 37 | Ga0070680_100010968 | 3300005336 | Bacteria | 7006 |
| 38 | Ga0070680_100018239 | 3300005336 | Bacteria | 5543 |
| 39 | Ga0070680_100022628 | 3300005336 | Bacteria | 5008 |
| 40 | Ga0070680_100028601 | 3300005336 | Bacteria | 4472 |
| 41 | Ga0070680_100071442 | 3300005336 | Bacteria | 2852 |
| 42 | Ga0070680_100073686 | 3300005336 | Bacteria | 2809 |
| 43 | Ga0070680_100136047 | 3300005336 | Bacteria | 2058 |
| 44 | Ga0070680_100242924 | 3300005336 | Bacteria | 1522 |
| 45 | Ga0070682_100002171 | 3300005337 | Bacteria | 10885 |
| 46 | Ga0070682_100039904 | 3300005337 | Bacteria | 2887 |
| 47 | Ga0070682_100101682 | 3300005337 | Bacteria | 1898 |
| 48 | Ga0068868_100320480 | 3300005338 | Bacteria | 1320 |
| 49 | Ga0070660_100008471 | 3300005339 | Bacteria | 7194 |
| 50 | Ga0070660_100012212 | 3300005339 | Bacteria | 6132 |
| 51 | Ga0070660_100025299 | 3300005339 | Bacteria | 4411 |
| 52 | Ga0070660_100050415 | 3300005339 | Bacteria | 3203 |
| 53 | Ga0070660_100356088 | 3300005339 | Bacteria | 1206 |
| 54 | Ga0070689_100004845 | 3300005340 | Bacteria | 9132 |
| 55 | Ga0070689_100014058 | 3300005340 | Bacteria | 5807 |
| 56 | Ga0070691_10072689 | 3300005341 | Bacteria | 1671 |
| 57 | Ga0070687_100023730 | 3300005343 | Bacteria | 2918 |
| 58 | Ga0070687_100026372 | 3300005343 | Bacteria | 2797 |
| 59 | Ga0070661_100008990 | 3300005344 | Bacteria | 6914 |
| 60 | Ga0070661_100012209 | 3300005344 | Bacteria | 6006 |
| 61 | Ga0070661_100038149 | 3300005344 | Bacteria | 3497 |
| 62 | Ga0070661_100130048 | 3300005344 | Bacteria | 1890 |
| 63 | Ga0070661_100289621 | 3300005344 | Bacteria | 1272 |
| 64 | Ga0070692_10109838 | 3300005345 | Bacteria | 1523 |
| 65 | Ga0070692_10172581 | 3300005345 | Bacteria | 1247 |
| 66 | Ga0070668_100053773 | 3300005347 | Bacteria | 3105 |
| 67 | Ga0070668_100123057 | 3300005347 | Bacteria | 2075 |
| 68 | Ga0070669_100151931 | 3300005353 | Bacteria | 1793 |
| 69 | Ga0070669_100472114 | 3300005353 | Bacteria | 1037 |
| 70 | Ga0070675_100006745 | 3300005354 | Bacteria | 8828 |
| 71 | Ga0070671_100029577 | 3300005355 | Bacteria | 4517 |
| 72 | Ga0070671_100395684 | 3300005355 | Bacteria | 1181 |
| 73 | Ga0070674_100000969 | 3300005356 | Bacteria | 14961 |
| 74 | Ga0070674_100055510 | 3300005356 | Bacteria | 2743 |
| 75 | Ga0070674_100279038 | 3300005356 | Bacteria | 1323 |
| 76 | Ga0070673_100036778 | 3300005364 | Bacteria | 3725 |
| 77 | Ga0070673_100093932 | 3300005364 | Bacteria | 2457 |
| 78 | Ga0070688_100000622 | 3300005365 | Bacteria | 17675 |
| 79 | Ga0070688_100051855 | 3300005365 | Bacteria | 2560 |
| 80 | Ga0070688_100139138 | 3300005365 | Bacteria | 1647 |
| 81 | Ga0070659_100013748 | 3300005366 | Bacteria | 6034 |
| 82 | Ga0070659_100069700 | 3300005366 | Bacteria | 2792 |
| 83 | Ga0070659_100185037 | 3300005366 | Bacteria | 1710 |
| 84 | Ga0070659_100196653 | 3300005366 | Bacteria | 1658 |
| 85 | Ga0070659_100483586 | 3300005366 | Bacteria | 1054 |
| 86 | Ga0070667_100034742 | 3300005367 | Bacteria | 4220 |
| 87 | Ga0070667_100158702 | 3300005367 | Bacteria | 1991 |
| 88 | Ga0070714_100526522 | 3300005435 | Bacteria | 1129 |
| 89 | Ga0070714_100654449 | 3300005435 | Bacteria | 1012 |
| 90 | Ga0070714_100683297 | 3300005435 | Bacteria | 990 |
| 91 | Ga0070713_100106004 | 3300005436 | Bacteria | 2443 |
| 92 | Ga0070713_100345254 | 3300005436 | Bacteria | 1380 |
| 93 | Ga0070710_10275368 | 3300005437 | Bacteria | 1090 |
| 94 | Ga0070701_10030345 | 3300005438 | Bacteria | 2674 |
| 95 | Ga0070711_100478100 | 3300005439 | Bacteria | 1024 |
| 96 | Ga0070705_100048881 | 3300005440 | Bacteria | 2453 |
| 97 | Ga0070700_100346796 | 3300005441 | Bacteria | 1099 |
| 98 | Ga0070694_100079502 | 3300005444 | Bacteria | 2276 |
| 99 | Ga0070708_100033117 | 3300005445 | Bacteria | 4489 |
| 100 | Ga0070663_100079585 | 3300005455 | Bacteria | 2405 |
| 101 | Ga0070663_100250382 | 3300005455 | Bacteria | 1402 |
| 102 | Ga0070663_100471652 | 3300005455 | Bacteria | 1038 |
| 103 | Ga0070678_100008743 | 3300005456 | Bacteria | 6084 |
| 104 | Ga0070678_100028711 | 3300005456 | Bacteria | 3798 |
| 105 | Ga0070678_100112538 | 3300005456 | Bacteria | 2132 |
| 106 | Ga0070678_100238729 | 3300005456 | Bacteria | 1519 |
| 107 | Ga0070662_100226865 | 3300005457 | Bacteria | 1493 |
| 108 | Ga0070681_10011373 | 3300005458 | Bacteria | 8806 |
| 109 | Ga0070681_10029668 | 3300005458 | Bacteria | 5492 |
| 110 | Ga0070681_10041815 | 3300005458 | Bacteria | 4594 |
| 111 | Ga0070681_10070401 | 3300005458 | Bacteria | 3463 |
| 112 | Ga0070681_10077344 | 3300005458 | Bacteria | 3285 |
| 113 | Ga0070681_10119786 | 3300005458 | Bacteria | 2568 |
| 114 | Ga0070681_10206450 | 3300005458 | Bacteria | 1881 |
| 115 | Ga0070681_10575848 | 3300005458 | Bacteria | 1040 |
| 116 | Ga0070681_10634043 | 3300005458 | Bacteria | 983 |
| 117 | Ga0068867_100033342 | 3300005459 | Bacteria | 3728 |
| 118 | Ga0068867_100337881 | 3300005459 | Bacteria | 1253 |
| 119 | Ga0070685_10003403 | 3300005466 | Bacteria | 8092 |
| 120 | Ga0070685_10038539 | 3300005466 | Bacteria | 2710 |
| 121 | Ga0070685_10124066 | 3300005466 | Bacteria | 1607 |
| 122 | Ga0070706_100136916 | 3300005467 | Bacteria | 2285 |
| 123 | Ga0070707_100230738 | 3300005468 | Bacteria | 1802 |
| 124 | Ga0070699_100021930 | 3300005518 | Bacteria | 5504 |
| 125 | Ga0070699_100213351 | 3300005518 | Bacteria | 1719 |
| 126 | Ga0070679_100007114 | 3300005530 | Bacteria | 10444 |
| 127 | Ga0070679_100028797 | 3300005530 | Bacteria | 5478 |
| 128 | Ga0070679_100089177 | 3300005530 | Bacteria | 3071 |
| 129 | Ga0070679_100125137 | 3300005530 | Bacteria | 2553 |
| 130 | Ga0070679_100169820 | 3300005530 | Bacteria | 2154 |
| 131 | Ga0070679_100308073 | 3300005530 | Bacteria | 1534 |
| 132 | Ga0070684_100005407 | 3300005535 | Bacteria | 9783 |
| 133 | Ga0070684_100038137 | 3300005535 | Bacteria | 4126 |
| 134 | Ga0070684_100058574 | 3300005535 | Bacteria | 3366 |
| 135 | Ga0070684_100073569 | 3300005535 | Bacteria | 3011 |
| 136 | Ga0070684_100126605 | 3300005535 | Bacteria | 2301 |
| 137 | Ga0070684_100148844 | 3300005535 | Bacteria | 2120 |
| 138 | Ga0070684_100307441 | 3300005535 | Bacteria | 1455 |
| 139 | Ga0068853_100163039 | 3300005539 | Bacteria | 2013 |
| 140 | Ga0068853_100648900 | 3300005539 | Bacteria | 1004 |
| 141 | Ga0070672_100024810 | 3300005543 | Bacteria | 4438 |
| 142 | Ga0070672_100025873 | 3300005543 | Bacteria | 4359 |
| 143 | Ga0070672_100387186 | 3300005543 | Bacteria | 1197 |
| 144 | Ga0070686_100287035 | 3300005544 | Bacteria | 1216 |
| 145 | Ga0070696_100011676 | 3300005546 | Bacteria | 5886 |
| 146 | Ga0070696_100176186 | 3300005546 | Bacteria | 1584 |
| 147 | Ga0070696_100328704 | 3300005546 | Bacteria | 1178 |
| 148 | Ga0070693_100006766 | 3300005547 | Bacteria | 5566 |
| 149 | Ga0070693_100019512 | 3300005547 | Bacteria | 3556 |
| 150 | Ga0070693_100106005 | 3300005547 | Bacteria | 1720 |
| 151 | Ga0070665_100051711 | 3300005548 | Bacteria | 4120 |
| 152 | Ga0070665_100125332 | 3300005548 | Bacteria | 2571 |
| 153 | Ga0070665_100211417 | 3300005548 | Bacteria | 1940 |
| 154 | Ga0070665_100327537 | 3300005548 | Bacteria | 1536 |
| 155 | Ga0070704_100069436 | 3300005549 | Unclassified | 2553 |
| 156 | Ga0070704_100124352 | 3300005549 | Bacteria | 1987 |
| 157 | Ga0070704_100294432 | 3300005549 | Bacteria | 1350 |
| 158 | Ga0068855_100012841 | 3300005563 | Bacteria | 10106 |
| 159 | Ga0068855_100016655 | 3300005563 | Bacteria | 8837 |
| 160 | Ga0068855_100022296 | 3300005563 | Bacteria | 7589 |
| 161 | Ga0068855_100052137 | 3300005563 | Bacteria | 4817 |
| 162 | Ga0068855_100094434 | 3300005563 | Bacteria | 3448 |
| 163 | Ga0068855_100462295 | 3300005563 | Bacteria | 1384 |
| 164 | Ga0070664_100044302 | 3300005564 | Bacteria | 3757 |
| 165 | Ga0070664_100106665 | 3300005564 | Bacteria | 2441 |
| 166 | Ga0070664_100182154 | 3300005564 | Bacteria | 1867 |
| 167 | Ga0068857_100104689 | 3300005577 | Bacteria | 2541 |
| 168 | Ga0068857_100110034 | 3300005577 | Bacteria | 2476 |
| 169 | Ga0068857_100118887 | 3300005577 | Bacteria | 2378 |
| 170 | Ga0068854_100062975 | 3300005578 | Bacteria | 2691 |
| 171 | Ga0068854_100074946 | 3300005578 | Bacteria | 2483 |
| 172 | Ga0068854_100239290 | 3300005578 | Bacteria | 1445 |
| 173 | Ga0068856_100024369 | 3300005614 | Bacteria | 5889 |
| 174 | Ga0068856_100028748 | 3300005614 | Bacteria | 5431 |
| 175 | Ga0068856_100053236 | 3300005614 | Bacteria | 3991 |
| 176 | Ga0068856_100077021 | 3300005614 | Bacteria | 3304 |
| 177 | Ga0068856_100135503 | 3300005614 | Bacteria | 2468 |
| 178 | Ga0068856_100288193 | 3300005614 | Bacteria | 1659 |
| 179 | Ga0070702_100006091 | 3300005615 | Bacteria | 5683 |
| 180 | Ga0070702_100077838 | 3300005615 | Bacteria | 1978 |
| 181 | Ga0070702_100137638 | 3300005615 | Bacteria | 1551 |
| 182 | Ga0070702_100336654 | 3300005615 | Bacteria | 1057 |
| 183 | Ga0068852_100112165 | 3300005616 | Bacteria | 2481 |
| 184 | Ga0068852_100270468 | 3300005616 | Bacteria | 1635 |
| 185 | Ga0068852_100281862 | 3300005616 | Bacteria | 1602 |
| 186 | Ga0068852_100353875 | 3300005616 | Bacteria | 1435 |
| 187 | Ga0068859_100178859 | 3300005617 | Bacteria | 2203 |
| 188 | Ga0068864_100063292 | 3300005618 | Bacteria | 3206 |
| 189 | Ga0068864_100138952 | 3300005618 | Unclassified | 2190 |
| 190 | Ga0068866_10034383 | 3300005718 | Bacteria | 2468 |
| 191 | Ga0068866_10046914 | 3300005718 | Bacteria | 2175 |
| 192 | Ga0068861_100077911 | 3300005719 | Bacteria | 2587 |
| 193 | Ga0068870_10001168 | 3300005840 | Bacteria | 10510 |
| 194 | Ga0068870_10038143 | 3300005840 | Bacteria | 2480 |
| 195 | Ga0068870_10055386 | 3300005840 | Bacteria | 2113 |
| 196 | Ga0068870_10185515 | 3300005840 | Bacteria | 1252 |
| 197 | Ga0068863_100079276 | 3300005841 | Bacteria | 3110 |
| 198 | Ga0068858_100035180 | 3300005842 | Bacteria | 4645 |
| 199 | Ga0068858_100128811 | 3300005842 | Bacteria | 2372 |
| 200 | Ga0068860_100145206 | 3300005843 | Bacteria | 2282 |
| 201 | Ga0068862_100067992 | 3300005844 | Bacteria | 3072 |
| 202 | Ga0068862_100390387 | 3300005844 | Bacteria | 1300 |
| 203 | Ga0081455_10020460 | 3300005937 | Bacteria | 6227 |
| 204 | Ga0081455_10029851 | 3300005937 | Bacteria | 4966 |
| 205 | Ga0081455_10053591 | 3300005937 | Unclassified | 3445 |
| 206 | Ga0081455_10075419 | 3300005937 | Bacteria | 2782 |
| 207 | Ga0081455_10099399 | 3300005937 | Bacteria | 2340 |
| 208 | Ga0081455_10135191 | 3300005937 | Bacteria | 1922 |
| 209 | Ga0081538_10000053 | 3300005981 | Bacteria | 109213 |
| 210 | Ga0081538_10000060 | 3300005981 | Bacteria | 101190 |
| 211 | Ga0081538_10001619 | 3300005981 | Bacteria | 23088 |
| 212 | Ga0081538_10003876 | 3300005981 | Bacteria | 13974 |
| 213 | Ga0081538_10023525 | 3300005981 | Bacteria | 4425 |
| 214 | Ga0081538_10085773 | 3300005981 | Bacteria | 1652 |
| 215 | Ga0081540_1028563 | 3300005983 | Bacteria | 3129 |
| 216 | Ga0081539_10005173 | 3300005985 | Bacteria | 13558 |
| 217 | Ga0081539_10008003 | 3300005985 | Bacteria | 9383 |
| 218 | Ga0081539_10133518 | 3300005985 | Bacteria | 1216 |
| 219 | Ga0070717_10036916 | 3300006028 | Bacteria | 3965 |
| 220 | Ga0070717_10381332 | 3300006028 | Unclassified | 1264 |
| 221 | Ga0075365_10083266 | 3300006038 | Bacteria | 2170 |
| 222 | Ga0075365_10267487 | 3300006038 | Bacteria | 1202 |
| 223 | Ga0075432_10001371 | 3300006058 | Bacteria | 7915 |
| 224 | Ga0075432_10046483 | 3300006058 | Bacteria | 1524 |
| 225 | Ga0070712_100168162 | 3300006175 | Bacteria | 1699 |
| 226 | Ga0070712_100441537 | 3300006175 | Bacteria | 1082 |
| 227 | Ga0097621_100335256 | 3300006237 | Bacteria | 1342 |
| 228 | Ga0097621_100474716 | 3300006237 | Bacteria | 1130 |
| 229 | Ga0068871_100369116 | 3300006358 | Bacteria | 1272 |
| 230 | Ga0075428_100000411 | 3300006844 | Bacteria | 42585 |
| 231 | Ga0075428_100005096 | 3300006844 | Bacteria | 14600 |
| 232 | Ga0075428_100019492 | 3300006844 | Bacteria | 7507 |
| 233 | Ga0075428_100165773 | 3300006844 | Bacteria | 2397 |
| 234 | Ga0075428_100242679 | 3300006844 | Bacteria | 1943 |
| 235 | Ga0075428_100535860 | 3300006844 | Bacteria | 1252 |
| 236 | Ga0075430_100001646 | 3300006846 | Bacteria | 18226 |
| 237 | Ga0075430_100188785 | 3300006846 | Bacteria | 1713 |
| 238 | Ga0075431_100008014 | 3300006847 | Bacteria | 10540 |
| 239 | Ga0075433_10079022 | 3300006852 | Bacteria | 2899 |
| 240 | Ga0075429_100011938 | 3300006880 | Bacteria | 7531 |
| 241 | Ga0075429_100084993 | 3300006880 | Bacteria | 2758 |
| 242 | Ga0068865_100005904 | 3300006881 | Bacteria | 7448 |
| 243 | Ga0068865_100086753 | 3300006881 | Bacteria | 2260 |
| 244 | Ga0068865_100188934 | 3300006881 | Bacteria | 1591 |
| 245 | Ga0097620_100178855 | 3300006931 | Bacteria | 2203 |
| 246 | Ga0075435_100057728 | 3300007076 | Bacteria | 3141 |
| 247 | Ga0075435_100189228 | 3300007076 | Bacteria | 1741 |
| 248 | Ga0105244_10164476 | 3300009036 | Bacteria | 1058 |
| 249 | Ga0105240_10055251 | 3300009093 | Bacteria | 4972 |
| 250 | Ga0105240_10130250 | 3300009093 | Bacteria | 3018 |
| 251 | Ga0105240_10158454 | 3300009093 | Bacteria | 2690 |
| 252 | Ga0105240_10217139 | 3300009093 | Bacteria | 2230 |
| 253 | Ga0111539_10005465 | 3300009094 | Bacteria | 16438 |
| 254 | Ga0111539_10006234 | 3300009094 | Bacteria | 15391 |
| 255 | Ga0111539_10026000 | 3300009094 | Bacteria | 7164 |
| 256 | Ga0111539_10076732 | 3300009094 | Bacteria | 3934 |
| 257 | Ga0111539_10087612 | 3300009094 | Bacteria | 3657 |
| 258 | Ga0111539_10213355 | 3300009094 | Bacteria | 2249 |
| 259 | Ga0111539_10259796 | 3300009094 | Bacteria | 2022 |
| 260 | Ga0111539_10894264 | 3300009094 | Unclassified | 1033 |
| 261 | Ga0105245_10036788 | 3300009098 | Bacteria | 4350 |
| 262 | Ga0105245_10059563 | 3300009098 | Bacteria | 3438 |
| 263 | Ga0105245_10191049 | 3300009098 | Bacteria | 1961 |
| 264 | Ga0105245_10414208 | 3300009098 | Bacteria | 1349 |
| 265 | Ga0105245_10726400 | 3300009098 | Bacteria | 1028 |
| 266 | Ga0105245_10868041 | 3300009098 | Bacteria | 943 |
| 267 | Ga0105247_10031890 | 3300009101 | Bacteria | 3199 |
| 268 | Ga0105247_10130276 | 3300009101 | Bacteria | 1639 |
| 269 | Ga0114129_10006651 | 3300009147 | Bacteria | 16412 |
| 270 | Ga0114129_10035068 | 3300009147 | Bacteria | 7088 |
| 271 | Ga0114129_10041736 | 3300009147 | Bacteria | 6461 |
| 272 | Ga0114129_10059915 | 3300009147 | Bacteria | 5323 |
| 273 | Ga0114129_10241534 | 3300009147 | Bacteria | 2428 |
| 274 | Ga0114129_10670477 | 3300009147 | Bacteria | 1336 |
| 275 | Ga0114129_10710552 | 3300009147 | Bacteria | 1291 |
| 276 | Ga0105243_10007699 | 3300009148 | Bacteria | 8280 |
| 277 | Ga0105243_10021955 | 3300009148 | Bacteria | 4848 |
| 278 | Ga0105243_10028908 | 3300009148 | Bacteria | 4260 |
| 279 | Ga0105243_10118470 | 3300009148 | Bacteria | 2228 |
| 280 | Ga0105241_10162076 | 3300009174 | Bacteria | 1839 |
| 281 | Ga0105241_10399936 | 3300009174 | Bacteria | 1204 |
| 282 | Ga0105241_10600437 | 3300009174 | Bacteria | 994 |
| 283 | Ga0105242_10019197 | 3300009176 | Bacteria | 5355 |
| 284 | Ga0105242_10038091 | 3300009176 | Bacteria | 3864 |
| 285 | Ga0105242_10038126 | 3300009176 | Bacteria | 3863 |
| 286 | Ga0105242_10236841 | 3300009176 | Bacteria | 1639 |
| 287 | Ga0105242_10334705 | 3300009176 | Bacteria | 1393 |
| 288 | Ga0105242_10533360 | 3300009176 | Bacteria | 1122 |
| 289 | Ga0105242_11035516 | 3300009176 | Bacteria | 831 |
| 290 | Ga0105248_10117333 | 3300009177 | Bacteria | 3002 |
| 291 | Ga0105248_10446221 | 3300009177 | Bacteria | 1458 |
| 292 | Ga0105248_10481304 | 3300009177 | Bacteria | 1399 |
| 293 | Ga0105248_11146134 | 3300009177 | Bacteria | 879 |
| 294 | Ga0105237_10396537 | 3300009545 | Bacteria | 1385 |
| 295 | Ga0105238_10013751 | 3300009551 | Bacteria | 8179 |
| 296 | Ga0105238_10094488 | 3300009551 | Bacteria | 2978 |
| 297 | Ga0105249_10104608 | 3300009553 | Bacteria | 2668 |
| 298 | Ga0105249_10349009 | 3300009553 | Bacteria | 1498 |
| 299 | Ga0105239_10023094 | 3300010375 | Bacteria | 6854 |
| 300 | Ga0105239_10025839 | 3300010375 | Bacteria | 6467 |
| 301 | Ga0105239_10060540 | 3300010375 | Bacteria | 4155 |
| 302 | Ga0105239_10308615 | 3300010375 | Bacteria | 1783 |
| 303 | Ga0105239_10891531 | 3300010375 | Bacteria | 1021 |
| 304 | Ga0105239_10962387 | 3300010375 | Bacteria | 981 |
| 305 | Ga0105246_10015487 | 3300011119 | Bacteria | 4819 |
| 306 | Ga0105246_10080467 | 3300011119 | Bacteria | 2319 |
| 307 | Ga0105246_10092536 | 3300011119 | Bacteria | 2182 |
| 308 | Ga0105246_11081543 | 3300011119 | Unclassified | 731 |
| 309 | Ga0157371_10030301 | 3300013102 | Bacteria | 3903 |
| 310 | Ga0157371_10159266 | 3300013102 | Bacteria | 1612 |
| 311 | Ga0157371_10165057 | 3300013102 | Bacteria | 1582 |
| 312 | Ga0157370_10016119 | 3300013104 | Bacteria | 7575 |
| 313 | Ga0157370_10045044 | 3300013104 | Bacteria | 4235 |
| 314 | Ga0157370_10055018 | 3300013104 | Bacteria | 3793 |
| 315 | Ga0157370_10076769 | 3300013104 | Bacteria | 3147 |
| 316 | Ga0157370_10095728 | 3300013104 | Bacteria | 2785 |
| 317 | Ga0157370_10189639 | 3300013104 | Bacteria | 1908 |
| 318 | Ga0157370_10451684 | 3300013104 | Bacteria | 1181 |
| 319 | Ga0157369_10002303 | 3300013105 | Bacteria | 22963 |
| 320 | Ga0157369_10010556 | 3300013105 | Bacteria | 10509 |
| 321 | Ga0157369_10015027 | 3300013105 | Bacteria | 8737 |
| 322 | Ga0157369_10046905 | 3300013105 | Bacteria | 4694 |
| 323 | Ga0157369_10403841 | 3300013105 | Bacteria | 1417 |
| 324 | Ga0157374_10440189 | 3300013296 | Bacteria | 1304 |
| 325 | Ga0157374_10486337 | 3300013296 | Bacteria | 1238 |
| 326 | Ga0157374_10703585 | 3300013296 | Bacteria | 1023 |
| 327 | Ga0157378_10572261 | 3300013297 | Unclassified | 1138 |
| 328 | Ga0163162_10427020 | 3300013306 | Bacteria | 1457 |
| 329 | Ga0157372_10152275 | 3300013307 | Bacteria | 2670 |
| 330 | Ga0157372_10255136 | 3300013307 | Bacteria | 2036 |
| 331 | Ga0157372_10318912 | 3300013307 | Bacteria | 1809 |
| 332 | Ga0157372_10345417 | 3300013307 | Bacteria | 1734 |
| 333 | Ga0157372_10463449 | 3300013307 | Bacteria | 1477 |
| 334 | Ga0157372_10797499 | 3300013307 | Bacteria | 1097 |
| 335 | Ga0157375_10014615 | 3300013308 | Bacteria | 7011 |
| 336 | Ga0157375_10080878 | 3300013308 | Bacteria | 3288 |
| 337 | Ga0157375_10117242 | 3300013308 | Bacteria | 2768 |
| 338 | Ga0157375_10143581 | 3300013308 | Bacteria | 2516 |
| 339 | Ga0157375_10467082 | 3300013308 | Bacteria | 1427 |
| 340 | Ga0157375_10575488 | 3300013308 | Bacteria | 1287 |
| 341 | Ga0163163_10003920 | 3300014325 | Bacteria | 12691 |
| 342 | Ga0163163_10013038 | 3300014325 | Bacteria | 7589 |
| 343 | Ga0163163_10041946 | 3300014325 | Bacteria | 4478 |
| 344 | Ga0163163_10116876 | 3300014325 | Bacteria | 2698 |
| 345 | Ga0163163_10439331 | 3300014325 | Bacteria | 1364 |
| 346 | Ga0157380_10014017 | 3300014326 | Bacteria | 5856 |
| 347 | Ga0157380_10034055 | 3300014326 | Bacteria | 3927 |
| 348 | Ga0157380_10080696 | 3300014326 | Bacteria | 2659 |
| 349 | Ga0157380_10118739 | 3300014326 | Bacteria | 2236 |
| 350 | Ga0157377_10044381 | 3300014745 | Bacteria | 2478 |
| 351 | Ga0157377_10064623 | 3300014745 | Bacteria | 2099 |
| 352 | Ga0157377_10144168 | 3300014745 | Bacteria | 1466 |
| 353 | Ga0157379_10068549 | 3300014968 | Bacteria | 3171 |
| 354 | Ga0157376_10099591 | 3300014969 | Bacteria | 2536 |
| 355 | Ga0157376_10253723 | 3300014969 | Bacteria | 1644 |
| 356 | Ga0157376_10556644 | 3300014969 | Bacteria | 1136 |
| 357 | Ga0163161_10040750 | 3300017792 | Bacteria | 3336 |
| 358 | Ga0197907_10409808 | 3300020069 | Bacteria | 2016 |
| 359 | Ga0197907_10896525 | 3300020069 | Bacteria | 1296 |
| 360 | Ga0206356_10031764 | 3300020070 | Bacteria | 2218 |
| 361 | Ga0206356_10355467 | 3300020070 | Bacteria | 2086 |
| 362 | Ga0206356_10456913 | 3300020070 | Bacteria | 1774 |
| 363 | Ga0206354_10030587 | 3300020081 | Bacteria | 2211 |
| 364 | Ga0206354_11649605 | 3300020081 | Bacteria | 1912 |
| 365 | Ga0206353_11455507 | 3300020082 | Bacteria | 4366 |
| 366 | Ga0206353_11548455 | 3300020082 | Bacteria | 5480 |
| 367 | Ga0207653_10030307 | 3300025885 | Bacteria | 1745 |
| 368 | Ga0207642_10082910 | 3300025899 | Bacteria | 1562 |
| 369 | Ga0207642_10083670 | 3300025899 | Bacteria | 1556 |
| 370 | Ga0207642_10205794 | 3300025899 | Bacteria | 1090 |
| 371 | Ga0207710_10034316 | 3300025900 | Bacteria | 2229 |
| 372 | Ga0207688_10058305 | 3300025901 | Bacteria | 2173 |
| 373 | Ga0207645_10042757 | 3300025907 | Bacteria | 2899 |
| 374 | Ga0207645_10308411 | 3300025907 | Bacteria | 1054 |
| 375 | Ga0207643_10001394 | 3300025908 | Bacteria | 13872 |
| 376 | Ga0207643_10011125 | 3300025908 | Bacteria | 4857 |
| 377 | Ga0207643_10019487 | 3300025908 | Bacteria | 3718 |
| 378 | Ga0207643_10053201 | 3300025908 | Bacteria | 2300 |
| 379 | Ga0207643_10089647 | 3300025908 | Bacteria | 1791 |
| 380 | Ga0207705_10022323 | 3300025909 | Bacteria | 4513 |
| 381 | Ga0207705_10045636 | 3300025909 | Bacteria | 3149 |
| 382 | Ga0207705_10143292 | 3300025909 | Bacteria | 1786 |
| 383 | Ga0207705_10217262 | 3300025909 | Bacteria | 1451 |
| 384 | Ga0207684_10099042 | 3300025910 | Bacteria | 2490 |
| 385 | Ga0207684_10112907 | 3300025910 | Bacteria | 2326 |
| 386 | Ga0207654_10056324 | 3300025911 | Bacteria | 2280 |
| 387 | Ga0207654_10082553 | 3300025911 | Bacteria | 1938 |
| 388 | Ga0207707_10003519 | 3300025912 | Bacteria | 13867 |
| 389 | Ga0207707_10009500 | 3300025912 | Bacteria | 8438 |
| 390 | Ga0207707_10010456 | 3300025912 | Bacteria | 8052 |
| 391 | Ga0207707_10048497 | 3300025912 | Bacteria | 3699 |
| 392 | Ga0207707_10060472 | 3300025912 | Bacteria | 3296 |
| 393 | Ga0207707_10232339 | 3300025912 | Bacteria | 1604 |
| 394 | Ga0207707_10237107 | 3300025912 | Bacteria | 1587 |
| 395 | Ga0207695_10445632 | 3300025913 | Unclassified | 1178 |
| 396 | Ga0207695_10588678 | 3300025913 | Bacteria | 994 |
| 397 | Ga0207671_10098486 | 3300025914 | Bacteria | 2212 |
| 398 | Ga0207693_10029592 | 3300025915 | Bacteria | 4324 |
| 399 | Ga0207693_10367469 | 3300025915 | Bacteria | 1125 |
| 400 | Ga0207663_10079884 | 3300025916 | Bacteria | 2137 |
| 401 | Ga0207663_10297435 | 3300025916 | Bacteria | 1205 |
| 402 | Ga0207660_10006022 | 3300025917 | Bacteria | 7872 |
| 403 | Ga0207660_10006989 | 3300025917 | Bacteria | 7309 |
| 404 | Ga0207660_10055775 | 3300025917 | Bacteria | 2825 |
| 405 | Ga0207660_10136576 | 3300025917 | Bacteria | 1871 |
| 406 | Ga0207660_10350383 | 3300025917 | Bacteria | 1183 |
| 407 | Ga0207662_10046335 | 3300025918 | Bacteria | 2572 |
| 408 | Ga0207662_10049628 | 3300025918 | Bacteria | 2490 |
| 409 | Ga0207657_10000964 | 3300025919 | Bacteria | 30488 |
| 410 | Ga0207657_10005129 | 3300025919 | Bacteria | 13727 |
| 411 | Ga0207657_10006273 | 3300025919 | Bacteria | 12358 |
| 412 | Ga0207657_10015819 | 3300025919 | Bacteria | 7292 |
| 413 | Ga0207657_10019162 | 3300025919 | Bacteria | 6507 |
| 414 | Ga0207657_10037998 | 3300025919 | Bacteria | 4292 |
| 415 | Ga0207649_10026660 | 3300025920 | Bacteria | 3383 |
| 416 | Ga0207649_10111901 | 3300025920 | Bacteria | 1826 |
| 417 | Ga0207649_10125261 | 3300025920 | Bacteria | 1738 |
| 418 | Ga0207649_10256595 | 3300025920 | Bacteria | 1262 |
| 419 | Ga0207649_10275813 | 3300025920 | Bacteria | 1221 |
| 420 | Ga0207652_10004108 | 3300025921 | Bacteria | 11877 |
| 421 | Ga0207652_10016334 | 3300025921 | Bacteria | 6059 |
| 422 | Ga0207652_10023280 | 3300025921 | Bacteria | 5130 |
| 423 | Ga0207652_10104857 | 3300025921 | Bacteria | 2501 |
| 424 | Ga0207652_10142354 | 3300025921 | Bacteria | 2145 |
| 425 | Ga0207652_10192852 | 3300025921 | Unclassified | 1832 |
| 426 | Ga0207652_10329969 | 3300025921 | Bacteria | 1377 |
| 427 | Ga0207646_10443255 | 3300025922 | Bacteria | 1172 |
| 428 | Ga0207681_10093155 | 3300025923 | Bacteria | 2156 |
| 429 | Ga0207681_10163446 | 3300025923 | Bacteria | 1681 |
| 430 | Ga0207681_10212534 | 3300025923 | Bacteria | 1492 |
| 431 | Ga0207681_10424348 | 3300025923 | Bacteria | 1078 |
| 432 | Ga0207694_10157213 | 3300025924 | Bacteria | 1834 |
| 433 | Ga0207650_10086636 | 3300025925 | Bacteria | 2384 |
| 434 | Ga0207659_10109256 | 3300025926 | Bacteria | 2099 |
| 435 | Ga0207687_10028420 | 3300025927 | Bacteria | 3756 |
| 436 | Ga0207687_10144978 | 3300025927 | Bacteria | 1806 |
| 437 | Ga0207687_10162881 | 3300025927 | Bacteria | 1713 |
| 438 | Ga0207687_10169103 | 3300025927 | Bacteria | 1684 |
| 439 | Ga0207687_10345717 | 3300025927 | Bacteria | 1210 |
| 440 | Ga0207700_10066710 | 3300025928 | Bacteria | 2751 |
| 441 | Ga0207664_10305579 | 3300025929 | Bacteria | 1400 |
| 442 | Ga0207664_10731049 | 3300025929 | Bacteria | 890 |
| 443 | Ga0207664_10825459 | 3300025929 | Bacteria | 834 |
| 444 | Ga0207644_10097090 | 3300025931 | Bacteria | 2207 |
| 445 | Ga0207644_10266247 | 3300025931 | Bacteria | 1372 |
| 446 | Ga0207690_10026511 | 3300025932 | Bacteria | 3649 |
| 447 | Ga0207690_10038356 | 3300025932 | Bacteria | 3117 |
| 448 | Ga0207690_10116671 | 3300025932 | Bacteria | 1931 |
| 449 | Ga0207690_10185241 | 3300025932 | Bacteria | 1570 |
| 450 | Ga0207706_10009052 | 3300025933 | Bacteria | 9160 |
| 451 | Ga0207706_10028469 | 3300025933 | Bacteria | 4989 |
| 452 | Ga0207686_10087634 | 3300025934 | Bacteria | 2048 |
| 453 | Ga0207686_10120860 | 3300025934 | Bacteria | 1783 |
| 454 | Ga0207686_10208494 | 3300025934 | Bacteria | 1404 |
| 455 | Ga0207709_10015116 | 3300025935 | Bacteria | 4276 |
| 456 | Ga0207709_10201683 | 3300025935 | Bacteria | 1421 |
| 457 | Ga0207670_10048334 | 3300025936 | Bacteria | 2838 |
| 458 | Ga0207670_10099191 | 3300025936 | Bacteria | 2077 |
| 459 | Ga0207669_10074747 | 3300025937 | Bacteria | 2144 |
| 460 | Ga0207669_10105227 | 3300025937 | Bacteria | 1876 |
| 461 | Ga0207669_10165568 | 3300025937 | Bacteria | 1567 |
| 462 | Ga0207704_10032534 | 3300025938 | Bacteria | 2953 |
| 463 | Ga0207704_10033752 | 3300025938 | Bacteria | 2914 |
| 464 | Ga0207704_10122465 | 3300025938 | Bacteria | 1783 |
| 465 | Ga0207691_10014782 | 3300025940 | Bacteria | 7440 |
| 466 | Ga0207691_10037730 | 3300025940 | Bacteria | 4473 |
| 467 | Ga0207691_10047204 | 3300025940 | Bacteria | 3954 |
| 468 | Ga0207691_10481241 | 3300025940 | Bacteria | 1055 |
| 469 | Ga0207711_10084135 | 3300025941 | Bacteria | 2784 |
| 470 | Ga0207711_10198323 | 3300025941 | Bacteria | 1831 |
| 471 | Ga0207711_10273676 | 3300025941 | Bacteria | 1554 |
| 472 | Ga0207689_10146634 | 3300025942 | Bacteria | 1944 |
| 473 | Ga0207689_10215945 | 3300025942 | Bacteria | 1585 |
| 474 | Ga0207661_10000504 | 3300025944 | Bacteria | 25223 |
| 475 | Ga0207661_10030216 | 3300025944 | Bacteria | 4171 |
| 476 | Ga0207661_10078061 | 3300025944 | Bacteria | 2724 |
| 477 | Ga0207661_10180837 | 3300025944 | Bacteria | 1842 |
| 478 | Ga0207661_10207740 | 3300025944 | Unclassified | 1724 |
| 479 | Ga0207661_10288065 | 3300025944 | Bacteria | 1469 |
| 480 | Ga0207661_10339606 | 3300025944 | Bacteria | 1353 |
| 481 | Ga0207661_10421831 | 3300025944 | Bacteria | 1212 |
| 482 | Ga0207661_10517096 | 3300025944 | Bacteria | 1091 |
| 483 | Ga0207679_10001100 | 3300025945 | Bacteria | 17213 |
| 484 | Ga0207679_10087018 | 3300025945 | Bacteria | 2405 |
| 485 | Ga0207667_10037484 | 3300025949 | Bacteria | 5181 |
| 486 | Ga0207667_10136180 | 3300025949 | Bacteria | 2529 |
| 487 | Ga0207667_10243197 | 3300025949 | Bacteria | 1841 |
| 488 | Ga0207667_10378071 | 3300025949 | Bacteria | 1443 |
| 489 | Ga0207651_10127222 | 3300025960 | Bacteria | 1944 |
| 490 | Ga0207651_10238499 | 3300025960 | Bacteria | 1480 |
| 491 | Ga0207651_10293315 | 3300025960 | Bacteria | 1349 |
| 492 | Ga0207712_10379298 | 3300025961 | Bacteria | 1183 |
| 493 | Ga0207668_10027746 | 3300025972 | Bacteria | 3692 |
| 494 | Ga0207668_10110569 | 3300025972 | Bacteria | 2061 |
| 495 | Ga0207668_10612357 | 3300025972 | Bacteria | 950 |
| 496 | Ga0207640_10014605 | 3300025981 | Bacteria | 4525 |
| 497 | Ga0207640_10033043 | 3300025981 | Bacteria | 3214 |
| 498 | Ga0207640_10092949 | 3300025981 | Bacteria | 2094 |
| 499 | Ga0207640_10184494 | 3300025981 | Bacteria | 1567 |
| 500 | Ga0207658_10017741 | 3300025986 | Bacteria | 4905 |
| 501 | Ga0207658_10126294 | 3300025986 | Bacteria | 2048 |
| 502 | Ga0207677_10212035 | 3300026023 | Bacteria | 1547 |
| 503 | Ga0207677_10675882 | 3300026023 | Bacteria | 914 |
| 504 | Ga0207639_10205217 | 3300026041 | Bacteria | 1693 |
| 505 | Ga0207639_10256476 | 3300026041 | Bacteria | 1527 |
| 506 | Ga0207678_10081335 | 3300026067 | Bacteria | 2773 |
| 507 | Ga0207678_10280944 | 3300026067 | Bacteria | 1429 |
| 508 | Ga0207678_10365984 | 3300026067 | Bacteria | 1245 |
| 509 | Ga0207708_10007756 | 3300026075 | Bacteria | 7948 |
| 510 | Ga0207708_10023543 | 3300026075 | Bacteria | 4657 |
| 511 | Ga0207702_10103209 | 3300026078 | Bacteria | 2521 |
| 512 | Ga0207702_10169536 | 3300026078 | Bacteria | 2000 |
| 513 | Ga0207702_10717734 | 3300026078 | Bacteria | 985 |
| 514 | Ga0207641_10054555 | 3300026088 | Bacteria | 3392 |
| 515 | Ga0207648_10002280 | 3300026089 | Bacteria | 20731 |
| 516 | Ga0207648_10026183 | 3300026089 | Bacteria | 5185 |
| 517 | Ga0207648_10065063 | 3300026089 | Bacteria | 3179 |
| 518 | Ga0207648_10329420 | 3300026089 | Bacteria | 1373 |
| 519 | Ga0207676_10016301 | 3300026095 | Bacteria | 5380 |
| 520 | Ga0207676_10029559 | 3300026095 | Bacteria | 4105 |
| 521 | Ga0207676_10178285 | 3300026095 | Bacteria | 1858 |
| 522 | Ga0207674_10013923 | 3300026116 | Bacteria | 8898 |
| 523 | Ga0207674_10041497 | 3300026116 | Bacteria | 4759 |
| 524 | Ga0207674_10049525 | 3300026116 | Bacteria | 4296 |
| 525 | Ga0207674_10064950 | 3300026116 | Bacteria | 3680 |
| 526 | Ga0207674_10178378 | 3300026116 | Bacteria | 2076 |
| 527 | Ga0207674_10369253 | 3300026116 | Bacteria | 1387 |
| 528 | Ga0207675_100011398 | 3300026118 | Bacteria | 8319 |
| 529 | Ga0207675_100061290 | 3300026118 | Bacteria | 3512 |
| 530 | Ga0207675_100150180 | 3300026118 | Bacteria | 2217 |
| 531 | Ga0207683_10037573 | 3300026121 | Bacteria | 4217 |
| 532 | Ga0207683_10037902 | 3300026121 | Bacteria | 4199 |
| 533 | Ga0207683_10097515 | 3300026121 | Bacteria | 2622 |
| 534 | Ga0207683_10227005 | 3300026121 | Bacteria | 1702 |
| 535 | Ga0207683_10285353 | 3300026121 | Bacteria | 1509 |
| 536 | Ga0207698_10077666 | 3300026142 | Bacteria | 2663 |
| 537 | Ga0207698_10368561 | 3300026142 | Bacteria | 1362 |
| 538 | Ga0207428_10000108 | 3300027907 | Bacteria | 115378 |
| 539 | Ga0207428_10007111 | 3300027907 | Bacteria | 10243 |
| 540 | Ga0207428_10022197 | 3300027907 | Bacteria | 5359 |
| 541 | Ga0207428_10028411 | 3300027907 | Bacteria | 4647 |
| 542 | Ga0207428_10289215 | 3300027907 | Bacteria | 1215 |
| 543 | Ga0268266_10022553 | 3300028379 | Bacteria | 5363 |
| 544 | Ga0268266_10041268 | 3300028379 | Bacteria | 3937 |
| 545 | Ga0268266_10363091 | 3300028379 | Bacteria | 1363 |
| 546 | Ga0268266_10481416 | 3300028379 | Bacteria | 1183 |
| 547 | Ga0268266_10577510 | 3300028379 | Bacteria | 1079 |
| 548 | Ga0268265_10202773 | 3300028380 | Bacteria | 1722 |
| 549 | Ga0268264_10096268 | 3300028381 | Bacteria | 2563 |
| 550 | Ga0268264_10192627 | 3300028381 | Bacteria | 1859 |
| 551 | Ga0268264_11036588 | 3300028381 | Bacteria | 828 |
| 552 | Ga0265326_10010724 | 3300028558 | Bacteria | 2716 |
| 553 | Ga0265319_1021414 | 3300028563 | Bacteria | 2374 |
| 554 | Ga0265318_10037910 | 3300028577 | Bacteria | 1844 |
| 555 | Ga0265338_10030316 | 3300028800 | Bacteria | 5331 |
| 556 | Ga0265338_10035415 | 3300028800 | Bacteria | 4799 |
| 557 | Ga0265338_10126744 | 3300028800 | Bacteria | 2024 |
| 558 | Ga0265328_10024366 | 3300031239 | Bacteria | 2287 |
| 559 | Ga0265320_10052353 | 3300031240 | Bacteria | 1977 |
| 560 | Ga0265325_10010118 | 3300031241 | Bacteria | 5477 |
| 561 | Ga0265329_10023878 | 3300031242 | Bacteria | 2032 |
| 562 | Ga0265339_10016391 | 3300031249 | Bacteria | 4418 |
| 563 | Ga0265331_10052052 | 3300031250 | Bacteria | 1957 |
| 564 | Ga0265327_10030796 | 3300031251 | Bacteria | 3026 |
| 565 | Ga0265327_10033181 | 3300031251 | Bacteria | 2880 |
| 566 | Ga0265327_10041907 | 3300031251 | Bacteria | 2462 |
| 567 | Ga0265316_10072474 | 3300031344 | Bacteria | 2653 |
| 568 | Ga0307408_100194268 | 3300031548 | Bacteria | 1638 |
| 569 | Ga0307408_100346381 | 3300031548 | Bacteria | 1259 |
| 570 | Ga0265313_10015452 | 3300031595 | Bacteria | 4441 |
| 571 | Ga0265313_10024998 | 3300031595 | Bacteria | 3176 |
| 572 | Ga0265314_10008957 | 3300031711 | Bacteria | 8517 |
| 573 | Ga0265314_10045410 | 3300031711 | Bacteria | 3107 |
| 574 | Ga0265342_10025929 | 3300031712 | Bacteria | 3679 |
| 575 | Ga0307410_10296863 | 3300031852 | Bacteria | 1273 |
| 576 | Ga0307407_10260407 | 3300031903 | Bacteria | 1193 |
| 577 | Ga0307412_10165365 | 3300031911 | Bacteria | 1649 |
| 578 | Ga0307412_10171630 | 3300031911 | Bacteria | 1622 |
| 579 | Ga0307409_100035699 | 3300031995 | Bacteria | 3645 |
| 580 | Ga0307416_100332500 | 3300032002 | Bacteria | 1528 |
| 581 | Ga0307416_100359604 | 3300032002 | Bacteria | 1477 |
| 582 | Ga0307414_10244955 | 3300032004 | Bacteria | 1486 |
| 583 | Ga0307415_100266713 | 3300032126 | Bacteria | 1400 |
| 584 | Ga0373938_0012473 | 3300034957 | Bacteria | 1595 |
| 585 | Ga0373926_0026260 | 3300035083 | Bacteria | 2036 |
| 586 | Ga0373926_0037205 | 3300035083 | Bacteria | 1731 |
| 587 | Ga0373934_0032538 | 3300035086 | Unclassified | 2046 |
| 588 | Ga0373944_0007465 | 3300035089 | Bacteria | 2933 |
| 589 | Ga0373944_0025593 | 3300035089 | Bacteria | 1738 |
| 590 | Ga0373951_0009786 | 3300035091 | Bacteria | 2156 |
| 591 | Ga0373952_0010306 | 3300035092 | Bacteria | 1804 |
| 592 | Ga0373936_0015074 | 3300035113 | Bacteria | 2960 |
| 593 | Ga0373939_0235164 | 3300035114 | Bacteria | 707 |
| 594 | Ga0373941_0112181 | 3300035115 | Bacteria | 962 |
| 595 | Ga0373945_0002007 | 3300035116 | Bacteria | 6328 |
| 596 | Ga0373956_0076238 | 3300035119 | Unclassified | 1534 |
| 597 | Ga0373960_0012535 | 3300035121 | Bacteria | 2109 |
| 598 | Ga0373943_0000968 | 3300035170 | Bacteria | 12761 |
| 599 | Ga0373943_0005277 | 3300035170 | Bacteria | 5814 |
| 600 | Ga0373943_0009624 | 3300035170 | Bacteria | 4330 |
| 601 | Ga0373943_0026802 | 3300035170 | Bacteria | 2703 |
| 602 | Ga0373946_0000950 | 3300035171 | Bacteria | 9916 |
| 603 | Ga0373946_0030674 | 3300035171 | Bacteria | 2148 |
| 604 | Ga0373946_0084228 | 3300035171 | Bacteria | 1398 |
| 605 | Ga0373961_0014308 | 3300035241 | Bacteria | 2014 |
| 606 | Ga0373931_0147565 | 3300035691 | Bacteria | 1368 |
| 607 | Ga0373935_0035080 | 3300035692 | Bacteria | 3130 |
| 608 | Ga0373935_0046128 | 3300035692 | Bacteria | 2752 |
| 609 | Ga0373935_0079007 | 3300035692 | Bacteria | 2135 |
| 610 | Ga0373935_0184417 | 3300035692 | Bacteria | 1434 |
| 611 | Ga0373927_0211566 | 3300035695 | Bacteria | 1274 |
| 612 | Ga0373947_0001964 | 3300035725 | Bacteria | 12587 |
| 613 | Ga0373947_0010758 | 3300035725 | Bacteria | 5250 |
| 614 | Ga0373947_0037586 | 3300035725 | Bacteria | 2873 |
| 615 | Ga0373947_0056406 | 3300035725 | Bacteria | 2374 |
| 616 | Ga0373947_0123861 | 3300035725 | Bacteria | 1644 |
| 617 | Ga0373947_0280159 | 3300035725 | Bacteria | 1108 |
| 618 | Ga0373937_0222149 | 3300036401 | Bacteria | 1778 |
| 619 | Ga0373925_0037531 | 3300037068 | Bacteria | 3577 |
| 620 | Ga0373925_0038325 | 3300037068 | Bacteria | 3543 |
| 621 | Ga0373925_0082725 | 3300037068 | Bacteria | 2444 |
| 622 | Ga0373925_0191575 | 3300037068 | Bacteria | 1622 |
| 623 | Ga0395899_0039928 | 3300037312 | Bacteria | 3511 |
| 624 | Ga0395899_0209533 | 3300037312 | Bacteria | 1355 |
| 625 | Ga0395900_0001643 | 3300037418 | Bacteria | 26244 |
| 626 | Ga0395900_0005467 | 3300037418 | Bacteria | 13302 |
| 627 | Ga0395900_0039238 | 3300037418 | Bacteria | 4879 |
| 628 | Ga0395900_0078466 | 3300037418 | Bacteria | 3393 |
| 629 | Ga0395900_0146606 | 3300037418 | Bacteria | 2413 |
| 630 | Ga0395900_0236231 | 3300037418 | Bacteria | 1836 |
| 631 | Ga0395900_0243407 | 3300037418 | Bacteria | 1803 |
| 632 | Ga0395900_0263495 | 3300037418 | Bacteria | 1720 |
| 633 | Ga0395900_0361778 | 3300037418 | Bacteria | 1422 |
| 634 | Ga0395898_0013457 | 3300037466 | Bacteria | 8425 |
| 635 | Ga0395898_0013908 | 3300037466 | Bacteria | 8270 |
| 636 | Ga0395898_0039522 | 3300037466 | Bacteria | 4670 |
| 637 | Ga0395898_0041036 | 3300037466 | Bacteria | 4573 |
| 638 | Ga0395898_0064476 | 3300037466 | Bacteria | 3553 |
| 639 | Ga0395898_0076771 | 3300037466 | Bacteria | 3225 |
| 640 | Ga0395898_0310855 | 3300037466 | Bacteria | 1503 |
| 641 | Ga0395898_0506189 | 3300037466 | Bacteria | 1148 |
| 642 | Ga0395905_0003232 | 3300037471 | Bacteria | 17522 |
| 643 | Ga0395905_0030084 | 3300037471 | Bacteria | 5118 |
| 644 | Ga0395905_0041418 | 3300037471 | Bacteria | 4322 |
| 645 | Ga0395905_0130549 | 3300037471 | Bacteria | 2363 |
| 646 | Ga0395905_0367028 | 3300037471 | Unclassified | 1333 |
| 647 | Ga0395905_0711909 | 3300037471 | Bacteria | 906 |
| 648 | Ga0395901_0003358 | 3300038443 | Bacteria | 16123 |
| 649 | Ga0395901_0009655 | 3300038443 | Bacteria | 9787 |
| 650 | Ga0395901_0010984 | 3300038443 | Bacteria | 9176 |
| 651 | Ga0395901_0018859 | 3300038443 | Bacteria | 7052 |
| 652 | Ga0395901_0020099 | 3300038443 | Bacteria | 6834 |
| 653 | Ga0395901_0064283 | 3300038443 | Bacteria | 3819 |
| 654 | Ga0395901_0082007 | 3300038443 | Bacteria | 3369 |
| 655 | Ga0395901_0084454 | 3300038443 | Bacteria | 3318 |
| 656 | Ga0395901_0178005 | 3300038443 | Bacteria | 2230 |
| 657 | Ga0395901_0270350 | 3300038443 | Bacteria | 1768 |
| 658 | Ga0395901_0293067 | 3300038443 | Bacteria | 1688 |
| 659 | Ga0395901_0872780 | 3300038443 | Bacteria | 883 |
| 660 | Ga0395901_1011125 | 3300038443 | Bacteria | 807 |
| 661 | Ga0436365_0347461 | 3300039437 | Bacteria | 4435 |
| 662 | Ga0436365_1709962 | 3300039437 | Bacteria | 4870 |
| 663 | Ga0436363_0108127 | 3300039450 | Bacteria | 4441 |
| 664 | Ga0436362_0004195 | 3300039453 | Bacteria | 1583 |
| 665 | Ga0436362_0693060 | 3300039453 | Bacteria | 2856 |
| 666 | Ga0439436_0033515 | 3300041404 | Bacteria | 1487 |
| 667 | Ga0439439_0005760 | 3300041406 | Bacteria | 2843 |
| 668 | Ga0439453_0007744 | 3300041408 | Unclassified | 1712 |
| 669 | Ga0439461_0011302 | 3300041410 | Bacteria | 1654 |
| 670 | Ga0439461_0011825 | 3300041410 | Bacteria | 1625 |
| 671 | Ga0439466_0026205 | 3300041411 | Bacteria | 2029 |
| 672 | Ga0451789_0814888 | 3300041443 | Bacteria | 2852 |
| 673 | Ga0451802_0785545 | 3300041460 | Bacteria | 1329 |
| 674 | Ga0451804_0467915 | 3300041463 | Bacteria | 1517 |
| 675 | Ga0451839_0279640 | 3300041496 | Bacteria | 3481 |
| 676 | Ga0451845_0652193 | 3300041501 | Bacteria | 1631 |
| 677 | Ga0451849_0359582 | 3300041505 | Bacteria | 3925 |
| 678 | Ga0451851_1288862 | 3300041507 | Bacteria | 1801 |
| 679 | Ga0451853_0484657 | 3300041512 | Bacteria | 2603 |
| 680 | Ga0439431_0012423 | 3300041997 | Bacteria | 1957 |
| 681 | Ga0439433_0000829 | 3300041999 | Bacteria | 6105 |
| 682 | Ga0439437_002296 | 3300042000 | Bacteria | 2044 |
| 683 | Ga0439442_027457 | 3300042002 | Bacteria | 1186 |
| 684 | Ga0439432_037000 | 3300042006 | Bacteria | 1560 |
| 685 | Ga0439449_0004389 | 3300042007 | Bacteria | 5442 |
| 686 | Ga0439449_0121727 | 3300042007 | Bacteria | 969 |
| 687 | Ga0439451_003997 | 3300042009 | Bacteria | 2998 |
| 688 | Ga0439454_008517 | 3300042011 | Bacteria | 1312 |
| 689 | Ga0439457_028472 | 3300042014 | Bacteria | 1237 |
| 690 | Ga0439462_0003956 | 3300042015 | Bacteria | 3588 |
| 691 | Ga0450920_001378 | 3300042122 | Bacteria | 4013 |
| 692 | Ga0450920_005942 | 3300042122 | Bacteria | 2182 |
| 693 | Ga0450920_021838 | 3300042122 | Bacteria | 1238 |
| 694 | Ga0450895_004009 | 3300042132 | Bacteria | 1152 |
| 695 | Ga0450906_003482 | 3300042145 | Bacteria | 3382 |
| 696 | Ga0450907_011561 | 3300042146 | Bacteria | 1466 |
| 697 | Ga0450907_017666 | 3300042146 | Bacteria | 1190 |
| 698 | Ga0439446_0000082 | 3300042156 | Bacteria | 15673 |
| 699 | Ga0439446_0001079 | 3300042156 | Bacteria | 6017 |
| 700 | Ga0439435_0055827 | 3300042436 | Bacteria | 1140 |
| 701 | Ga0439460_0042868 | 3300042461 | Bacteria | 1335 |
| 702 | Ga0466969_0040665 | 3300044656 | Bacteria | 2329 |
| 703 | Ga0466972_0078918 | 3300044658 | Bacteria | 1568 |
| 704 | Ga0466965_0298431 | 3300044683 | Bacteria | 874 |
| 705 | Ga0466966_0030501 | 3300044684 | Bacteria | 3501 |
| 706 | Ga0466966_0056180 | 3300044684 | Bacteria | 2491 |
| 707 | Ga0466966_0071103 | 3300044684 | Bacteria | 2180 |
| 708 | Ga0466966_0197436 | 3300044684 | Bacteria | 1218 |
| 709 | Ga0466961_0003168 | 3300044693 | Bacteria | 10245 |
| 710 | Ga0466961_0036972 | 3300044693 | Bacteria | 3133 |
| 711 | Ga0466961_0093418 | 3300044693 | Bacteria | 1898 |
| 712 | Ga0466963_0001137 | 3300044694 | Bacteria | 13906 |
| 713 | Ga0466963_0001659 | 3300044694 | Bacteria | 12142 |
| 714 | Ga0466963_0002621 | 3300044694 | Bacteria | 10100 |
| 715 | Ga0466963_0018971 | 3300044694 | Bacteria | 4306 |
| 716 | Ga0466963_0028319 | 3300044694 | Bacteria | 3596 |
| 717 | Ga0466963_0037365 | 3300044694 | Bacteria | 3170 |
| 718 | Ga0466963_0045465 | 3300044694 | Bacteria | 2892 |
| 719 | Ga0466963_0630872 | 3300044694 | Bacteria | 756 |
| 720 | Ga0466964_0003114 | 3300044706 | Bacteria | 6030 |
| 721 | Ga0466964_0008335 | 3300044706 | Bacteria | 3889 |
| 722 | Ga0466964_0015865 | 3300044706 | Bacteria | 2869 |
| 723 | Ga0466964_0043269 | 3300044706 | Bacteria | 1826 |
| 724 | Ga0466964_0081548 | 3300044706 | Bacteria | 1389 |
| 725 | Ga0466964_0092323 | 3300044706 | Bacteria | 1320 |
| 726 | Ga0466964_0098955 | 3300044706 | Bacteria | 1282 |
| 727 | Ga0466971_0000469 | 3300044719 | Bacteria | 15840 |
| 728 | Ga0466971_0011900 | 3300044719 | Bacteria | 3812 |
| 729 | Ga0466971_0040769 | 3300044719 | Bacteria | 2085 |
| 730 | Ga0466968_0017299 | 3300044735 | Bacteria | 2880 |
| 731 | Ga0466968_0044664 | 3300044735 | Bacteria | 1878 |
| 732 | Ga0466968_0102435 | 3300044735 | Bacteria | 1279 |
| 733 | Ga0466970_0008011 | 3300044765 | Bacteria | 5305 |
| 734 | Ga0466970_0292598 | 3300044765 | Bacteria | 917 |
| 735 | Ga0466957_0004662 | 3300044842 | Bacteria | 7662 |
| 736 | Ga0466957_0020684 | 3300044842 | Bacteria | 3873 |
| 737 | Ga0466957_0597860 | 3300044842 | Bacteria | 772 |
| 738 | Ga0466960_0003090 | 3300044901 | Bacteria | 6372 |
| 739 | Ga0466960_0040112 | 3300044901 | Bacteria | 2212 |
| 740 | Ga0466959_0016687 | 3300045049 | Bacteria | 5371 |
| 741 | Ga0466959_0021004 | 3300045049 | Bacteria | 4814 |
| 742 | Ga0466959_0074413 | 3300045049 | Bacteria | 2456 |
| 743 | Ga0466959_0082890 | 3300045049 | Unclassified | 2310 |
| 744 | Ga0466959_0137323 | 3300045049 | Bacteria | 1730 |
| 745 | Ga0466959_0345112 | 3300045049 | Bacteria | 1015 |
| 746 | Ga0466958_0001601 | 3300045836 | Bacteria | 10877 |
| 747 | Ga0466958_0020678 | 3300045836 | Bacteria | 3840 |
| 748 | Ga0466958_0069479 | 3300045836 | Bacteria | 2153 |
| 749 | Ga0466967_0006178 | 3300045976 | Bacteria | 8438 |
| 750 | Ga0466967_0012646 | 3300045976 | Bacteria | 6472 |
| 751 | Ga0466967_0014726 | 3300045976 | Bacteria | 6107 |
| 752 | Ga0466967_0018416 | 3300045976 | Bacteria | 5579 |
| 753 | Ga0466967_0019241 | 3300045976 | Bacteria | 5486 |
| 754 | Ga0466967_0022820 | 3300045976 | Bacteria | 5116 |
| 755 | Ga0466967_0029693 | 3300045976 | Bacteria | 4579 |
| 756 | Ga0466967_0032572 | 3300045976 | Bacteria | 4402 |
| 757 | Ga0466967_0040809 | 3300045976 | Bacteria | 3997 |
| 758 | Ga0466967_0042790 | 3300045976 | Bacteria | 3916 |
| 759 | Ga0466967_0042853 | 3300045976 | Bacteria | 3914 |
| 760 | Ga0466967_0044056 | 3300045976 | Bacteria | 3868 |
| 761 | Ga0466967_0047797 | 3300045976 | Bacteria | 3732 |
| 762 | Ga0466967_0052120 | 3300045976 | Bacteria | 3589 |
| 763 | Ga0466967_0064391 | 3300045976 | Bacteria | 3260 |
| 764 | Ga0466967_0172629 | 3300045976 | Bacteria | 2035 |
| 765 | Ga0466967_0222782 | 3300045976 | Unclassified | 1793 |
| 766 | Ga0466967_0237212 | 3300045976 | Bacteria | 1738 |
| 767 | Ga0466967_0310406 | 3300045976 | Bacteria | 1519 |
| 768 | Ga0466967_0315663 | 3300045976 | Bacteria | 1506 |
| 769 | Ga0466967_0335753 | 3300045976 | Bacteria | 1460 |
| 770 | Ga0466967_0450899 | 3300045976 | Bacteria | 1257 |
| 771 | Ga0466967_0896138 | 3300045976 | Bacteria | 882 |
| 772 | Ga0495592_0027463 | 3300046454 | Bacteria | 4316 |
| 773 | Ga0495592_0056012 | 3300046454 | Bacteria | 2915 |
| 774 | Ga0495592_0199531 | 3300046454 | Bacteria | 1351 |
| 775 | Ga0495603_0000315 | 3300046455 | Bacteria | 25931 |
| 776 | Ga0495629_0001172 | 3300046459 | Bacteria | 20684 |
| 777 | Ga0495629_0072043 | 3300046459 | Bacteria | 2412 |
| 778 | Ga0495629_0123992 | 3300046459 | Unclassified | 1800 |
| 779 | Ga0495641_0001392 | 3300046461 | Bacteria | 20624 |
| 780 | Ga0495641_0009942 | 3300046461 | Bacteria | 5590 |
| 781 | Ga0495641_0020369 | 3300046461 | Bacteria | 3364 |
| 782 | Ga0495641_0028381 | 3300046461 | Bacteria | 2709 |
| 783 | Ga0495641_0039218 | 3300046461 | Bacteria | 2210 |
| 784 | Ga0495641_0124567 | 3300046461 | Bacteria | 1150 |
| 785 | Ga0495651_0119261 | 3300046462 | Unclassified | 1940 |
| 786 | Ga0495653_0088926 | 3300046463 | Bacteria | 2264 |
| 787 | Ga0495653_0089196 | 3300046463 | Bacteria | 2260 |
| 788 | Ga0495653_0157782 | 3300046463 | Unclassified | 1578 |
| 789 | Ga0495580_0077909 | 3300046472 | Bacteria | 2312 |
| 790 | Ga0495580_0272061 | 3300046472 | Bacteria | 1157 |
| 791 | Ga0495582_0004758 | 3300046473 | Bacteria | 7633 |
| 792 | Ga0495582_0014796 | 3300046473 | Bacteria | 4286 |
| 793 | Ga0495605_0117263 | 3300046474 | Bacteria | 1210 |
| 794 | Ga0495639_0160703 | 3300046475 | Bacteria | 1087 |
| 795 | Ga0495662_0002670 | 3300046476 | Bacteria | 9011 |
| 796 | Ga0495662_0038842 | 3300046476 | Bacteria | 2300 |
| 797 | Ga0495664_0196550 | 3300046477 | Bacteria | 1222 |
| 798 | Ga0495664_0234035 | 3300046477 | Bacteria | 1111 |
| 799 | Ga0495594_0008752 | 3300046499 | Bacteria | 5217 |
| 800 | Ga0495596_0049541 | 3300046500 | Bacteria | 1647 |
| 801 | Ga0495608_0003235 | 3300046511 | Bacteria | 11652 |
| 802 | Ga0495608_0046549 | 3300046511 | Bacteria | 2886 |
| 803 | Ga0495608_0125067 | 3300046511 | Unclassified | 1647 |
| 804 | Ga0495618_0161813 | 3300046514 | Bacteria | 1427 |
| 805 | Ga0495618_0419350 | 3300046514 | Bacteria | 816 |
| 806 | Ga0495620_0132920 | 3300046515 | Bacteria | 976 |
| 807 | Ga0495628_0014360 | 3300046516 | Bacteria | 6640 |
| 808 | Ga0495628_0061184 | 3300046516 | Unclassified | 2953 |
| 809 | Ga0495630_0010760 | 3300046517 | Bacteria | 6607 |
| 810 | Ga0495630_0044810 | 3300046517 | Bacteria | 3306 |
| 811 | Ga0495630_0062675 | 3300046517 | Bacteria | 2793 |
| 812 | Ga0495630_0104481 | 3300046517 | Bacteria | 2144 |
| 813 | Ga0495630_0158058 | 3300046517 | Bacteria | 1725 |
| 814 | Ga0495630_0362948 | 3300046517 | Unclassified | 1109 |
| 815 | Ga0495631_0123808 | 3300046518 | Bacteria | 1112 |
| 816 | Ga0495666_0026315 | 3300046526 | Bacteria | 2869 |
| 817 | Ga0495652_0031157 | 3300046529 | Bacteria | 4672 |
| 818 | Ga0495652_0093133 | 3300046529 | Bacteria | 2461 |
| 819 | Ga0495652_0133909 | 3300046529 | Bacteria | 1958 |
| 820 | Ga0495652_0171428 | 3300046529 | Unclassified | 1674 |
| 821 | Ga0495665_0000572 | 3300046531 | Bacteria | 18699 |
| 822 | Ga0495640_0004895 | 3300046533 | Bacteria | 10659 |
| 823 | Ga0495587_0034460 | 3300046536 | Bacteria | 3053 |
| 824 | Ga0495587_0092126 | 3300046536 | Bacteria | 1750 |
| 825 | Ga0495587_0136055 | 3300046536 | Bacteria | 1404 |
| 826 | Ga0495587_0219547 | 3300046536 | Bacteria | 1072 |
| 827 | Ga0495598_0164334 | 3300046537 | Bacteria | 783 |
| 828 | Ga0495645_0215829 | 3300046543 | Bacteria | 1293 |
| 829 | Ga0495622_0027533 | 3300046557 | Bacteria | 2653 |
| 830 | Ga0495667_0023106 | 3300046559 | Bacteria | 4190 |
| 831 | Ga0495667_0057285 | 3300046559 | Unclassified | 2561 |
| 832 | Ga0495667_0080279 | 3300046559 | Bacteria | 2120 |
| 833 | Ga0495667_0162027 | 3300046559 | Unclassified | 1439 |
| 834 | Ga0495656_0058447 | 3300046615 | Bacteria | 1674 |
| 835 | Ga0495668_0285209 | 3300046616 | Bacteria | 905 |
| 836 | Ga0495634_0007352 | 3300046642 | Bacteria | 8288 |
| 837 | Ga0495634_0120903 | 3300046642 | Bacteria | 1677 |
| 838 | Ga0495635_0017186 | 3300046663 | Bacteria | 5051 |
| 839 | Ga0495635_0086325 | 3300046663 | Unclassified | 2147 |
| 840 | Ga0495657_0049866 | 3300046675 | Unclassified | 2817 |
| 841 | Ga0495657_0094425 | 3300046675 | Bacteria | 1913 |
| 842 | Ga0495657_0133657 | 3300046675 | Bacteria | 1552 |
| 843 | Ga0495599_0065381 | 3300046678 | Unclassified | 2272 |
| 844 | Ga0495599_0070330 | 3300046678 | Bacteria | 2184 |
| 845 | Ga0495599_0129731 | 3300046678 | Bacteria | 1566 |
| 846 | Ga0495599_0198107 | 3300046678 | Bacteria | 1234 |
| 847 | Ga0495623_0075178 | 3300046679 | Unclassified | 2098 |
| 848 | Ga0495623_0075328 | 3300046679 | Bacteria | 2096 |
| 849 | Ga0495623_0130720 | 3300046679 | Bacteria | 1504 |
| 850 | Ga0495623_0349677 | 3300046679 | Bacteria | 805 |
| 851 | Ga0495646_0073701 | 3300046680 | Unclassified | 2005 |
| 852 | Ga0495658_0002818 | 3300046683 | Bacteria | 8732 |
| 853 | Ga0495658_0004955 | 3300046683 | Bacteria | 6534 |
| 854 | Ga0495658_0077825 | 3300046683 | Bacteria | 1940 |
| 855 | Ga0495658_0233716 | 3300046683 | Bacteria | 1153 |
| 856 | Ga0495658_0414159 | 3300046683 | Bacteria | 860 |
| 857 | Ga0495613_0002807 | 3300046689 | Bacteria | 13069 |
| 858 | Ga0495613_0012232 | 3300046689 | Bacteria | 6379 |
| 859 | Ga0495613_0122236 | 3300046689 | Unclassified | 1869 |
| 860 | Ga0495613_0244944 | 3300046689 | Bacteria | 1252 |
| 861 | Ga0495624_0003083 | 3300046690 | Bacteria | 12472 |
| 862 | Ga0495624_0178912 | 3300046690 | Bacteria | 1293 |
| 863 | Ga0495670_0294500 | 3300046691 | Unclassified | 869 |
| 864 | Ga0495600_0172365 | 3300046809 | Unclassified | 1396 |
| 865 | Ga0495581_0001629 | 3300047315 | Bacteria | 12517 |
| 866 | Ga0495581_0069125 | 3300047315 | Bacteria | 2042 |
| 867 | Ga0495581_0202315 | 3300047315 | Bacteria | 1162 |
| 868 | Ga0495604_0096905 | 3300047317 | Bacteria | 2176 |
| 869 | Ga0495604_0188325 | 3300047317 | Unclassified | 1439 |
| 870 | Ga0495674_0000604 | 3300047319 | Bacteria | 33665 |
| 871 | Ga0495674_0014819 | 3300047319 | Bacteria | 7294 |
| 872 | Ga0495674_0071641 | 3300047319 | Bacteria | 2990 |
| 873 | Ga0495674_0099515 | 3300047319 | Bacteria | 2475 |
| 874 | Ga0495674_0128421 | 3300047319 | Bacteria | 2137 |
| 875 | Ga0495674_0193304 | 3300047319 | Bacteria | 1690 |
| 876 | Ga0495676_0005988 | 3300047321 | Bacteria | 11171 |
| 877 | Ga0495676_0033632 | 3300047321 | Bacteria | 4314 |
| 878 | Ga0495676_0140388 | 3300047321 | Bacteria | 1732 |
| 879 | Ga0495676_0465998 | 3300047321 | Bacteria | 832 |
| 880 | Ga0495680_0001294 | 3300047322 | Bacteria | 27286 |
| 881 | Ga0495680_0045915 | 3300047322 | Bacteria | 3447 |
| 882 | Ga0495680_0092680 | 3300047322 | Bacteria | 2262 |
| 883 | Ga0495675_0053040 | 3300047444 | Unclassified | 2574 |
| 884 | Ga0495675_0236048 | 3300047444 | Bacteria | 1102 |
| 885 | Ga0495677_0171790 | 3300047445 | Bacteria | 839 |
| 886 | Ga0495684_0003459 | 3300047471 | Bacteria | 12362 |
| 887 | Ga0495684_0005729 | 3300047471 | Bacteria | 9663 |
| 888 | Ga0495684_0014928 | 3300047471 | Bacteria | 5983 |
| 889 | Ga0495684_0113633 | 3300047471 | Unclassified | 2042 |
| 890 | Ga0495602_0089556 | 3300048088 | Unclassified | 2558 |
| 891 | Ga0495602_0093372 | 3300048088 | Bacteria | 2490 |
| 892 | Ga0495602_0237503 | 3300048088 | Bacteria | 1365 |
| 893 | Ga0495602_0272659 | 3300048088 | Bacteria | 1250 |
| 894 | Ga0495614_0053543 | 3300048089 | Bacteria | 1730 |
| 895 | Ga0496100_0006166 | 3300048903 | Bacteria | 6521 |
| 896 | Ga0496100_0045937 | 3300048903 | Bacteria | 2805 |
| 897 | Ga0496100_0161348 | 3300048903 | Bacteria | 1607 |
| 898 | Ga0496100_0251467 | 3300048903 | Bacteria | 1307 |
| 899 | Ga0496100_0272999 | 3300048903 | Bacteria | 1258 |
| 900 | Ga0496100_0343499 | 3300048903 | Bacteria | 1126 |
| 901 | Ga0496101_0001648 | 3300048904 | Bacteria | 13382 |
| 902 | Ga0496101_0002848 | 3300048904 | Bacteria | 10634 |
| 903 | Ga0496101_0009732 | 3300048904 | Bacteria | 6327 |
| 904 | Ga0496101_0013967 | 3300048904 | Bacteria | 5393 |
| 905 | Ga0496101_0060791 | 3300048904 | Bacteria | 2742 |
| 906 | Ga0496101_0081773 | 3300048904 | Bacteria | 2390 |
| 907 | Ga0496101_0201592 | 3300048904 | Bacteria | 1538 |
| 908 | Ga0496102_0013692 | 3300048905 | Bacteria | 7032 |
| 909 | Ga0496102_0074671 | 3300048905 | Bacteria | 3117 |
| 910 | Ga0496102_0145755 | 3300048905 | Bacteria | 2222 |
| 911 | Ga0496102_0209630 | 3300048905 | Bacteria | 1837 |
| 912 | Ga0496102_0396914 | 3300048905 | Bacteria | 1297 |
| 913 | Ga0496103_0003789 | 3300048906 | Bacteria | 9197 |
| 914 | Ga0496103_0015518 | 3300048906 | Bacteria | 4535 |
| 915 | Ga0496103_0057042 | 3300048906 | Bacteria | 2425 |
| 916 | Ga0496103_0149993 | 3300048906 | Bacteria | 1493 |
| 917 | Ga0496104_0000188 | 3300048907 | Bacteria | 55678 |
| 918 | Ga0496104_0003035 | 3300048907 | Bacteria | 14462 |
| 919 | Ga0496104_0005264 | 3300048907 | Bacteria | 11308 |
| 920 | Ga0496104_0014260 | 3300048907 | Bacteria | 7175 |
| 921 | Ga0496104_0018343 | 3300048907 | Bacteria | 6385 |
| 922 | Ga0496104_0071653 | 3300048907 | Bacteria | 3295 |
| 923 | Ga0496104_0084751 | 3300048907 | Bacteria | 3024 |
| 924 | Ga0496104_0106996 | 3300048907 | Bacteria | 2680 |
| 925 | Ga0496104_0142746 | 3300048907 | Bacteria | 2300 |
| 926 | Ga0496104_0459205 | 3300048907 | Bacteria | 1185 |
| 927 | Ga0496105_0000413 | 3300048908 | Bacteria | 28035 |
| 928 | Ga0496105_0005539 | 3300048908 | Bacteria | 9585 |
| 929 | Ga0496105_0020137 | 3300048908 | Bacteria | 5387 |
| 930 | Ga0496105_0029849 | 3300048908 | Bacteria | 4464 |
| 931 | Ga0496105_0042692 | 3300048908 | Bacteria | 3739 |
| 932 | Ga0496105_0055302 | 3300048908 | Bacteria | 3277 |
| 933 | Ga0496105_0065099 | 3300048908 | Bacteria | 3009 |
| 934 | Ga0496105_0081376 | 3300048908 | Bacteria | 2675 |
| 935 | Ga0496105_0365581 | 3300048908 | Bacteria | 1150 |
| 936 | Ga0496105_0423328 | 3300048908 | Bacteria | 1054 |
| 937 | Ga0496105_0477182 | 3300048908 | Bacteria | 982 |
| 938 | Ga0496106_0000380 | 3300048909 | Bacteria | 31592 |
| 939 | Ga0496106_0020230 | 3300048909 | Bacteria | 4938 |
| 940 | Ga0496106_0109377 | 3300048909 | Bacteria | 2151 |
| 941 | Ga0496106_0113327 | 3300048909 | Bacteria | 2113 |
| 942 | Ga0496106_0173779 | 3300048909 | Bacteria | 1708 |
| 943 | Ga0496106_0206411 | 3300048909 | Unclassified | 1564 |
| 944 | Ga0496106_0356618 | 3300048909 | Bacteria | 1175 |
| 945 | Ga0496106_0801938 | 3300048909 | Bacteria | 747 |
| 946 | Ga0496107_0002348 | 3300048910 | Bacteria | 12224 |
| 947 | Ga0496107_0018083 | 3300048910 | Bacteria | 4958 |
| 948 | Ga0496107_0023614 | 3300048910 | Bacteria | 4348 |
| 949 | Ga0496107_0034518 | 3300048910 | Bacteria | 3623 |
| 950 | Ga0496107_0058994 | 3300048910 | Bacteria | 2776 |
| 951 | Ga0496107_0061268 | 3300048910 | Bacteria | 2724 |
| 952 | Ga0496107_0328701 | 3300048910 | Bacteria | 1138 |
| 953 | Ga0496107_0543176 | 3300048910 | Bacteria | 861 |
| 954 | Ga0496108_0002556 | 3300048911 | Bacteria | 14570 |
| 955 | Ga0496108_0003631 | 3300048911 | Bacteria | 12368 |
| 956 | Ga0496108_0009595 | 3300048911 | Bacteria | 7844 |
| 957 | Ga0496108_0014113 | 3300048911 | Bacteria | 6516 |
| 958 | Ga0496108_0014117 | 3300048911 | Bacteria | 6515 |
| 959 | Ga0496108_0042016 | 3300048911 | Bacteria | 3815 |
| 960 | Ga0496108_0121679 | 3300048911 | Bacteria | 2239 |
| 961 | Ga0496108_0235031 | 3300048911 | Bacteria | 1594 |
| 962 | Ga0496108_0407882 | 3300048911 | Bacteria | 1187 |
| 963 | Ga0496108_0844752 | 3300048911 | Bacteria | 788 |
| 964 | Ga0496109_0001947 | 3300048912 | Bacteria | 17152 |
| 965 | Ga0496109_0002346 | 3300048912 | Bacteria | 15791 |
| 966 | Ga0496109_0020416 | 3300048912 | Bacteria | 5851 |
| 967 | Ga0496109_0024899 | 3300048912 | Bacteria | 5327 |
| 968 | Ga0496109_0029868 | 3300048912 | Bacteria | 4884 |
| 969 | Ga0496109_0059690 | 3300048912 | Bacteria | 3485 |
| 970 | Ga0496109_0148976 | 3300048912 | Bacteria | 2190 |
| 971 | Ga0496109_0359621 | 3300048912 | Bacteria | 1375 |
| 972 | Ga0496109_0443251 | 3300048912 | Bacteria | 1227 |
| 973 | Ga0496109_0533740 | 3300048912 | Bacteria | 1107 |
| 974 | Ga0496109_0645325 | 3300048912 | Bacteria | 995 |
| 975 | Ga0496110_0005633 | 3300048913 | Bacteria | 9826 |
| 976 | Ga0496110_0011527 | 3300048913 | Bacteria | 7241 |
| 977 | Ga0496110_0011939 | 3300048913 | Bacteria | 7136 |
| 978 | Ga0496110_0038121 | 3300048913 | Bacteria | 4180 |
| 979 | Ga0496110_0041928 | 3300048913 | Bacteria | 3995 |
| 980 | Ga0496110_0090392 | 3300048913 | Bacteria | 2737 |
| 981 | Ga0496110_0102504 | 3300048913 | Bacteria | 2567 |
| 982 | Ga0496110_0115522 | 3300048913 | Unclassified | 2416 |
| 983 | Ga0496110_0120683 | 3300048913 | Bacteria | 2361 |
| 984 | Ga0496110_0283619 | 3300048913 | Bacteria | 1508 |
| 985 | Ga0496110_0352549 | 3300048913 | Bacteria | 1340 |
| 986 | Ga0496110_0752129 | 3300048913 | Bacteria | 878 |
| 987 | Ga0496111_0000288 | 3300048914 | Bacteria | 24472 |
| 988 | Ga0496111_0001194 | 3300048914 | Bacteria | 14492 |
| 989 | Ga0496111_0003824 | 3300048914 | Bacteria | 9396 |
| 990 | Ga0496111_0035054 | 3300048914 | Bacteria | 3585 |
| 991 | Ga0496111_0059001 | 3300048914 | Bacteria | 2779 |
| 992 | Ga0496111_0182958 | 3300048914 | Bacteria | 1558 |
| 993 | Ga0496112_0000307 | 3300048915 | Bacteria | 31590 |
| 994 | Ga0496112_0002174 | 3300048915 | Bacteria | 15585 |
| 995 | Ga0496112_0014425 | 3300048915 | Bacteria | 7330 |
| 996 | Ga0496112_0133008 | 3300048915 | Bacteria | 2458 |
| 997 | Ga0496112_0147006 | 3300048915 | Bacteria | 2325 |
| 998 | Ga0496112_0171753 | 3300048915 | Bacteria | 2133 |
| 999 | Ga0496112_0180594 | 3300048915 | Bacteria | 2074 |
| 1000 | Ga0496112_0355812 | 3300048915 | Bacteria | 1406 |
| 1001 | Ga0496112_0589703 | 3300048915 | Bacteria | 1044 |
| 1002 | Ga0496113_0000192 | 3300048916 | Bacteria | 27861 |
| 1003 | Ga0496113_0026625 | 3300048916 | Bacteria | 4137 |
| 1004 | Ga0496113_0028359 | 3300048916 | Bacteria | 4026 |
| 1005 | Ga0496113_0540332 | 3300048916 | Bacteria | 935 |
| 1006 | Ga0496114_0001026 | 3300048917 | Bacteria | 20985 |
| 1007 | Ga0496114_0003757 | 3300048917 | Bacteria | 11703 |
| 1008 | Ga0496114_0004276 | 3300048917 | Bacteria | 11055 |
| 1009 | Ga0496114_0008425 | 3300048917 | Bacteria | 8165 |
| 1010 | Ga0496114_0013129 | 3300048917 | Bacteria | 6637 |
| 1011 | Ga0496114_0194178 | 3300048917 | Bacteria | 1777 |
| 1012 | Ga0496114_0211269 | 3300048917 | Bacteria | 1702 |
| 1013 | Ga0496114_0389575 | 3300048917 | Bacteria | 1234 |
| 1014 | Ga0496114_0400800 | 3300048917 | Bacteria | 1215 |
| 1015 | Ga0496114_0907380 | 3300048917 | Bacteria | 762 |
| 1016 | Ga0496115_0000307 | 3300048918 | Bacteria | 41675 |
| 1017 | Ga0496115_0002915 | 3300048918 | Bacteria | 12347 |
| 1018 | Ga0496115_0037455 | 3300048918 | Bacteria | 3843 |
| 1019 | Ga0496115_0079838 | 3300048918 | Bacteria | 2663 |
| 1020 | Ga0496115_0082496 | 3300048918 | Bacteria | 2619 |
| 1021 | Ga0496115_0398865 | 3300048918 | Bacteria | 1116 |
| 1022 | Ga0496115_0402829 | 3300048918 | Bacteria | 1110 |
| 1023 | Ga0501031_0004061 | 3300049568 | Bacteria | 9440 |
| 1024 | Ga0501031_0007219 | 3300049568 | Bacteria | 7250 |
| 1025 | Ga0501031_0023359 | 3300049568 | Bacteria | 4032 |
| 1026 | Ga0501031_0089642 | 3300049568 | Bacteria | 2006 |
| 1027 | Ga0501031_0094238 | 3300049568 | Bacteria | 1954 |
| 1028 | Ga0501031_0131442 | 3300049568 | Bacteria | 1635 |
| 1029 | Ga0501031_0252695 | 3300049568 | Bacteria | 1146 |
| 1030 | Ga0501032_0001182 | 3300049569 | Bacteria | 20907 |
| 1031 | Ga0501032_0006448 | 3300049569 | Bacteria | 8631 |
| 1032 | Ga0501032_0032342 | 3300049569 | Bacteria | 3585 |
| 1033 | Ga0501032_0110688 | 3300049569 | Bacteria | 1817 |
| 1034 | Ga0501033_0001160 | 3300049570 | Bacteria | 23837 |
| 1035 | Ga0501033_0013301 | 3300049570 | Bacteria | 6270 |
| 1036 | Ga0501033_0130903 | 3300049570 | Bacteria | 1817 |
| 1037 | Ga0501034_0028186 | 3300049571 | Bacteria | 5714 |
| 1038 | Ga0501034_0032710 | 3300049571 | Bacteria | 5282 |
| 1039 | Ga0501034_0109772 | 3300049571 | Bacteria | 2750 |
| 1040 | Ga0501034_0257213 | 3300049571 | Bacteria | 1689 |
| 1041 | Ga0501034_0471040 | 3300049571 | Bacteria | 1172 |
| 1042 | Ga0501034_0714841 | 3300049571 | Bacteria | 899 |
| 1043 | Ga0501034_0728698 | 3300049571 | Bacteria | 888 |
| 1044 | Ga0501036_0000750 | 3300049572 | Bacteria | 24049 |
| 1045 | Ga0501036_0000982 | 3300049572 | Bacteria | 21538 |
| 1046 | Ga0501036_0004190 | 3300049572 | Bacteria | 11619 |
| 1047 | Ga0501036_0004891 | 3300049572 | Bacteria | 10821 |
| 1048 | Ga0501036_0006322 | 3300049572 | Bacteria | 9611 |
| 1049 | Ga0501036_0022582 | 3300049572 | Bacteria | 5293 |
| 1050 | Ga0501036_0023919 | 3300049572 | Bacteria | 5149 |
| 1051 | Ga0501036_0036586 | 3300049572 | Bacteria | 4154 |
| 1052 | Ga0501036_0041161 | 3300049572 | Bacteria | 3910 |
| 1053 | Ga0501036_0044479 | 3300049572 | Bacteria | 3761 |
| 1054 | Ga0501036_0106066 | 3300049572 | Bacteria | 2376 |
| 1055 | Ga0501036_0106315 | 3300049572 | Bacteria | 2373 |
| 1056 | Ga0501036_0133474 | 3300049572 | Bacteria | 2095 |
| 1057 | Ga0501037_0009265 | 3300049573 | Bacteria | 7217 |
| 1058 | Ga0501037_0019670 | 3300049573 | Bacteria | 4981 |
| 1059 | Ga0501037_0022874 | 3300049573 | Bacteria | 4622 |
| 1060 | Ga0501037_0026977 | 3300049573 | Bacteria | 4243 |
| 1061 | Ga0501037_0065311 | 3300049573 | Bacteria | 2651 |
| 1062 | Ga0501037_0224500 | 3300049573 | Bacteria | 1320 |
| 1063 | Ga0501037_0547932 | 3300049573 | Bacteria | 781 |
| 1064 | Ga0501038_0000446 | 3300049574 | Bacteria | 36005 |
| 1065 | Ga0501038_0001935 | 3300049574 | Bacteria | 19107 |
| 1066 | Ga0501038_0002315 | 3300049574 | Bacteria | 17712 |
| 1067 | Ga0501038_0007078 | 3300049574 | Bacteria | 10361 |
| 1068 | Ga0501038_0033734 | 3300049574 | Bacteria | 4506 |
| 1069 | Ga0501038_0051573 | 3300049574 | Bacteria | 3549 |
| 1070 | Ga0501038_0063560 | 3300049574 | Bacteria | 3150 |
| 1071 | Ga0501038_0076331 | 3300049574 | Bacteria | 2830 |
| 1072 | Ga0501038_0081299 | 3300049574 | Bacteria | 2730 |
| 1073 | Ga0501038_0123872 | 3300049574 | Bacteria | 2129 |
| 1074 | Ga0501038_0216183 | 3300049574 | Bacteria | 1531 |
| 1075 | Ga0501039_0000317 | 3300049575 | Bacteria | 34072 |
| 1076 | Ga0501039_0000364 | 3300049575 | Bacteria | 32385 |
| 1077 | Ga0501039_0006406 | 3300049575 | Bacteria | 8943 |
| 1078 | Ga0501039_0007361 | 3300049575 | Bacteria | 8391 |
| 1079 | Ga0501039_0008152 | 3300049575 | Bacteria | 7982 |
| 1080 | Ga0501039_0013728 | 3300049575 | Bacteria | 6196 |
| 1081 | Ga0501039_0023521 | 3300049575 | Bacteria | 4728 |
| 1082 | Ga0501039_0048603 | 3300049575 | Bacteria | 3279 |
| 1083 | Ga0501039_0049631 | 3300049575 | Bacteria | 3244 |
| 1084 | Ga0501039_0071027 | 3300049575 | Bacteria | 2704 |
| 1085 | Ga0501039_0168599 | 3300049575 | Bacteria | 1721 |
| 1086 | Ga0501039_0255567 | 3300049575 | Bacteria | 1377 |
| 1087 | Ga0501039_0426672 | 3300049575 | Bacteria | 1041 |
| 1088 | Ga0501040_0000039 | 3300049576 | Bacteria | 59106 |
| 1089 | Ga0501040_0000524 | 3300049576 | Bacteria | 23062 |
| 1090 | Ga0501040_0001948 | 3300049576 | Bacteria | 13284 |
| 1091 | Ga0501040_0004381 | 3300049576 | Bacteria | 9178 |
| 1092 | Ga0501040_0005940 | 3300049576 | Bacteria | 7904 |
| 1093 | Ga0501040_0007266 | 3300049576 | Bacteria | 7177 |
| 1094 | Ga0501040_0008593 | 3300049576 | Bacteria | 6630 |
| 1095 | Ga0501040_0010689 | 3300049576 | Bacteria | 6004 |
| 1096 | Ga0501040_0010719 | 3300049576 | Bacteria | 5994 |
| 1097 | Ga0501040_0019296 | 3300049576 | Bacteria | 4535 |
| 1098 | Ga0501040_0024024 | 3300049576 | Bacteria | 4089 |
| 1099 | Ga0501040_0028099 | 3300049576 | Bacteria | 3790 |
| 1100 | Ga0501040_0042231 | 3300049576 | Bacteria | 3105 |
| 1101 | Ga0501040_0054781 | 3300049576 | Bacteria | 2734 |
| 1102 | Ga0501040_0063978 | 3300049576 | Bacteria | 2532 |
| 1103 | Ga0501040_0123217 | 3300049576 | Bacteria | 1820 |
| 1104 | Ga0501040_0225990 | 3300049576 | Bacteria | 1332 |
| 1105 | Ga0501040_0287193 | 3300049576 | Bacteria | 1175 |
| 1106 | Ga0501041_0000291 | 3300049577 | Bacteria | 24200 |
| 1107 | Ga0501041_0001974 | 3300049577 | Bacteria | 11523 |
| 1108 | Ga0501041_0002802 | 3300049577 | Bacteria | 9958 |
| 1109 | Ga0501041_0003315 | 3300049577 | Bacteria | 9261 |
| 1110 | Ga0501041_0007727 | 3300049577 | Bacteria | 6312 |
| 1111 | Ga0501041_0009316 | 3300049577 | Bacteria | 5782 |
| 1112 | Ga0501041_0017134 | 3300049577 | Bacteria | 4310 |
| 1113 | Ga0501041_0026890 | 3300049577 | Bacteria | 3464 |
| 1114 | Ga0501041_0030942 | 3300049577 | Bacteria | 3230 |
| 1115 | Ga0501041_0091007 | 3300049577 | Bacteria | 1883 |
| 1116 | Ga0501041_0165773 | 3300049577 | Bacteria | 1382 |
| 1117 | Ga0501041_0245350 | 3300049577 | Bacteria | 1125 |
| 1118 | Ga0501042_0000258 | 3300049578 | Bacteria | 25888 |
| 1119 | Ga0501042_0000894 | 3300049578 | Bacteria | 16677 |
| 1120 | Ga0501042_0002492 | 3300049578 | Bacteria | 11325 |
| 1121 | Ga0501042_0005192 | 3300049578 | Bacteria | 8371 |
| 1122 | Ga0501042_0011682 | 3300049578 | Bacteria | 5933 |
| 1123 | Ga0501042_0014135 | 3300049578 | Bacteria | 5443 |
| 1124 | Ga0501042_0020651 | 3300049578 | Bacteria | 4584 |
| 1125 | Ga0501042_0045673 | 3300049578 | Bacteria | 3122 |
| 1126 | Ga0501042_0060267 | 3300049578 | Bacteria | 2710 |
| 1127 | Ga0501042_0110691 | 3300049578 | Bacteria | 1977 |
| 1128 | Ga0501042_0115515 | 3300049578 | Bacteria | 1932 |
| 1129 | Ga0501042_0124007 | 3300049578 | Bacteria | 1860 |
| 1130 | Ga0501042_0124081 | 3300049578 | Bacteria | 1859 |
| 1131 | Ga0501042_0174112 | 3300049578 | Bacteria | 1553 |
| 1132 | Ga0501042_0178963 | 3300049578 | Bacteria | 1530 |
| 1133 | Ga0501042_0222692 | 3300049578 | Bacteria | 1361 |
| 1134 | Ga0501042_0285936 | 3300049578 | Bacteria | 1191 |
| 1135 | Ga0501042_0295804 | 3300049578 | Bacteria | 1169 |
| 1136 | Ga0501042_0382013 | 3300049578 | Bacteria | 1020 |
| 1137 | Ga0501043_0003344 | 3300049579 | Bacteria | 13212 |
| 1138 | Ga0501043_0006109 | 3300049579 | Bacteria | 9675 |
| 1139 | Ga0501043_0021905 | 3300049579 | Bacteria | 5012 |
| 1140 | Ga0501043_0028534 | 3300049579 | Bacteria | 4381 |
| 1141 | Ga0501043_0100014 | 3300049579 | Bacteria | 2279 |
| 1142 | Ga0501043_0103426 | 3300049579 | Bacteria | 2238 |
| 1143 | Ga0501043_0152466 | 3300049579 | Bacteria | 1808 |
| 1144 | Ga0501043_0239699 | 3300049579 | Bacteria | 1399 |
| 1145 | Ga0501043_0390522 | 3300049579 | Bacteria | 1052 |
| 1146 | Ga0501046_0004525 | 3300049580 | Bacteria | 12599 |
| 1147 | Ga0501046_0006475 | 3300049580 | Bacteria | 10358 |
| 1148 | Ga0501046_0007866 | 3300049580 | Bacteria | 9351 |
| 1149 | Ga0501046_0008764 | 3300049580 | Bacteria | 8786 |
| 1150 | Ga0501046_0012843 | 3300049580 | Bacteria | 7122 |
| 1151 | Ga0501046_0013629 | 3300049580 | Bacteria | 6875 |
| 1152 | Ga0501046_0038072 | 3300049580 | Bacteria | 3862 |
| 1153 | Ga0501046_0049648 | 3300049580 | Bacteria | 3318 |
| 1154 | Ga0501046_0053855 | 3300049580 | Bacteria | 3167 |
| 1155 | Ga0501046_0150718 | 3300049580 | Bacteria | 1754 |
| 1156 | Ga0501046_0167311 | 3300049580 | Bacteria | 1651 |
| 1157 | Ga0501046_0252201 | 3300049580 | Bacteria | 1298 |
| 1158 | Ga0501047_0025018 | 3300049581 | Bacteria | 5735 |
| 1159 | Ga0501047_0046030 | 3300049581 | Bacteria | 4217 |
| 1160 | Ga0501047_0106833 | 3300049581 | Bacteria | 2680 |
| 1161 | Ga0501047_0117116 | 3300049581 | Bacteria | 2545 |
| 1162 | Ga0501048_0001067 | 3300049582 | Bacteria | 20543 |
| 1163 | Ga0501048_0002786 | 3300049582 | Bacteria | 13352 |
| 1164 | Ga0501048_0004532 | 3300049582 | Bacteria | 10576 |
| 1165 | Ga0501048_0005882 | 3300049582 | Bacteria | 9337 |
| 1166 | Ga0501048_0011653 | 3300049582 | Bacteria | 6557 |
| 1167 | Ga0501048_0012860 | 3300049582 | Bacteria | 6217 |
| 1168 | Ga0501048_0018685 | 3300049582 | Bacteria | 5095 |
| 1169 | Ga0501048_0023252 | 3300049582 | Bacteria | 4532 |
| 1170 | Ga0501048_0040337 | 3300049582 | Bacteria | 3346 |
| 1171 | Ga0501048_0054022 | 3300049582 | Bacteria | 2854 |
| 1172 | Ga0501048_0107743 | 3300049582 | Bacteria | 1967 |
| 1173 | Ga0501048_0135138 | 3300049582 | Bacteria | 1743 |
| 1174 | Ga0501048_0435783 | 3300049582 | Bacteria | 938 |
| 1175 | Ga0501067_0001127 | 3300049583 | Bacteria | 14464 |
| 1176 | Ga0501067_0015833 | 3300049583 | Bacteria | 4171 |
| 1177 | Ga0501067_0031503 | 3300049583 | Bacteria | 2942 |
| 1178 | Ga0501067_0075356 | 3300049583 | Bacteria | 1869 |
| 1179 | Ga0501067_0104658 | 3300049583 | Bacteria | 1572 |
| 1180 | Ga0501067_0178915 | 3300049583 | Bacteria | 1181 |
| 1181 | Ga0501068_0001596 | 3300049584 | Bacteria | 12071 |
| 1182 | Ga0501068_0002939 | 3300049584 | Bacteria | 9078 |
| 1183 | Ga0501068_0005404 | 3300049584 | Bacteria | 6989 |
| 1184 | Ga0501068_0011225 | 3300049584 | Bacteria | 5051 |
| 1185 | Ga0501068_0011823 | 3300049584 | Bacteria | 4934 |
| 1186 | Ga0501068_0033330 | 3300049584 | Bacteria | 3067 |
| 1187 | Ga0501068_0038221 | 3300049584 | Bacteria | 2875 |
| 1188 | Ga0501068_0039534 | 3300049584 | Bacteria | 2828 |
| 1189 | Ga0501068_0049046 | 3300049584 | Bacteria | 2550 |
| 1190 | Ga0501068_0049209 | 3300049584 | Bacteria | 2545 |
| 1191 | Ga0501068_0224488 | 3300049584 | Bacteria | 1194 |
| 1192 | Ga0501068_0416139 | 3300049584 | Bacteria | 868 |
| 1193 | Ga0501069_0001903 | 3300049585 | Bacteria | 10415 |
| 1194 | Ga0501069_0003627 | 3300049585 | Bacteria | 7947 |
| 1195 | Ga0501069_0013701 | 3300049585 | Bacteria | 4326 |
| 1196 | Ga0501069_0016558 | 3300049585 | Bacteria | 3961 |
| 1197 | Ga0501069_0020235 | 3300049585 | Bacteria | 3604 |
| 1198 | Ga0501069_0022274 | 3300049585 | Bacteria | 3444 |
| 1199 | Ga0501069_0031400 | 3300049585 | Bacteria | 2921 |
| 1200 | Ga0501069_0081977 | 3300049585 | Bacteria | 1817 |
| 1201 | Ga0501069_0123768 | 3300049585 | Bacteria | 1478 |
| 1202 | Ga0501069_0143064 | 3300049585 | Bacteria | 1372 |
| 1203 | Ga0501069_0174459 | 3300049585 | Bacteria | 1241 |
| 1204 | Ga0501070_0036445 | 3300049586 | Bacteria | 4107 |
| 1205 | Ga0501070_0038771 | 3300049586 | Bacteria | 3975 |
| 1206 | Ga0501070_0044821 | 3300049586 | Bacteria | 3679 |
| 1207 | Ga0501070_0086461 | 3300049586 | Bacteria | 2596 |
| 1208 | Ga0501070_0124503 | 3300049586 | Bacteria | 2130 |
| 1209 | Ga0501070_0269133 | 3300049586 | Bacteria | 1392 |
| 1210 | Ga0501070_0613952 | 3300049586 | Bacteria | 866 |
| 1211 | Ga0501070_0668289 | 3300049586 | Unclassified | 824 |
| 1212 | Ga0501071_0000033 | 3300049587 | Bacteria | 45630 |
| 1213 | Ga0501071_0002214 | 3300049587 | Bacteria | 11691 |
| 1214 | Ga0501071_0002277 | 3300049587 | Bacteria | 11562 |
| 1215 | Ga0501071_0003153 | 3300049587 | Bacteria | 10252 |
| 1216 | Ga0501071_0005857 | 3300049587 | Bacteria | 7942 |
| 1217 | Ga0501071_0026212 | 3300049587 | Bacteria | 4089 |
| 1218 | Ga0501071_0028624 | 3300049587 | Bacteria | 3928 |
| 1219 | Ga0501071_0035549 | 3300049587 | Bacteria | 3549 |
| 1220 | Ga0501071_0050230 | 3300049587 | Bacteria | 3004 |
| 1221 | Ga0501071_0058780 | 3300049587 | Bacteria | 2780 |
| 1222 | Ga0501071_0072992 | 3300049587 | Bacteria | 2502 |
| 1223 | Ga0501071_0130074 | 3300049587 | Bacteria | 1869 |
| 1224 | Ga0501071_0148176 | 3300049587 | Bacteria | 1749 |
| 1225 | Ga0501071_0182424 | 3300049587 | Bacteria | 1573 |
| 1226 | Ga0501072_0000837 | 3300049588 | Bacteria | 22627 |
| 1227 | Ga0501072_0001260 | 3300049588 | Bacteria | 18907 |
| 1228 | Ga0501072_0001414 | 3300049588 | Bacteria | 18022 |
| 1229 | Ga0501072_0001579 | 3300049588 | Bacteria | 17015 |
| 1230 | Ga0501072_0003808 | 3300049588 | Bacteria | 11391 |
| 1231 | Ga0501072_0005441 | 3300049588 | Bacteria | 9696 |
| 1232 | Ga0501072_0007502 | 3300049588 | Bacteria | 8278 |
| 1233 | Ga0501072_0035670 | 3300049588 | Bacteria | 3896 |
| 1234 | Ga0501072_0045353 | 3300049588 | Bacteria | 3456 |
| 1235 | Ga0501072_0051258 | 3300049588 | Bacteria | 3250 |
| 1236 | Ga0501072_0078873 | 3300049588 | Bacteria | 2607 |
| 1237 | Ga0501072_0081590 | 3300049588 | Bacteria | 2563 |
| 1238 | Ga0501072_0085185 | 3300049588 | Bacteria | 2506 |
| 1239 | Ga0501072_0093659 | 3300049588 | Bacteria | 2386 |
| 1240 | Ga0501072_0128313 | 3300049588 | Bacteria | 2021 |
| 1241 | Ga0501072_0232257 | 3300049588 | Bacteria | 1469 |
| 1242 | Ga0501072_0269483 | 3300049588 | Bacteria | 1355 |
| 1243 | Ga0501072_0337423 | 3300049588 | Bacteria | 1197 |
| 1244 | Ga0501072_0339803 | 3300049588 | Bacteria | 1192 |
| 1245 | Ga0501072_0560674 | 3300049588 | Bacteria | 902 |
| 1246 | Ga0501073_0009166 | 3300049589 | Bacteria | 7300 |
| 1247 | Ga0501073_0011499 | 3300049589 | Bacteria | 6471 |
| 1248 | Ga0501073_0022682 | 3300049589 | Bacteria | 4516 |
| 1249 | Ga0501073_0073553 | 3300049589 | Bacteria | 2379 |
| 1250 | Ga0501073_0222779 | 3300049589 | Bacteria | 1303 |
| 1251 | Ga0501073_0267647 | 3300049589 | Unclassified | 1179 |
| 1252 | Ga0501073_0308242 | 3300049589 | Bacteria | 1092 |
| 1253 | Ga0501073_0444456 | 3300049589 | Bacteria | 896 |
| 1254 | Ga0501074_0000235 | 3300049590 | Bacteria | 30883 |
| 1255 | Ga0501074_0001738 | 3300049590 | Bacteria | 14891 |
| 1256 | Ga0501074_0012633 | 3300049590 | Bacteria | 6141 |
| 1257 | Ga0501074_0013730 | 3300049590 | Bacteria | 5887 |
| 1258 | Ga0501074_0016469 | 3300049590 | Bacteria | 5367 |
| 1259 | Ga0501074_0016954 | 3300049590 | Bacteria | 5285 |
| 1260 | Ga0501074_0018260 | 3300049590 | Bacteria | 5096 |
| 1261 | Ga0501074_0029829 | 3300049590 | Bacteria | 3953 |
| 1262 | Ga0501074_0098357 | 3300049590 | Bacteria | 2094 |
| 1263 | Ga0501074_0117793 | 3300049590 | Bacteria | 1900 |
| 1264 | Ga0501074_0121577 | 3300049590 | Bacteria | 1867 |
| 1265 | Ga0501074_0134276 | 3300049590 | Bacteria | 1770 |
| 1266 | Ga0501074_0149905 | 3300049590 | Bacteria | 1668 |
| 1267 | Ga0501074_0284672 | 3300049590 | Bacteria | 1175 |
| 1268 | Ga0501074_0456125 | 3300049590 | Unclassified | 906 |
| 1269 | Ga0501075_0000893 | 3300049591 | Bacteria | 18824 |
| 1270 | Ga0501075_0006562 | 3300049591 | Bacteria | 8012 |
| 1271 | Ga0501075_0012322 | 3300049591 | Bacteria | 6074 |
| 1272 | Ga0501075_0015474 | 3300049591 | Bacteria | 5475 |
| 1273 | Ga0501075_0017158 | 3300049591 | Bacteria | 5225 |
| 1274 | Ga0501075_0018610 | 3300049591 | Bacteria | 5030 |
| 1275 | Ga0501075_0024351 | 3300049591 | Bacteria | 4437 |
| 1276 | Ga0501075_0038508 | 3300049591 | Bacteria | 3574 |
| 1277 | Ga0501075_0044871 | 3300049591 | Bacteria | 3316 |
| 1278 | Ga0501075_0061712 | 3300049591 | Bacteria | 2825 |
| 1279 | Ga0501075_0073283 | 3300049591 | Bacteria | 2589 |
| 1280 | Ga0501075_0089938 | 3300049591 | Bacteria | 2328 |
| 1281 | Ga0501075_0256608 | 3300049591 | Bacteria | 1332 |
| 1282 | Ga0501075_0258299 | 3300049591 | Bacteria | 1328 |
| 1283 | Ga0501075_0292716 | 3300049591 | Bacteria | 1240 |
| 1284 | Ga0501075_0565501 | 3300049591 | Bacteria | 867 |
| 1285 | Ga0501076_0001738 | 3300049592 | Bacteria | 14736 |
| 1286 | Ga0501076_0002834 | 3300049592 | Bacteria | 11989 |
| 1287 | Ga0501076_0004808 | 3300049592 | Bacteria | 9642 |
| 1288 | Ga0501076_0010423 | 3300049592 | Bacteria | 6900 |
| 1289 | Ga0501076_0016033 | 3300049592 | Bacteria | 5671 |
| 1290 | Ga0501076_0045490 | 3300049592 | Bacteria | 3465 |
| 1291 | Ga0501076_0049222 | 3300049592 | Bacteria | 3332 |
| 1292 | Ga0501076_0056608 | 3300049592 | Bacteria | 3112 |
| 1293 | Ga0501076_0058149 | 3300049592 | Bacteria | 3072 |
| 1294 | Ga0501076_0071667 | 3300049592 | Bacteria | 2772 |
| 1295 | Ga0501076_0100404 | 3300049592 | Bacteria | 2331 |
| 1296 | Ga0501076_0117512 | 3300049592 | Bacteria | 2152 |
| 1297 | Ga0501076_0132895 | 3300049592 | Bacteria | 2019 |
| 1298 | Ga0501076_0171173 | 3300049592 | Bacteria | 1770 |
| 1299 | Ga0501076_0184625 | 3300049592 | Bacteria | 1701 |
| 1300 | Ga0501076_0207385 | 3300049592 | Bacteria | 1601 |
| 1301 | Ga0501076_0311650 | 3300049592 | Unclassified | 1291 |
| 1302 | Ga0501076_0493106 | 3300049592 | Bacteria | 1009 |
| 1303 | Ga0501076_0577694 | 3300049592 | Bacteria | 927 |
| 1304 | Ga0501077_0003176 | 3300049593 | Bacteria | 9893 |
| 1305 | Ga0501077_0003831 | 3300049593 | Bacteria | 9060 |
| 1306 | Ga0501077_0006263 | 3300049593 | Bacteria | 7278 |
| 1307 | Ga0501077_0006855 | 3300049593 | Bacteria | 7010 |
| 1308 | Ga0501077_0007221 | 3300049593 | Bacteria | 6853 |
| 1309 | Ga0501077_0013641 | 3300049593 | Bacteria | 5094 |
| 1310 | Ga0501077_0014691 | 3300049593 | Bacteria | 4920 |
| 1311 | Ga0501077_0018134 | 3300049593 | Bacteria | 4450 |
| 1312 | Ga0501077_0022735 | 3300049593 | Bacteria | 3973 |
| 1313 | Ga0501077_0023533 | 3300049593 | Bacteria | 3906 |
| 1314 | Ga0501077_0024871 | 3300049593 | Bacteria | 3802 |
| 1315 | Ga0501077_0029189 | 3300049593 | Bacteria | 3506 |
| 1316 | Ga0501077_0047200 | 3300049593 | Bacteria | 2736 |
| 1317 | Ga0501077_0066364 | 3300049593 | Bacteria | 2289 |
| 1318 | Ga0501077_0071464 | 3300049593 | Bacteria | 2200 |
| 1319 | Ga0501077_0113433 | 3300049593 | Bacteria | 1718 |
| 1320 | Ga0501077_0163919 | 3300049593 | Bacteria | 1411 |
| 1321 | Ga0501077_0186567 | 3300049593 | Bacteria | 1318 |
| 1322 | Ga0501077_0253531 | 3300049593 | Bacteria | 1119 |
| 1323 | Ga0501077_0422966 | 3300049593 | Bacteria | 852 |
| 1324 | Ga0501079_0000130 | 3300049741 | Bacteria | 40553 |
| 1325 | Ga0501079_0001508 | 3300049741 | Bacteria | 16495 |
| 1326 | Ga0501079_0003750 | 3300049741 | Bacteria | 11216 |
| 1327 | Ga0501079_0004138 | 3300049741 | Bacteria | 10742 |
| 1328 | Ga0501079_0005359 | 3300049741 | Bacteria | 9552 |
| 1329 | Ga0501079_0005449 | 3300049741 | Bacteria | 9483 |
| 1330 | Ga0501079_0008306 | 3300049741 | Bacteria | 7867 |
| 1331 | Ga0501079_0036298 | 3300049741 | Bacteria | 3797 |
| 1332 | Ga0501079_0041273 | 3300049741 | Bacteria | 3561 |
| 1333 | Ga0501079_0043045 | 3300049741 | Bacteria | 3485 |
| 1334 | Ga0501079_0049423 | 3300049741 | Bacteria | 3245 |
| 1335 | Ga0501079_0057012 | 3300049741 | Bacteria | 3014 |
| 1336 | Ga0501079_0073837 | 3300049741 | Bacteria | 2636 |
| 1337 | Ga0501079_0078772 | 3300049741 | Bacteria | 2549 |
| 1338 | Ga0501079_0160792 | 3300049741 | Bacteria | 1751 |
| 1339 | Ga0501079_0551389 | 3300049741 | Unclassified | 906 |
| 1340 | Ga0501080_0005311 | 3300049742 | Bacteria | 11480 |
| 1341 | Ga0501080_0006151 | 3300049742 | Bacteria | 10771 |
| 1342 | Ga0501080_0027447 | 3300049742 | Bacteria | 5293 |
| 1343 | Ga0501080_0034997 | 3300049742 | Bacteria | 4689 |
| 1344 | Ga0501080_0044862 | 3300049742 | Bacteria | 4114 |
| 1345 | Ga0501080_0097169 | 3300049742 | Bacteria | 2734 |
| 1346 | Ga0501080_0254688 | 3300049742 | Unclassified | 1600 |
| 1347 | Ga0501080_0435148 | 3300049742 | Bacteria | 1177 |
| 1348 | Ga0501080_0640491 | 3300049742 | Bacteria | 941 |
| 1349 | Ga0501081_0000313 | 3300049743 | Bacteria | 26016 |
| 1350 | Ga0501081_0019483 | 3300049743 | Bacteria | 4518 |
| 1351 | Ga0501081_0026522 | 3300049743 | Bacteria | 3908 |
| 1352 | Ga0501081_0028312 | 3300049743 | Bacteria | 3781 |
| 1353 | Ga0501081_0031393 | 3300049743 | Bacteria | 3600 |
| 1354 | Ga0501081_0049954 | 3300049743 | Bacteria | 2881 |
| 1355 | Ga0501081_0051817 | 3300049743 | Bacteria | 2830 |
| 1356 | Ga0501081_0052240 | 3300049743 | Bacteria | 2819 |
| 1357 | Ga0501081_0054448 | 3300049743 | Bacteria | 2764 |
| 1358 | Ga0501081_0069304 | 3300049743 | Bacteria | 2457 |
| 1359 | Ga0501081_0114333 | 3300049743 | Bacteria | 1917 |
| 1360 | Ga0501081_0285355 | 3300049743 | Bacteria | 1209 |
| 1361 | Ga0501081_0378957 | 3300049743 | Bacteria | 1045 |
| 1362 | Ga0501081_0493967 | 3300049743 | Bacteria | 912 |
| 1363 | Ga0501083_0000058 | 3300049744 | Bacteria | 78835 |
| 1364 | Ga0501083_0007751 | 3300049744 | Bacteria | 7606 |
| 1365 | Ga0501083_0011370 | 3300049744 | Bacteria | 6244 |
| 1366 | Ga0501083_0031791 | 3300049744 | Bacteria | 3622 |
| 1367 | Ga0501083_0036231 | 3300049744 | Bacteria | 3366 |
| 1368 | Ga0501083_0133777 | 3300049744 | Bacteria | 1625 |
| 1369 | Ga0501083_0187185 | 3300049744 | Bacteria | 1351 |
| 1370 | Ga0501083_0281683 | 3300049744 | Bacteria | 1081 |
| 1371 | Ga0501035_0002449 | 3300049822 | Bacteria | 18130 |
| 1372 | Ga0501035_0005704 | 3300049822 | Bacteria | 11744 |
| 1373 | Ga0501035_0007774 | 3300049822 | Bacteria | 10016 |
| 1374 | Ga0501035_0014714 | 3300049822 | Bacteria | 7222 |
| 1375 | Ga0501035_0016047 | 3300049822 | Bacteria | 6910 |
| 1376 | Ga0501035_0048080 | 3300049822 | Bacteria | 3826 |
| 1377 | Ga0501035_0057549 | 3300049822 | Bacteria | 3466 |
| 1378 | Ga0501035_0108471 | 3300049822 | Bacteria | 2434 |
| 1379 | Ga0501035_0118208 | 3300049822 | Bacteria | 2319 |
| 1380 | Ga0501035_0158037 | 3300049822 | Bacteria | 1964 |
| 1381 | Ga0501035_0160066 | 3300049822 | Bacteria | 1949 |
| 1382 | Ga0501044_0017898 | 3300049823 | Bacteria | 7600 |
| 1383 | Ga0501044_0021418 | 3300049823 | Bacteria | 6896 |
| 1384 | Ga0501044_0034640 | 3300049823 | Bacteria | 5293 |
| 1385 | Ga0501044_0040304 | 3300049823 | Bacteria | 4868 |
| 1386 | Ga0501044_0372247 | 3300049823 | Bacteria | 1345 |
| 1387 | Ga0501045_0000191 | 3300049824 | Bacteria | 34468 |
| 1388 | Ga0501045_0000429 | 3300049824 | Bacteria | 25701 |
| 1389 | Ga0501045_0005703 | 3300049824 | Bacteria | 8614 |
| 1390 | Ga0501045_0007997 | 3300049824 | Bacteria | 7367 |
| 1391 | Ga0501045_0008558 | 3300049824 | Bacteria | 7130 |
| 1392 | Ga0501045_0018931 | 3300049824 | Bacteria | 4903 |
| 1393 | Ga0501045_0024331 | 3300049824 | Bacteria | 4347 |
| 1394 | Ga0501045_0026426 | 3300049824 | Bacteria | 4176 |
| 1395 | Ga0501045_0030872 | 3300049824 | Bacteria | 3880 |
| 1396 | Ga0501045_0040167 | 3300049824 | Bacteria | 3405 |
| 1397 | Ga0501045_0044419 | 3300049824 | Bacteria | 3237 |
| 1398 | Ga0501045_0047217 | 3300049824 | Bacteria | 3136 |
| 1399 | Ga0501045_0049686 | 3300049824 | Bacteria | 3058 |
| 1400 | Ga0501045_0072788 | 3300049824 | Bacteria | 2530 |
| 1401 | Ga0501045_0217930 | 3300049824 | Bacteria | 1421 |
| 1402 | nmdc:mga0yw44_353131_c1 | 3300050492 | Bacteria | 990 |
| 1403 | nmdc:mga0yw44_82810_c1 | 3300050492 | Unclassified | 2014 |
| 1404 | nmdc:mga05p37_105727_c1 | 3300050507 | Bacteria | 3462 |
| 1405 | nmdc:mga05p37_240730_c1 | 3300050507 | Bacteria | 2176 |
| 1406 | nmdc:mga05p37_2477_c1 | 3300050507 | Bacteria | 21478 |
| 1407 | nmdc:mga05p37_26964_c1 | 3300050507 | Bacteria | 6991 |
| 1408 | nmdc:mga05p37_436500_c1 | 3300050507 | Bacteria | 1520 |
| 1409 | nmdc:mga05p37_57579_c1 | 3300050507 | Bacteria | 4787 |
| 1410 | nmdc:mga05p37_589693_c1 | 3300050507 | Bacteria | 1257 |
| 1411 | nmdc:mga05p37_830768_c1 | 3300050507 | Bacteria | 1006 |
| 1412 | nmdc:mga09592_27201_c1 | 3300050508 | Bacteria | 4747 |
| 1413 | nmdc:mga09592_519923_c1 | 3300050508 | Bacteria | 1024 |
| 1414 | nmdc:mga0qj67_100111_c1 | 3300050509 | Bacteria | 2336 |
| 1415 | nmdc:mga0qj67_151928_c1 | 3300050509 | Bacteria | 1879 |
| 1416 | nmdc:mga0qj67_8087_c1 | 3300050509 | Bacteria | 7783 |
| 1417 | nmdc:mga06r32_10854_c1 | 3300050510 | Bacteria | 8202 |
| 1418 | nmdc:mga08y16_118864_c1 | 3300050511 | Bacteria | 2751 |
| 1419 | nmdc:mga08y16_171617_c1 | 3300050511 | Bacteria | 2253 |
| 1420 | nmdc:mga08y16_17740_c1 | 3300050511 | Bacteria | 7496 |
| 1421 | nmdc:mga08y16_218367_c1 | 3300050511 | Bacteria | 1974 |
| 1422 | nmdc:mga08y16_251706_c1 | 3300050511 | Bacteria | 1825 |
| 1423 | nmdc:mga08y16_56389_c1 | 3300050511 | Bacteria | 4107 |
| 1424 | nmdc:mga08y16_7118_c1 | 3300050511 | Bacteria | 11738 |
| 1425 | nmdc:mga08y16_79430_c1 | 3300050511 | Bacteria | 3419 |
| 1426 | nmdc:mga0n895_116841_c1 | 3300050512 | Bacteria | 2686 |
| 1427 | nmdc:mga0n895_464058_c1 | 3300050512 | Bacteria | 1278 |
| 1428 | nmdc:mga0rr50_40874_c1 | 3300050513 | Bacteria | 3374 |
| 1429 | nmdc:mga0rr50_56179_c1 | 3300050513 | Bacteria | 2940 |
| 1430 | nmdc:mga0a205_27721_c1 | 3300050515 | Bacteria | 1399 |
| 1431 | nmdc:mga0a205_28420_c1 | 3300050515 | Bacteria | 5347 |
| 1432 | nmdc:mga0a205_672020_c1 | 3300050515 | Bacteria | 886 |
| 1433 | Ga0495601_0024608 | 3300053077 | Bacteria | 3709 |
| 1434 | Ga0495601_0144163 | 3300053077 | Bacteria | 1554 |
| 1435 | Ga0495612_0065026 | 3300053078 | Bacteria | 1515 |
| 1436 | Ga0495655_0000926 | 3300053083 | Bacteria | 4564 |
| 1437 | Ga0495655_0001216 | 3300053083 | Bacteria | 3975 |
| 1438 | Ga0495595_0005011 | 3300053084 | Bacteria | 5348 |
| 1439 | Ga0495595_0040034 | 3300053084 | Bacteria | 2141 |
| 1440 | Ga0495595_0122088 | 3300053084 | Unclassified | 1269 |
| 1441 | Ga0495619_0003130 | 3300053085 | Bacteria | 10733 |
| 1442 | Ga0495619_0230677 | 3300053085 | Unclassified | 1282 |
| 1443 | Ga0501084_0000824 | 3300054114 | Bacteria | 23857 |
| 1444 | Ga0501084_0000882 | 3300054114 | Bacteria | 23193 |
| 1445 | Ga0501084_0002015 | 3300054114 | Bacteria | 16226 |
| 1446 | Ga0501084_0003386 | 3300054114 | Bacteria | 12920 |
| 1447 | Ga0501084_0011466 | 3300054114 | Bacteria | 7339 |
| 1448 | Ga0501084_0014312 | 3300054114 | Bacteria | 6572 |
| 1449 | Ga0501084_0017115 | 3300054114 | Bacteria | 6022 |
| 1450 | Ga0501084_0027966 | 3300054114 | Bacteria | 4711 |
| 1451 | Ga0501084_0033649 | 3300054114 | Bacteria | 4287 |
| 1452 | Ga0501084_0041808 | 3300054114 | Bacteria | 3834 |
| 1453 | Ga0501084_0044543 | 3300054114 | Bacteria | 3714 |
| 1454 | Ga0501084_0052643 | 3300054114 | Bacteria | 3405 |
| 1455 | Ga0501084_0065561 | 3300054114 | Bacteria | 3039 |
| 1456 | Ga0501084_0079544 | 3300054114 | Bacteria | 2748 |
| 1457 | Ga0501084_0103261 | 3300054114 | Bacteria | 2394 |
| 1458 | Ga0501084_0107193 | 3300054114 | Bacteria | 2347 |
| 1459 | Ga0501084_0145219 | 3300054114 | Bacteria | 1998 |
| 1460 | Ga0501084_0290502 | 3300054114 | Bacteria | 1381 |
| 1461 | Ga0501084_0349834 | 3300054114 | Bacteria | 1248 |
| 1462 | Ga0501084_0469525 | 3300054114 | Bacteria | 1064 |
| 1463 | Ga0590071_008552 | 3300059421 | Bacteria | 2407 |
| 1464 | Ga0590075_013707 | 3300059424 | Bacteria | 1978 |
| 1465 | Ga0501082_0001300 | 3300060353 | Bacteria | 21901 |
| 1466 | Ga0501082_0008205 | 3300060353 | Bacteria | 9011 |
| 1467 | Ga0501082_0015071 | 3300060353 | Bacteria | 6658 |
| 1468 | Ga0501082_0016418 | 3300060353 | Bacteria | 6371 |
| 1469 | Ga0501082_0025059 | 3300060353 | Bacteria | 5139 |
| 1470 | Ga0501082_0026383 | 3300060353 | Bacteria | 5005 |
| 1471 | Ga0501082_0027469 | 3300060353 | Bacteria | 4899 |
| 1472 | Ga0501082_0031802 | 3300060353 | Bacteria | 4551 |
| 1473 | Ga0501082_0038077 | 3300060353 | Bacteria | 4148 |
| 1474 | Ga0501082_0052677 | 3300060353 | Bacteria | 3507 |
| 1475 | Ga0501082_0067700 | 3300060353 | Bacteria | 3075 |
| 1476 | Ga0501082_0086816 | 3300060353 | Bacteria | 2698 |
| 1477 | Ga0501082_0141421 | 3300060353 | Unclassified | 2089 |
| 1478 | Ga0501082_0152317 | 3300060353 | Bacteria | 2009 |
| 1479 | Ga0501082_0191475 | 3300060353 | Bacteria | 1779 |
| 1480 | Ga0501082_0306002 | 3300060353 | Bacteria | 1384 |
| 1481 | Ga0501082_0449647 | 3300060353 | Bacteria | 1126 |
| 1482 | Ga0501082_0501195 | 3300060353 | Bacteria | 1061 |
| 1483 | Ga0501082_0538202 | 3300060353 | Bacteria | 1021 |
| 1484 | Ga0501082_0776418 | 3300060353 | Bacteria | 838 |
| 1485 | Ga0466962_0004873 | 3300061719 | Bacteria | 6454 |
| 1486 | Ga0466962_0012256 | 3300061719 | Bacteria | 4121 |
| 1487 | Ga0466962_0182991 | 3300061719 | Bacteria | 1022 |
| 1488 | Ga0530510_0000865 | 3300061734 | Bacteria | 19956 |
| 1489 | Ga0530510_0001330 | 3300061734 | Bacteria | 16535 |
| 1490 | Ga0530510_0004226 | 3300061734 | Bacteria | 9931 |
| 1491 | Ga0530510_0005976 | 3300061734 | Bacteria | 8443 |
| 1492 | Ga0530510_0013738 | 3300061734 | Bacteria | 5699 |
| 1493 | Ga0530510_0016178 | 3300061734 | Bacteria | 5275 |
| 1494 | Ga0530510_0027309 | 3300061734 | Bacteria | 4089 |
| 1495 | Ga0530510_0042956 | 3300061734 | Bacteria | 3265 |
| 1496 | Ga0530510_0045203 | 3300061734 | Bacteria | 3182 |
| 1497 | Ga0530510_0071984 | 3300061734 | Bacteria | 2509 |
| 1498 | Ga0530510_0075426 | 3300061734 | Bacteria | 2449 |
| 1499 | Ga0530510_0080206 | 3300061734 | Bacteria | 2374 |
| 1500 | Ga0530510_0131194 | 3300061734 | Bacteria | 1843 |
| 1501 | Ga0530510_0201021 | 3300061734 | Bacteria | 1480 |
| 1502 | Ga0530510_0614790 | 3300061734 | Unclassified | 827 |
| 1503 | Ga0530510_0158472 | |||
| 1504 | ARcpr5oldR_c003182 | |||
| 1505 | JGI24739J22299_10032072 | |||
| 1506 | JGI24743J22301_10004088 | |||
| 1507 | JGI24738J21930_10013484 | |||
| 1508 | JGI24744J21845_10010742 | |||
| 1509 | JGI24744J21845_10015692 | |||
| 1510 | JGI24033J26618_1009698 | |||
| 1511 | JGI24751J29686_10002390 | |||
| 1512 | JGI25407J50210_10002200 | |||
| 1513 | JGI25407J50210_10012870 | |||
| 1514 | JGI25407J50210_10019135 | |||
| 1515 | JGI25407J50210_10040997 | |||
| 1516 | JGI25407J50210_10070894 | |||
| 1517 | Ga0070658_10177926 | |||
| 1518 | Ga0070658_10227673 | |||
| 1519 | Ga0070658_10555359 | |||
| 1520 | Ga0070658_10601447 | |||
| 1521 | Ga0070676_10105811 | |||
| 1522 | Ga0070683_100022112 | |||
| 1523 | Ga0070683_100040560 | |||
| 1524 | Ga0070683_100048201 | |||
| 1525 | Ga0070683_100057210 | |||
| 1526 | Ga0070683_100082560 | |||
| 1527 | Ga0070683_100135504 | |||
| 1528 | Ga0070683_100144012 | |||
| 1529 | Ga0070683_100200893 | |||
| 1530 | Ga0070683_100270508 | |||
| 1531 | Ga0070683_100344858 | |||
| 1532 | Ga0070683_100463967 | |||
| 1533 | Ga0070683_100485687 | |||
| 1534 | Ga0070683_100500406 | |||
| 1535 | Ga0070683_100649423 | |||
| 1536 | Ga0070690_100131236 | |||
| 1537 | Ga0068869_100088600 | |||
| 1538 | Ga0068869_100473325 | |||
| 1539 | Ga0070680_100010968 | |||
| 1540 | Ga0070680_100018239 | |||
| 1541 | Ga0070680_100022628 | |||
| 1542 | Ga0070680_100028601 | |||
| 1543 | Ga0070680_100071442 | |||
| 1544 | Ga0070680_100073686 | |||
| 1545 | Ga0070680_100136047 | |||
| 1546 | Ga0070680_100242924 | |||
| 1547 | Ga0070682_100002171 | |||
| 1548 | Ga0070682_100039904 | |||
| 1549 | Ga0070682_100101682 | |||
| 1550 | Ga0068868_100320480 | |||
| 1551 | Ga0070660_100008471 | |||
| 1552 | Ga0070660_100012212 | |||
| 1553 | Ga0070660_100025299 | |||
| 1554 | Ga0070660_100050415 | |||
| 1555 | Ga0070660_100356088 | |||
| 1556 | Ga0070689_100004845 | |||
| 1557 | Ga0070689_100014058 | |||
| 1558 | Ga0070691_10072689 | |||
| 1559 | Ga0070687_100023730 | |||
| 1560 | Ga0070687_100026372 | |||
| 1561 | Ga0070661_100008990 | |||
| 1562 | Ga0070661_100012209 | |||
| 1563 | Ga0070661_100038149 | |||
| 1564 | Ga0070661_100130048 | |||
| 1565 | Ga0070661_100289621 | |||
| 1566 | Ga0070692_10109838 | |||
| 1567 | Ga0070692_10172581 | |||
| 1568 | Ga0070668_100053773 | |||
| 1569 | Ga0070668_100123057 | |||
| 1570 | Ga0070669_100151931 | |||
| 1571 | Ga0070669_100472114 | |||
| 1572 | Ga0070675_100006745 | |||
| 1573 | Ga0070671_100029577 | |||
| 1574 | Ga0070671_100395684 | |||
| 1575 | Ga0070674_100000969 | |||
| 1576 | Ga0070674_100055510 | |||
| 1577 | Ga0070674_100279038 | |||
| 1578 | Ga0070673_100036778 | |||
| 1579 | Ga0070673_100093932 | |||
| 1580 | Ga0070688_100000622 | |||
| 1581 | Ga0070688_100051855 | |||
| 1582 | Ga0070688_100139138 | |||
| 1583 | Ga0070659_100013748 | |||
| 1584 | Ga0070659_100069700 | |||
| 1585 | Ga0070659_100185037 | |||
| 1586 | Ga0070659_100196653 | |||
| 1587 | Ga0070659_100483586 | |||
| 1588 | Ga0070667_100034742 | |||
| 1589 | Ga0070667_100158702 | |||
| 1590 | Ga0070714_100526522 | |||
| 1591 | Ga0070714_100654449 | |||
| 1592 | Ga0070714_100683297 | |||
| 1593 | Ga0070713_100106004 | |||
| 1594 | Ga0070713_100345254 | |||
| 1595 | Ga0070710_10275368 | |||
| 1596 | Ga0070701_10030345 | |||
| 1597 | Ga0070711_100478100 | |||
| 1598 | Ga0070705_100048881 | |||
| 1599 | Ga0070700_100346796 | |||
| 1600 | Ga0070694_100079502 | |||
| 1601 | Ga0070708_100033117 | |||
| 1602 | Ga0070663_100079585 | |||
| 1603 | Ga0070663_100250382 | |||
| 1604 | Ga0070663_100471652 | |||
| 1605 | Ga0070678_100008743 | |||
| 1606 | Ga0070678_100028711 | |||
| 1607 | Ga0070678_100112538 | |||
| 1608 | Ga0070678_100238729 | |||
| 1609 | Ga0070662_100226865 | |||
| 1610 | Ga0070681_10011373 | |||
| 1611 | Ga0070681_10029668 | |||
| 1612 | Ga0070681_10041815 | |||
| 1613 | Ga0070681_10070401 | |||
| 1614 | Ga0070681_10077344 | |||
| 1615 | Ga0070681_10119786 | |||
| 1616 | Ga0070681_10206450 | |||
| 1617 | Ga0070681_10575848 | |||
| 1618 | Ga0070681_10634043 | |||
| 1619 | Ga0068867_100033342 | |||
| 1620 | Ga0068867_100337881 | |||
| 1621 | Ga0070685_10003403 | |||
| 1622 | Ga0070685_10038539 | |||
| 1623 | Ga0070685_10124066 | |||
| 1624 | Ga0070706_100136916 | |||
| 1625 | Ga0070707_100230738 | |||
| 1626 | Ga0070699_100021930 | |||
| 1627 | Ga0070699_100213351 | |||
| 1628 | Ga0070679_100007114 | |||
| 1629 | Ga0070679_100028797 | |||
| 1630 | Ga0070679_100089177 | |||
| 1631 | Ga0070679_100125137 | |||
| 1632 | Ga0070679_100169820 | |||
| 1633 | Ga0070679_100308073 | |||
| 1634 | Ga0070684_100005407 | |||
| 1635 | Ga0070684_100038137 | |||
| 1636 | Ga0070684_100058574 | |||
| 1637 | Ga0070684_100073569 | |||
| 1638 | Ga0070684_100126605 | |||
| 1639 | Ga0070684_100148844 | |||
| 1640 | Ga0070684_100307441 | |||
| 1641 | Ga0068853_100163039 | |||
| 1642 | Ga0068853_100648900 | |||
| 1643 | Ga0070672_100024810 | |||
| 1644 | Ga0070672_100025873 | |||
| 1645 | Ga0070672_100387186 | |||
| 1646 | Ga0070686_100287035 | |||
| 1647 | Ga0070696_100011676 | |||
| 1648 | Ga0070696_100176186 | |||
| 1649 | Ga0070696_100328704 | |||
| 1650 | Ga0070693_100006766 | |||
| 1651 | Ga0070693_100019512 | |||
| 1652 | Ga0070693_100106005 | |||
| 1653 | Ga0070665_100051711 | |||
| 1654 | Ga0070665_100125332 | |||
| 1655 | Ga0070665_100211417 | |||
| 1656 | Ga0070665_100327537 | |||
| 1657 | Ga0070704_100069436 | |||
| 1658 | Ga0070704_100124352 | |||
| 1659 | Ga0070704_100294432 | |||
| 1660 | Ga0068855_100012841 | |||
| 1661 | Ga0068855_100016655 | |||
| 1662 | Ga0068855_100022296 | |||
| 1663 | Ga0068855_100052137 | |||
| 1664 | Ga0068855_100094434 | |||
| 1665 | Ga0068855_100462295 | |||
| 1666 | Ga0070664_100044302 | |||
| 1667 | Ga0070664_100106665 | |||
| 1668 | Ga0070664_100182154 | |||
| 1669 | Ga0068857_100104689 | |||
| 1670 | Ga0068857_100110034 | |||
| 1671 | Ga0068857_100118887 | |||
| 1672 | Ga0068854_100062975 | |||
| 1673 | Ga0068854_100074946 | |||
| 1674 | Ga0068854_100239290 | |||
| 1675 | Ga0068856_100024369 | |||
| 1676 | Ga0068856_100028748 | |||
| 1677 | Ga0068856_100053236 | |||
| 1678 | Ga0068856_100077021 | |||
| 1679 | Ga0068856_100135503 | |||
| 1680 | Ga0068856_100288193 | |||
| 1681 | Ga0070702_100006091 | |||
| 1682 | Ga0070702_100077838 | |||
| 1683 | Ga0070702_100137638 | |||
| 1684 | Ga0070702_100336654 | |||
| 1685 | Ga0068852_100112165 | |||
| 1686 | Ga0068852_100270468 | |||
| 1687 | Ga0068852_100281862 | |||
| 1688 | Ga0068852_100353875 | |||
| 1689 | Ga0068859_100178859 | |||
| 1690 | Ga0068864_100063292 | |||
| 1691 | Ga0068864_100138952 | |||
| 1692 | Ga0068866_10034383 | |||
| 1693 | Ga0068866_10046914 | |||
| 1694 | Ga0068861_100077911 | |||
| 1695 | Ga0068870_10001168 | |||
| 1696 | Ga0068870_10038143 | |||
| 1697 | Ga0068870_10055386 | |||
| 1698 | Ga0068870_10185515 | |||
| 1699 | Ga0068863_100079276 | |||
| 1700 | Ga0068858_100035180 | |||
| 1701 | Ga0068858_100128811 | |||
| 1702 | Ga0068860_100145206 | |||
| 1703 | Ga0068862_100067992 | |||
| 1704 | Ga0068862_100390387 | |||
| 1705 | Ga0081455_10020460 | |||
| 1706 | Ga0081455_10029851 | |||
| 1707 | Ga0081455_10053591 | |||
| 1708 | Ga0081455_10075419 | |||
| 1709 | Ga0081455_10099399 | |||
| 1710 | Ga0081455_10135191 | |||
| 1711 | Ga0081538_10000053 | |||
| 1712 | Ga0081538_10000060 | |||
| 1713 | Ga0081538_10001619 | |||
| 1714 | Ga0081538_10003876 | |||
| 1715 | Ga0081538_10023525 | |||
| 1716 | Ga0081538_10085773 | |||
| 1717 | Ga0081540_1028563 | |||
| 1718 | Ga0081539_10005173 | |||
| 1719 | Ga0081539_10008003 | |||
| 1720 | Ga0081539_10133518 | |||
| 1721 | Ga0070717_10036916 | |||
| 1722 | Ga0070717_10381332 | |||
| 1723 | Ga0075365_10083266 | |||
| 1724 | Ga0075365_10267487 | |||
| 1725 | Ga0075432_10001371 | |||
| 1726 | Ga0075432_10046483 | |||
| 1727 | Ga0070712_100168162 | |||
| 1728 | Ga0070712_100441537 | |||
| 1729 | Ga0097621_100335256 | |||
| 1730 | Ga0097621_100474716 | |||
| 1731 | Ga0068871_100369116 | |||
| 1732 | Ga0075428_100000411 | |||
| 1733 | Ga0075428_100005096 | |||
| 1734 | Ga0075428_100019492 | |||
| 1735 | Ga0075428_100165773 | |||
| 1736 | Ga0075428_100242679 | |||
| 1737 | Ga0075428_100535860 | |||
| 1738 | Ga0075430_100001646 | |||
| 1739 | Ga0075430_100188785 | |||
| 1740 | Ga0075431_100008014 | |||
| 1741 | Ga0075433_10079022 | |||
| 1742 | Ga0075429_100011938 | |||
| 1743 | Ga0075429_100084993 | |||
| 1744 | Ga0068865_100005904 | |||
| 1745 | Ga0068865_100086753 | |||
| 1746 | Ga0068865_100188934 | |||
| 1747 | Ga0097620_100178855 | |||
| 1748 | Ga0075435_100057728 | |||
| 1749 | Ga0075435_100189228 | |||
| 1750 | Ga0105244_10164476 | |||
| 1751 | Ga0105240_10055251 | |||
| 1752 | Ga0105240_10130250 | |||
| 1753 | Ga0105240_10158454 | |||
| 1754 | Ga0105240_10217139 | |||
| 1755 | Ga0111539_10005465 | |||
| 1756 | Ga0111539_10006234 | |||
| 1757 | Ga0111539_10026000 | |||
| 1758 | Ga0111539_10076732 | |||
| 1759 | Ga0111539_10087612 | |||
| 1760 | Ga0111539_10213355 | |||
| 1761 | Ga0111539_10259796 | |||
| 1762 | Ga0111539_10894264 | |||
| 1763 | Ga0105245_10036788 | |||
| 1764 | Ga0105245_10059563 | |||
| 1765 | Ga0105245_10191049 | |||
| 1766 | Ga0105245_10414208 | |||
| 1767 | Ga0105245_10726400 | |||
| 1768 | Ga0105245_10868041 | |||
| 1769 | Ga0105247_10031890 | |||
| 1770 | Ga0105247_10130276 | |||
| 1771 | Ga0114129_10006651 | |||
| 1772 | Ga0114129_10035068 | |||
| 1773 | Ga0114129_10041736 | |||
| 1774 | Ga0114129_10059915 | |||
| 1775 | Ga0114129_10241534 | |||
| 1776 | Ga0114129_10670477 | |||
| 1777 | Ga0114129_10710552 | |||
| 1778 | Ga0105243_10007699 | |||
| 1779 | Ga0105243_10021955 | |||
| 1780 | Ga0105243_10028908 | |||
| 1781 | Ga0105243_10118470 | |||
| 1782 | Ga0105241_10162076 | |||
| 1783 | Ga0105241_10399936 | |||
| 1784 | Ga0105241_10600437 | |||
| 1785 | Ga0105242_10019197 | |||
| 1786 | Ga0105242_10038091 | |||
| 1787 | Ga0105242_10038126 | |||
| 1788 | Ga0105242_10236841 | |||
| 1789 | Ga0105242_10334705 | |||
| 1790 | Ga0105242_10533360 | |||
| 1791 | Ga0105242_11035516 | |||
| 1792 | Ga0105248_10117333 | |||
| 1793 | Ga0105248_10446221 | |||
| 1794 | Ga0105248_10481304 | |||
| 1795 | Ga0105248_11146134 | |||
| 1796 | Ga0105237_10396537 | |||
| 1797 | Ga0105238_10013751 | |||
| 1798 | Ga0105238_10094488 | |||
| 1799 | Ga0105249_10104608 | |||
| 1800 | Ga0105249_10349009 | |||
| 1801 | Ga0105239_10023094 | |||
| 1802 | Ga0105239_10025839 | |||
| 1803 | Ga0105239_10060540 | |||
| 1804 | Ga0105239_10308615 | |||
| 1805 | Ga0105239_10891531 | |||
| 1806 | Ga0105239_10962387 | |||
| 1807 | Ga0105246_10015487 | |||
| 1808 | Ga0105246_10080467 | |||
| 1809 | Ga0105246_10092536 | |||
| 1810 | Ga0105246_11081543 | |||
| 1811 | Ga0157371_10030301 | |||
| 1812 | Ga0157371_10159266 | |||
| 1813 | Ga0157371_10165057 | |||
| 1814 | Ga0157370_10016119 | |||
| 1815 | Ga0157370_10045044 | |||
| 1816 | Ga0157370_10055018 | |||
| 1817 | Ga0157370_10076769 | |||
| 1818 | Ga0157370_10095728 | |||
| 1819 | Ga0157370_10189639 | |||
| 1820 | Ga0157370_10451684 | |||
| 1821 | Ga0157369_10002303 | |||
| 1822 | Ga0157369_10010556 | |||
| 1823 | Ga0157369_10015027 | |||
| 1824 | Ga0157369_10046905 | |||
| 1825 | Ga0157369_10403841 | |||
| 1826 | Ga0157374_10440189 | |||
| 1827 | Ga0157374_10486337 | |||
| 1828 | Ga0157374_10703585 | |||
| 1829 | Ga0157378_10572261 | |||
| 1830 | Ga0163162_10427020 | |||
| 1831 | Ga0157372_10152275 | |||
| 1832 | Ga0157372_10255136 | |||
| 1833 | Ga0157372_10318912 | |||
| 1834 | Ga0157372_10345417 | |||
| 1835 | Ga0157372_10463449 | |||
| 1836 | Ga0157372_10797499 | |||
| 1837 | Ga0157375_10014615 | |||
| 1838 | Ga0157375_10080878 | |||
| 1839 | Ga0157375_10117242 | |||
| 1840 | Ga0157375_10143581 | |||
| 1841 | Ga0157375_10467082 | |||
| 1842 | Ga0157375_10575488 | |||
| 1843 | Ga0163163_10003920 | |||
| 1844 | Ga0163163_10013038 | |||
| 1845 | Ga0163163_10041946 | |||
| 1846 | Ga0163163_10116876 | |||
| 1847 | Ga0163163_10439331 | |||
| 1848 | Ga0157380_10014017 | |||
| 1849 | Ga0157380_10034055 | |||
| 1850 | Ga0157380_10080696 | |||
| 1851 | Ga0157380_10118739 | |||
| 1852 | Ga0157377_10044381 | |||
| 1853 | Ga0157377_10064623 | |||
| 1854 | Ga0157377_10144168 | |||
| 1855 | Ga0157379_10068549 | |||
| 1856 | Ga0157376_10099591 | |||
| 1857 | Ga0157376_10253723 | |||
| 1858 | Ga0157376_10556644 | |||
| 1859 | Ga0163161_10040750 | |||
| 1860 | Ga0197907_10409808 | |||
| 1861 | Ga0197907_10896525 | |||
| 1862 | Ga0206356_10031764 | |||
| 1863 | Ga0206356_10355467 | |||
| 1864 | Ga0206356_10456913 | |||
| 1865 | Ga0206354_10030587 | |||
| 1866 | Ga0206354_11649605 | |||
| 1867 | Ga0206353_11455507 | |||
| 1868 | Ga0206353_11548455 | |||
| 1869 | Ga0207653_10030307 | |||
| 1870 | Ga0207642_10082910 | |||
| 1871 | Ga0207642_10083670 | |||
| 1872 | Ga0207642_10205794 | |||
| 1873 | Ga0207710_10034316 | |||
| 1874 | Ga0207688_10058305 | |||
| 1875 | Ga0207645_10042757 | |||
| 1876 | Ga0207645_10308411 | |||
| 1877 | Ga0207643_10001394 | |||
| 1878 | Ga0207643_10011125 | |||
| 1879 | Ga0207643_10019487 | |||
| 1880 | Ga0207643_10053201 | |||
| 1881 | Ga0207643_10089647 | |||
| 1882 | Ga0207705_10022323 | |||
| 1883 | Ga0207705_10045636 | |||
| 1884 | Ga0207705_10143292 | |||
| 1885 | Ga0207705_10217262 | |||
| 1886 | Ga0207684_10099042 | |||
| 1887 | Ga0207684_10112907 | |||
| 1888 | Ga0207654_10056324 | |||
| 1889 | Ga0207654_10082553 | |||
| 1890 | Ga0207707_10003519 | |||
| 1891 | Ga0207707_10009500 | |||
| 1892 | Ga0207707_10010456 | |||
| 1893 | Ga0207707_10048497 | |||
| 1894 | Ga0207707_10060472 | |||
| 1895 | Ga0207707_10232339 | |||
| 1896 | Ga0207707_10237107 | |||
| 1897 | Ga0207695_10445632 | |||
| 1898 | Ga0207695_10588678 | |||
| 1899 | Ga0207671_10098486 | |||
| 1900 | Ga0207693_10029592 | |||
| 1901 | Ga0207693_10367469 | |||
| 1902 | Ga0207663_10079884 | |||
| 1903 | Ga0207663_10297435 | |||
| 1904 | Ga0207660_10006022 | |||
| 1905 | Ga0207660_10006989 | |||
| 1906 | Ga0207660_10055775 | |||
| 1907 | Ga0207660_10136576 | |||
| 1908 | Ga0207660_10350383 | |||
| 1909 | Ga0207662_10046335 | |||
| 1910 | Ga0207662_10049628 | |||
| 1911 | Ga0207657_10000964 | |||
| 1912 | Ga0207657_10005129 | |||
| 1913 | Ga0207657_10006273 | |||
| 1914 | Ga0207657_10015819 | |||
| 1915 | Ga0207657_10019162 | |||
| 1916 | Ga0207657_10037998 | |||
| 1917 | Ga0207649_10026660 | |||
| 1918 | Ga0207649_10111901 | |||
| 1919 | Ga0207649_10125261 | |||
| 1920 | Ga0207649_10256595 | |||
| 1921 | Ga0207649_10275813 | |||
| 1922 | Ga0207652_10004108 | |||
| 1923 | Ga0207652_10016334 | |||
| 1924 | Ga0207652_10023280 | |||
| 1925 | Ga0207652_10104857 | |||
| 1926 | Ga0207652_10142354 | |||
| 1927 | Ga0207652_10192852 | |||
| 1928 | Ga0207652_10329969 | |||
| 1929 | Ga0207646_10443255 | |||
| 1930 | Ga0207681_10093155 | |||
| 1931 | Ga0207681_10163446 | |||
| 1932 | Ga0207681_10212534 | |||
| 1933 | Ga0207681_10424348 | |||
| 1934 | Ga0207694_10157213 | |||
| 1935 | Ga0207650_10086636 | |||
| 1936 | Ga0207659_10109256 | |||
| 1937 | Ga0207687_10028420 | |||
| 1938 | Ga0207687_10144978 | |||
| 1939 | Ga0207687_10162881 | |||
| 1940 | Ga0207687_10169103 | |||
| 1941 | Ga0207687_10345717 | |||
| 1942 | Ga0207700_10066710 | |||
| 1943 | Ga0207664_10305579 | |||
| 1944 | Ga0207664_10731049 | |||
| 1945 | Ga0207664_10825459 | |||
| 1946 | Ga0207644_10097090 | |||
| 1947 | Ga0207644_10266247 | |||
| 1948 | Ga0207690_10026511 | |||
| 1949 | Ga0207690_10038356 | |||
| 1950 | Ga0207690_10116671 | |||
| 1951 | Ga0207690_10185241 | |||
| 1952 | Ga0207706_10009052 | |||
| 1953 | Ga0207706_10028469 | |||
| 1954 | Ga0207686_10087634 | |||
| 1955 | Ga0207686_10120860 | |||
| 1956 | Ga0207686_10208494 | |||
| 1957 | Ga0207709_10015116 | |||
| 1958 | Ga0207709_10201683 | |||
| 1959 | Ga0207670_10048334 | |||
| 1960 | Ga0207670_10099191 | |||
| 1961 | Ga0207669_10074747 | |||
| 1962 | Ga0207669_10105227 | |||
| 1963 | Ga0207669_10165568 | |||
| 1964 | Ga0207704_10032534 | |||
| 1965 | Ga0207704_10033752 | |||
| 1966 | Ga0207704_10122465 | |||
| 1967 | Ga0207691_10014782 | |||
| 1968 | Ga0207691_10037730 | |||
| 1969 | Ga0207691_10047204 | |||
| 1970 | Ga0207691_10481241 | |||
| 1971 | Ga0207711_10084135 | |||
| 1972 | Ga0207711_10198323 | |||
| 1973 | Ga0207711_10273676 | |||
| 1974 | Ga0207689_10146634 | |||
| 1975 | Ga0207689_10215945 | |||
| 1976 | Ga0207661_10000504 | |||
| 1977 | Ga0207661_10030216 | |||
| 1978 | Ga0207661_10078061 | |||
| 1979 | Ga0207661_10180837 | |||
| 1980 | Ga0207661_10207740 | |||
| 1981 | Ga0207661_10288065 | |||
| 1982 | Ga0207661_10339606 | |||
| 1983 | Ga0207661_10421831 | |||
| 1984 | Ga0207661_10517096 | |||
| 1985 | Ga0207679_10001100 | |||
| 1986 | Ga0207679_10087018 | |||
| 1987 | Ga0207667_10037484 | |||
| 1988 | Ga0207667_10136180 | |||
| 1989 | Ga0207667_10243197 | |||
| 1990 | Ga0207667_10378071 | |||
| 1991 | Ga0207651_10127222 | |||
| 1992 | Ga0207651_10238499 | |||
| 1993 | Ga0207651_10293315 | |||
| 1994 | Ga0207712_10379298 | |||
| 1995 | Ga0207668_10027746 | |||
| 1996 | Ga0207668_10110569 | |||
| 1997 | Ga0207668_10612357 | |||
| 1998 | Ga0207640_10014605 | |||
| 1999 | Ga0207640_10033043 | |||
| 2000 | Ga0207640_10092949 | |||
| 2001 | Ga0207640_10184494 | |||
| 2002 | Ga0207658_10017741 | |||
| 2003 | Ga0207658_10126294 | |||
| 2004 | Ga0207677_10212035 | |||
| 2005 | Ga0207677_10675882 | |||
| 2006 | Ga0207639_10205217 | |||
| 2007 | Ga0207639_10256476 | |||
| 2008 | Ga0207678_10081335 | |||
| 2009 | Ga0207678_10280944 | |||
| 2010 | Ga0207678_10365984 | |||
| 2011 | Ga0207708_10007756 | |||
| 2012 | Ga0207708_10023543 | |||
| 2013 | Ga0207702_10103209 | |||
| 2014 | Ga0207702_10169536 | |||
| 2015 | Ga0207702_10717734 | |||
| 2016 | Ga0207641_10054555 | |||
| 2017 | Ga0207648_10002280 | |||
| 2018 | Ga0207648_10026183 | |||
| 2019 | Ga0207648_10065063 | |||
| 2020 | Ga0207648_10329420 | |||
| 2021 | Ga0207676_10016301 | |||
| 2022 | Ga0207676_10029559 | |||
| 2023 | Ga0207676_10178285 | |||
| 2024 | Ga0207674_10013923 | |||
| 2025 | Ga0207674_10041497 | |||
| 2026 | Ga0207674_10049525 | |||
| 2027 | Ga0207674_10064950 | |||
| 2028 | Ga0207674_10178378 | |||
| 2029 | Ga0207674_10369253 | |||
| 2030 | Ga0207675_100011398 | |||
| 2031 | Ga0207675_100061290 | |||
| 2032 | Ga0207675_100150180 | |||
| 2033 | Ga0207683_10037573 | |||
| 2034 | Ga0207683_10037902 | |||
| 2035 | Ga0207683_10097515 | |||
| 2036 | Ga0207683_10227005 | |||
| 2037 | Ga0207683_10285353 | |||
| 2038 | Ga0207698_10077666 | |||
| 2039 | Ga0207698_10368561 | |||
| 2040 | Ga0207428_10000108 | |||
| 2041 | Ga0207428_10007111 | |||
| 2042 | Ga0207428_10022197 | |||
| 2043 | Ga0207428_10028411 | |||
| 2044 | Ga0207428_10289215 | |||
| 2045 | Ga0268266_10022553 | |||
| 2046 | Ga0268266_10041268 | |||
| 2047 | Ga0268266_10363091 | |||
| 2048 | Ga0268266_10481416 | |||
| 2049 | Ga0268266_10577510 | |||
| 2050 | Ga0268265_10202773 | |||
| 2051 | Ga0268264_10096268 | |||
| 2052 | Ga0268264_10192627 | |||
| 2053 | Ga0268264_11036588 | |||
| 2054 | Ga0265326_10010724 | |||
| 2055 | Ga0265319_1021414 | |||
| 2056 | Ga0265318_10037910 | |||
| 2057 | Ga0265338_10030316 | |||
| 2058 | Ga0265338_10035415 | |||
| 2059 | Ga0265338_10126744 | |||
| 2060 | Ga0265328_10024366 | |||
| 2061 | Ga0265320_10052353 | |||
| 2062 | Ga0265325_10010118 | |||
| 2063 | Ga0265329_10023878 | |||
| 2064 | Ga0265339_10016391 | |||
| 2065 | Ga0265331_10052052 | |||
| 2066 | Ga0265327_10030796 | |||
| 2067 | Ga0265327_10033181 | |||
| 2068 | Ga0265327_10041907 | |||
| 2069 | Ga0265316_10072474 | |||
| 2070 | Ga0307408_100194268 | |||
| 2071 | Ga0307408_100346381 | |||
| 2072 | Ga0265313_10015452 | |||
| 2073 | Ga0265313_10024998 | |||
| 2074 | Ga0265314_10008957 | |||
| 2075 | Ga0265314_10045410 | |||
| 2076 | Ga0265342_10025929 | |||
| 2077 | Ga0307410_10296863 | |||
| 2078 | Ga0307407_10260407 | |||
| 2079 | Ga0307412_10165365 | |||
| 2080 | Ga0307412_10171630 | |||
| 2081 | Ga0307409_100035699 | |||
| 2082 | Ga0307416_100332500 | |||
| 2083 | Ga0307416_100359604 | |||
| 2084 | Ga0307414_10244955 | |||
| 2085 | Ga0307415_100266713 | |||
| 2086 | Ga0373938_0012473 | |||
| 2087 | Ga0373926_0026260 | |||
| 2088 | Ga0373926_0037205 | |||
| 2089 | Ga0373934_0032538 | |||
| 2090 | Ga0373944_0007465 | |||
| 2091 | Ga0373944_0025593 | |||
| 2092 | Ga0373951_0009786 | |||
| 2093 | Ga0373952_0010306 | |||
| 2094 | Ga0373936_0015074 | |||
| 2095 | Ga0373939_0235164 | |||
| 2096 | Ga0373941_0112181 | |||
| 2097 | Ga0373945_0002007 | |||
| 2098 | Ga0373956_0076238 | |||
| 2099 | Ga0373960_0012535 | |||
| 2100 | Ga0373943_0000968 | |||
| 2101 | Ga0373943_0005277 | |||
| 2102 | Ga0373943_0009624 | |||
| 2103 | Ga0373943_0026802 | |||
| 2104 | Ga0373946_0000950 | |||
| 2105 | Ga0373946_0030674 | |||
| 2106 | Ga0373946_0084228 | |||
| 2107 | Ga0373961_0014308 | |||
| 2108 | Ga0373931_0147565 | |||
| 2109 | Ga0373935_0035080 | |||
| 2110 | Ga0373935_0046128 | |||
| 2111 | Ga0373935_0079007 | |||
| 2112 | Ga0373935_0184417 | |||
| 2113 | Ga0373927_0211566 | |||
| 2114 | Ga0373947_0001964 | |||
| 2115 | Ga0373947_0010758 | |||
| 2116 | Ga0373947_0037586 | |||
| 2117 | Ga0373947_0056406 | |||
| 2118 | Ga0373947_0123861 | |||
| 2119 | Ga0373947_0280159 | |||
| 2120 | Ga0373937_0222149 | |||
| 2121 | Ga0373925_0037531 | |||
| 2122 | Ga0373925_0038325 | |||
| 2123 | Ga0373925_0082725 | |||
| 2124 | Ga0373925_0191575 | |||
| 2125 | Ga0395899_0039928 | |||
| 2126 | Ga0395899_0209533 | |||
| 2127 | Ga0395900_0001643 | |||
| 2128 | Ga0395900_0005467 | |||
| 2129 | Ga0395900_0039238 | |||
| 2130 | Ga0395900_0078466 | |||
| 2131 | Ga0395900_0146606 | |||
| 2132 | Ga0395900_0236231 | |||
| 2133 | Ga0395900_0243407 | |||
| 2134 | Ga0395900_0263495 | |||
| 2135 | Ga0395900_0361778 | |||
| 2136 | Ga0395898_0013457 | |||
| 2137 | Ga0395898_0013908 | |||
| 2138 | Ga0395898_0039522 | |||
| 2139 | Ga0395898_0041036 | |||
| 2140 | Ga0395898_0064476 | |||
| 2141 | Ga0395898_0076771 | |||
| 2142 | Ga0395898_0310855 | |||
| 2143 | Ga0395898_0506189 | |||
| 2144 | Ga0395905_0003232 | |||
| 2145 | Ga0395905_0030084 | |||
| 2146 | Ga0395905_0041418 | |||
| 2147 | Ga0395905_0130549 | |||
| 2148 | Ga0395905_0367028 | |||
| 2149 | Ga0395905_0711909 | |||
| 2150 | Ga0395901_0003358 | |||
| 2151 | Ga0395901_0009655 | |||
| 2152 | Ga0395901_0010984 | |||
| 2153 | Ga0395901_0018859 | |||
| 2154 | Ga0395901_0020099 | |||
| 2155 | Ga0395901_0064283 | |||
| 2156 | Ga0395901_0082007 | |||
| 2157 | Ga0395901_0084454 | |||
| 2158 | Ga0395901_0178005 | |||
| 2159 | Ga0395901_0270350 | |||
| 2160 | Ga0395901_0293067 | |||
| 2161 | Ga0395901_0872780 | |||
| 2162 | Ga0395901_1011125 | |||
| 2163 | Ga0436365_0347461 | |||
| 2164 | Ga0436365_1709962 | |||
| 2165 | Ga0436363_0108127 | |||
| 2166 | Ga0436362_0004195 | |||
| 2167 | Ga0436362_0693060 | |||
| 2168 | Ga0439436_0033515 | |||
| 2169 | Ga0439439_0005760 | |||
| 2170 | Ga0439453_0007744 | |||
| 2171 | Ga0439461_0011302 | |||
| 2172 | Ga0439461_0011825 | |||
| 2173 | Ga0439466_0026205 | |||
| 2174 | Ga0451789_0814888 | |||
| 2175 | Ga0451802_0785545 | |||
| 2176 | Ga0451804_0467915 | |||
| 2177 | Ga0451839_0279640 | |||
| 2178 | Ga0451845_0652193 | |||
| 2179 | Ga0451849_0359582 | |||
| 2180 | Ga0451851_1288862 | |||
| 2181 | Ga0451853_0484657 | |||
| 2182 | Ga0439431_0012423 | |||
| 2183 | Ga0439433_0000829 | |||
| 2184 | Ga0439437_002296 | |||
| 2185 | Ga0439442_027457 | |||
| 2186 | Ga0439432_037000 | |||
| 2187 | Ga0439449_0004389 | |||
| 2188 | Ga0439449_0121727 | |||
| 2189 | Ga0439451_003997 | |||
| 2190 | Ga0439454_008517 | |||
| 2191 | Ga0439457_028472 | |||
| 2192 | Ga0439462_0003956 | |||
| 2193 | Ga0450920_001378 | |||
| 2194 | Ga0450920_005942 | |||
| 2195 | Ga0450920_021838 | |||
| 2196 | Ga0450895_004009 | |||
| 2197 | Ga0450906_003482 | |||
| 2198 | Ga0450907_011561 | |||
| 2199 | Ga0450907_017666 | |||
| 2200 | Ga0439446_0000082 | |||
| 2201 | Ga0439446_0001079 | |||
| 2202 | Ga0439435_0055827 | |||
| 2203 | Ga0439460_0042868 | |||
| 2204 | Ga0466969_0040665 | |||
| 2205 | Ga0466972_0078918 | |||
| 2206 | Ga0466965_0298431 | |||
| 2207 | Ga0466966_0030501 | |||
| 2208 | Ga0466966_0056180 | |||
| 2209 | Ga0466966_0071103 | |||
| 2210 | Ga0466966_0197436 | |||
| 2211 | Ga0466961_0003168 | |||
| 2212 | Ga0466961_0036972 | |||
| 2213 | Ga0466961_0093418 | |||
| 2214 | Ga0466963_0001137 | |||
| 2215 | Ga0466963_0001659 | |||
| 2216 | Ga0466963_0002621 | |||
| 2217 | Ga0466963_0018971 | |||
| 2218 | Ga0466963_0028319 | |||
| 2219 | Ga0466963_0037365 | |||
| 2220 | Ga0466963_0045465 | |||
| 2221 | Ga0466963_0630872 | |||
| 2222 | Ga0466964_0003114 | |||
| 2223 | Ga0466964_0008335 | |||
| 2224 | Ga0466964_0015865 | |||
| 2225 | Ga0466964_0043269 | |||
| 2226 | Ga0466964_0081548 | |||
| 2227 | Ga0466964_0092323 | |||
| 2228 | Ga0466964_0098955 | |||
| 2229 | Ga0466971_0000469 | |||
| 2230 | Ga0466971_0011900 | |||
| 2231 | Ga0466971_0040769 | |||
| 2232 | Ga0466968_0017299 | |||
| 2233 | Ga0466968_0044664 | |||
| 2234 | Ga0466968_0102435 | |||
| 2235 | Ga0466970_0008011 | |||
| 2236 | Ga0466970_0292598 | |||
| 2237 | Ga0466957_0004662 | |||
| 2238 | Ga0466957_0020684 | |||
| 2239 | Ga0466957_0597860 | |||
| 2240 | Ga0466960_0003090 | |||
| 2241 | Ga0466960_0040112 | |||
| 2242 | Ga0466959_0016687 | |||
| 2243 | Ga0466959_0021004 | |||
| 2244 | Ga0466959_0074413 | |||
| 2245 | Ga0466959_0082890 | |||
| 2246 | Ga0466959_0137323 | |||
| 2247 | Ga0466959_0345112 | |||
| 2248 | Ga0466958_0001601 | |||
| 2249 | Ga0466958_0020678 | |||
| 2250 | Ga0466958_0069479 | |||
| 2251 | Ga0466967_0006178 | |||
| 2252 | Ga0466967_0012646 | |||
| 2253 | Ga0466967_0014726 | |||
| 2254 | Ga0466967_0018416 | |||
| 2255 | Ga0466967_0019241 | |||
| 2256 | Ga0466967_0022820 | |||
| 2257 | Ga0466967_0029693 | |||
| 2258 | Ga0466967_0032572 | |||
| 2259 | Ga0466967_0040809 | |||
| 2260 | Ga0466967_0042790 | |||
| 2261 | Ga0466967_0042853 | |||
| 2262 | Ga0466967_0044056 | |||
| 2263 | Ga0466967_0047797 | |||
| 2264 | Ga0466967_0052120 | |||
| 2265 | Ga0466967_0064391 | |||
| 2266 | Ga0466967_0172629 | |||
| 2267 | Ga0466967_0222782 | |||
| 2268 | Ga0466967_0237212 | |||
| 2269 | Ga0466967_0310406 | |||
| 2270 | Ga0466967_0315663 | |||
| 2271 | Ga0466967_0335753 | |||
| 2272 | Ga0466967_0450899 | |||
| 2273 | Ga0466967_0896138 | |||
| 2274 | Ga0495592_0027463 | |||
| 2275 | Ga0495592_0056012 | |||
| 2276 | Ga0495592_0199531 | |||
| 2277 | Ga0495603_0000315 | |||
| 2278 | Ga0495629_0001172 | |||
| 2279 | Ga0495629_0072043 | |||
| 2280 | Ga0495629_0123992 | |||
| 2281 | Ga0495641_0001392 | |||
| 2282 | Ga0495641_0009942 | |||
| 2283 | Ga0495641_0020369 | |||
| 2284 | Ga0495641_0028381 | |||
| 2285 | Ga0495641_0039218 | |||
| 2286 | Ga0495641_0124567 | |||
| 2287 | Ga0495651_0119261 | |||
| 2288 | Ga0495653_0088926 | |||
| 2289 | Ga0495653_0089196 | |||
| 2290 | Ga0495653_0157782 | |||
| 2291 | Ga0495580_0077909 | |||
| 2292 | Ga0495580_0272061 | |||
| 2293 | Ga0495582_0004758 | |||
| 2294 | Ga0495582_0014796 | |||
| 2295 | Ga0495605_0117263 | |||
| 2296 | Ga0495639_0160703 | |||
| 2297 | Ga0495662_0002670 | |||
| 2298 | Ga0495662_0038842 | |||
| 2299 | Ga0495664_0196550 | |||
| 2300 | Ga0495664_0234035 | |||
| 2301 | Ga0495594_0008752 | |||
| 2302 | Ga0495596_0049541 | |||
| 2303 | Ga0495608_0003235 | |||
| 2304 | Ga0495608_0046549 | |||
| 2305 | Ga0495608_0125067 | |||
| 2306 | Ga0495618_0161813 | |||
| 2307 | Ga0495618_0419350 | |||
| 2308 | Ga0495620_0132920 | |||
| 2309 | Ga0495628_0014360 | |||
| 2310 | Ga0495628_0061184 | |||
| 2311 | Ga0495630_0010760 | |||
| 2312 | Ga0495630_0044810 | |||
| 2313 | Ga0495630_0062675 | |||
| 2314 | Ga0495630_0104481 | |||
| 2315 | Ga0495630_0158058 | |||
| 2316 | Ga0495630_0362948 | |||
| 2317 | Ga0495631_0123808 | |||
| 2318 | Ga0495666_0026315 | |||
| 2319 | Ga0495652_0031157 | |||
| 2320 | Ga0495652_0093133 | |||
| 2321 | Ga0495652_0133909 | |||
| 2322 | Ga0495652_0171428 | |||
| 2323 | Ga0495665_0000572 | |||
| 2324 | Ga0495640_0004895 | |||
| 2325 | Ga0495587_0034460 | |||
| 2326 | Ga0495587_0092126 | |||
| 2327 | Ga0495587_0136055 | |||
| 2328 | Ga0495587_0219547 | |||
| 2329 | Ga0495598_0164334 | |||
| 2330 | Ga0495645_0215829 | |||
| 2331 | Ga0495622_0027533 | |||
| 2332 | Ga0495667_0023106 | |||
| 2333 | Ga0495667_0057285 | |||
| 2334 | Ga0495667_0080279 | |||
| 2335 | Ga0495667_0162027 | |||
| 2336 | Ga0495656_0058447 | |||
| 2337 | Ga0495668_0285209 | |||
| 2338 | Ga0495634_0007352 | |||
| 2339 | Ga0495634_0120903 | |||
| 2340 | Ga0495635_0017186 | |||
| 2341 | Ga0495635_0086325 | |||
| 2342 | Ga0495657_0049866 | |||
| 2343 | Ga0495657_0094425 | |||
| 2344 | Ga0495657_0133657 | |||
| 2345 | Ga0495599_0065381 | |||
| 2346 | Ga0495599_0070330 | |||
| 2347 | Ga0495599_0129731 | |||
| 2348 | Ga0495599_0198107 | |||
| 2349 | Ga0495623_0075178 | |||
| 2350 | Ga0495623_0075328 | |||
| 2351 | Ga0495623_0130720 | |||
| 2352 | Ga0495623_0349677 | |||
| 2353 | Ga0495646_0073701 | |||
| 2354 | Ga0495658_0002818 | |||
| 2355 | Ga0495658_0004955 | |||
| 2356 | Ga0495658_0077825 | |||
| 2357 | Ga0495658_0233716 | |||
| 2358 | Ga0495658_0414159 | |||
| 2359 | Ga0495613_0002807 | |||
| 2360 | Ga0495613_0012232 | |||
| 2361 | Ga0495613_0122236 | |||
| 2362 | Ga0495613_0244944 | |||
| 2363 | Ga0495624_0003083 | |||
| 2364 | Ga0495624_0178912 | |||
| 2365 | Ga0495670_0294500 | |||
| 2366 | Ga0495600_0172365 | |||
| 2367 | Ga0495581_0001629 | |||
| 2368 | Ga0495581_0069125 | |||
| 2369 | Ga0495581_0202315 | |||
| 2370 | Ga0495604_0096905 | |||
| 2371 | Ga0495604_0188325 | |||
| 2372 | Ga0495674_0000604 | |||
| 2373 | Ga0495674_0014819 | |||
| 2374 | Ga0495674_0071641 | |||
| 2375 | Ga0495674_0099515 | |||
| 2376 | Ga0495674_0128421 | |||
| 2377 | Ga0495674_0193304 | |||
| 2378 | Ga0495676_0005988 | |||
| 2379 | Ga0495676_0033632 | |||
| 2380 | Ga0495676_0140388 | |||
| 2381 | Ga0495676_0465998 | |||
| 2382 | Ga0495680_0001294 | |||
| 2383 | Ga0495680_0045915 | |||
| 2384 | Ga0495680_0092680 | |||
| 2385 | Ga0495675_0053040 | |||
| 2386 | Ga0495675_0236048 | |||
| 2387 | Ga0495677_0171790 | |||
| 2388 | Ga0495684_0003459 | |||
| 2389 | Ga0495684_0005729 | |||
| 2390 | Ga0495684_0014928 | |||
| 2391 | Ga0495684_0113633 | |||
| 2392 | Ga0495602_0089556 | |||
| 2393 | Ga0495602_0093372 | |||
| 2394 | Ga0495602_0237503 | |||
| 2395 | Ga0495602_0272659 | |||
| 2396 | Ga0495614_0053543 | |||
| 2397 | Ga0496100_0006166 | |||
| 2398 | Ga0496100_0045937 | |||
| 2399 | Ga0496100_0161348 | |||
| 2400 | Ga0496100_0251467 | |||
| 2401 | Ga0496100_0272999 | |||
| 2402 | Ga0496100_0343499 | |||
| 2403 | Ga0496101_0001648 | |||
| 2404 | Ga0496101_0002848 | |||
| 2405 | Ga0496101_0009732 | |||
| 2406 | Ga0496101_0013967 | |||
| 2407 | Ga0496101_0060791 | |||
| 2408 | Ga0496101_0081773 | |||
| 2409 | Ga0496101_0201592 | |||
| 2410 | Ga0496102_0013692 | |||
| 2411 | Ga0496102_0074671 | |||
| 2412 | Ga0496102_0145755 | |||
| 2413 | Ga0496102_0209630 | |||
| 2414 | Ga0496102_0396914 | |||
| 2415 | Ga0496103_0003789 | |||
| 2416 | Ga0496103_0015518 | |||
| 2417 | Ga0496103_0057042 | |||
| 2418 | Ga0496103_0149993 | |||
| 2419 | Ga0496104_0000188 | |||
| 2420 | Ga0496104_0003035 | |||
| 2421 | Ga0496104_0005264 | |||
| 2422 | Ga0496104_0014260 | |||
| 2423 | Ga0496104_0018343 | |||
| 2424 | Ga0496104_0071653 | |||
| 2425 | Ga0496104_0084751 | |||
| 2426 | Ga0496104_0106996 | |||
| 2427 | Ga0496104_0142746 | |||
| 2428 | Ga0496104_0459205 | |||
| 2429 | Ga0496105_0000413 | |||
| 2430 | Ga0496105_0005539 | |||
| 2431 | Ga0496105_0020137 | |||
| 2432 | Ga0496105_0029849 | |||
| 2433 | Ga0496105_0042692 | |||
| 2434 | Ga0496105_0055302 | |||
| 2435 | Ga0496105_0065099 | |||
| 2436 | Ga0496105_0081376 | |||
| 2437 | Ga0496105_0365581 | |||
| 2438 | Ga0496105_0423328 | |||
| 2439 | Ga0496105_0477182 | |||
| 2440 | Ga0496106_0000380 | |||
| 2441 | Ga0496106_0020230 | |||
| 2442 | Ga0496106_0109377 | |||
| 2443 | Ga0496106_0113327 | |||
| 2444 | Ga0496106_0173779 | |||
| 2445 | Ga0496106_0206411 | |||
| 2446 | Ga0496106_0356618 | |||
| 2447 | Ga0496106_0801938 | |||
| 2448 | Ga0496107_0002348 | |||
| 2449 | Ga0496107_0018083 | |||
| 2450 | Ga0496107_0023614 | |||
| 2451 | Ga0496107_0034518 | |||
| 2452 | Ga0496107_0058994 | |||
| 2453 | Ga0496107_0061268 | |||
| 2454 | Ga0496107_0328701 | |||
| 2455 | Ga0496107_0543176 | |||
| 2456 | Ga0496108_0002556 | |||
| 2457 | Ga0496108_0003631 | |||
| 2458 | Ga0496108_0009595 | |||
| 2459 | Ga0496108_0014113 | |||
| 2460 | Ga0496108_0014117 | |||
| 2461 | Ga0496108_0042016 | |||
| 2462 | Ga0496108_0121679 | |||
| 2463 | Ga0496108_0235031 | |||
| 2464 | Ga0496108_0407882 | |||
| 2465 | Ga0496108_0844752 | |||
| 2466 | Ga0496109_0001947 | |||
| 2467 | Ga0496109_0002346 | |||
| 2468 | Ga0496109_0020416 | |||
| 2469 | Ga0496109_0024899 | |||
| 2470 | Ga0496109_0029868 | |||
| 2471 | Ga0496109_0059690 | |||
| 2472 | Ga0496109_0148976 | |||
| 2473 | Ga0496109_0359621 | |||
| 2474 | Ga0496109_0443251 | |||
| 2475 | Ga0496109_0533740 | |||
| 2476 | Ga0496109_0645325 | |||
| 2477 | Ga0496110_0005633 | |||
| 2478 | Ga0496110_0011527 | |||
| 2479 | Ga0496110_0011939 | |||
| 2480 | Ga0496110_0038121 | |||
| 2481 | Ga0496110_0041928 | |||
| 2482 | Ga0496110_0090392 | |||
| 2483 | Ga0496110_0102504 | |||
| 2484 | Ga0496110_0115522 | |||
| 2485 | Ga0496110_0120683 | |||
| 2486 | Ga0496110_0283619 | |||
| 2487 | Ga0496110_0352549 | |||
| 2488 | Ga0496110_0752129 | |||
| 2489 | Ga0496111_0000288 | |||
| 2490 | Ga0496111_0001194 | |||
| 2491 | Ga0496111_0003824 | |||
| 2492 | Ga0496111_0035054 | |||
| 2493 | Ga0496111_0059001 | |||
| 2494 | Ga0496111_0182958 | |||
| 2495 | Ga0496112_0000307 | |||
| 2496 | Ga0496112_0002174 | |||
| 2497 | Ga0496112_0014425 | |||
| 2498 | Ga0496112_0133008 | |||
| 2499 | Ga0496112_0147006 | |||
| 2500 | Ga0496112_0171753 | |||
| 2501 | Ga0496112_0180594 | |||
| 2502 | Ga0496112_0355812 | |||
| 2503 | Ga0496112_0589703 | |||
| 2504 | Ga0496113_0000192 | |||
| 2505 | Ga0496113_0026625 | |||
| 2506 | Ga0496113_0028359 | |||
| 2507 | Ga0496113_0540332 | |||
| 2508 | Ga0496114_0001026 | |||
| 2509 | Ga0496114_0003757 | |||
| 2510 | Ga0496114_0004276 | |||
| 2511 | Ga0496114_0008425 | |||
| 2512 | Ga0496114_0013129 | |||
| 2513 | Ga0496114_0194178 | |||
| 2514 | Ga0496114_0211269 | |||
| 2515 | Ga0496114_0389575 | |||
| 2516 | Ga0496114_0400800 | |||
| 2517 | Ga0496114_0907380 | |||
| 2518 | Ga0496115_0000307 | |||
| 2519 | Ga0496115_0002915 | |||
| 2520 | Ga0496115_0037455 | |||
| 2521 | Ga0496115_0079838 | |||
| 2522 | Ga0496115_0082496 | |||
| 2523 | Ga0496115_0398865 | |||
| 2524 | Ga0496115_0402829 | |||
| 2525 | Ga0501031_0004061 | |||
| 2526 | Ga0501031_0007219 | |||
| 2527 | Ga0501031_0023359 | |||
| 2528 | Ga0501031_0089642 | |||
| 2529 | Ga0501031_0094238 | |||
| 2530 | Ga0501031_0131442 | |||
| 2531 | Ga0501031_0252695 | |||
| 2532 | Ga0501032_0001182 | |||
| 2533 | Ga0501032_0006448 | |||
| 2534 | Ga0501032_0032342 | |||
| 2535 | Ga0501032_0110688 | |||
| 2536 | Ga0501033_0001160 | |||
| 2537 | Ga0501033_0013301 | |||
| 2538 | Ga0501033_0130903 | |||
| 2539 | Ga0501034_0028186 | |||
| 2540 | Ga0501034_0032710 | |||
| 2541 | Ga0501034_0109772 | |||
| 2542 | Ga0501034_0257213 | |||
| 2543 | Ga0501034_0471040 | |||
| 2544 | Ga0501034_0714841 | |||
| 2545 | Ga0501034_0728698 | |||
| 2546 | Ga0501036_0000750 | |||
| 2547 | Ga0501036_0000982 | |||
| 2548 | Ga0501036_0004190 | |||
| 2549 | Ga0501036_0004891 | |||
| 2550 | Ga0501036_0006322 | |||
| 2551 | Ga0501036_0022582 | |||
| 2552 | Ga0501036_0023919 | |||
| 2553 | Ga0501036_0036586 | |||
| 2554 | Ga0501036_0041161 | |||
| 2555 | Ga0501036_0044479 | |||
| 2556 | Ga0501036_0106066 | |||
| 2557 | Ga0501036_0106315 | |||
| 2558 | Ga0501036_0133474 | |||
| 2559 | Ga0501037_0009265 | |||
| 2560 | Ga0501037_0019670 | |||
| 2561 | Ga0501037_0022874 | |||
| 2562 | Ga0501037_0026977 | |||
| 2563 | Ga0501037_0065311 | |||
| 2564 | Ga0501037_0224500 | |||
| 2565 | Ga0501037_0547932 | |||
| 2566 | Ga0501038_0000446 | |||
| 2567 | Ga0501038_0001935 | |||
| 2568 | Ga0501038_0002315 | |||
| 2569 | Ga0501038_0007078 | |||
| 2570 | Ga0501038_0033734 | |||
| 2571 | Ga0501038_0051573 | |||
| 2572 | Ga0501038_0063560 | |||
| 2573 | Ga0501038_0076331 | |||
| 2574 | Ga0501038_0081299 | |||
| 2575 | Ga0501038_0123872 | |||
| 2576 | Ga0501038_0216183 | |||
| 2577 | Ga0501039_0000317 | |||
| 2578 | Ga0501039_0000364 | |||
| 2579 | Ga0501039_0006406 | |||
| 2580 | Ga0501039_0007361 | |||
| 2581 | Ga0501039_0008152 | |||
| 2582 | Ga0501039_0013728 | |||
| 2583 | Ga0501039_0023521 | |||
| 2584 | Ga0501039_0048603 | |||
| 2585 | Ga0501039_0049631 | |||
| 2586 | Ga0501039_0071027 | |||
| 2587 | Ga0501039_0168599 | |||
| 2588 | Ga0501039_0255567 | |||
| 2589 | Ga0501039_0426672 | |||
| 2590 | Ga0501040_0000039 | |||
| 2591 | Ga0501040_0000524 | |||
| 2592 | Ga0501040_0001948 | |||
| 2593 | Ga0501040_0004381 | |||
| 2594 | Ga0501040_0005940 | |||
| 2595 | Ga0501040_0007266 | |||
| 2596 | Ga0501040_0008593 | |||
| 2597 | Ga0501040_0010689 | |||
| 2598 | Ga0501040_0010719 | |||
| 2599 | Ga0501040_0019296 | |||
| 2600 | Ga0501040_0024024 | |||
| 2601 | Ga0501040_0028099 | |||
| 2602 | Ga0501040_0042231 | |||
| 2603 | Ga0501040_0054781 | |||
| 2604 | Ga0501040_0063978 | |||
| 2605 | Ga0501040_0123217 | |||
| 2606 | Ga0501040_0225990 | |||
| 2607 | Ga0501040_0287193 | |||
| 2608 | Ga0501041_0000291 | |||
| 2609 | Ga0501041_0001974 | |||
| 2610 | Ga0501041_0002802 | |||
| 2611 | Ga0501041_0003315 | |||
| 2612 | Ga0501041_0007727 | |||
| 2613 | Ga0501041_0009316 | |||
| 2614 | Ga0501041_0017134 | |||
| 2615 | Ga0501041_0026890 | |||
| 2616 | Ga0501041_0030942 | |||
| 2617 | Ga0501041_0091007 | |||
| 2618 | Ga0501041_0165773 | |||
| 2619 | Ga0501041_0245350 | |||
| 2620 | Ga0501042_0000258 | |||
| 2621 | Ga0501042_0000894 | |||
| 2622 | Ga0501042_0002492 | |||
| 2623 | Ga0501042_0005192 | |||
| 2624 | Ga0501042_0011682 | |||
| 2625 | Ga0501042_0014135 | |||
| 2626 | Ga0501042_0020651 | |||
| 2627 | Ga0501042_0045673 | |||
| 2628 | Ga0501042_0060267 | |||
| 2629 | Ga0501042_0110691 | |||
| 2630 | Ga0501042_0115515 | |||
| 2631 | Ga0501042_0124007 | |||
| 2632 | Ga0501042_0124081 | |||
| 2633 | Ga0501042_0174112 | |||
| 2634 | Ga0501042_0178963 | |||
| 2635 | Ga0501042_0222692 | |||
| 2636 | Ga0501042_0285936 | |||
| 2637 | Ga0501042_0295804 | |||
| 2638 | Ga0501042_0382013 | |||
| 2639 | Ga0501043_0003344 | |||
| 2640 | Ga0501043_0006109 | |||
| 2641 | Ga0501043_0021905 | |||
| 2642 | Ga0501043_0028534 | |||
| 2643 | Ga0501043_0100014 | |||
| 2644 | Ga0501043_0103426 | |||
| 2645 | Ga0501043_0152466 | |||
| 2646 | Ga0501043_0239699 | |||
| 2647 | Ga0501043_0390522 | |||
| 2648 | Ga0501046_0004525 | |||
| 2649 | Ga0501046_0006475 | |||
| 2650 | Ga0501046_0007866 | |||
| 2651 | Ga0501046_0008764 | |||
| 2652 | Ga0501046_0012843 | |||
| 2653 | Ga0501046_0013629 | |||
| 2654 | Ga0501046_0038072 | |||
| 2655 | Ga0501046_0049648 | |||
| 2656 | Ga0501046_0053855 | |||
| 2657 | Ga0501046_0150718 | |||
| 2658 | Ga0501046_0167311 | |||
| 2659 | Ga0501046_0252201 | |||
| 2660 | Ga0501047_0025018 | |||
| 2661 | Ga0501047_0046030 | |||
| 2662 | Ga0501047_0106833 | |||
| 2663 | Ga0501047_0117116 | |||
| 2664 | Ga0501048_0001067 | |||
| 2665 | Ga0501048_0002786 | |||
| 2666 | Ga0501048_0004532 | |||
| 2667 | Ga0501048_0005882 | |||
| 2668 | Ga0501048_0011653 | |||
| 2669 | Ga0501048_0012860 | |||
| 2670 | Ga0501048_0018685 | |||
| 2671 | Ga0501048_0023252 | |||
| 2672 | Ga0501048_0040337 | |||
| 2673 | Ga0501048_0054022 | |||
| 2674 | Ga0501048_0107743 | |||
| 2675 | Ga0501048_0135138 | |||
| 2676 | Ga0501048_0435783 | |||
| 2677 | Ga0501067_0001127 | |||
| 2678 | Ga0501067_0015833 | |||
| 2679 | Ga0501067_0031503 | |||
| 2680 | Ga0501067_0075356 | |||
| 2681 | Ga0501067_0104658 | |||
| 2682 | Ga0501067_0178915 | |||
| 2683 | Ga0501068_0001596 | |||
| 2684 | Ga0501068_0002939 | |||
| 2685 | Ga0501068_0005404 | |||
| 2686 | Ga0501068_0011225 | |||
| 2687 | Ga0501068_0011823 | |||
| 2688 | Ga0501068_0033330 | |||
| 2689 | Ga0501068_0038221 | |||
| 2690 | Ga0501068_0039534 | |||
| 2691 | Ga0501068_0049046 | |||
| 2692 | Ga0501068_0049209 | |||
| 2693 | Ga0501068_0224488 | |||
| 2694 | Ga0501068_0416139 | |||
| 2695 | Ga0501069_0001903 | |||
| 2696 | Ga0501069_0003627 | |||
| 2697 | Ga0501069_0013701 | |||
| 2698 | Ga0501069_0016558 | |||
| 2699 | Ga0501069_0020235 | |||
| 2700 | Ga0501069_0022274 | |||
| 2701 | Ga0501069_0031400 | |||
| 2702 | Ga0501069_0081977 | |||
| 2703 | Ga0501069_0123768 | |||
| 2704 | Ga0501069_0143064 | |||
| 2705 | Ga0501069_0174459 | |||
| 2706 | Ga0501070_0036445 | |||
| 2707 | Ga0501070_0038771 | |||
| 2708 | Ga0501070_0044821 | |||
| 2709 | Ga0501070_0086461 | |||
| 2710 | Ga0501070_0124503 | |||
| 2711 | Ga0501070_0269133 | |||
| 2712 | Ga0501070_0613952 | |||
| 2713 | Ga0501070_0668289 | |||
| 2714 | Ga0501071_0000033 | |||
| 2715 | Ga0501071_0002214 | |||
| 2716 | Ga0501071_0002277 | |||
| 2717 | Ga0501071_0003153 | |||
| 2718 | Ga0501071_0005857 | |||
| 2719 | Ga0501071_0026212 | |||
| 2720 | Ga0501071_0028624 | |||
| 2721 | Ga0501071_0035549 | |||
| 2722 | Ga0501071_0050230 | |||
| 2723 | Ga0501071_0058780 | |||
| 2724 | Ga0501071_0072992 | |||
| 2725 | Ga0501071_0130074 | |||
| 2726 | Ga0501071_0148176 | |||
| 2727 | Ga0501071_0182424 | |||
| 2728 | Ga0501072_0000837 | |||
| 2729 | Ga0501072_0001260 | |||
| 2730 | Ga0501072_0001414 | |||
| 2731 | Ga0501072_0001579 | |||
| 2732 | Ga0501072_0003808 | |||
| 2733 | Ga0501072_0005441 | |||
| 2734 | Ga0501072_0007502 | |||
| 2735 | Ga0501072_0035670 | |||
| 2736 | Ga0501072_0045353 | |||
| 2737 | Ga0501072_0051258 | |||
| 2738 | Ga0501072_0078873 | |||
| 2739 | Ga0501072_0081590 | |||
| 2740 | Ga0501072_0085185 | |||
| 2741 | Ga0501072_0093659 | |||
| 2742 | Ga0501072_0128313 | |||
| 2743 | Ga0501072_0232257 | |||
| 2744 | Ga0501072_0269483 | |||
| 2745 | Ga0501072_0337423 | |||
| 2746 | Ga0501072_0339803 | |||
| 2747 | Ga0501072_0560674 | |||
| 2748 | Ga0501073_0009166 | |||
| 2749 | Ga0501073_0011499 | |||
| 2750 | Ga0501073_0022682 | |||
| 2751 | Ga0501073_0073553 | |||
| 2752 | Ga0501073_0222779 | |||
| 2753 | Ga0501073_0267647 | |||
| 2754 | Ga0501073_0308242 | |||
| 2755 | Ga0501073_0444456 | |||
| 2756 | Ga0501074_0000235 | |||
| 2757 | Ga0501074_0001738 | |||
| 2758 | Ga0501074_0012633 | |||
| 2759 | Ga0501074_0013730 | |||
| 2760 | Ga0501074_0016469 | |||
| 2761 | Ga0501074_0016954 | |||
| 2762 | Ga0501074_0018260 | |||
| 2763 | Ga0501074_0029829 | |||
| 2764 | Ga0501074_0098357 | |||
| 2765 | Ga0501074_0117793 | |||
| 2766 | Ga0501074_0121577 | |||
| 2767 | Ga0501074_0134276 | |||
| 2768 | Ga0501074_0149905 | |||
| 2769 | Ga0501074_0284672 | |||
| 2770 | Ga0501074_0456125 | |||
| 2771 | Ga0501075_0000893 | |||
| 2772 | Ga0501075_0006562 | |||
| 2773 | Ga0501075_0012322 | |||
| 2774 | Ga0501075_0015474 | |||
| 2775 | Ga0501075_0017158 | |||
| 2776 | Ga0501075_0018610 | |||
| 2777 | Ga0501075_0024351 | |||
| 2778 | Ga0501075_0038508 | |||
| 2779 | Ga0501075_0044871 | |||
| 2780 | Ga0501075_0061712 | |||
| 2781 | Ga0501075_0073283 | |||
| 2782 | Ga0501075_0089938 | |||
| 2783 | Ga0501075_0256608 | |||
| 2784 | Ga0501075_0258299 | |||
| 2785 | Ga0501075_0292716 | |||
| 2786 | Ga0501075_0565501 | |||
| 2787 | Ga0501076_0001738 | |||
| 2788 | Ga0501076_0002834 | |||
| 2789 | Ga0501076_0004808 | |||
| 2790 | Ga0501076_0010423 | |||
| 2791 | Ga0501076_0016033 | |||
| 2792 | Ga0501076_0045490 | |||
| 2793 | Ga0501076_0049222 | |||
| 2794 | Ga0501076_0056608 | |||
| 2795 | Ga0501076_0058149 | |||
| 2796 | Ga0501076_0071667 | |||
| 2797 | Ga0501076_0100404 | |||
| 2798 | Ga0501076_0117512 | |||
| 2799 | Ga0501076_0132895 | |||
| 2800 | Ga0501076_0171173 | |||
| 2801 | Ga0501076_0184625 | |||
| 2802 | Ga0501076_0207385 | |||
| 2803 | Ga0501076_0311650 | |||
| 2804 | Ga0501076_0493106 | |||
| 2805 | Ga0501076_0577694 | |||
| 2806 | Ga0501077_0003176 | |||
| 2807 | Ga0501077_0003831 | |||
| 2808 | Ga0501077_0006263 | |||
| 2809 | Ga0501077_0006855 | |||
| 2810 | Ga0501077_0007221 | |||
| 2811 | Ga0501077_0013641 | |||
| 2812 | Ga0501077_0014691 | |||
| 2813 | Ga0501077_0018134 | |||
| 2814 | Ga0501077_0022735 | |||
| 2815 | Ga0501077_0023533 | |||
| 2816 | Ga0501077_0024871 | |||
| 2817 | Ga0501077_0029189 | |||
| 2818 | Ga0501077_0047200 | |||
| 2819 | Ga0501077_0066364 | |||
| 2820 | Ga0501077_0071464 | |||
| 2821 | Ga0501077_0113433 | |||
| 2822 | Ga0501077_0163919 | |||
| 2823 | Ga0501077_0186567 | |||
| 2824 | Ga0501077_0253531 | |||
| 2825 | Ga0501077_0422966 | |||
| 2826 | Ga0501079_0000130 | |||
| 2827 | Ga0501079_0001508 | |||
| 2828 | Ga0501079_0003750 | |||
| 2829 | Ga0501079_0004138 | |||
| 2830 | Ga0501079_0005359 | |||
| 2831 | Ga0501079_0005449 | |||
| 2832 | Ga0501079_0008306 | |||
| 2833 | Ga0501079_0036298 | |||
| 2834 | Ga0501079_0041273 | |||
| 2835 | Ga0501079_0043045 | |||
| 2836 | Ga0501079_0049423 | |||
| 2837 | Ga0501079_0057012 | |||
| 2838 | Ga0501079_0073837 | |||
| 2839 | Ga0501079_0078772 | |||
| 2840 | Ga0501079_0160792 | |||
| 2841 | Ga0501079_0551389 | |||
| 2842 | Ga0501080_0005311 | |||
| 2843 | Ga0501080_0006151 | |||
| 2844 | Ga0501080_0027447 | |||
| 2845 | Ga0501080_0034997 | |||
| 2846 | Ga0501080_0044862 | |||
| 2847 | Ga0501080_0097169 | |||
| 2848 | Ga0501080_0254688 | |||
| 2849 | Ga0501080_0435148 | |||
| 2850 | Ga0501080_0640491 | |||
| 2851 | Ga0501081_0000313 | |||
| 2852 | Ga0501081_0019483 | |||
| 2853 | Ga0501081_0026522 | |||
| 2854 | Ga0501081_0028312 | |||
| 2855 | Ga0501081_0031393 | |||
| 2856 | Ga0501081_0049954 | |||
| 2857 | Ga0501081_0051817 | |||
| 2858 | Ga0501081_0052240 | |||
| 2859 | Ga0501081_0054448 | |||
| 2860 | Ga0501081_0069304 | |||
| 2861 | Ga0501081_0114333 | |||
| 2862 | Ga0501081_0285355 | |||
| 2863 | Ga0501081_0378957 | |||
| 2864 | Ga0501081_0493967 | |||
| 2865 | Ga0501083_0000058 | |||
| 2866 | Ga0501083_0007751 | |||
| 2867 | Ga0501083_0011370 | |||
| 2868 | Ga0501083_0031791 | |||
| 2869 | Ga0501083_0036231 | |||
| 2870 | Ga0501083_0133777 | |||
| 2871 | Ga0501083_0187185 | |||
| 2872 | Ga0501083_0281683 | |||
| 2873 | Ga0501035_0002449 | |||
| 2874 | Ga0501035_0005704 | |||
| 2875 | Ga0501035_0007774 | |||
| 2876 | Ga0501035_0014714 | |||
| 2877 | Ga0501035_0016047 | |||
| 2878 | Ga0501035_0048080 | |||
| 2879 | Ga0501035_0057549 | |||
| 2880 | Ga0501035_0108471 | |||
| 2881 | Ga0501035_0118208 | |||
| 2882 | Ga0501035_0158037 | |||
| 2883 | Ga0501035_0160066 | |||
| 2884 | Ga0501044_0017898 | |||
| 2885 | Ga0501044_0021418 | |||
| 2886 | Ga0501044_0034640 | |||
| 2887 | Ga0501044_0040304 | |||
| 2888 | Ga0501044_0372247 | |||
| 2889 | Ga0501045_0000191 | |||
| 2890 | Ga0501045_0000429 | |||
| 2891 | Ga0501045_0005703 | |||
| 2892 | Ga0501045_0007997 | |||
| 2893 | Ga0501045_0008558 | |||
| 2894 | Ga0501045_0018931 | |||
| 2895 | Ga0501045_0024331 | |||
| 2896 | Ga0501045_0026426 | |||
| 2897 | Ga0501045_0030872 | |||
| 2898 | Ga0501045_0040167 | |||
| 2899 | Ga0501045_0044419 | |||
| 2900 | Ga0501045_0047217 | |||
| 2901 | Ga0501045_0049686 | |||
| 2902 | Ga0501045_0072788 | |||
| 2903 | Ga0501045_0217930 | |||
| 2904 | nmdc:mga0yw44_353131_c1 | |||
| 2905 | nmdc:mga0yw44_82810_c1 | |||
| 2906 | nmdc:mga05p37_105727_c1 | |||
| 2907 | nmdc:mga05p37_240730_c1 | |||
| 2908 | nmdc:mga05p37_2477_c1 | |||
| 2909 | nmdc:mga05p37_26964_c1 | |||
| 2910 | nmdc:mga05p37_436500_c1 | |||
| 2911 | nmdc:mga05p37_57579_c1 | |||
| 2912 | nmdc:mga05p37_589693_c1 | |||
| 2913 | nmdc:mga05p37_830768_c1 | |||
| 2914 | nmdc:mga09592_27201_c1 | |||
| 2915 | nmdc:mga09592_519923_c1 | |||
| 2916 | nmdc:mga0qj67_100111_c1 | |||
| 2917 | nmdc:mga0qj67_151928_c1 | |||
| 2918 | nmdc:mga0qj67_8087_c1 | |||
| 2919 | nmdc:mga06r32_10854_c1 | |||
| 2920 | nmdc:mga08y16_118864_c1 | |||
| 2921 | nmdc:mga08y16_171617_c1 | |||
| 2922 | nmdc:mga08y16_17740_c1 | |||
| 2923 | nmdc:mga08y16_218367_c1 | |||
| 2924 | nmdc:mga08y16_251706_c1 | |||
| 2925 | nmdc:mga08y16_56389_c1 | |||
| 2926 | nmdc:mga08y16_7118_c1 | |||
| 2927 | nmdc:mga08y16_79430_c1 | |||
| 2928 | nmdc:mga0n895_116841_c1 | |||
| 2929 | nmdc:mga0n895_464058_c1 | |||
| 2930 | nmdc:mga0rr50_40874_c1 | |||
| 2931 | nmdc:mga0rr50_56179_c1 | |||
| 2932 | nmdc:mga0a205_27721_c1 | |||
| 2933 | nmdc:mga0a205_28420_c1 | |||
| 2934 | nmdc:mga0a205_672020_c1 | |||
| 2935 | Ga0495601_0024608 | |||
| 2936 | Ga0495601_0144163 | |||
| 2937 | Ga0495612_0065026 | |||
| 2938 | Ga0495655_0000926 | |||
| 2939 | Ga0495655_0001216 | |||
| 2940 | Ga0495595_0005011 | |||
| 2941 | Ga0495595_0040034 | |||
| 2942 | Ga0495595_0122088 | |||
| 2943 | Ga0495619_0003130 | |||
| 2944 | Ga0495619_0230677 | |||
| 2945 | Ga0501084_0000824 | |||
| 2946 | Ga0501084_0000882 | |||
| 2947 | Ga0501084_0002015 | |||
| 2948 | Ga0501084_0003386 | |||
| 2949 | Ga0501084_0011466 | |||
| 2950 | Ga0501084_0014312 | |||
| 2951 | Ga0501084_0017115 | |||
| 2952 | Ga0501084_0027966 | |||
| 2953 | Ga0501084_0033649 | |||
| 2954 | Ga0501084_0041808 | |||
| 2955 | Ga0501084_0044543 | |||
| 2956 | Ga0501084_0052643 | |||
| 2957 | Ga0501084_0065561 | |||
| 2958 | Ga0501084_0079544 | |||
| 2959 | Ga0501084_0103261 | |||
| 2960 | Ga0501084_0107193 | |||
| 2961 | Ga0501084_0145219 | |||
| 2962 | Ga0501084_0290502 | |||
| 2963 | Ga0501084_0349834 | |||
| 2964 | Ga0501084_0469525 | |||
| 2965 | Ga0590071_008552 | |||
| 2966 | Ga0590075_013707 | |||
| 2967 | Ga0501082_0001300 | |||
| 2968 | Ga0501082_0008205 | |||
| 2969 | Ga0501082_0015071 | |||
| 2970 | Ga0501082_0016418 | |||
| 2971 | Ga0501082_0025059 | |||
| 2972 | Ga0501082_0026383 | |||
| 2973 | Ga0501082_0027469 | |||
| 2974 | Ga0501082_0031802 | |||
| 2975 | Ga0501082_0038077 | |||
| 2976 | Ga0501082_0052677 | |||
| 2977 | Ga0501082_0067700 | |||
| 2978 | Ga0501082_0086816 | |||
| 2979 | Ga0501082_0141421 | |||
| 2980 | Ga0501082_0152317 | |||
| 2981 | Ga0501082_0191475 | |||
| 2982 | Ga0501082_0306002 | |||
| 2983 | Ga0501082_0449647 | |||
| 2984 | Ga0501082_0501195 | |||
| 2985 | Ga0501082_0538202 | |||
| 2986 | Ga0501082_0776418 | |||
| 2987 | Ga0466962_0004873 | |||
| 2988 | Ga0466962_0012256 | |||
| 2989 | Ga0466962_0182991 | |||
| 2990 | Ga0530510_0000865 | |||
| 2991 | Ga0530510_0001330 | |||
| 2992 | Ga0530510_0004226 | |||
| 2993 | Ga0530510_0005976 | |||
| 2994 | Ga0530510_0013738 | |||
| 2995 | Ga0530510_0016178 | |||
| 2996 | Ga0530510_0027309 | |||
| 2997 | Ga0530510_0042956 | |||
| 2998 | Ga0530510_0045203 | |||
| 2999 | Ga0530510_0071984 | |||
| 3000 | Ga0530510_0075426 | |||
| 3001 | Ga0530510_0080206 | |||
| 3002 | Ga0530510_0131194 | |||
| 3003 | Ga0530510_0201021 | |||
| 3004 | Ga0530510_0614790 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hl3-assembly1.cif.gz_A | 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. | 0.9304 | 1 | 253 |
| 3pkq-assembly2.cif.gz_A | q83d variant of s. enterica rmla with dgtp | 0.9252 | 2 | 253 |
| 6b5k-assembly1.cif.gz_A-2 | mycobacterium tuberculosis rmla in complex with mg/dttp | 0.9244 | 1 | 252 |
| 1mp3-assembly1.cif.gz_A | l89t variant of s. enterica rmla | 0.9226 | 2 | 253 |
| 1iim-assembly1.cif.gz_A | thymidylyltransferase complexed with ttp | 0.9225 | 2 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9504 | 1 | 253 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9309 | 1 | 237 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9224 | 1 | 237 | 3.90.550.10 |
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9194 | 2 | 253 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.909 | 1 | 253 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9EG16-F1-model_v4 | Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) | 0.9848 | 137 | 258 |
GO:0008879
GO:0045226 |
| AF-A0A7V9DIT3-F1-model_v4 | Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) | 0.9749 | 2 | 184 |
GO:0008879
GO:0045226 |
| AF-A0A1Q7UBP0-F1-model_v4 | Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) | 0.9577 | 1 | 251 |
GO:0008830
GO:0008879 GO:0045226 |
| AF-A0A3N5UV34-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.957 | 1 | 237 |
GO:0008879
GO:0045226 |
| AF-A0A6L3A6Q4-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9569 | 1 | 258 |
GO:0008879
GO:0045226 |