metagRoot

F494405

General Info

Members	Datasets	Scaffolds	Average Seq Length
1500	499	1243	309

Family's Representative Sequence

Representative Sequence	3300046507\|Ga0495606_0001996\|Ga0495606_0001996_11305_12264
Length	319
Sequence	MAKLMDTLIPDTTVLVTGGAGFIGSHLTDALLANGYSVRVLDDLSTGKRHNLPMDNPRIEFIEGDVADAALVARAAKGCQAVVHLAAVASVQASVDDPVRTHQSNFIGTLNVCEAMRLAGIKRVVFASSAAIYGNNGEGEGEAIGEDTPKAPLTPYASDKLASEFYLDFYRRQHGLEPVIFRFFNIFGPRQDPSSPYSGVISIFSERAQKGLPISVFGDGEQTRDFFFVSDLVKLLMQGLEFPTVKGGAFNVGLNKATSLNQILATLSEVLGGLPEVTYQPARSGDIRHSRANNTRLLGSFKMSEPTPLDVGLARLLER

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
4	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
5	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
6	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
7	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
8	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
9	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
10	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
11	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
12	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
13	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
14	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
15	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
16	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
17	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
18	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
19	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
20	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
21	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
22	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
23	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
24	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
25	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
26	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
27	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
28	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
29	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
30	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
31	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
32	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
33	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
34	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
35	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
36	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
37	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
38	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
39	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
40	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
41	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
42	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
43	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
44	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
45	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
46	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
47	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
48	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
49	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
50	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
51	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
52	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
53	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
54	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
55	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
56	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
57	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
58	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
59	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
60	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
61	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
62	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
63	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
64	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
65	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
66	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
67	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
68	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
69	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
70	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
71	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
72	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
73	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
74	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
75	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
76	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
77	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
78	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
79	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
80	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
81	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
82	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
83	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
84	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
85	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
86	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
87	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
88	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
89	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
90	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
91	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
92	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
93	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
94	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
95	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
96	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
97	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
98	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
99	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
100	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
101	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
102	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
103	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
104	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
105	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
106	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
107	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
108	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
109	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
110	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
111	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
112	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
113	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
114	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
115	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
116	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
117	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
118	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
119	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
120	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
121	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
122	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
123	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
124	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
125	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
126	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
127	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
128	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
129	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
130	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
131	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
132	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
133	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
134	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
135	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
136	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
137	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
138	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
139	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
140	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
141	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
142	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
143	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
144	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
145	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
146	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
147	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
148	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
149	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
150	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
151	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
152	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
153	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
154	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
155	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
156	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
157	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
158	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
159	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
160	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
161	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
162	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
163	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
164	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
165	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
166	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
167	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
168	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
169	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
170	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
171	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
172	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
173	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
174	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
175	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
176	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
177	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
178	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
179	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
180	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
181	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
182	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
183	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
184	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
185	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
186	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
187	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
188	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
189	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
190	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
191	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
192	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
193	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
194	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
195	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
196	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
197	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
198	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
199	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
200	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
201	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
202	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
203	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
204	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
205	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
206	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
207	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
208	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
209	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
210	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
211	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
212	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
213	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
214	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
215	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
216	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
217	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
218	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
219	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
220	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
221	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
222	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
223	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
224	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
225	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
226	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
227	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
228	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
229	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
230	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
231	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
232	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
233	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
234	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
235	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
236	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
237	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
238	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
239	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
240	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
241	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
242	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
243	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
244	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
245	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
246	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
247	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
248	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
249	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
250	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
251	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
252	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
253	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
254	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
255	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
256	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
257	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
258	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
259	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
260	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
278	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
279	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
284	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
287	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
289	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
290	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
291	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
292	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
293	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
294	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
295	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
296	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
297	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
298	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
299	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
300	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
301	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
302	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
303	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
304	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
305	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
306	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
307	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
308	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
309	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
310	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
311	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
312	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
313	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
314	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
315	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
316	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
317	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
318	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
319	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
320	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
321	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
322	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
323	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
324	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
325	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
326	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
327	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
328	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
329	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
330	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
331	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
332	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
333	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
334	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
335	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
336	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
337	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
338	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
339	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
340	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
341	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
342	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
343	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
344	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
345	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
346	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
347	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
348	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
349	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
350	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
351	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
352	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
353	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
354	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
355	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
356	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
357	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
358	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
359	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
360	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
361	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
362	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
363	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
364	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
365	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
366	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
367	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
368	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
369	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
370	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
371	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
372	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
373	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
374	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
375	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
376	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
377	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
378	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
379	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
380	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
381	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
382	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
383	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
384	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
385	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
386	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
387	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
388	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
389	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
390	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
391	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
392	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
393	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
394	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
395	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
396	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
397	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
398	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
399	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
400	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
401	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
402	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
403	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
404	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
405	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
406	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
407	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
408	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
409	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
410	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
411	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
412	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
413	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
414	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
415	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
416	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
417	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
418	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
419	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
420	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
421	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
422	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
423	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
424	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
425	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
426	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
427	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
428	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
429	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
430	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
431	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
432	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
433	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
434	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
435	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
436	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
437	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
438	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
439	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
440	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
441	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
442	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
443	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
444	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
445	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
446	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
447	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
448	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
449	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
450	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
451	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
452	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
453	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
454	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
455	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
456	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
457	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
458	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
459	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
460	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
461	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
462	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
463	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
464	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
465	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
466	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
467	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
468	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
469	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
470	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
471	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
472	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
473	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
474	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
475	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
476	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
477	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
478	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
479	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
480	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
481	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
482	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
483	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
484	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
485	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
486	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
487	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
488	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
489	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
490	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
491	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
492	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
493	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
494	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
495	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
496	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
497	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
498	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
499	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	82.87
Metatranscriptomes	0
Isolates	17.13

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.8
Nodule	2.33
Rhizoplane	7.53
Rhizosphere	75.27
Stem	0
Stem Tuber	0
Unclassified	11.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_1387	2124908027	Bacteria	12500
2	MRS2a_Contig_1412	2124908027	Bacteria	7684
3	SwRhRL2b_contig_1140398	2162886007	Bacteria	1359
4	SwRhRL2b_contig_1545246	2162886007	Bacteria	2970
5	JGI24741J21665_1001500	3300001915	Bacteria	6656
6	JGI24741J21665_1006780	3300001915	Bacteria	2271
7	JGI25162J39368_1000327	3300002737	Bacteria	41734
8	JGI25162J39368_1000492	3300002737	Bacteria	30025
9	JGI25163J39215_1000177	3300002771	Bacteria	24899
10	JGI25164J39214_1000034	3300002772	Bacteria	139998
11	JGI25164J39214_1000241	3300002772	Bacteria	41734
12	JGI25164J39214_1000335	3300002772	Bacteria	30025
13	JGI25165J46597_1000011	3300003214	Bacteria	441040
14	JGI25165J46597_1000442	3300003214	Bacteria	41734
15	JGI25165J46597_1000619	3300003214	Bacteria	30025
16	Ga0055536_1002037	3300003781	Bacteria	11576
17	Ga0055536_1002107	3300003781	Bacteria	11324
18	Ga0055536_1003318	3300003781	Bacteria	8708
19	Ga0055530_10000398	3300003791	Bacteria	38934
20	Ga0055530_10003488	3300003791	Bacteria	8913
21	Ga0055530_10004698	3300003791	Bacteria	6917
22	Ga0055540_1000330	3300003792	Bacteria	41330
23	Ga0055540_1002807	3300003792	Bacteria	8913
24	Ga0055540_1002885	3300003792	Bacteria	8721
25	Ga0055531_10000125	3300003794	Bacteria	86349
26	Ga0058692_1013102	3300003856	Bacteria	1942
27	Ga0065714_10000512	3300005288	Bacteria	4131
28	Ga0065714_10002270	3300005288	Bacteria	29515
29	Ga0065714_10003529	3300005288	Bacteria	6826
30	Ga0065714_10004837	3300005288	Bacteria	4626
31	Ga0065714_10005381	3300005288	Bacteria	7398
32	Ga0065714_10007146	3300005288	Bacteria	4142
33	Ga0065714_10010074	3300005288	Bacteria	2183
34	Ga0065714_10013255	3300005288	Bacteria	3151
35	Ga0065714_10022318	3300005288	Bacteria	1987
36	Ga0065714_10064906	3300005288	Bacteria	15783
37	Ga0065714_10069510	3300005288	Bacteria	4197
38	Ga0065714_10069657	3300005288	Bacteria	4141
39	Ga0065714_10075805	3300005288	Bacteria	2864
40	Ga0065714_10086110	3300005288	Bacteria	2114
41	Ga0065714_10086971	3300005288	Bacteria	2079
42	Ga0065714_10088597	3300005288	Bacteria	2011
43	Ga0065714_10095905	3300005288	Bacteria	1774
44	Ga0065704_10006911	3300005289	Bacteria	3424
45	Ga0065704_10023831	3300005289	Bacteria	2699
46	Ga0065704_10076565	3300005289	Bacteria	5075
47	Ga0065704_10081410	3300005289	Bacteria	3763
48	Ga0065704_10092861	3300005289	Bacteria	2630
49	Ga0065712_10004870	3300005290	Bacteria	4364
50	Ga0065712_10067888	3300005290	Bacteria	22792
51	Ga0065712_10110281	3300005290	Bacteria	1824
52	Ga0070670_100006484	3300005331	Bacteria	9903
53	Ga0070670_100261586	3300005331	Bacteria	1508
54	Ga0070661_100000510	3300005344	Bacteria	29800
55	Ga0070668_100411024	3300005347	Bacteria	1157
56	Ga0070669_100000090	3300005353	Bacteria	88133
57	Ga0070669_100000578	3300005353	Bacteria	27227
58	Ga0070669_100001254	3300005353	Bacteria	18423
59	Ga0070662_100000656	3300005457	Bacteria	20969
60	Ga0070662_100001995	3300005457	Bacteria	12518
61	Ga0070662_100238776	3300005457	Bacteria	1457
62	Ga0070706_100319593	3300005467	Bacteria	1448
63	Ga0068853_100000218	3300005539	Bacteria	40498
64	Ga0068853_100004630	3300005539	Bacteria	10664
65	Ga0070665_100072536	3300005548	Bacteria	3450
66	Ga0070665_100122588	3300005548	Bacteria	2601
67	Ga0070664_100004150	3300005564	Bacteria	11639
68	Ga0070664_100005583	3300005564	Bacteria	10108
69	Ga0070664_100474302	3300005564	Bacteria	1151
70	Ga0068857_100364881	3300005577	Bacteria	1339
71	Ga0068854_100022744	3300005578	Bacteria	4276
72	Ga0068851_10000004	3300005834	Bacteria	269685
73	Ga0068851_10000035	3300005834	Bacteria	106588
74	Ga0075364_10058129	3300006051	Bacteria	2534
75	Ga0075364_10090518	3300006051	Bacteria	2030
76	Ga0075364_10178260	3300006051	Bacteria	1437
77	Ga0075432_10001026	3300006058	Bacteria	8878
78	Ga0075432_10029314	3300006058	Bacteria	1899
79	Ga0075432_10041569	3300006058	Bacteria	1606
80	Ga0070712_100249761	3300006175	Bacteria	1417
81	Ga0075436_100228891	3300006914	Bacteria	1320
82	Ga0099823_1000360	3300006944	Bacteria	28884
83	Ga0079104_1000478	3300006946	Bacteria	44469
84	Ga0079104_1000630	3300006946	Bacteria	34371
85	Ga0079104_1006183	3300006946	Bacteria	4594
86	Ga0079104_1030300	3300006946	Bacteria	1352
87	Ga0099826_10057411	3300006948	Bacteria	2560
88	Ga0105251_10000011	3300009011	Bacteria	180176
89	Ga0105251_10000163	3300009011	Bacteria	68706
90	Ga0105251_10000423	3300009011	Bacteria	41081
91	Ga0105251_10000844	3300009011	Bacteria	27457
92	Ga0105251_10001384	3300009011	Bacteria	20990
93	Ga0105251_10003773	3300009011	Bacteria	10831
94	Ga0105251_10004461	3300009011	Bacteria	9521
95	Ga0105251_10007786	3300009011	Bacteria	6528
96	Ga0105251_10012324	3300009011	Bacteria	4841
97	Ga0105251_10020575	3300009011	Bacteria	3464
98	Ga0105251_10038764	3300009011	Bacteria	2332
99	Ga0105251_10050498	3300009011	Bacteria	1986
100	Ga0105251_10061060	3300009011	Bacteria	1773
101	Ga0105251_10086561	3300009011	Bacteria	1443
102	Ga0105251_10116600	3300009011	Bacteria	1214
103	Ga0105244_10000323	3300009036	Bacteria	45689
104	Ga0105244_10018231	3300009036	Bacteria	3945
105	Ga0105244_10022490	3300009036	Bacteria	3469
106	Ga0105244_10043434	3300009036	Bacteria	2319
107	Ga0105244_10048930	3300009036	Bacteria	2162
108	Ga0105244_10053027	3300009036	Bacteria	2063
109	Ga0105244_10060701	3300009036	Bacteria	1904
110	Ga0105244_10079259	3300009036	Bacteria	1628
111	Ga0105244_10097145	3300009036	Bacteria	1444
112	Ga0105244_10106571	3300009036	Bacteria	1367
113	Ga0105250_10000617	3300009092	Bacteria	23112
114	Ga0105250_10001071	3300009092	Bacteria	15533
115	Ga0105250_10001615	3300009092	Bacteria	12061
116	Ga0105250_10001910	3300009092	Bacteria	10813
117	Ga0105250_10005432	3300009092	Bacteria	5716
118	Ga0105250_10030228	3300009092	Bacteria	2178
119	Ga0105250_10107472	3300009092	Bacteria	1141
120	Ga0105243_10000449	3300009148	Bacteria	42923
121	Ga0105243_10001222	3300009148	Bacteria	23139
122	Ga0105243_10001384	3300009148	Bacteria	21521
123	Ga0105243_10015598	3300009148	Bacteria	5743
124	Ga0105243_10033733	3300009148	Bacteria	3958
125	Ga0105243_10073289	3300009148	Bacteria	2774
126	Ga0105243_10140003	3300009148	Bacteria	2063
127	Ga0105242_10000658	3300009176	Bacteria	27031
128	Ga0105248_10006369	3300009177	Bacteria	12952
129	Ga0105248_10018229	3300009177	Bacteria	7752
130	Ga0105237_10002728	3300009545	Bacteria	21553
131	Ga0105237_10117321	3300009545	Bacteria	2655
132	Ga0105249_10008133	3300009553	Bacteria	9145
133	Ga0105246_10000751	3300011119	Bacteria	18487
134	Ga0105246_10017623	3300011119	Bacteria	4543
135	Ga0157345_1000195	3300012498	Bacteria	9422
136	Ga0157373_10000759	3300013100	Bacteria	25031
137	Ga0157373_10005866	3300013100	Bacteria	9187
138	Ga0157373_10015801	3300013100	Bacteria	5510
139	Ga0157373_10036478	3300013100	Bacteria	3528
140	Ga0157373_10042724	3300013100	Bacteria	3239
141	Ga0157373_10044024	3300013100	Bacteria	3187
142	Ga0157373_10046518	3300013100	Bacteria	3096
143	Ga0157373_10186584	3300013100	Bacteria	1461
144	Ga0157373_10289551	3300013100	Bacteria	1161
145	Ga0157371_10000039	3300013102	Bacteria	207724
146	Ga0157371_10000057	3300013102	Bacteria	171900
147	Ga0157371_10000243	3300013102	Bacteria	77959
148	Ga0157371_10000814	3300013102	Bacteria	35852
149	Ga0157371_10000897	3300013102	Bacteria	33517
150	Ga0157371_10000941	3300013102	Bacteria	32519
151	Ga0157371_10001343	3300013102	Bacteria	25909
152	Ga0157371_10046171	3300013102	Bacteria	3098
153	Ga0157371_10050747	3300013102	Bacteria	2949
154	Ga0157371_10143027	3300013102	Bacteria	1704
155	Ga0157370_10001150	3300013104	Bacteria	32991
156	Ga0157370_10002807	3300013104	Bacteria	20805
157	Ga0157370_10005350	3300013104	Bacteria	14411
158	Ga0157370_10061453	3300013104	Bacteria	3566
159	Ga0157370_10075351	3300013104	Bacteria	3181
160	Ga0157370_10086212	3300013104	Bacteria	2950
161	Ga0157370_10095733	3300013104	Bacteria	2785
162	Ga0157370_10159819	3300013104	Bacteria	2097
163	Ga0157370_10241996	3300013104	Bacteria	1669
164	Ga0157370_10245173	3300013104	Bacteria	1658
165	Ga0157370_10291909	3300013104	Bacteria	1506
166	Ga0157369_10001287	3300013105	Bacteria	31182
167	Ga0157369_10008971	3300013105	Bacteria	11454
168	Ga0157369_10013723	3300013105	Bacteria	9158
169	Ga0157369_10015739	3300013105	Bacteria	8522
170	Ga0157369_10085902	3300013105	Bacteria	3361
171	Ga0157369_10124681	3300013105	Bacteria	2732
172	Ga0163162_10002990	3300013306	Bacteria	16150
173	Ga0163162_10008768	3300013306	Bacteria	9834
174	Ga0163162_10010341	3300013306	Bacteria	9070
175	Ga0163162_10011051	3300013306	Bacteria	8794
176	Ga0163162_10034142	3300013306	Bacteria	5060
177	Ga0157372_10002218	3300013307	Bacteria	21103
178	Ga0157372_10024915	3300013307	Bacteria	6502
179	Ga0157375_10000664	3300013308	Bacteria	30435
180	Ga0157375_10057479	3300013308	Bacteria	3846
181	Ga0157375_10078846	3300013308	Bacteria	3328
182	Ga0157375_10099786	3300013308	Bacteria	2983
183	Ga0157375_10216291	3300013308	Bacteria	2074
184	Ga0182008_10000177	3300014497	Bacteria	49865
185	Ga0182008_10002101	3300014497	Bacteria	12714
186	Ga0182008_10003013	3300014497	Bacteria	10352
187	Ga0182008_10003388	3300014497	Bacteria	9663
188	Ga0182008_10003486	3300014497	Bacteria	9489
189	Ga0182008_10009774	3300014497	Bacteria	5162
190	Ga0182008_10011252	3300014497	Bacteria	4768
191	Ga0182008_10012415	3300014497	Bacteria	4496
192	Ga0182008_10025477	3300014497	Bacteria	3003
193	Ga0182008_10034963	3300014497	Bacteria	2518
194	Ga0182008_10042300	3300014497	Bacteria	2270
195	Ga0182008_10042591	3300014497	Bacteria	2262
196	Ga0182008_10055360	3300014497	Bacteria	1962
197	Ga0157376_10191835	3300014969	Unclassified	1874
198	Ga0182006_1002556	3300015261	Bacteria	9864
199	Ga0182006_1002946	3300015261	Bacteria	9006
200	Ga0182006_1013082	3300015261	Bacteria	3612
201	Ga0182006_1014690	3300015261	Bacteria	3372
202	Ga0182006_1036402	3300015261	Bacteria	1957
203	Ga0182006_1052286	3300015261	Bacteria	1570
204	Ga0182006_1059315	3300015261	Bacteria	1449
205	Ga0182007_10000296	3300015262	Bacteria	32264
206	Ga0182007_10000322	3300015262	Bacteria	30363
207	Ga0182007_10011182	3300015262	Bacteria	3501
208	Ga0182007_10016029	3300015262	Bacteria	2775
209	Ga0182005_1001565	3300015265	Bacteria	9040
210	Ga0182005_1002901	3300015265	Bacteria	5965
211	Ga0182005_1014239	3300015265	Bacteria	2227
212	Ga0182005_1022890	3300015265	Bacteria	1710
213	Ga0182005_1036148	3300015265	Bacteria	1343
214	Ga0163161_10001454	3300017792	Bacteria	17494
215	Ga0163161_10012783	3300017792	Bacteria	5831
216	Ga0163161_10014263	3300017792	Bacteria	5534
217	Ga0163161_10041729	3300017792	Bacteria	3298
218	Ga0163161_10049824	3300017792	Bacteria	3028
219	Ga0163161_10052148	3300017792	Bacteria	2965
220	Ga0163161_10069881	3300017792	Bacteria	2567
221	Ga0163161_10083337	3300017792	Bacteria	2357
222	Ga0163161_10094293	3300017792	Bacteria	2219
223	Ga0163161_10105314	3300017792	Bacteria	2104
224	Ga0163161_10109447	3300017792	Bacteria	2064
225	Ga0163161_10151060	3300017792	Bacteria	1765
226	Ga0163161_10182369	3300017792	Bacteria	1610
227	Ga0209760_100050	3300025207	Bacteria	106788
228	Ga0209760_100117	3300025207	Bacteria	57229
229	Ga0209760_100153	3300025207	Bacteria	42023
230	Ga0209563_100242	3300025230	Bacteria	26179
231	Ga0207427_100003	3300025231	Bacteria	1035004
232	Ga0207427_100056	3300025231	Bacteria	204343
233	Ga0207427_100063	3300025231	Bacteria	177711
234	Ga0209437_100002	3300025233	Bacteria	1574801
235	Ga0209437_100065	3300025233	Bacteria	332417
236	Ga0209437_100133	3300025233	Bacteria	178493
237	Ga0209233_1000004	3300025261	Bacteria	1574798
238	Ga0209233_1000085	3300025261	Bacteria	333078
239	Ga0209233_1000133	3300025261	Bacteria	202716
240	Ga0209675_1006756	3300025291	Bacteria	4539
241	Ga0209676_1000076	3300025292	Bacteria	301393
242	Ga0209676_1000314	3300025292	Bacteria	94905
243	Ga0209676_1000337	3300025292	Bacteria	89361
244	Ga0209676_1001941	3300025292	Bacteria	16658
245	Ga0209676_1008114	3300025292	Bacteria	4760
246	Ga0209676_1014710	3300025292	Bacteria	2927
247	Ga0209050_1000063	3300025298	Bacteria	314955
248	Ga0209050_1000080	3300025298	Bacteria	275154
249	Ga0209050_1000106	3300025298	Bacteria	224396
250	Ga0209050_1001281	3300025298	Bacteria	28701
251	Ga0209051_1000045	3300025303	Bacteria	297882
252	Ga0209051_1000260	3300025303	Bacteria	88213
253	Ga0209051_1000283	3300025303	Bacteria	82731
254	Ga0209257_1000185	3300025304	Bacteria	155047
255	Ga0207656_10000007	3300025321	Bacteria	289154
256	Ga0207656_10000008	3300025321	Bacteria	275365
257	Ga0207696_1000047	3300025711	Bacteria	285005
258	Ga0207696_1000118	3300025711	Bacteria	147902
259	Ga0207696_1000168	3300025711	Bacteria	103496
260	Ga0207696_1000229	3300025711	Bacteria	79025
261	Ga0207696_1000587	3300025711	Bacteria	28197
262	Ga0207696_1001474	3300025711	Bacteria	12730
263	Ga0207696_1005288	3300025711	Bacteria	5376
264	Ga0207696_1008131	3300025711	Bacteria	4045
265	Ga0207696_1009034	3300025711	Bacteria	3741
266	Ga0207696_1021070	3300025711	Bacteria	2091
267	Ga0207696_1046701	3300025711	Bacteria	1249
268	Ga0207655_1000104	3300025728	Bacteria	184765
269	Ga0207655_1000415	3300025728	Bacteria	58289
270	Ga0207655_1000568	3300025728	Bacteria	45908
271	Ga0207655_1000606	3300025728	Bacteria	43412
272	Ga0207655_1000789	3300025728	Bacteria	34566
273	Ga0207655_1000921	3300025728	Bacteria	30542
274	Ga0207655_1001528	3300025728	Bacteria	21022
275	Ga0207655_1001963	3300025728	Bacteria	17569
276	Ga0207655_1008138	3300025728	Bacteria	6704
277	Ga0207655_1009879	3300025728	Bacteria	5873
278	Ga0207655_1010191	3300025728	Bacteria	5731
279	Ga0207655_1012210	3300025728	Bacteria	5042
280	Ga0207655_1013479	3300025728	Bacteria	4691
281	Ga0207655_1029377	3300025728	Bacteria	2575
282	Ga0207655_1035913	3300025728	Bacteria	2206
283	Ga0207655_1048622	3300025728	Bacteria	1739
284	Ga0207713_1000049	3300025735	Bacteria	227882
285	Ga0207713_1000073	3300025735	Bacteria	181519
286	Ga0207713_1000225	3300025735	Bacteria	76469
287	Ga0207713_1000763	3300025735	Bacteria	29784
288	Ga0207713_1000874	3300025735	Bacteria	27547
289	Ga0207713_1001275	3300025735	Bacteria	20756
290	Ga0207713_1001277	3300025735	Bacteria	20747
291	Ga0207713_1001528	3300025735	Bacteria	18224
292	Ga0207713_1001685	3300025735	Bacteria	17089
293	Ga0207713_1002325	3300025735	Bacteria	13960
294	Ga0207713_1002936	3300025735	Bacteria	11924
295	Ga0207713_1012385	3300025735	Bacteria	4566
296	Ga0207713_1013089	3300025735	Bacteria	4395
297	Ga0207713_1014590	3300025735	Bacteria	4074
298	Ga0207713_1051894	3300025735	Bacteria	1627
299	Ga0207699_10087511	3300025906	Bacteria	1948
300	Ga0207671_10000015	3300025914	Bacteria	439607
301	Ga0207693_10178541	3300025915	Bacteria	1670
302	Ga0207649_10000001	3300025920	Bacteria	537851
303	Ga0207649_10123024	3300025920	Bacteria	1752
304	Ga0207681_10000048	3300025923	Bacteria	120755
305	Ga0207681_10001746	3300025923	Bacteria	13958
306	Ga0207681_10005762	3300025923	Bacteria	7597
307	Ga0207650_10001153	3300025925	Bacteria	19401
308	Ga0207650_10004096	3300025925	Bacteria	9954
309	Ga0207706_10000374	3300025933	Bacteria	48637
310	Ga0207706_10000624	3300025933	Bacteria	37622
311	Ga0207706_10247015	3300025933	Bacteria	1559
312	Ga0207686_10007858	3300025934	Bacteria	5751
313	Ga0207709_10000030	3300025935	Bacteria	331710
314	Ga0207709_10000343	3300025935	Bacteria	48072
315	Ga0207709_10001579	3300025935	Bacteria	15567
316	Ga0207709_10003423	3300025935	Bacteria	9457
317	Ga0207709_10018499	3300025935	Bacteria	3903
318	Ga0207711_10127975	3300025941	Bacteria	2274
319	Ga0207679_10000011	3300025945	Bacteria	346112
320	Ga0207640_10069802	3300025981	Bacteria	2361
321	Ga0207639_10000392	3300026041	Bacteria	30199
322	Ga0207639_10001691	3300026041	Bacteria	14893
323	Ga0209281_1000070	3300027111	Bacteria	277098
324	Ga0209281_1000127	3300027111	Bacteria	200036
325	Ga0209281_1011604	3300027111	Bacteria	1966
326	Ga0209281_1016651	3300027111	Bacteria	1507
327	Ga0209389_1000020	3300027296	Bacteria	172003
328	Ga0209371_1000302	3300027312	Bacteria	55126
329	Ga0209996_1000911	3300027395	Bacteria	3487
330	Ga0209995_1002328	3300027471	Bacteria	3000
331	Ga0209983_1003865	3300027665	Bacteria	3169
332	Ga0209282_1049505	3300027666	Bacteria	2423
333	Ga0209971_1000288	3300027682	Bacteria	14053
334	Ga0209974_10002241	3300027876	Bacteria	7028
335	Ga0207428_10030007	3300027907	Bacteria	4498
336	Ga0207428_10069683	3300027907	Bacteria	2765
337	Ga0207428_10136380	3300027907	Bacteria	1876
338	Ga0207428_10141382	3300027907	Bacteria	1837
339	Ga0268266_10008566	3300028379	Bacteria	9088
340	Ga0307517_10056132	3300028786	Bacteria	3849
341	Ga0268256_1000669	3300030500	Bacteria	26000
342	Ga0307511_10097049	3300030521	Bacteria	1959
343	Ga0314311_1116775	3300030733	Bacteria	5197
344	Ga0316179_1066345	3300030734	Bacteria	3297
345	Ga0307509_10081300	3300031507	Bacteria	3347
346	Ga0307408_100037081	3300031548	Bacteria	3431
347	Ga0307408_100094552	3300031548	Bacteria	2263
348	Ga0307408_100144710	3300031548	Bacteria	1869
349	Ga0307408_100447814	3300031548	Bacteria	1119
350	Ga0307405_10002165	3300031731	Bacteria	8577
351	Ga0307405_10031514	3300031731	Bacteria	3122
352	Ga0307405_10059983	3300031731	Bacteria	2399
353	Ga0307405_10076842	3300031731	Bacteria	2167
354	Ga0307405_10099461	3300031731	Bacteria	1946
355	Ga0307413_10134799	3300031824	Bacteria	1696
356	Ga0307406_10111057	3300031901	Bacteria	1887
357	Ga0307407_10219198	3300031903	Bacteria	1285
358	Ga0307412_10003273	3300031911	Bacteria	8993
359	Ga0307412_10111492	3300031911	Bacteria	1954
360	Ga0307412_10126603	3300031911	Bacteria	1848
361	Ga0307412_10127891	3300031911	Bacteria	1840
362	Ga0307412_10150494	3300031911	Bacteria	1716
363	Ga0307412_10247852	3300031911	Bacteria	1381
364	Ga0307416_100282968	3300032002	Bacteria	1636
365	Ga0307414_10016387	3300032004	Bacteria	4504
366	Ga0307414_10076651	3300032004	Bacteria	2430
367	Ga0307414_10164071	3300032004	Bacteria	1768
368	Ga0307411_10028463	3300032005	Bacteria	3397
369	Ga0307411_10093173	3300032005	Bacteria	2108
370	Ga0307510_10014907	3300033180	Bacteria	9192
371	Ga0307510_10067234	3300033180	Bacteria	3610
372	Ga0373945_0026530	3300035116	Bacteria	2018
373	Ga0373943_0000121	3300035170	Bacteria	29176
374	Ga0373927_0191516	3300035695	Bacteria	1342
375	Ga0373947_0005724	3300035725	Bacteria	7249
376	Ga0373925_0000937	3300037068	Bacteria	26571
377	Ga0395900_0509408	3300037418	Bacteria	1153
378	Ga0395898_0054707	3300037466	Bacteria	3894
379	Ga0395898_0207010	3300037466	Bacteria	1872
380	Ga0395905_0207949	3300037471	Bacteria	1834
381	Ga0395901_0249548	3300038443	Bacteria	1849
382	Ga0237819_02300	3300038705	Bacteria	3958
383	Ga0439438_002027	3300041405	Bacteria	8820
384	Ga0439438_002662	3300041405	Bacteria	7531
385	Ga0439438_003168	3300041405	Bacteria	6747
386	Ga0439438_004163	3300041405	Bacteria	5639
387	Ga0439438_004780	3300041405	Bacteria	5116
388	Ga0439438_007708	3300041405	Bacteria	3647
389	Ga0439438_008486	3300041405	Bacteria	3399
390	Ga0439438_009822	3300041405	Bacteria	3073
391	Ga0439438_016233	3300041405	Bacteria	2168
392	Ga0439438_027956	3300041405	Bacteria	1519
393	Ga0439447_000984	3300041407	Bacteria	10389
394	Ga0439447_003060	3300041407	Bacteria	5969
395	Ga0439447_004828	3300041407	Bacteria	4576
396	Ga0439447_008588	3300041407	Bacteria	3157
397	Ga0439447_018779	3300041407	Bacteria	1856
398	Ga0439447_022936	3300041407	Bacteria	1630
399	Ga0439447_032517	3300041407	Bacteria	1303
400	Ga0439447_037707	3300041407	Bacteria	1190
401	Ga0439466_0000291	3300041411	Bacteria	19484
402	Ga0439466_0001178	3300041411	Bacteria	10175
403	Ga0439466_0001273	3300041411	Bacteria	9796
404	Ga0439466_0002860	3300041411	Bacteria	6752
405	Ga0439466_0003123	3300041411	Bacteria	6443
406	Ga0439466_0003732	3300041411	Bacteria	5881
407	Ga0439466_0004845	3300041411	Bacteria	5174
408	Ga0439466_0012679	3300041411	Bacteria	3098
409	Ga0439437_000847	3300042000	Bacteria	3167
410	Ga0439445_0007177	3300042004	Bacteria	2578
411	Ga0439432_000387	3300042006	Bacteria	16241
412	Ga0439432_001214	3300042006	Bacteria	9752
413	Ga0439432_001292	3300042006	Bacteria	9470
414	Ga0439432_001599	3300042006	Bacteria	8486
415	Ga0439432_037011	3300042006	Bacteria	1559
416	Ga0439432_058000	3300042006	Bacteria	1197
417	Ga0439451_002709	3300042009	Bacteria	3597
418	Ga0439451_002935	3300042009	Bacteria	3468
419	Ga0439451_022118	3300042009	Bacteria	1282
420	Ga0439451_032958	3300042009	Bacteria	1042
421	Ga0439452_000152	3300042010	Bacteria	51070
422	Ga0439452_000339	3300042010	Bacteria	29028
423	Ga0439452_002271	3300042010	Bacteria	7182
424	Ga0439452_002361	3300042010	Bacteria	7009
425	Ga0439452_006091	3300042010	Bacteria	3809
426	Ga0439452_015387	3300042010	Bacteria	2100
427	Ga0439452_017608	3300042010	Bacteria	1916
428	Ga0439452_025163	3300042010	Bacteria	1514
429	Ga0439456_000103	3300042013	Bacteria	28631
430	Ga0439456_001527	3300042013	Bacteria	4662
431	Ga0439456_003352	3300042013	Bacteria	3242
432	Ga0439456_003540	3300042013	Bacteria	3166
433	Ga0439456_003802	3300042013	Bacteria	3072
434	Ga0439456_004429	3300042013	Bacteria	2838
435	Ga0439456_014059	3300042013	Bacteria	1668
436	Ga0439456_023511	3300042013	Bacteria	1306
437	Ga0439463_000187	3300042016	Bacteria	16491
438	Ga0439463_000495	3300042016	Bacteria	11003
439	Ga0439463_001747	3300042016	Bacteria	5656
440	Ga0439463_001870	3300042016	Bacteria	5460
441	Ga0439463_006145	3300042016	Bacteria	2979
442	Ga0439463_021093	3300042016	Bacteria	1626
443	Ga0439463_021874	3300042016	Bacteria	1598
444	Ga0450911_000022	3300042115	Bacteria	91239
445	Ga0450911_000160	3300042115	Bacteria	26844
446	Ga0450911_001266	3300042115	Bacteria	6040
447	Ga0450911_001270	3300042115	Bacteria	6030
448	Ga0450911_003704	3300042115	Bacteria	2638
449	Ga0450911_007233	3300042115	Bacteria	1618
450	Ga0450919_000403	3300042121	Bacteria	5272
451	Ga0450920_000513	3300042122	Bacteria	6112
452	Ga0450922_000328	3300042124	Bacteria	5012
453	Ga0450890_000086	3300042127	Bacteria	15527
454	Ga0450900_000044	3300042136	Bacteria	5673
455	Ga0450902_000289	3300042137	Bacteria	5996
456	Ga0450902_000575	3300042137	Bacteria	4659
457	Ga0450902_008347	3300042137	Bacteria	1616
458	Ga0450902_013308	3300042137	Bacteria	1324
459	Ga0450902_018900	3300042137	Bacteria	1131
460	Ga0450903_006726	3300042138	Bacteria	1904
461	Ga0450903_011020	3300042138	Bacteria	1459
462	Ga0450904_000091	3300042139	Bacteria	20642
463	Ga0450904_004817	3300042139	Bacteria	1388
464	Ga0450905_000440	3300042142	Bacteria	5096
465	Ga0450906_003802	3300042145	Bacteria	3211
466	Ga0450907_000072	3300042146	Bacteria	38960
467	Ga0450907_007095	3300042146	Bacteria	1870
468	Ga0450907_007819	3300042146	Bacteria	1781
469	Ga0450910_001219	3300042147	Bacteria	3205
470	Ga0439446_0002571	3300042156	Bacteria	4370
471	Ga0439446_0032414	3300042156	Bacteria	1515
472	Ga0450908_002778	3300042184	Bacteria	3408
473	Ga0450908_008892	3300042184	Bacteria	1875
474	Ga0450908_017595	3300042184	Bacteria	1268
475	Ga0450909_000255	3300042185	Bacteria	6391
476	Ga0450909_000990	3300042185	Bacteria	3897
477	Ga0439434_0001139	3300042435	Bacteria	7687
478	Ga0439434_0003766	3300042435	Bacteria	4432
479	Ga0439464_0010708	3300042439	Bacteria	2423
480	Ga0439460_0000418	3300042461	Bacteria	9081
481	Ga0439460_0002716	3300042461	Bacteria	4265
482	Ga0450893_0025212	3300042532	Bacteria	1041
483	Ga0450901_000091	3300042533	Bacteria	9470
484	Ga0450901_000101	3300042533	Bacteria	9219
485	Ga0451577_0041688	3300042876	Bacteria	4120
486	Ga0439440_0002351	3300042993	Bacteria	3562
487	Ga0466967_0210728	3300045976	Bacteria	1843
488	Ga0495617_000462	3300046452	Bacteria	21788
489	Ga0495617_028745	3300046452	Bacteria	1868
490	Ga0495617_033400	3300046452	Bacteria	1726
491	Ga0495617_034018	3300046452	Bacteria	1710
492	Ga0495617_038861	3300046452	Bacteria	1591
493	Ga0495627_000037	3300046453	Bacteria	198542
494	Ga0495627_004300	3300046453	Bacteria	5991
495	Ga0495627_005759	3300046453	Bacteria	4945
496	Ga0495627_016803	3300046453	Bacteria	2499
497	Ga0495627_017397	3300046453	Bacteria	2442
498	Ga0495627_020390	3300046453	Bacteria	2209
499	Ga0495627_022059	3300046453	Bacteria	2100
500	Ga0495627_023831	3300046453	Bacteria	2001
501	Ga0495627_025483	3300046453	Bacteria	1917
502	Ga0495592_0197670	3300046454	Bacteria	1359
503	Ga0495603_0000800	3300046455	Bacteria	18018
504	Ga0495603_0013173	3300046455	Bacteria	4998
505	Ga0495603_0014438	3300046455	Bacteria	4777
506	Ga0495603_0045539	3300046455	Bacteria	2616
507	Ga0495603_0069677	3300046455	Bacteria	2068
508	Ga0495590_0001176	3300046457	Bacteria	11451
509	Ga0495590_0009185	3300046457	Bacteria	3753
510	Ga0495590_0010689	3300046457	Bacteria	3440
511	Ga0495590_0014222	3300046457	Bacteria	2908
512	Ga0495590_0016193	3300046457	Bacteria	2695
513	Ga0495590_0045746	3300046457	Bacteria	1527
514	Ga0495591_000036	3300046458	Bacteria	167479
515	Ga0495591_000753	3300046458	Bacteria	23393
516	Ga0495591_001278	3300046458	Bacteria	16072
517	Ga0495591_002445	3300046458	Bacteria	10328
518	Ga0495591_002812	3300046458	Bacteria	9375
519	Ga0495591_003927	3300046458	Bacteria	7484
520	Ga0495591_004908	3300046458	Bacteria	6354
521	Ga0495591_010647	3300046458	Bacteria	3546
522	Ga0495591_014537	3300046458	Bacteria	2825
523	Ga0495591_015785	3300046458	Bacteria	2655
524	Ga0495591_016285	3300046458	Bacteria	2595
525	Ga0495591_016854	3300046458	Bacteria	2527
526	Ga0495591_018010	3300046458	Bacteria	2406
527	Ga0495591_022401	3300046458	Bacteria	2041
528	Ga0495591_037789	3300046458	Bacteria	1394
529	Ga0495591_047496	3300046458	Bacteria	1188
530	Ga0495591_047529	3300046458	Bacteria	1187
531	Ga0495629_0001138	3300046459	Bacteria	20986
532	Ga0495629_0216928	3300046459	Bacteria	1320
533	Ga0495638_0001683	3300046460	Bacteria	19564
534	Ga0495638_0002555	3300046460	Bacteria	14757
535	Ga0495638_0004957	3300046460	Bacteria	9996
536	Ga0495638_0012547	3300046460	Bacteria	5801
537	Ga0495638_0014289	3300046460	Bacteria	5374
538	Ga0495638_0025060	3300046460	Bacteria	3881
539	Ga0495638_0037075	3300046460	Bacteria	3103
540	Ga0495638_0041622	3300046460	Bacteria	2905
541	Ga0495638_0076687	3300046460	Bacteria	2036
542	Ga0495638_0081014	3300046460	Bacteria	1971
543	Ga0495638_0128589	3300046460	Bacteria	1490
544	Ga0495638_0132994	3300046460	Bacteria	1459
545	Ga0495638_0154899	3300046460	Bacteria	1326
546	Ga0495638_0257357	3300046460	Bacteria	959
547	Ga0495641_0016842	3300046461	Bacteria	3832
548	Ga0495651_0121748	3300046462	Bacteria	1916
549	Ga0495653_0004321	3300046463	Bacteria	11492
550	Ga0495653_0012643	3300046463	Bacteria	6893
551	Ga0495653_0022282	3300046463	Bacteria	5127
552	Ga0495653_0061487	3300046463	Bacteria	2841
553	Ga0495653_0126780	3300046463	Bacteria	1811
554	Ga0495650_0000311	3300046471	Bacteria	87755
555	Ga0495650_0001743	3300046471	Bacteria	19813
556	Ga0495650_0002440	3300046471	Bacteria	15047
557	Ga0495650_0012206	3300046471	Bacteria	4636
558	Ga0495650_0037463	3300046471	Bacteria	2111
559	Ga0495650_0069233	3300046471	Bacteria	1389
560	Ga0495650_0070179	3300046471	Bacteria	1376
561	Ga0495582_0000476	3300046473	Bacteria	21966
562	Ga0495582_0011017	3300046473	Bacteria	4977
563	Ga0495605_0000033	3300046474	Bacteria	209203
564	Ga0495605_0000209	3300046474	Bacteria	71906
565	Ga0495605_0000691	3300046474	Bacteria	25267
566	Ga0495605_0000724	3300046474	Bacteria	24299
567	Ga0495605_0001216	3300046474	Bacteria	17156
568	Ga0495605_0001307	3300046474	Bacteria	16507
569	Ga0495605_0002110	3300046474	Bacteria	12465
570	Ga0495605_0002428	3300046474	Bacteria	11521
571	Ga0495605_0003914	3300046474	Bacteria	8815
572	Ga0495605_0006812	3300046474	Bacteria	6528
573	Ga0495605_0018155	3300046474	Bacteria	3776
574	Ga0495605_0055683	3300046474	Bacteria	1909
575	Ga0495605_0059755	3300046474	Bacteria	1829
576	Ga0495605_0060262	3300046474	Bacteria	1819
577	Ga0495639_0000248	3300046475	Bacteria	26780
578	Ga0495639_0000472	3300046475	Bacteria	19185
579	Ga0495639_0000773	3300046475	Bacteria	14548
580	Ga0495662_0017909	3300046476	Bacteria	3428
581	Ga0495664_0086572	3300046477	Bacteria	1882
582	Ga0495584_0003840	3300046491	Bacteria	8161
583	Ga0495584_0004092	3300046491	Bacteria	7871
584	Ga0495584_0005915	3300046491	Bacteria	6446
585	Ga0495584_0009286	3300046491	Bacteria	5069
586	Ga0495584_0012329	3300046491	Bacteria	4363
587	Ga0495584_0023273	3300046491	Bacteria	3141
588	Ga0495584_0040440	3300046491	Bacteria	2354
589	Ga0495584_0046121	3300046491	Bacteria	2198
590	Ga0495584_0060272	3300046491	Bacteria	1908
591	Ga0495584_0070840	3300046491	Bacteria	1752
592	Ga0495585_0000641	3300046492	Bacteria	32185
593	Ga0495585_0000754	3300046492	Bacteria	28684
594	Ga0495585_0000827	3300046492	Bacteria	26761
595	Ga0495585_0003238	3300046492	Bacteria	11099
596	Ga0495585_0010256	3300046492	Bacteria	5588
597	Ga0495585_0026275	3300046492	Bacteria	3325
598	Ga0495585_0027893	3300046492	Bacteria	3222
599	Ga0495585_0035645	3300046492	Bacteria	2810
600	Ga0495585_0040916	3300046492	Bacteria	2601
601	Ga0495585_0055804	3300046492	Bacteria	2182
602	Ga0495585_0061632	3300046492	Bacteria	2062
603	Ga0495594_0001886	3300046499	Bacteria	10906
604	Ga0495594_0007124	3300046499	Bacteria	5752
605	Ga0495594_0013234	3300046499	Bacteria	4304
606	Ga0495594_0028708	3300046499	Bacteria	3003
607	Ga0495594_0074567	3300046499	Bacteria	1890
608	Ga0495594_0210086	3300046499	Bacteria	1109
609	Ga0495596_0000258	3300046500	Bacteria	35383
610	Ga0495596_0012084	3300046500	Bacteria	3706
611	Ga0495596_0034997	3300046500	Bacteria	1992
612	Ga0495607_0000482	3300046501	Bacteria	39874
613	Ga0495607_0000938	3300046501	Bacteria	27121
614	Ga0495607_0001003	3300046501	Bacteria	26008
615	Ga0495607_0001384	3300046501	Bacteria	21585
616	Ga0495607_0001420	3300046501	Bacteria	21343
617	Ga0495607_0002109	3300046501	Bacteria	16605
618	Ga0495607_0002221	3300046501	Bacteria	16069
619	Ga0495607_0003809	3300046501	Bacteria	11379
620	Ga0495607_0004815	3300046501	Bacteria	9845
621	Ga0495607_0006727	3300046501	Bacteria	8042
622	Ga0495607_0014898	3300046501	Bacteria	5053
623	Ga0495607_0020589	3300046501	Bacteria	4166
624	Ga0495607_0030521	3300046501	Bacteria	3308
625	Ga0495607_0049107	3300046501	Bacteria	2462
626	Ga0495607_0049175	3300046501	Bacteria	2460
627	Ga0495607_0050375	3300046501	Bacteria	2424
628	Ga0495607_0056587	3300046501	Bacteria	2251
629	Ga0495607_0063608	3300046501	Bacteria	2087
630	Ga0495607_0066820	3300046501	Bacteria	2021
631	Ga0495607_0089826	3300046501	Bacteria	1667
632	Ga0495607_0115465	3300046501	Bacteria	1417
633	Ga0495607_0146276	3300046501	Bacteria	1214
634	Ga0495583_0000031	3300046506	Bacteria	253982
635	Ga0495583_0000830	3300046506	Bacteria	37819
636	Ga0495583_0003344	3300046506	Bacteria	12387
637	Ga0495583_0005408	3300046506	Bacteria	8681
638	Ga0495583_0006633	3300046506	Bacteria	7511
639	Ga0495583_0014605	3300046506	Bacteria	4321
640	Ga0495583_0020352	3300046506	Bacteria	3439
641	Ga0495583_0021691	3300046506	Bacteria	3297
642	Ga0495583_0035562	3300046506	Bacteria	2376
643	Ga0495606_0001608	3300046507	Bacteria	29469
644	Ga0495606_0001996	3300046507	Bacteria	25148
645	Ga0495606_0004534	3300046507	Bacteria	13813
646	Ga0495606_0005860	3300046507	Bacteria	11582
647	Ga0495606_0008324	3300046507	Bacteria	9038
648	Ga0495606_0008615	3300046507	Bacteria	8816
649	Ga0495606_0010298	3300046507	Bacteria	7780
650	Ga0495606_0013937	3300046507	Bacteria	6308
651	Ga0495606_0020705	3300046507	Bacteria	4840
652	Ga0495606_0045420	3300046507	Bacteria	2911
653	Ga0495606_0048245	3300046507	Bacteria	2802
654	Ga0495606_0051663	3300046507	Bacteria	2679
655	Ga0495606_0059873	3300046507	Bacteria	2441
656	Ga0495610_0003091	3300046512	Bacteria	13284
657	Ga0495610_0004211	3300046512	Bacteria	10732
658	Ga0495610_0005602	3300046512	Bacteria	8864
659	Ga0495610_0009045	3300046512	Bacteria	6354
660	Ga0495610_0010339	3300046512	Bacteria	5810
661	Ga0495610_0025086	3300046512	Bacteria	3207
662	Ga0495610_0029984	3300046512	Bacteria	2856
663	Ga0495610_0034423	3300046512	Bacteria	2609
664	Ga0495610_0035330	3300046512	Bacteria	2567
665	Ga0495610_0036268	3300046512	Bacteria	2521
666	Ga0495610_0038173	3300046512	Bacteria	2439
667	Ga0495610_0041537	3300046512	Bacteria	2308
668	Ga0495610_0047751	3300046512	Bacteria	2104
669	Ga0495610_0051208	3300046512	Bacteria	2011
670	Ga0495610_0098125	3300046512	Bacteria	1316
671	Ga0495616_0003090	3300046513	Bacteria	10786
672	Ga0495616_0013441	3300046513	Bacteria	4617
673	Ga0495616_0013589	3300046513	Bacteria	4587
674	Ga0495616_0019873	3300046513	Bacteria	3661
675	Ga0495616_0020209	3300046513	Bacteria	3626
676	Ga0495616_0028861	3300046513	Bacteria	2934
677	Ga0495616_0060620	3300046513	Bacteria	1858
678	Ga0495620_0000112	3300046515	Bacteria	64688
679	Ga0495620_0000222	3300046515	Bacteria	42955
680	Ga0495620_0000505	3300046515	Bacteria	25337
681	Ga0495620_0000828	3300046515	Bacteria	19100
682	Ga0495620_0002192	3300046515	Bacteria	11347
683	Ga0495620_0002619	3300046515	Bacteria	10409
684	Ga0495620_0008305	3300046515	Bacteria	5581
685	Ga0495620_0011338	3300046515	Bacteria	4649
686	Ga0495620_0016733	3300046515	Bacteria	3672
687	Ga0495620_0039267	3300046515	Bacteria	2094
688	Ga0495620_0044472	3300046515	Bacteria	1929
689	Ga0495620_0094108	3300046515	Bacteria	1199
690	Ga0495628_0289889	3300046516	Bacteria	1213
691	Ga0495630_0017334	3300046517	Bacteria	5275
692	Ga0495630_0066396	3300046517	Bacteria	2711
693	Ga0495630_0146721	3300046517	Bacteria	1794
694	Ga0495630_0291725	3300046517	Bacteria	1246
695	Ga0495631_0000138	3300046518	Bacteria	49408
696	Ga0495631_0000301	3300046518	Bacteria	34657
697	Ga0495631_0011250	3300046518	Bacteria	4404
698	Ga0495631_0056498	3300046518	Bacteria	1709
699	Ga0495631_0062366	3300046518	Bacteria	1615
700	Ga0495631_0169495	3300046518	Bacteria	936
701	Ga0495632_0001173	3300046519	Bacteria	22288
702	Ga0495632_0001768	3300046519	Bacteria	17482
703	Ga0495632_0004714	3300046519	Bacteria	9203
704	Ga0495632_0005896	3300046519	Bacteria	7998
705	Ga0495632_0010733	3300046519	Bacteria	5397
706	Ga0495632_0011313	3300046519	Bacteria	5213
707	Ga0495632_0017239	3300046519	Bacteria	3993
708	Ga0495632_0038139	3300046519	Bacteria	2434
709	Ga0495632_0041456	3300046519	Bacteria	2314
710	Ga0495632_0042661	3300046519	Bacteria	2272
711	Ga0495632_0051797	3300046519	Bacteria	2019
712	Ga0495632_0060000	3300046519	Bacteria	1849
713	Ga0495632_0089243	3300046519	Bacteria	1463
714	Ga0495632_0094903	3300046519	Bacteria	1410
715	Ga0495632_0157459	3300046519	Bacteria	1047
716	Ga0495637_0000064	3300046520	Bacteria	92793
717	Ga0495637_0000110	3300046520	Bacteria	59616
718	Ga0495637_0000992	3300046520	Bacteria	17932
719	Ga0495637_0001007	3300046520	Bacteria	17765
720	Ga0495637_0001611	3300046520	Bacteria	13093
721	Ga0495637_0005733	3300046520	Bacteria	6294
722	Ga0495637_0008873	3300046520	Bacteria	4920
723	Ga0495637_0009654	3300046520	Bacteria	4701
724	Ga0495637_0014118	3300046520	Bacteria	3774
725	Ga0495637_0014644	3300046520	Bacteria	3695
726	Ga0495637_0021635	3300046520	Bacteria	2946
727	Ga0495637_0040647	3300046520	Bacteria	2000
728	Ga0495637_0040937	3300046520	Bacteria	1991
729	Ga0495637_0041076	3300046520	Bacteria	1987
730	Ga0495637_0044783	3300046520	Bacteria	1882
731	Ga0495637_0047400	3300046520	Bacteria	1814
732	Ga0495643_0001951	3300046522	Bacteria	17354
733	Ga0495643_0009583	3300046522	Bacteria	6009
734	Ga0495643_0018938	3300046522	Bacteria	3987
735	Ga0495643_0022277	3300046522	Bacteria	3618
736	Ga0495643_0023347	3300046522	Bacteria	3517
737	Ga0495643_0050316	3300046522	Bacteria	2244
738	Ga0495643_0062683	3300046522	Bacteria	1967
739	Ga0495643_0065887	3300046522	Bacteria	1912
740	Ga0495643_0089057	3300046522	Bacteria	1594
741	Ga0495643_0095065	3300046522	Bacteria	1533
742	Ga0495644_0005691	3300046523	Bacteria	4863
743	Ga0495644_0007142	3300046523	Bacteria	4316
744	Ga0495644_0011953	3300046523	Bacteria	3337
745	Ga0495644_0013449	3300046523	Bacteria	3139
746	Ga0495644_0107453	3300046523	Bacteria	1058
747	Ga0495648_0001399	3300046524	Bacteria	23701
748	Ga0495648_0001400	3300046524	Bacteria	23699
749	Ga0495648_0002582	3300046524	Bacteria	16589
750	Ga0495648_0004043	3300046524	Bacteria	12662
751	Ga0495648_0005266	3300046524	Bacteria	10800
752	Ga0495648_0007113	3300046524	Bacteria	9007
753	Ga0495648_0008111	3300046524	Bacteria	8298
754	Ga0495648_0009411	3300046524	Bacteria	7579
755	Ga0495648_0018873	3300046524	Bacteria	4866
756	Ga0495648_0029634	3300046524	Bacteria	3630
757	Ga0495648_0081481	3300046524	Bacteria	1840
758	Ga0495648_0086973	3300046524	Bacteria	1761
759	Ga0495648_0097528	3300046524	Bacteria	1630
760	Ga0495648_0097842	3300046524	Bacteria	1626
761	Ga0495666_0001680	3300046526	Bacteria	10925
762	Ga0495666_0044267	3300046526	Bacteria	2149
763	Ga0495642_0000266	3300046528	Bacteria	29529
764	Ga0495642_0001492	3300046528	Bacteria	10445
765	Ga0495652_0049798	3300046529	Bacteria	3584
766	Ga0495652_0068451	3300046529	Bacteria	2974
767	Ga0495654_0002156	3300046530	Bacteria	12824
768	Ga0495654_0002353	3300046530	Bacteria	12215
769	Ga0495654_0003548	3300046530	Bacteria	9511
770	Ga0495654_0004664	3300046530	Bacteria	8084
771	Ga0495654_0004669	3300046530	Bacteria	8079
772	Ga0495654_0004858	3300046530	Bacteria	7915
773	Ga0495654_0008678	3300046530	Bacteria	5602
774	Ga0495654_0015669	3300046530	Bacteria	4023
775	Ga0495654_0018367	3300046530	Bacteria	3665
776	Ga0495654_0019267	3300046530	Bacteria	3570
777	Ga0495654_0022305	3300046530	Bacteria	3289
778	Ga0495654_0023606	3300046530	Bacteria	3184
779	Ga0495654_0027328	3300046530	Bacteria	2927
780	Ga0495654_0030165	3300046530	Bacteria	2760
781	Ga0495654_0036053	3300046530	Bacteria	2487
782	Ga0495654_0056787	3300046530	Bacteria	1891
783	Ga0495654_0056814	3300046530	Bacteria	1891
784	Ga0495654_0119556	3300046530	Bacteria	1194
785	Ga0495665_0002039	3300046531	Bacteria	10936
786	Ga0495640_0017385	3300046533	Bacteria	5362
787	Ga0495586_0003234	3300046535	Bacteria	8753
788	Ga0495587_0002198	3300046536	Bacteria	13040
789	Ga0495587_0003138	3300046536	Bacteria	11047
790	Ga0495587_0097658	3300046536	Bacteria	1693
791	Ga0495609_0000018	3300046538	Bacteria	302609
792	Ga0495609_0000089	3300046538	Bacteria	107029
793	Ga0495609_0000161	3300046538	Bacteria	69842
794	Ga0495609_0001507	3300046538	Bacteria	15353
795	Ga0495609_0002962	3300046538	Bacteria	10044
796	Ga0495609_0004045	3300046538	Bacteria	8180
797	Ga0495609_0005970	3300046538	Bacteria	6293
798	Ga0495609_0015645	3300046538	Bacteria	3548
799	Ga0495609_0022644	3300046538	Bacteria	2894
800	Ga0495609_0031445	3300046538	Bacteria	2412
801	Ga0495609_0050103	3300046538	Bacteria	1862
802	Ga0495597_0000026	3300046542	Bacteria	139551
803	Ga0495597_0000450	3300046542	Bacteria	35268
804	Ga0495597_0003744	3300046542	Bacteria	8673
805	Ga0495597_0023840	3300046542	Bacteria	2828
806	Ga0495597_0024352	3300046542	Bacteria	2795
807	Ga0495597_0032304	3300046542	Bacteria	2376
808	Ga0495597_0033502	3300046542	Bacteria	2325
809	Ga0495597_0055286	3300046542	Bacteria	1741
810	Ga0495597_0062982	3300046542	Bacteria	1612
811	Ga0495597_0080601	3300046542	Bacteria	1392
812	Ga0495645_0048844	3300046543	Bacteria	3081
813	Ga0495645_0184199	3300046543	Bacteria	1428
814	Ga0495622_0000572	3300046557	Bacteria	22065
815	Ga0495622_0000585	3300046557	Bacteria	21467
816	Ga0495622_0004628	3300046557	Bacteria	6371
817	Ga0495622_0021670	3300046557	Bacteria	2991
818	Ga0495622_0061708	3300046557	Bacteria	1735
819	Ga0495622_0094731	3300046557	Bacteria	1370
820	Ga0495633_0000062	3300046558	Bacteria	142101
821	Ga0495633_0001293	3300046558	Bacteria	19785
822	Ga0495633_0014096	3300046558	Bacteria	4190
823	Ga0495633_0028755	3300046558	Bacteria	2706
824	Ga0495633_0058601	3300046558	Bacteria	1807
825	Ga0495633_0136367	3300046558	Bacteria	1135
826	Ga0495667_0009083	3300046559	Bacteria	6752
827	Ga0495656_0001543	3300046615	Bacteria	7527
828	Ga0495656_0093794	3300046615	Bacteria	1377
829	Ga0495668_0001154	3300046616	Bacteria	26997
830	Ga0495668_0010735	3300046616	Bacteria	5530
831	Ga0495668_0017093	3300046616	Bacteria	4213
832	Ga0495668_0069639	3300046616	Bacteria	1934
833	Ga0495668_0119799	3300046616	Bacteria	1439
834	Ga0495668_0133758	3300046616	Bacteria	1357
835	Ga0495634_0000185	3300046642	Bacteria	57480
836	Ga0495634_0011635	3300046642	Bacteria	6401
837	Ga0495634_0050087	3300046642	Bacteria	2807
838	Ga0495634_0131353	3300046642	Bacteria	1596
839	Ga0495634_0167399	3300046642	Bacteria	1383
840	Ga0495611_0001707	3300046648	Bacteria	10664
841	Ga0495611_0002957	3300046648	Bacteria	7577
842	Ga0495611_0044049	3300046648	Bacteria	1995
843	Ga0495611_0109178	3300046648	Bacteria	1287
844	Ga0495625_0000194	3300046660	Bacteria	96964
845	Ga0495625_0001131	3300046660	Bacteria	34499
846	Ga0495625_0006553	3300046660	Bacteria	10338
847	Ga0495625_0007579	3300046660	Bacteria	9424
848	Ga0495625_0033683	3300046660	Bacteria	3785
849	Ga0495625_0033955	3300046660	Bacteria	3767
850	Ga0495625_0066780	3300046660	Bacteria	2533
851	Ga0495625_0092520	3300046660	Bacteria	2089
852	Ga0495625_0108174	3300046660	Bacteria	1902
853	Ga0495625_0128231	3300046660	Bacteria	1720
854	Ga0495625_0167870	3300046660	Bacteria	1466
855	Ga0495635_0000596	3300046663	Bacteria	23274
856	Ga0495635_0015817	3300046663	Bacteria	5270
857	Ga0495635_0019967	3300046663	Bacteria	4668
858	Ga0495659_0000153	3300046664	Bacteria	30457
859	Ga0495659_0007174	3300046664	Bacteria	3529
860	Ga0495661_0000016	3300046665	Bacteria	213593
861	Ga0495661_0000115	3300046665	Bacteria	95492
862	Ga0495661_0000233	3300046665	Bacteria	64169
863	Ga0495661_0009333	3300046665	Bacteria	6733
864	Ga0495661_0009792	3300046665	Bacteria	6559
865	Ga0495661_0014699	3300046665	Bacteria	5241
866	Ga0495661_0018665	3300046665	Bacteria	4555
867	Ga0495661_0041493	3300046665	Bacteria	2846
868	Ga0495661_0047613	3300046665	Bacteria	2609
869	Ga0495661_0051451	3300046665	Bacteria	2487
870	Ga0495661_0064284	3300046665	Bacteria	2166
871	Ga0495661_0081585	3300046665	Bacteria	1863
872	Ga0495661_0106470	3300046665	Bacteria	1569
873	Ga0495661_0107427	3300046665	Bacteria	1560
874	Ga0495588_0000332	3300046674	Bacteria	31035
875	Ga0495588_0045111	3300046674	Bacteria	2259
876	Ga0495588_0084267	3300046674	Bacteria	1661
877	Ga0495657_0078064	3300046675	Bacteria	2147
878	Ga0495657_0127283	3300046675	Bacteria	1599
879	Ga0495599_0032754	3300046678	Bacteria	3263
880	Ga0495623_0001387	3300046679	Bacteria	16447
881	Ga0495623_0016837	3300046679	Bacteria	4721
882	Ga0495623_0084013	3300046679	Bacteria	1965
883	Ga0495646_0006936	3300046680	Bacteria	7189
884	Ga0495646_0084552	3300046680	Bacteria	1842
885	Ga0495646_0107485	3300046680	Bacteria	1591
886	Ga0495658_0002194	3300046683	Bacteria	9879
887	Ga0495669_0004547	3300046684	Bacteria	5739
888	Ga0495613_0000618	3300046689	Bacteria	28357
889	Ga0495613_0004997	3300046689	Bacteria	9960
890	Ga0495613_0028408	3300046689	Bacteria	4159
891	Ga0495613_0103787	3300046689	Bacteria	2052
892	Ga0495613_0132213	3300046689	Bacteria	1787
893	Ga0495624_0000545	3300046690	Bacteria	29452
894	Ga0495624_0002524	3300046690	Bacteria	13845
895	Ga0495670_0001158	3300046691	Bacteria	12822
896	Ga0495670_0001183	3300046691	Bacteria	12658
897	Ga0495670_0002586	3300046691	Bacteria	8941
898	Ga0495670_0008168	3300046691	Bacteria	5146
899	Ga0495670_0014622	3300046691	Bacteria	3859
900	Ga0495670_0022446	3300046691	Bacteria	3115
901	Ga0495670_0120822	3300046691	Bacteria	1360
902	Ga0495671_0000336	3300046692	Bacteria	39246
903	Ga0495671_0001377	3300046692	Bacteria	16495
904	Ga0495671_0003558	3300046692	Bacteria	9519
905	Ga0495671_0011625	3300046692	Bacteria	4833
906	Ga0495671_0018340	3300046692	Bacteria	3715
907	Ga0495671_0019377	3300046692	Bacteria	3599
908	Ga0495671_0028125	3300046692	Bacteria	2898
909	Ga0495671_0032365	3300046692	Bacteria	2669
910	Ga0495671_0034800	3300046692	Bacteria	2559
911	Ga0495671_0037758	3300046692	Bacteria	2441
912	Ga0495671_0042966	3300046692	Bacteria	2269
913	Ga0495671_0054790	3300046692	Bacteria	1976
914	Ga0495671_0063781	3300046692	Bacteria	1814
915	Ga0495649_0001934	3300046694	Bacteria	15091
916	Ga0495649_0003160	3300046694	Bacteria	11257
917	Ga0495649_0004607	3300046694	Bacteria	8968
918	Ga0495649_0005075	3300046694	Bacteria	8456
919	Ga0495649_0016081	3300046694	Bacteria	4246
920	Ga0495649_0017584	3300046694	Bacteria	4032
921	Ga0495649_0020553	3300046694	Bacteria	3702
922	Ga0495649_0034486	3300046694	Bacteria	2784
923	Ga0495649_0050820	3300046694	Bacteria	2248
924	Ga0495649_0054409	3300046694	Bacteria	2164
925	Ga0495649_0057211	3300046694	Bacteria	2103
926	Ga0495649_0067717	3300046694	Bacteria	1915
927	Ga0495649_0112028	3300046694	Bacteria	1446
928	Ga0495649_0205567	3300046694	Bacteria	1021
929	Ga0495589_0001485	3300046794	Bacteria	13486
930	Ga0495589_0002188	3300046794	Bacteria	10992
931	Ga0495589_0002334	3300046794	Bacteria	10665
932	Ga0495589_0003113	3300046794	Bacteria	9077
933	Ga0495589_0008233	3300046794	Bacteria	5447
934	Ga0495589_0048920	3300046794	Bacteria	2092
935	Ga0495589_0058205	3300046794	Bacteria	1900
936	Ga0495589_0058747	3300046794	Bacteria	1891
937	Ga0495589_0083614	3300046794	Bacteria	1552
938	Ga0495600_0058372	3300046809	Bacteria	2521
939	Ga0495600_0082079	3300046809	Bacteria	2103
940	Ga0495600_0259674	3300046809	Bacteria	1103
941	Ga0495660_0000540	3300046810	Bacteria	30975
942	Ga0495660_0001212	3300046810	Bacteria	18042
943	Ga0495660_0001791	3300046810	Bacteria	14180
944	Ga0495660_0002416	3300046810	Bacteria	11907
945	Ga0495660_0003334	3300046810	Bacteria	9962
946	Ga0495660_0004771	3300046810	Bacteria	8186
947	Ga0495660_0011701	3300046810	Bacteria	5090
948	Ga0495660_0015075	3300046810	Bacteria	4469
949	Ga0495660_0016303	3300046810	Bacteria	4285
950	Ga0495660_0016509	3300046810	Bacteria	4256
951	Ga0495660_0020736	3300046810	Bacteria	3767
952	Ga0495660_0036950	3300046810	Bacteria	2722
953	Ga0495660_0049237	3300046810	Bacteria	2301
954	Ga0495660_0056937	3300046810	Bacteria	2110
955	Ga0495660_0064392	3300046810	Bacteria	1959
956	Ga0495660_0093128	3300046810	Bacteria	1562
957	Ga0495660_0104633	3300046810	Bacteria	1452
958	Ga0495660_0111976	3300046810	Bacteria	1391
959	Ga0495660_0121857	3300046810	Bacteria	1318
960	Ga0495660_0144418	3300046810	Bacteria	1180
961	Ga0495581_0000478	3300047315	Bacteria	20395
962	Ga0495581_0187298	3300047315	Bacteria	1210
963	Ga0495604_0028990	3300047317	Bacteria	4403
964	Ga0495604_0029718	3300047317	Bacteria	4347
965	Ga0495604_0050095	3300047317	Bacteria	3243
966	Ga0495604_0155797	3300047317	Bacteria	1618
967	Ga0495604_0225927	3300047317	Bacteria	1286
968	Ga0495636_0019750	3300047318	Bacteria	2710
969	Ga0495674_0002388	3300047319	Bacteria	18371
970	Ga0495674_0037309	3300047319	Bacteria	4367
971	Ga0495674_0042160	3300047319	Bacteria	4072
972	Ga0495672_0001008	3300047320	Bacteria	29092
973	Ga0495672_0007185	3300047320	Bacteria	8415
974	Ga0495672_0009359	3300047320	Bacteria	7107
975	Ga0495672_0013087	3300047320	Bacteria	5741
976	Ga0495672_0020811	3300047320	Bacteria	4290
977	Ga0495672_0023220	3300047320	Bacteria	4019
978	Ga0495672_0030873	3300047320	Bacteria	3352
979	Ga0495672_0042221	3300047320	Bacteria	2751
980	Ga0495672_0043403	3300047320	Bacteria	2704
981	Ga0495672_0051953	3300047320	Bacteria	2410
982	Ga0495672_0061160	3300047320	Bacteria	2172
983	Ga0495672_0061999	3300047320	Bacteria	2153
984	Ga0495672_0062194	3300047320	Bacteria	2148
985	Ga0495672_0122588	3300047320	Bacteria	1379
986	Ga0495676_0000052	3300047321	Bacteria	97049
987	Ga0495676_0001540	3300047321	Bacteria	19962
988	Ga0495676_0011505	3300047321	Bacteria	7980
989	Ga0495676_0033322	3300047321	Bacteria	4340
990	Ga0495676_0068030	3300047321	Bacteria	2753
991	Ga0495680_0001796	3300047322	Bacteria	22697
992	Ga0495680_0014046	3300047322	Bacteria	6957
993	Ga0495680_0014916	3300047322	Bacteria	6716
994	Ga0495680_0021128	3300047322	Bacteria	5455
995	Ga0495680_0050466	3300047322	Bacteria	3253
996	Ga0495680_0293275	3300047322	Bacteria	1143
997	Ga0495683_0000137	3300047323	Bacteria	71500
998	Ga0495683_0000404	3300047323	Bacteria	34663
999	Ga0495683_0000405	3300047323	Bacteria	34581
1000	Ga0495683_0003719	3300047323	Bacteria	8825
1001	Ga0495683_0009294	3300047323	Bacteria	5237
1002	Ga0495683_0021554	3300047323	Bacteria	3320
1003	Ga0495683_0045419	3300047323	Bacteria	2207
1004	Ga0495683_0050251	3300047323	Bacteria	2087
1005	Ga0495683_0063146	3300047323	Bacteria	1830
1006	Ga0495683_0065787	3300047323	Bacteria	1787
1007	Ga0495683_0072042	3300047323	Bacteria	1695
1008	Ga0495687_004603	3300047443	Bacteria	9220
1009	Ga0495687_036488	3300047443	Bacteria	2199
1010	Ga0495687_041371	3300047443	Bacteria	2022
1011	Ga0495675_0023388	3300047444	Bacteria	3936
1012	Ga0495675_0083259	3300047444	Bacteria	2013
1013	Ga0495677_0000491	3300047445	Bacteria	16791
1014	Ga0495679_000136	3300047446	Bacteria	65848
1015	Ga0495679_000368	3300047446	Bacteria	34941
1016	Ga0495679_010290	3300047446	Bacteria	3679
1017	Ga0495679_012306	3300047446	Bacteria	3261
1018	Ga0495679_014360	3300047446	Bacteria	2937
1019	Ga0495679_019569	3300047446	Bacteria	2375
1020	Ga0495673_0000487	3300047469	Bacteria	42373
1021	Ga0495673_0000598	3300047469	Bacteria	36127
1022	Ga0495673_0000630	3300047469	Bacteria	34694
1023	Ga0495673_0000858	3300047469	Bacteria	28212
1024	Ga0495673_0002165	3300047469	Bacteria	14269
1025	Ga0495673_0002217	3300047469	Bacteria	13982
1026	Ga0495673_0003174	3300047469	Bacteria	10985
1027	Ga0495673_0011346	3300047469	Bacteria	4797
1028	Ga0495673_0014248	3300047469	Bacteria	4139
1029	Ga0495673_0017963	3300047469	Bacteria	3577
1030	Ga0495673_0019827	3300047469	Bacteria	3362
1031	Ga0495673_0023994	3300047469	Bacteria	2955
1032	Ga0495673_0024704	3300047469	Bacteria	2896
1033	Ga0495673_0057258	3300047469	Bacteria	1683
1034	Ga0495673_0062817	3300047469	Bacteria	1585
1035	Ga0495673_0102535	3300047469	Bacteria	1154
1036	Ga0495681_0001488	3300047470	Bacteria	17507
1037	Ga0495681_0001494	3300047470	Bacteria	17464
1038	Ga0495681_0002011	3300047470	Bacteria	14862
1039	Ga0495681_0004112	3300047470	Bacteria	10002
1040	Ga0495681_0004409	3300047470	Bacteria	9611
1041	Ga0495681_0005030	3300047470	Bacteria	8912
1042	Ga0495681_0005854	3300047470	Bacteria	8165
1043	Ga0495681_0008004	3300047470	Bacteria	6671
1044	Ga0495681_0011714	3300047470	Bacteria	5199
1045	Ga0495681_0012841	3300047470	Bacteria	4897
1046	Ga0495681_0014402	3300047470	Bacteria	4534
1047	Ga0495681_0014427	3300047470	Bacteria	4527
1048	Ga0495681_0014790	3300047470	Bacteria	4452
1049	Ga0495681_0016828	3300047470	Bacteria	4080
1050	Ga0495681_0019914	3300047470	Bacteria	3649
1051	Ga0495681_0020954	3300047470	Bacteria	3533
1052	Ga0495681_0035744	3300047470	Bacteria	2464
1053	Ga0495681_0043972	3300047470	Bacteria	2150
1054	Ga0495681_0101470	3300047470	Bacteria	1257
1055	Ga0495684_0006886	3300047471	Bacteria	8827
1056	Ga0495684_0011021	3300047471	Bacteria	6991
1057	Ga0495684_0108031	3300047471	Bacteria	2101
1058	Ga0495686_0001398	3300047472	Bacteria	26701
1059	Ga0495686_0004777	3300047472	Bacteria	10952
1060	Ga0495686_0013097	3300047472	Bacteria	5773
1061	Ga0495686_0051787	3300047472	Bacteria	2576
1062	Ga0495686_0062333	3300047472	Bacteria	2313
1063	Ga0495593_0005579	3300047673	Bacteria	7432
1064	Ga0495593_0007312	3300047673	Bacteria	6470
1065	Ga0495593_0023450	3300047673	Bacteria	3430
1066	Ga0495593_0114204	3300047673	Bacteria	1377
1067	Ga0495602_0072840	3300048088	Bacteria	2927
1068	Ga0495602_0117762	3300048088	Bacteria	2143
1069	Ga0495626_0000126	3300048091	Bacteria	99054
1070	Ga0495626_0000898	3300048091	Bacteria	26374
1071	Ga0495626_0001022	3300048091	Bacteria	24045
1072	Ga0495626_0001131	3300048091	Bacteria	22336
1073	Ga0495626_0004273	3300048091	Bacteria	8815
1074	Ga0495626_0007133	3300048091	Bacteria	6255
1075	Ga0495626_0007411	3300048091	Bacteria	6112
1076	Ga0495626_0023186	3300048091	Bacteria	3059
1077	Ga0495626_0025509	3300048091	Bacteria	2889
1078	Ga0495626_0053358	3300048091	Bacteria	1861
1079	Ga0495626_0096152	3300048091	Bacteria	1296
1080	Ga0495626_0145040	3300048091	Bacteria	1004
1081	Ga0496100_0029499	3300048903	Bacteria	3394
1082	Ga0496100_0057091	3300048903	Bacteria	2556
1083	Ga0496101_0216478	3300048904	Unclassified	1485
1084	Ga0496102_0000763	3300048905	Bacteria	31332
1085	Ga0496102_0004886	3300048905	Bacteria	11348
1086	Ga0496103_0000922	3300048906	Bacteria	21101
1087	Ga0496103_0007615	3300048906	Bacteria	6444
1088	Ga0496103_0218552	3300048906	Bacteria	1226
1089	Ga0496104_0048584	3300048907	Bacteria	4000
1090	Ga0496104_0056484	3300048907	Bacteria	3712
1091	Ga0496104_0236303	3300048907	Unclassified	1739
1092	Ga0496105_0024382	3300048908	Bacteria	4914
1093	Ga0496105_0047762	3300048908	Bacteria	3533
1094	Ga0496105_0158845	3300048908	Bacteria	1856
1095	Ga0496105_0364728	3300048908	Bacteria	1152
1096	Ga0496107_0022297	3300048910	Bacteria	4476
1097	Ga0496109_0068916	3300048912	Bacteria	3243
1098	Ga0496109_0156700	3300048912	Bacteria	2133
1099	Ga0496110_0120031	3300048913	Unclassified	2368
1100	Ga0496110_0132645	3300048913	Bacteria	2250
1101	Ga0496110_0134625	3300048913	Bacteria	2233
1102	Ga0496110_0206313	3300048913	Bacteria	1786
1103	Ga0496110_0264895	3300048913	Bacteria	1564
1104	Ga0496114_0006009	3300048917	Bacteria	9551
1105	Ga0496114_0015681	3300048917	Bacteria	6097
1106	Ga0496114_0017826	3300048917	Bacteria	5739
1107	Ga0496114_0021856	3300048917	Bacteria	5208
1108	Ga0496115_0056691	3300048918	Bacteria	3149
1109	Ga0496115_0093131	3300048918	Bacteria	2464
1110	Ga0496116_0000038	3300048919	Bacteria	370217
1111	Ga0496116_0000488	3300048919	Bacteria	54504
1112	Ga0496116_0001579	3300048919	Bacteria	25081
1113	Ga0496116_0002262	3300048919	Bacteria	20416
1114	Ga0496116_0002272	3300048919	Bacteria	20373
1115	Ga0496116_0041202	3300048919	Bacteria	3171
1116	Ga0496116_0072929	3300048919	Bacteria	2167
1117	Ga0496116_0115501	3300048919	Bacteria	1566
1118	Ga0496116_0127135	3300048919	Bacteria	1461
1119	Ga0496116_0127381	3300048919	Bacteria	1459
1120	Ga0496117_0001488	3300048920	Bacteria	33593
1121	Ga0496117_0003877	3300048920	Bacteria	16991
1122	Ga0496117_0003907	3300048920	Bacteria	16881
1123	Ga0496117_0003918	3300048920	Bacteria	16855
1124	Ga0496117_0004300	3300048920	Bacteria	15859
1125	Ga0496117_0007130	3300048920	Bacteria	11045
1126	Ga0496117_0007696	3300048920	Bacteria	10431
1127	Ga0496117_0031668	3300048920	Bacteria	4033
1128	Ga0496117_0032142	3300048920	Bacteria	3993
1129	Ga0496117_0077541	3300048920	Bacteria	2199
1130	Ga0496118_0002215	3300048921	Bacteria	26938
1131	Ga0496118_0003760	3300048921	Bacteria	18753
1132	Ga0496118_0004272	3300048921	Bacteria	17091
1133	Ga0496118_0019679	3300048921	Bacteria	6024
1134	Ga0496118_0021406	3300048921	Bacteria	5692
1135	Ga0496118_0022135	3300048921	Bacteria	5568
1136	Ga0496118_0034789	3300048921	Bacteria	4104
1137	Ga0496118_0040147	3300048921	Bacteria	3724
1138	Ga0496118_0085792	3300048921	Bacteria	2190
1139	Ga0496118_0150230	3300048921	Bacteria	1459
1140	Ga0496119_0000220	3300048922	Bacteria	81054
1141	Ga0496119_0003087	3300048922	Bacteria	17570
1142	Ga0496119_0128542	3300048922	Bacteria	1383
1143	Ga0496120_0001623	3300048923	Bacteria	26107
1144	Ga0496120_0008468	3300048923	Bacteria	7462
1145	Ga0496120_0053512	3300048923	Bacteria	2293
1146	Ga0496121_0000592	3300048924	Bacteria	68016
1147	Ga0496121_0000867	3300048924	Bacteria	54641
1148	Ga0496121_0002170	3300048924	Bacteria	30723
1149	Ga0496121_0003270	3300048924	Bacteria	23272
1150	Ga0496121_0006946	3300048924	Bacteria	13794
1151	Ga0496121_0007558	3300048924	Bacteria	13098
1152	Ga0496121_0023619	3300048924	Bacteria	5913
1153	Ga0496121_0038598	3300048924	Bacteria	4223
1154	Ga0496121_0058104	3300048924	Bacteria	3201
1155	Ga0496121_0106211	3300048924	Bacteria	2152
1156	Ga0496121_0253137	3300048924	Bacteria	1220
1157	Ga0496122_0000434	3300048925	Bacteria	87536
1158	Ga0496122_0002298	3300048925	Bacteria	27613
1159	Ga0496122_0002929	3300048925	Bacteria	23272
1160	Ga0496122_0005011	3300048925	Bacteria	16021
1161	Ga0496122_0008822	3300048925	Bacteria	10766
1162	Ga0496122_0020676	3300048925	Bacteria	5931
1163	Ga0496122_0034709	3300048925	Bacteria	4121
1164	Ga0496122_0134906	3300048925	Bacteria	1558
1165	Ga0496123_0000318	3300048926	Bacteria	91911
1166	Ga0496123_0001247	3300048926	Bacteria	36848
1167	Ga0496123_0002268	3300048926	Bacteria	24237
1168	Ga0496123_0002436	3300048926	Bacteria	23120
1169	Ga0496123_0003514	3300048926	Bacteria	17459
1170	Ga0496123_0006054	3300048926	Bacteria	11877
1171	Ga0496123_0019029	3300048926	Bacteria	5425
1172	Ga0496123_0059408	3300048926	Bacteria	2472
1173	Ga0496123_0107032	3300048926	Bacteria	1609
1174	Ga0496123_0153463	3300048926	Bacteria	1239
1175	Ga0496123_0207078	3300048926	Bacteria	1000
1176	Ga0496124_0000471	3300048927	Bacteria	69533
1177	Ga0496124_0000942	3300048927	Bacteria	46610
1178	Ga0496124_0004244	3300048927	Bacteria	16864
1179	Ga0496124_0004692	3300048927	Bacteria	15793
1180	Ga0496124_0005898	3300048927	Bacteria	13552
1181	Ga0496124_0006570	3300048927	Bacteria	12637
1182	Ga0496124_0011619	3300048927	Bacteria	8787
1183	Ga0496124_0014385	3300048927	Bacteria	7651
1184	Ga0496124_0016110	3300048927	Bacteria	7130
1185	Ga0496124_0028084	3300048927	Bacteria	5036
1186	Ga0496124_0066808	3300048927	Bacteria	2993
1187	Ga0496124_0078801	3300048927	Bacteria	2714
1188	Ga0496124_0111542	3300048927	Bacteria	2200
1189	Ga0496124_0212017	3300048927	Bacteria	1464
1190	Ga0496124_0216433	3300048927	Bacteria	1444
1191	Ga0496124_0278934	3300048927	Bacteria	1219
1192	Ga0496124_0324357	3300048927	Bacteria	1101
1193	Ga0496125_0002917	3300048928	Bacteria	21513
1194	Ga0496125_0004780	3300048928	Bacteria	15422
1195	Ga0496125_0009627	3300048928	Bacteria	9880
1196	Ga0496125_0013029	3300048928	Bacteria	8206
1197	Ga0496125_0013553	3300048928	Bacteria	8009
1198	Ga0496125_0032717	3300048928	Bacteria	4615
1199	Ga0496125_0062313	3300048928	Bacteria	2983
1200	Ga0496125_0083318	3300048928	Bacteria	2433
1201	Ga0496125_0087632	3300048928	Bacteria	2350
1202	Ga0496125_0100460	3300048928	Bacteria	2132
1203	Ga0496125_0116206	3300048928	Bacteria	1922
1204	Ga0496125_0154703	3300048928	Bacteria	1568
1205	Ga0496125_0157548	3300048928	Bacteria	1548
1206	Ga0496126_0018460	3300048929	Bacteria	6911
1207	Ga0496126_0078699	3300048929	Bacteria	2920
1208	Ga0496126_0133969	3300048929	Bacteria	2139
1209	Ga0496126_0136923	3300048929	Bacteria	2111
1210	Ga0495678_000021	3300049459	Bacteria	239150
1211	Ga0495678_000169	3300049459	Bacteria	76063
1212	Ga0495678_002042	3300049459	Bacteria	14448
1213	Ga0495678_003645	3300049459	Bacteria	9357
1214	Ga0495678_005129	3300049459	Bacteria	7352
1215	Ga0495678_012262	3300049459	Bacteria	4068
1216	Ga0495678_012904	3300049459	Bacteria	3940
1217	Ga0495678_014590	3300049459	Bacteria	3649
1218	Ga0495678_021234	3300049459	Bacteria	2862
1219	Ga0495678_023289	3300049459	Bacteria	2695
1220	Ga0495678_035109	3300049459	Bacteria	2058
1221	Ga0495678_041062	3300049459	Bacteria	1854
1222	Ga0495678_072604	3300049459	Bacteria	1257
1223	Ga0495678_077705	3300049459	Bacteria	1199
1224	Ga0495682_0000597	3300049460	Bacteria	24443
1225	Ga0495682_0000914	3300049460	Bacteria	18025
1226	Ga0495682_0005934	3300049460	Bacteria	5005
1227	Ga0495682_0010026	3300049460	Bacteria	3682
1228	Ga0495682_0037452	3300049460	Bacteria	1785
1229	Ga0495682_0044702	3300049460	Bacteria	1620
1230	Ga0495682_0084471	3300049460	Bacteria	1141
1231	Ga0501032_0003203	3300049569	Bacteria	12587
1232	Ga0501034_0000214	3300049571	Bacteria	110247
1233	Ga0501034_0275061	3300049571	Bacteria	1624
1234	Ga0501226_000004	3300049853	Bacteria	284656
1235	nmdc:mga00v17_170475_c1	3300050491	Bacteria	1403
1236	nmdc:mga00v17_33145_c1	3300050491	Bacteria	1430
1237	Ga0495619_0002232	3300053085	Bacteria	12806
1238	Ga0495619_0003103	3300053085	Bacteria	10782
1239	Ga0500572_007525	3300053111	Bacteria	2524
1240	Ga0500659_0002191	3300053135	Bacteria	11865
1241	Ga0500568_0009162	3300053139	Bacteria	4721
1242	Ga0500573_0008058	3300053140	Bacteria	5790
1243	Ga0500634_0040604	3300053161	Bacteria	2528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046694	Ga0495649_0112028	Ga0495649_0112028_11_706	231
2	3300048907	Ga0496104_0236303	Ga0496104_0236303_929_1720	233
3	3300048908	Ga0496105_0158845	Ga0496105_0158845_1032_1823	233
4	3300046460	Ga0495638_0257357	Ga0495638_0257357_101_943	280
5	3300046501	Ga0495607_0049107	Ga0495607_0049107_1606_2448	280
6	3300048926	Ga0496123_0153463	Ga0496123_0153463_383_1225	280
7	3300048927	Ga0496124_0324357	Ga0496124_0324357_22_864	280
8	3300046518	Ga0495631_0169495	Ga0495631_0169495_14_859	281
9	3300048923	Ga0496120_0053512	Ga0496120_0053512_597_1532	285
10	iso_pu_bacteria	2917070673	2917073777	285
11	3300013308	Ga0157375_10216291	Ga0157375_102162912	286
12	3300013307	Ga0157372_10002218	Ga0157372_1000221814	287
13	3300046501	Ga0495607_0001384	Ga0495607_0001384_9758_10687	287
14	3300009036	Ga0105244_10022490	Ga0105244_100224902	288
15	3300013308	Ga0157375_10057479	Ga0157375_100574792	288
16	3300025728	Ga0207655_1001963	Ga0207655_10019632	288
17	3300048929	Ga0496126_0078699	Ga0496126_0078699_971_1906	288
18	3300005289	Ga0065704_10023831	Ga0065704_100238313	289
19	3300009011	Ga0105251_10003773	Ga0105251_100037732	289
20	3300025735	Ga0207713_1000763	Ga0207713_10007639	289
21	3300027907	Ga0207428_10141382	Ga0207428_101413822	289
22	3300031731	Ga0307405_10031514	Ga0307405_100315142	289
23	3300046512	Ga0495610_0025086	Ga0495610_0025086_992_1927	289
24	3300046530	Ga0495654_0030165	Ga0495654_0030165_1006_1941	289
25	3300047320	Ga0495672_0001008	Ga0495672_0001008_21699_22568	289
26	3300048924	Ga0496121_0000592	Ga0496121_0000592_44389_45264	289
27	3300048924	Ga0496121_0058104	Ga0496121_0058104_969_1904	289
28	3300048927	Ga0496124_0066808	Ga0496124_0066808_1801_2736	289
29	3300048918	Ga0496115_0093131	Ga0496115_0093131_1393_2322	290
30	3300013104	Ga0157370_10001150	Ga0157370_100011509	291
31	3300046519	Ga0495632_0017239	Ga0495632_0017239_1966_2904	291
32	3300047446	Ga0495679_012306	Ga0495679_012306_1165_2091	292
33	3300006914	Ga0075436_100228891	Ga0075436_1002288911	293
34	3300009092	Ga0105250_10001910	Ga0105250_100019109	293
35	3300017792	Ga0163161_10083337	Ga0163161_100833372	293
36	3300025292	Ga0209676_1008114	Ga0209676_10081142	293
37	3300025298	Ga0209050_1001281	Ga0209050_100128115	293
38	3300025711	Ga0207696_1000229	Ga0207696_100022942	293
39	3300027907	Ga0207428_10030007	Ga0207428_100300074	293
40	3300042013	Ga0439456_003540	Ga0439456_003540_1437_2366	293
41	3300042461	Ga0439460_0000418	Ga0439460_0000418_886_1815	293
42	3300047320	Ga0495672_0062194	Ga0495672_0062194_1003_1932	293
43	3300048920	Ga0496117_0077541	Ga0496117_0077541_991_1926	293
44	3300048921	Ga0496118_0085792	Ga0496118_0085792_982_1917	293
45	3300048928	Ga0496125_0100460	Ga0496125_0100460_201_1136	293
46	3300033180	Ga0307510_10067234	Ga0307510_100672344	294
47	3300046501	Ga0495607_0050375	Ga0495607_0050375_404_1333	294
48	3300046507	Ga0495606_0001608	Ga0495606_0001608_22569_23498	294
49	3300046648	Ga0495611_0001707	Ga0495611_0001707_1924_2853	294
50	3300047320	Ga0495672_0042221	Ga0495672_0042221_178_1107	294
51	3300047321	Ga0495676_0000052	Ga0495676_0000052_17438_18367	294
52	3300038443	Ga0395901_0249548	Ga0395901_0249548_362_1339	295
53	3300046453	Ga0495627_025483	Ga0495627_025483_932_1861	295
54	3300046454	Ga0495592_0197670	Ga0495592_0197670_202_1179	295
55	3300046458	Ga0495591_001278	Ga0495591_001278_72_1001	295
56	3300046458	Ga0495591_003927	Ga0495591_003927_4155_5084	295
57	3300046462	Ga0495651_0121748	Ga0495651_0121748_208_1185	295
58	3300046463	Ga0495653_0022282	Ga0495653_0022282_1156_2133	295
59	3300046471	Ga0495650_0000311	Ga0495650_0000311_75544_76473	295
60	3300046471	Ga0495650_0037463	Ga0495650_0037463_75_1004	295
61	3300046474	Ga0495605_0003914	Ga0495605_0003914_832_1761	295
62	3300046474	Ga0495605_0059755	Ga0495605_0059755_286_1215	295
63	3300046476	Ga0495662_0017909	Ga0495662_0017909_824_1801	295
64	3300046477	Ga0495664_0086572	Ga0495664_0086572_854_1831	295
65	3300046492	Ga0495585_0027893	Ga0495585_0027893_388_1317	295
66	3300046500	Ga0495596_0012084	Ga0495596_0012084_2195_3124	295
67	3300046501	Ga0495607_0000938	Ga0495607_0000938_832_1761	295
68	3300046506	Ga0495583_0000830	Ga0495583_0000830_19700_20629	295
69	3300046506	Ga0495583_0014605	Ga0495583_0014605_2620_3549	295
70	3300046506	Ga0495583_0035562	Ga0495583_0035562_78_1007	295
71	3300046512	Ga0495610_0038173	Ga0495610_0038173_491_1420	295
72	3300046512	Ga0495610_0051208	Ga0495610_0051208_14_943	295
73	3300046515	Ga0495620_0002619	Ga0495620_0002619_48_977	295
74	3300046519	Ga0495632_0001173	Ga0495632_0001173_19571_20500	295
75	3300046519	Ga0495632_0010733	Ga0495632_0010733_1801_2730	295
76	3300046520	Ga0495637_0000064	Ga0495637_0000064_76375_77304	295
77	3300046522	Ga0495643_0023347	Ga0495643_0023347_582_1511	295
78	3300046523	Ga0495644_0007142	Ga0495644_0007142_2811_3740	295
79	3300046529	Ga0495652_0049798	Ga0495652_0049798_2179_3156	295
80	3300046530	Ga0495654_0015669	Ga0495654_0015669_1475_2404	295
81	3300046533	Ga0495640_0017385	Ga0495640_0017385_3358_4335	295
82	3300046538	Ga0495609_0000161	Ga0495609_0000161_17274_18203	295
83	3300046543	Ga0495645_0048844	Ga0495645_0048844_376_1353	295
84	3300046642	Ga0495634_0131353	Ga0495634_0131353_30_1007	295
85	3300046660	Ga0495625_0000194	Ga0495625_0000194_78757_79686	295
86	3300046663	Ga0495635_0015817	Ga0495635_0015817_1311_2288	295
87	3300046665	Ga0495661_0000115	Ga0495661_0000115_17346_18275	295
88	3300046665	Ga0495661_0000233	Ga0495661_0000233_15127_16056	295
89	3300046675	Ga0495657_0127283	Ga0495657_0127283_173_1150	295
90	3300046678	Ga0495599_0032754	Ga0495599_0032754_1149_2126	295
91	3300046692	Ga0495671_0063781	Ga0495671_0063781_332_1261	295
92	3300046694	Ga0495649_0016081	Ga0495649_0016081_3029_3958	295
93	3300046809	Ga0495600_0058372	Ga0495600_0058372_686_1663	295
94	3300046810	Ga0495660_0001791	Ga0495660_0001791_9577_10506	295
95	3300047317	Ga0495604_0029718	Ga0495604_0029718_184_1161	295
96	3300047319	Ga0495674_0042160	Ga0495674_0042160_1716_2693	295
97	3300047322	Ga0495680_0014046	Ga0495680_0014046_2794_3771	295
98	3300047323	Ga0495683_0072042	Ga0495683_0072042_276_1205	295
99	3300047446	Ga0495679_000136	Ga0495679_000136_59139_60068	295
100	3300047470	Ga0495681_0001488	Ga0495681_0001488_9075_10004	295
101	3300047471	Ga0495684_0006886	Ga0495684_0006886_6464_7441	295
102	3300049459	Ga0495678_002042	Ga0495678_002042_12520_13449	295
103	3300049460	Ga0495682_0000914	Ga0495682_0000914_12209_13138	295
104	3300053085	Ga0495619_0003103	Ga0495619_0003103_5009_5986	295
105	3300046501	Ga0495607_0115465	Ga0495607_0115465_26_955	296
106	3300046665	Ga0495661_0009792	Ga0495661_0009792_1175_2104	296
107	3300048091	Ga0495626_0000126	Ga0495626_0000126_17307_18236	296
108	3300005467	Ga0070706_100319593	Ga0070706_1003195931	297
109	3300006175	Ga0070712_100249761	Ga0070712_1002497612	297
110	3300013308	Ga0157375_10099786	Ga0157375_100997863	297
111	3300014969	Ga0157376_10191835	Ga0157376_101918352	297
112	3300025906	Ga0207699_10087511	Ga0207699_100875112	297
113	3300025915	Ga0207693_10178541	Ga0207693_101785412	297
114	3300035116	Ga0373945_0026530	Ga0373945_0026530_283_1266	297
115	3300035170	Ga0373943_0000121	Ga0373943_0000121_16610_17593	297
116	3300035695	Ga0373927_0191516	Ga0373927_0191516_249_1232	297
117	3300035725	Ga0373947_0005724	Ga0373947_0005724_2156_3139	297
118	3300037068	Ga0373925_0000937	Ga0373925_0000937_18238_19221	297
119	3300037418	Ga0395900_0509408	Ga0395900_0509408_62_1036	297
120	3300037466	Ga0395898_0054707	Ga0395898_0054707_173_1147	297
121	3300037466	Ga0395898_0207010	Ga0395898_0207010_229_1212	297
122	3300037471	Ga0395905_0207949	Ga0395905_0207949_191_1174	297
123	3300041411	Ga0439466_0000291	Ga0439466_0000291_18322_19251	297
124	3300042009	Ga0439451_022118	Ga0439451_022118_314_1207	297
125	3300045976	Ga0466967_0210728	Ga0466967_0210728_535_1518	297
126	3300046455	Ga0495603_0014438	Ga0495603_0014438_1551_2534	297
127	3300046459	Ga0495629_0001138	Ga0495629_0001138_14991_15974	297
128	3300046460	Ga0495638_0128589	Ga0495638_0128589_385_1314	297
129	3300046461	Ga0495641_0016842	Ga0495641_0016842_684_1667	297
130	3300046473	Ga0495582_0000476	Ga0495582_0000476_2144_3127	297
131	3300046475	Ga0495639_0000472	Ga0495639_0000472_15810_16793	297
132	3300046517	Ga0495630_0017334	Ga0495630_0017334_353_1336	297
133	3300046524	Ga0495648_0086973	Ga0495648_0086973_383_1312	297
134	3300046526	Ga0495666_0001680	Ga0495666_0001680_9071_10054	297
135	3300046531	Ga0495665_0002039	Ga0495665_0002039_4002_4985	297
136	3300046542	Ga0495597_0080601	Ga0495597_0080601_447_1340	297
137	3300046559	Ga0495667_0009083	Ga0495667_0009083_983_1966	297
138	3300046675	Ga0495657_0078064	Ga0495657_0078064_121_1104	297
139	3300046683	Ga0495658_0002194	Ga0495658_0002194_3069_4052	297
140	3300046689	Ga0495613_0000618	Ga0495613_0000618_14001_14984	297
141	3300046690	Ga0495624_0002524	Ga0495624_0002524_3689_4672	297
142	3300046691	Ga0495670_0022446	Ga0495670_0022446_1443_2372	297
143	3300047315	Ga0495581_0000478	Ga0495581_0000478_5071_6054	297
144	3300047321	Ga0495676_0001540	Ga0495676_0001540_2485_3468	297
145	3300047322	Ga0495680_0001796	Ga0495680_0001796_20095_21078	297
146	3300047443	Ga0495687_004603	Ga0495687_004603_5661_6590	297
147	3300047471	Ga0495684_0011021	Ga0495684_0011021_4640_5623	297
148	3300048903	Ga0496100_0029499	Ga0496100_0029499_2120_3103	297
149	3300048903	Ga0496100_0057091	Ga0496100_0057091_1065_2048	297
150	3300048904	Ga0496101_0216478	Ga0496101_0216478_412_1395	297
151	3300048907	Ga0496104_0048584	Ga0496104_0048584_2748_3731	297
152	3300048907	Ga0496104_0056484	Ga0496104_0056484_962_1945	297
153	3300048908	Ga0496105_0024382	Ga0496105_0024382_3792_4775	297
154	3300048908	Ga0496105_0047762	Ga0496105_0047762_1260_2243	297
155	3300048910	Ga0496107_0022297	Ga0496107_0022297_3461_4444	297
156	3300048912	Ga0496109_0068916	Ga0496109_0068916_1158_2141	297
157	3300048912	Ga0496109_0156700	Ga0496109_0156700_1024_2007	297
158	3300048913	Ga0496110_0120031	Ga0496110_0120031_1245_2228	297
159	3300048917	Ga0496114_0015681	Ga0496114_0015681_415_1398	297
160	3300048917	Ga0496114_0021856	Ga0496114_0021856_158_1141	297
161	3300048918	Ga0496115_0056691	Ga0496115_0056691_1689_2672	297
162	3300053085	Ga0495619_0002232	Ga0495619_0002232_7032_8015	297
163	iso_pu_bacteria	2599185160	2599358118	299
164	iso_pu_bacteria	2599185164	2599383283	299
165	iso_pu_bacteria	2599185165	2599389730	299
166	iso_pu_bacteria	2599185181	2599464933	299
167	iso_pu_bacteria	2599185186	2599494152	299
168	iso_pu_bacteria	2599185356	2600217665	299
169	iso_pu_bacteria	2600255313	2601777832	299
170	3300005288	Ga0065714_10022318	Ga0065714_100223182	300
171	3300006051	Ga0075364_10178260	Ga0075364_101782602	300
172	3300013102	Ga0157371_10000897	Ga0157371_1000089710	300
173	3300025735	Ga0207713_1001277	Ga0207713_10012772	300
174	3300027907	Ga0207428_10136380	Ga0207428_101363802	300
175	3300041405	Ga0439438_003168	Ga0439438_003168_4539_5468	300
176	3300042010	Ga0439452_002271	Ga0439452_002271_5392_6321	300
177	3300042122	Ga0450920_000513	Ga0450920_000513_795_1724	300
178	3300042124	Ga0450922_000328	Ga0450922_000328_459_1388	300
179	3300042146	Ga0450907_007819	Ga0450907_007819_367_1296	300
180	3300042147	Ga0450910_001219	Ga0450910_001219_2046_2975	300
181	3300042184	Ga0450908_008892	Ga0450908_008892_757_1686	300
182	3300046474	Ga0495605_0018155	Ga0495605_0018155_2324_3253	300
183	3300046492	Ga0495585_0040916	Ga0495585_0040916_863_1792	300
184	3300046512	Ga0495610_0035330	Ga0495610_0035330_198_1127	300
185	3300046524	Ga0495648_0009411	Ga0495648_0009411_5840_6769	300
186	3300046557	Ga0495622_0061708	Ga0495622_0061708_506_1435	300
187	3300046674	Ga0495588_0045111	Ga0495588_0045111_1066_1995	300
188	3300047320	Ga0495672_0007185	Ga0495672_0007185_7254_8183	300
189	3300047443	Ga0495687_036488	Ga0495687_036488_682_1611	300
190	3300047470	Ga0495681_0020954	Ga0495681_0020954_1185_2114	300
191	3300048091	Ga0495626_0000898	Ga0495626_0000898_18154_19083	300
192	3300048927	Ga0496124_0078801	Ga0496124_0078801_288_1217	300
193	3300049460	Ga0495682_0044702	Ga0495682_0044702_240_1169	300
194	3300050491	nmdc:mga00v17_170475_c1	nmdc:mga00v17_170475_c1_356_1285	300
195	2124908027	MRS2a_Contig_1412	MRS2a_00302800	301
196	3300046506	Ga0495583_0006633	Ga0495583_0006633_6039_6968	301
197	3300046530	Ga0495654_0004858	Ga0495654_0004858_854_1783	301
198	3300046692	Ga0495671_0054790	Ga0495671_0054790_58_987	301
199	3300046694	Ga0495649_0004607	Ga0495649_0004607_7222_8151	301
200	3300047320	Ga0495672_0030873	Ga0495672_0030873_1571_2500	301
201	3300047469	Ga0495673_0011346	Ga0495673_0011346_1699_2628	301
202	3300048091	Ga0495626_0007411	Ga0495626_0007411_4380_5309	301
203	3300009011	Ga0105251_10007786	Ga0105251_100077862	302
204	3300025735	Ga0207713_1002936	Ga0207713_10029363	302
205	3300046457	Ga0495590_0010689	Ga0495590_0010689_2143_3072	302
206	3300046460	Ga0495638_0014289	Ga0495638_0014289_3692_4621	302
207	3300046692	Ga0495671_0018340	Ga0495671_0018340_865_1794	302
208	3300047323	Ga0495683_0009294	Ga0495683_0009294_861_1790	302
209	3300047469	Ga0495673_0014248	Ga0495673_0014248_954_1883	302
210	3300048913	Ga0496110_0132645	Ga0496110_0132645_949_1878	302
211	3300048927	Ga0496124_0000942	Ga0496124_0000942_42086_43015	302
212	3300013105	Ga0157369_10013723	Ga0157369_1001372310	303
213	3300048919	Ga0496116_0000038	Ga0496116_0000038_274162_275094	303
214	iso_pu_bacteria	2599185167	2599398803	303
215	iso_pu_bacteria	2599185179	2599450858	303
216	iso_pu_bacteria	2599185190	2599514197	303
217	iso_pu_bacteria	2599185191	2599518797	303
218	iso_pu_bacteria	2599185290	2599893468	303
219	iso_pu_bacteria	2834028612	2834032164	303
220	iso_pu_bacteria	2931390751	2931391428	303
221	iso_pu_bacteria	2945928738	2945930108	303
222	iso_pu_bacteria	8054285046	8054290957	303
223	iso_pu_bacteria	8055817908	8055818419	303
224	iso_pu_bacteria	8056161164	8056164401	303
225	iso_pu_bacteria	2511231018	2511338784	304
226	iso_pu_bacteria	2554235341	2555669957	304
227	iso_pu_bacteria	2599185160	2599353014	304
228	iso_pu_bacteria	2599185161	2599359355	304
229	iso_pu_bacteria	2599185162	2599365124	304
230	iso_pu_bacteria	2599185163	2599372049	304
231	iso_pu_bacteria	2599185164	2599378122	304
232	iso_pu_bacteria	2599185165	2599384501	304
233	iso_pu_bacteria	2599185166	2599390907	304
234	iso_pu_bacteria	2599185167	2599399053	304
235	iso_pu_bacteria	2599185168	2599403092	304
236	iso_pu_bacteria	2599185179	2599451065	304
237	iso_pu_bacteria	2599185181	2599459848	304
238	iso_pu_bacteria	2599185182	2599465817	304
239	iso_pu_bacteria	2599185186	2599488869	304
240	iso_pu_bacteria	2599185190	2599515259	304
241	iso_pu_bacteria	2599185191	2599518592	304
242	iso_pu_bacteria	2599185290	2599894791	304
243	iso_pu_bacteria	2599185356	2600212455	304
244	iso_pu_bacteria	2600255313	2601772623	304
245	iso_pu_bacteria	2643221565	2643843944	304
246	iso_pu_bacteria	2667528171	2671095412	304
247	iso_pu_bacteria	2728369097	2729145570	304
248	iso_pu_bacteria	2818991464	2819701111	304
249	iso_pu_bacteria	2860339153	2860343378	304
250	iso_pu_bacteria	2919456309	2919462149	304
251	iso_pu_bacteria	2931390751	2931391219	304
252	iso_pu_bacteria	2931396565	2931399160	304
253	iso_pu_bacteria	2935353572	2935357178	304
254	iso_pu_bacteria	2945928738	2945930316	304
255	iso_pu_bacteria	3007511990	3007512036	304
256	iso_pu_bacteria	637000220	637320310	304
257	iso_pu_bacteria	640427133	640486774	304
258	iso_pu_bacteria	651053060	651174624	304
259	iso_pu_bacteria	8056161164	8056164186	304
260	iso_pu_bacteria	8056177738	8056180908	304
261	iso_pu_bacteria	2511231004	2511253670	305
262	iso_pu_bacteria	2511231006	2511264635	305
263	iso_pu_bacteria	2511231007	2511269440	305
264	iso_pu_bacteria	2511231008	2511278754	305
265	iso_pu_bacteria	2511231010	2511290499	305
266	iso_pu_bacteria	2511231011	2511296689	305
267	iso_pu_bacteria	2511231012	2511299117	305
268	iso_pu_bacteria	2511231014	2511312735	305
269	iso_pu_bacteria	2511231015	2511320765	305
270	iso_pu_bacteria	2511231016	2511325903	305
271	iso_pu_bacteria	2511231017	2511331969	305
272	iso_pu_bacteria	2511231018	2511340799	305
273	iso_pu_bacteria	2511231019	2511346374	305
274	iso_pu_bacteria	2511231020	2511353038	305
275	iso_pu_bacteria	2511231021	2511359720	305
276	iso_pu_bacteria	2511231022	2511364638	305
277	iso_pu_bacteria	2511231023	2511369261	305
278	iso_pu_bacteria	2511231156	2511827248	305
279	iso_pu_bacteria	2512047018	2512327952	305
280	iso_pu_bacteria	2554235132	2554813211	305
281	iso_pu_bacteria	2582580891	2583794861	305
282	iso_pu_bacteria	2597489887	2597860495	305
283	iso_pu_bacteria	2599185155	2599329288	305
284	iso_pu_bacteria	2599185161	2599364481	305
285	iso_pu_bacteria	2599185162	2599370983	305
286	iso_pu_bacteria	2599185163	2599377005	305
287	iso_pu_bacteria	2599185166	2599396027	305
288	iso_pu_bacteria	2599185168	2599407867	305
289	iso_pu_bacteria	2599185182	2599471258	305
290	iso_pu_bacteria	2599185185	2599486653	305
291	iso_pu_bacteria	2599185188	2599504968	305
292	iso_pu_bacteria	2599185212	2599615573	305
293	iso_pu_bacteria	2599185248	2599773518	305
294	iso_pu_bacteria	2599185257	2599807212	305
295	iso_pu_bacteria	2599185289	2599889981	305
296	iso_pu_bacteria	2599185291	2599901704	305
297	iso_pu_bacteria	2599185300	2599930528	305
298	iso_pu_bacteria	2599185302	2599944938	305
299	iso_pu_bacteria	2599185304	2599955333	305
300	iso_pu_bacteria	2599185305	2599962845	305
301	iso_pu_bacteria	2599185306	2599967765	305
302	iso_pu_bacteria	2599185307	2599974032	305
303	iso_pu_bacteria	2599185308	2599978973	305
304	iso_pu_bacteria	2599185309	2599984065	305
305	iso_pu_bacteria	2599185310	2599990214	305
306	iso_pu_bacteria	2599185311	2599996893	305
307	iso_pu_bacteria	2599185312	2600001847	305
308	iso_pu_bacteria	2599185313	2600008938	305
309	iso_pu_bacteria	2599185314	2600012933	305
310	iso_pu_bacteria	2599185315	2600020784	305
311	iso_pu_bacteria	2599185316	2600025760	305
312	iso_pu_bacteria	2599185317	2600031062	305
313	iso_pu_bacteria	2599185318	2600038422	305
314	iso_pu_bacteria	2599185319	2600043754	305
315	iso_pu_bacteria	2599185320	2600048748	305
316	iso_pu_bacteria	2599185321	2600055564	305
317	iso_pu_bacteria	2599185322	2600062006	305
318	iso_pu_bacteria	2599185323	2600067247	305
319	iso_pu_bacteria	2599185324	2600073340	305
320	iso_pu_bacteria	2599185325	2600079891	305
321	iso_pu_bacteria	2600254930	2600360947	305
322	iso_pu_bacteria	2600254931	2600367878	305
323	iso_pu_bacteria	2600255283	2601628630	305
324	iso_pu_bacteria	2600255318	2601800601	305
325	iso_pu_bacteria	2603880185	2606078591	305
326	iso_pu_bacteria	2603880199	2606125749	305
327	iso_pu_bacteria	2606217733	2608384051	305
328	iso_pu_bacteria	2623620443	2624483014	305
329	iso_pu_bacteria	2623620446	2624494543	305
330	iso_pu_bacteria	2643221565	2643844985	305
331	iso_pu_bacteria	2643221589	2643957693	305
332	iso_pu_bacteria	2643221602	2644025809	305
333	iso_pu_bacteria	2643221633	2644188384	305
334	iso_pu_bacteria	2643221650	2644286658	305
335	iso_pu_bacteria	2651869719	2652545076	305
336	iso_pu_bacteria	2667528170	2671094199	305
337	iso_pu_bacteria	2667528171	2671100655	305
338	iso_pu_bacteria	2667528176	2671129699	305
339	iso_pu_bacteria	2671180172	2671773228	305
340	iso_pu_bacteria	2675903515	2678265758	305
341	iso_pu_bacteria	2713897149	2715759190	305
342	iso_pu_bacteria	2738541271	2738690983	305
343	iso_pu_bacteria	2738543004	2739200489	305
344	iso_pu_bacteria	2738543015	2739262171	305
345	iso_pu_bacteria	2738543016	2739266880	305
346	iso_pu_bacteria	2740892503	2743740050	305
347	iso_pu_bacteria	2744054620	2745006992	305
348	iso_pu_bacteria	2773857670	2774121920	305
349	iso_pu_bacteria	2773857673	2774137157	305
350	iso_pu_bacteria	2784132063	2784262218	305
351	iso_pu_bacteria	2784132072	2784314583	305
352	iso_pu_bacteria	2791355520	2794595166	305
353	iso_pu_bacteria	2808606361	2808858061	305
354	iso_pu_bacteria	2808606373	2808906510	305
355	iso_pu_bacteria	2808606376	2808926184	305
356	iso_pu_bacteria	2808606377	2808932333	305
357	iso_pu_bacteria	2808606378	2808938232	305
358	iso_pu_bacteria	2808606380	2808948285	305
359	iso_pu_bacteria	2808606381	2808954454	305
360	iso_pu_bacteria	2808606383	2808966571	305
361	iso_pu_bacteria	2808606389	2809001401	305
362	iso_pu_bacteria	2808606445	2809219173	305
363	iso_pu_bacteria	2818991456	2819659311	305
364	iso_pu_bacteria	2818991464	2819706322	305
365	iso_pu_bacteria	2825651385	2825655495	305
366	iso_pu_bacteria	2826581358	2826582806	305
367	iso_pu_bacteria	2842815866	2842819850	305
368	iso_pu_bacteria	2842849001	2842852899	305
369	iso_pu_bacteria	2842854478	2842859193	305
370	iso_pu_bacteria	2844665904	2844666603	305
371	iso_pu_bacteria	2852657418	2852661136	305
372	iso_pu_bacteria	2860339153	2860344003	305
373	iso_pu_bacteria	2878029506	2878034952	305
374	iso_pu_bacteria	2880230671	2880235593	305
375	iso_pu_bacteria	2904518522	2904522546	305
376	iso_pu_bacteria	2904550169	2904554163	305
377	iso_pu_bacteria	2912963787	2912968501	305
378	iso_pu_bacteria	2913036834	2913042165	305
379	iso_pu_bacteria	2917070673	2917076312	305
380	iso_pu_bacteria	2919063839	2919067670	305
381	iso_pu_bacteria	2919456309	2919461639	305
382	iso_pu_bacteria	2919481497	2919485994	305
383	iso_pu_bacteria	2919697872	2919701357	305
384	iso_pu_bacteria	2923153595	2923159141	305
385	iso_pu_bacteria	2923586266	2923591112	305
386	iso_pu_bacteria	2929144301	2929149553	305
387	iso_pu_bacteria	2931369376	2931373044	305
388	iso_pu_bacteria	2931396565	2931397667	305
389	iso_pu_bacteria	2935353572	2935359736	305
390	iso_pu_bacteria	2939636861	2939641938	305
391	iso_pu_bacteria	2939651529	2939654579	305
392	iso_pu_bacteria	2984286254	2984287018	305
393	iso_pu_bacteria	2988728565	2988731101	305
394	iso_pu_bacteria	3007395558	3007398791	305
395	iso_pu_bacteria	3007419365	3007425335	305
396	iso_pu_bacteria	3007511990	3007516794	305
397	iso_pu_bacteria	3007614139	3007617361	305
398	iso_pu_bacteria	3007619802	3007624319	305
399	iso_pu_bacteria	3007718800	3007721293	305
400	iso_pu_bacteria	3007861166	3007866464	305
401	iso_pu_bacteria	3007866637	3007867137	305
402	iso_pu_bacteria	637000220	637322868	305
403	iso_pu_bacteria	8015687852	8015693227	305
404	iso_pu_bacteria	8019769354	8019771210	305
405	iso_pu_bacteria	8019775933	8019780478	305
406	iso_pu_bacteria	8055770955	8055776477	305
407	iso_pu_bacteria	8055878733	8055880504	305
408	iso_pu_bacteria	8056125926	8056131221	305
409	iso_pu_bacteria	8056143049	8056148372	305
410	iso_pu_bacteria	8056155041	8056156419	305
411	iso_pu_bacteria	8056172158	8056172230	305
412	iso_pu_bacteria	8056177738	8056179295	305
413	iso_pu_bacteria	8056569372	8056572053	305
414	iso_pu_bacteria	8057798959	8057803890	305
415	iso_pu_bacteria	2511231012	2511301442	306
416	iso_pu_bacteria	2511231024	2511374262	306
417	iso_pu_bacteria	2511231031	2511412045	306
418	iso_pu_bacteria	2554235231	2555246619	306
419	iso_pu_bacteria	2597489889	2597867438	306
420	iso_pu_bacteria	2599185288	2599883517	306
421	iso_pu_bacteria	2599185303	2599950703	306
422	iso_pu_bacteria	2643221713	2644619698	306
423	iso_pu_bacteria	2713897148	2715752440	306
424	iso_pu_bacteria	2718217725	2718636229	306
425	iso_pu_bacteria	2738541294	2738807849	306
426	iso_pu_bacteria	2738541309	2738895209	306
427	iso_pu_bacteria	2738543025	2739314969	306
428	iso_pu_bacteria	2765235841	2765586235	306
429	iso_pu_bacteria	2806310737	2807410470	306
430	iso_pu_bacteria	2806310745	2807458815	306
431	iso_pu_bacteria	2808606382	2808961463	306
432	iso_pu_bacteria	2808606385	2808976601	306
433	iso_pu_bacteria	2808606388	2808991961	306
434	iso_pu_bacteria	2842832357	2842836863	306
435	iso_pu_bacteria	2842843487	2842847599	306
436	iso_pu_bacteria	2852612431	2852617132	306
437	iso_pu_bacteria	2852667396	2852671879	306
438	iso_pu_bacteria	2908446538	2908447082	306
439	iso_pu_bacteria	2919385768	2919390534	306
440	iso_pu_bacteria	2919487758	2919492655	306
441	iso_pu_bacteria	2929189879	2929190346	306
442	iso_pu_bacteria	2946006987	2946012459	306
443	iso_pu_bacteria	2969304461	2969309780	306
444	iso_pu_bacteria	2974289157	2974294473	306
445	iso_pu_bacteria	2998139840	2998145006	306
446	iso_pu_bacteria	3007803356	3007804598	306
447	iso_pu_bacteria	3007855910	3007860210	306
448	iso_pu_bacteria	3007872151	3007874223	306
449	iso_pu_bacteria	8029995093	8029995890	306
450	iso_pu_bacteria	8052494512	8052499448	306
451	iso_pu_bacteria	8054503363	8054504022	306
452	iso_pu_bacteria	8054929484	8054933548	306
453	iso_pu_bacteria	8056115690	8056115765	306
454	iso_pu_bacteria	8056120720	8056121281	306
455	iso_pu_bacteria	8056131705	8056132388	306
456	iso_pu_bacteria	8056137416	8056137993	306
457	iso_pu_bacteria	8056166840	8056171562	306
458	3300001915	JGI24741J21665_1006780	JGI24741J21665_10067802	307
459	3300005288	Ga0065714_10075805	Ga0065714_100758052	307
460	3300005331	Ga0070670_100261586	Ga0070670_1002615862	307
461	3300005353	Ga0070669_100000578	Ga0070669_1000005782	307
462	3300005457	Ga0070662_100000656	Ga0070662_10000065618	307
463	3300005539	Ga0068853_100004630	Ga0068853_1000046302	307
464	3300005564	Ga0070664_100474302	Ga0070664_1004743021	307
465	3300005834	Ga0068851_10000004	Ga0068851_10000004196	307
466	3300009011	Ga0105251_10004461	Ga0105251_100044612	307
467	3300009177	Ga0105248_10018229	Ga0105248_100182296	307
468	3300009545	Ga0105237_10117321	Ga0105237_101173212	307
469	3300013100	Ga0157373_10042724	Ga0157373_100427242	307
470	3300013100	Ga0157373_10046518	Ga0157373_100465182	307
471	3300013105	Ga0157369_10124681	Ga0157369_101246812	307
472	3300014497	Ga0182008_10025477	Ga0182008_100254772	307
473	3300014497	Ga0182008_10055360	Ga0182008_100553602	307
474	3300015262	Ga0182007_10016029	Ga0182007_100160292	307
475	3300025321	Ga0207656_10000007	Ga0207656_1000000760	307
476	3300025735	Ga0207713_1001685	Ga0207713_10016852	307
477	3300025923	Ga0207681_10005762	Ga0207681_100057622	307
478	3300025925	Ga0207650_10001153	Ga0207650_100011538	307
479	3300025933	Ga0207706_10000624	Ga0207706_1000062425	307
480	3300025941	Ga0207711_10127975	Ga0207711_101279752	307
481	3300026041	Ga0207639_10001691	Ga0207639_1000169113	307
482	3300028786	Ga0307517_10056132	Ga0307517_100561322	307
483	3300031507	Ga0307509_10081300	Ga0307509_100813002	307
484	3300042136	Ga0450900_000044	Ga0450900_000044_741_1664	307
485	3300048926	Ga0496123_0059408	Ga0496123_0059408_903_1829	307
486	3300048928	Ga0496125_0009627	Ga0496125_0009627_7664_8590	307
487	iso_pu_bacteria	2919155634	2919158626	307
488	3300001915	JGI24741J21665_1001500	JGI24741J21665_10015002	308
489	3300002771	JGI25163J39215_1000177	JGI25163J39215_100017718	308
490	3300002772	JGI25164J39214_1000034	JGI25164J39214_100003438	308
491	3300003214	JGI25165J46597_1000011	JGI25165J46597_1000011171	308
492	3300005288	Ga0065714_10064906	Ga0065714_1006490617	308
493	3300005288	Ga0065714_10069510	Ga0065714_100695102	308
494	3300005288	Ga0065714_10086971	Ga0065714_100869712	308
495	3300005288	Ga0065714_10088597	Ga0065714_100885972	308
496	3300005289	Ga0065704_10092861	Ga0065704_100928612	308
497	3300005331	Ga0070670_100006484	Ga0070670_1000064842	308
498	3300005344	Ga0070661_100000510	Ga0070661_10000051025	308
499	3300005353	Ga0070669_100000090	Ga0070669_10000009035	308
500	3300005457	Ga0070662_100001995	Ga0070662_10000199510	308
501	3300005539	Ga0068853_100000218	Ga0068853_10000021825	308
502	3300005564	Ga0070664_100004150	Ga0070664_1000041503	308
503	3300005564	Ga0070664_100005583	Ga0070664_1000055838	308
504	3300005577	Ga0068857_100364881	Ga0068857_1003648811	308
505	3300005578	Ga0068854_100022744	Ga0068854_1000227444	308
506	3300005834	Ga0068851_10000035	Ga0068851_1000003510	308
507	3300006946	Ga0079104_1006183	Ga0079104_10061831	308
508	3300009011	Ga0105251_10000423	Ga0105251_1000042320	308
509	3300009148	Ga0105243_10001222	Ga0105243_1000122218	308
510	3300009176	Ga0105242_10000658	Ga0105242_100006584	308
511	3300009177	Ga0105248_10006369	Ga0105248_1000636910	308
512	3300009545	Ga0105237_10002728	Ga0105237_1000272812	308
513	3300011119	Ga0105246_10000751	Ga0105246_100007514	308
514	3300013100	Ga0157373_10036478	Ga0157373_100364782	308
515	3300013100	Ga0157373_10044024	Ga0157373_100440242	308
516	3300013102	Ga0157371_10000039	Ga0157371_10000039152	308
517	3300013102	Ga0157371_10000057	Ga0157371_1000005761	308
518	3300013102	Ga0157371_10000941	Ga0157371_1000094121	308
519	3300013104	Ga0157370_10005350	Ga0157370_100053506	308
520	3300013104	Ga0157370_10061453	Ga0157370_100614532	308
521	3300013105	Ga0157369_10001287	Ga0157369_100012879	308
522	3300013105	Ga0157369_10008971	Ga0157369_100089713	308
523	3300013105	Ga0157369_10085902	Ga0157369_100859022	308
524	3300013306	Ga0163162_10002990	Ga0163162_1000299013	308
525	3300013306	Ga0163162_10008768	Ga0163162_100087685	308
526	3300013308	Ga0157375_10078846	Ga0157375_100788462	308
527	3300014497	Ga0182008_10000177	Ga0182008_1000017725	308
528	3300014497	Ga0182008_10003013	Ga0182008_100030133	308
529	3300014497	Ga0182008_10003388	Ga0182008_100033882	308
530	3300014497	Ga0182008_10011252	Ga0182008_100112522	308
531	3300015261	Ga0182006_1002556	Ga0182006_10025562	308
532	3300015261	Ga0182006_1036402	Ga0182006_10364021	308
533	3300015261	Ga0182006_1059315	Ga0182006_10593151	308
534	3300015262	Ga0182007_10011182	Ga0182007_100111823	308
535	3300015265	Ga0182005_1002901	Ga0182005_10029013	308
536	3300015265	Ga0182005_1036148	Ga0182005_10361482	308
537	3300017792	Ga0163161_10001454	Ga0163161_1000145418	308
538	3300017792	Ga0163161_10014263	Ga0163161_100142632	308
539	3300017792	Ga0163161_10041729	Ga0163161_100417292	308
540	3300017792	Ga0163161_10052148	Ga0163161_100521482	308
541	3300017792	Ga0163161_10105314	Ga0163161_101053142	308
542	3300017792	Ga0163161_10182369	Ga0163161_101823692	308
543	3300025207	Ga0209760_100050	Ga0209760_10005051	308
544	3300025231	Ga0207427_100003	Ga0207427_100003169	308
545	3300025233	Ga0209437_100002	Ga0209437_100002844	308
546	3300025261	Ga0209233_1000004	Ga0209233_1000004581	308
547	3300025321	Ga0207656_10000008	Ga0207656_1000000899	308
548	3300025728	Ga0207655_1000568	Ga0207655_100056839	308
549	3300025735	Ga0207713_1000225	Ga0207713_100022535	308
550	3300025914	Ga0207671_10000015	Ga0207671_10000015311	308
551	3300025920	Ga0207649_10000001	Ga0207649_10000001177	308
552	3300025920	Ga0207649_10123024	Ga0207649_101230242	308
553	3300025923	Ga0207681_10000048	Ga0207681_1000004812	308
554	3300025925	Ga0207650_10004096	Ga0207650_100040962	308
555	3300025933	Ga0207706_10000374	Ga0207706_100003748	308
556	3300025934	Ga0207686_10007858	Ga0207686_100078584	308
557	3300025935	Ga0207709_10001579	Ga0207709_100015793	308
558	3300025945	Ga0207679_10000011	Ga0207679_10000011177	308
559	3300025981	Ga0207640_10069802	Ga0207640_100698021	308
560	3300026041	Ga0207639_10000392	Ga0207639_1000039224	308
561	3300027111	Ga0209281_1011604	Ga0209281_10116042	308
562	3300027395	Ga0209996_1000911	Ga0209996_10009113	308
563	3300027471	Ga0209995_1002328	Ga0209995_10023282	308
564	3300027665	Ga0209983_1003865	Ga0209983_10038652	308
565	3300027682	Ga0209971_1000288	Ga0209971_10002883	308
566	3300027876	Ga0209974_10002241	Ga0209974_100022414	308
567	3300031824	Ga0307413_10134799	Ga0307413_101347992	308
568	3300041407	Ga0439447_008588	Ga0439447_008588_1199_2131	308
569	3300041407	Ga0439447_022936	Ga0439447_022936_285_1220	308
570	3300041411	Ga0439466_0001273	Ga0439466_0001273_941_1873	308
571	3300042006	Ga0439432_001214	Ga0439432_001214_7563_8498	308
572	3300042010	Ga0439452_000152	Ga0439452_000152_14677_15726	308
573	3300042013	Ga0439456_023511	Ga0439456_023511_55_987	308
574	3300042016	Ga0439463_001870	Ga0439463_001870_2273_3205	308
575	3300042016	Ga0439463_006145	Ga0439463_006145_1505_2437	308
576	3300042016	Ga0439463_021874	Ga0439463_021874_23_955	308
577	3300042115	Ga0450911_001270	Ga0450911_001270_5023_5955	308
578	3300042115	Ga0450911_007233	Ga0450911_007233_348_1280	308
579	3300042137	Ga0450902_000575	Ga0450902_000575_3380_4312	308
580	3300042533	Ga0450901_000101	Ga0450901_000101_6119_7051	308
581	3300046453	Ga0495627_017397	Ga0495627_017397_450_1451	308
582	3300046455	Ga0495603_0069677	Ga0495603_0069677_990_1922	308
583	3300046460	Ga0495638_0002555	Ga0495638_0002555_1980_3029	308
584	3300046471	Ga0495650_0002440	Ga0495650_0002440_13740_14672	308
585	3300046474	Ga0495605_0000691	Ga0495605_0000691_13346_14278	308
586	3300046474	Ga0495605_0001307	Ga0495605_0001307_7200_8132	308
587	3300046475	Ga0495639_0000773	Ga0495639_0000773_1318_2250	308
588	3300046491	Ga0495584_0023273	Ga0495584_0023273_938_1987	308
589	3300046492	Ga0495585_0000641	Ga0495585_0000641_15282_16331	308
590	3300046499	Ga0495594_0013234	Ga0495594_0013234_2323_3255	308
591	3300046501	Ga0495607_0001420	Ga0495607_0001420_2257_3189	308
592	3300046501	Ga0495607_0004815	Ga0495607_0004815_785_1714	308
593	3300046501	Ga0495607_0030521	Ga0495607_0030521_907_1833	308
594	3300046506	Ga0495583_0021691	Ga0495583_0021691_1295_2230	308
595	3300046507	Ga0495606_0005860	Ga0495606_0005860_3606_4538	308
596	3300046507	Ga0495606_0048245	Ga0495606_0048245_1117_2052	308
597	3300046507	Ga0495606_0059873	Ga0495606_0059873_1293_2342	308
598	3300046512	Ga0495610_0036268	Ga0495610_0036268_273_1205	308
599	3300046512	Ga0495610_0041537	Ga0495610_0041537_1003_1938	308
600	3300046512	Ga0495610_0098125	Ga0495610_0098125_300_1235	308
601	3300046513	Ga0495616_0020209	Ga0495616_0020209_1275_2207	308
602	3300046515	Ga0495620_0000505	Ga0495620_0000505_13822_14754	308
603	3300046517	Ga0495630_0291725	Ga0495630_0291725_48_980	308
604	3300046518	Ga0495631_0000138	Ga0495631_0000138_7876_8808	308
605	3300046518	Ga0495631_0056498	Ga0495631_0056498_85_1020	308
606	3300046519	Ga0495632_0011313	Ga0495632_0011313_3811_4860	308
607	3300046520	Ga0495637_0001611	Ga0495637_0001611_4208_5257	308
608	3300046520	Ga0495637_0040937	Ga0495637_0040937_933_1934	308
609	3300046520	Ga0495637_0047400	Ga0495637_0047400_753_1688	308
610	3300046522	Ga0495643_0095065	Ga0495643_0095065_503_1435	308
611	3300046524	Ga0495648_0004043	Ga0495648_0004043_11324_12256	308
612	3300046524	Ga0495648_0097528	Ga0495648_0097528_655_1590	308
613	3300046529	Ga0495652_0068451	Ga0495652_0068451_1442_2374	308
614	3300046530	Ga0495654_0002353	Ga0495654_0002353_1422_2354	308
615	3300046530	Ga0495654_0004664	Ga0495654_0004664_3847_4779	308
616	3300046530	Ga0495654_0022305	Ga0495654_0022305_1308_2243	308
617	3300046530	Ga0495654_0027328	Ga0495654_0027328_314_1363	308
618	3300046536	Ga0495587_0002198	Ga0495587_0002198_11875_12807	308
619	3300046538	Ga0495609_0004045	Ga0495609_0004045_5276_6208	308
620	3300046538	Ga0495609_0050103	Ga0495609_0050103_376_1308	308
621	3300046558	Ga0495633_0001293	Ga0495633_0001293_5154_6086	308
622	3300046558	Ga0495633_0136367	Ga0495633_0136367_39_974	308
623	3300046642	Ga0495634_0000185	Ga0495634_0000185_39420_40352	308
624	3300046660	Ga0495625_0001131	Ga0495625_0001131_31003_31935	308
625	3300046663	Ga0495635_0000596	Ga0495635_0000596_12783_13715	308
626	3300046665	Ga0495661_0014699	Ga0495661_0014699_2716_3648	308
627	3300046665	Ga0495661_0047613	Ga0495661_0047613_1047_1982	308
628	3300046665	Ga0495661_0107427	Ga0495661_0107427_343_1392	308
629	3300046679	Ga0495623_0001387	Ga0495623_0001387_12805_13737	308
630	3300046680	Ga0495646_0107485	Ga0495646_0107485_426_1358	308
631	3300046689	Ga0495613_0004997	Ga0495613_0004997_873_1805	308
632	3300046691	Ga0495670_0001183	Ga0495670_0001183_5301_6233	308
633	3300046692	Ga0495671_0011625	Ga0495671_0011625_737_1663	308
634	3300046692	Ga0495671_0028125	Ga0495671_0028125_1805_2737	308
635	3300046694	Ga0495649_0001934	Ga0495649_0001934_8786_9715	308
636	3300046694	Ga0495649_0003160	Ga0495649_0003160_4711_5760	308
637	3300046694	Ga0495649_0057211	Ga0495649_0057211_141_1073	308
638	3300046794	Ga0495589_0008233	Ga0495589_0008233_2524_3456	308
639	3300046810	Ga0495660_0002416	Ga0495660_0002416_1953_2885	308
640	3300046810	Ga0495660_0003334	Ga0495660_0003334_560_1582	308
641	3300046810	Ga0495660_0016303	Ga0495660_0016303_2167_3099	308
642	3300046810	Ga0495660_0036950	Ga0495660_0036950_854_1789	308
643	3300046810	Ga0495660_0104633	Ga0495660_0104633_104_1153	308
644	3300047317	Ga0495604_0050095	Ga0495604_0050095_562_1494	308
645	3300047319	Ga0495674_0002388	Ga0495674_0002388_4963_5895	308
646	3300047320	Ga0495672_0061999	Ga0495672_0061999_848_1780	308
647	3300047321	Ga0495676_0011505	Ga0495676_0011505_6873_7802	308
648	3300047322	Ga0495680_0021128	Ga0495680_0021128_3670_4602	308
649	3300047323	Ga0495683_0000405	Ga0495683_0000405_2503_3435	308
650	3300047444	Ga0495675_0023388	Ga0495675_0023388_1125_2057	308
651	3300047446	Ga0495679_014360	Ga0495679_014360_1007_1942	308
652	3300047469	Ga0495673_0000598	Ga0495673_0000598_31879_32811	308
653	3300047470	Ga0495681_0002011	Ga0495681_0002011_1080_2081	308
654	3300047470	Ga0495681_0005854	Ga0495681_0005854_4753_5685	308
655	3300047470	Ga0495681_0008004	Ga0495681_0008004_2420_3469	308
656	3300047472	Ga0495686_0001398	Ga0495686_0001398_9528_10577	308
657	3300047673	Ga0495593_0023450	Ga0495593_0023450_2398_3330	308
658	3300048088	Ga0495602_0072840	Ga0495602_0072840_685_1617	308
659	3300048905	Ga0496102_0000763	Ga0496102_0000763_13140_14072	308
660	3300048906	Ga0496103_0000922	Ga0496103_0000922_7336_8268	308
661	3300048908	Ga0496105_0364728	Ga0496105_0364728_197_1129	308
662	3300048919	Ga0496116_0002262	Ga0496116_0002262_12545_13477	308
663	3300048920	Ga0496117_0003877	Ga0496117_0003877_3362_4294	308
664	3300048920	Ga0496117_0003918	Ga0496117_0003918_10596_11528	308
665	3300048920	Ga0496117_0007130	Ga0496117_0007130_3551_4483	308
666	3300048920	Ga0496117_0031668	Ga0496117_0031668_1319_2251	308
667	3300048921	Ga0496118_0002215	Ga0496118_0002215_18928_19860	308
668	3300048921	Ga0496118_0040147	Ga0496118_0040147_1072_2004	308
669	3300048922	Ga0496119_0003087	Ga0496119_0003087_13079_14011	308
670	3300048923	Ga0496120_0001623	Ga0496120_0001623_21539_22471	308
671	3300048924	Ga0496121_0003270	Ga0496121_0003270_3182_4114	308
672	3300048924	Ga0496121_0007558	Ga0496121_0007558_10926_11858	308
673	3300048924	Ga0496121_0023619	Ga0496121_0023619_3351_4283	308
674	3300048924	Ga0496121_0038598	Ga0496121_0038598_1498_2430	308
675	3300048925	Ga0496122_0002298	Ga0496122_0002298_23450_24382	308
676	3300048926	Ga0496123_0001247	Ga0496123_0001247_8426_9358	308
677	3300048926	Ga0496123_0002436	Ga0496123_0002436_2170_3102	308
678	3300048927	Ga0496124_0011619	Ga0496124_0011619_280_1212	308
679	3300048927	Ga0496124_0016110	Ga0496124_0016110_2552_3484	308
680	3300048927	Ga0496124_0111542	Ga0496124_0111542_709_1644	308
681	3300048928	Ga0496125_0002917	Ga0496125_0002917_10275_11207	308
682	3300048928	Ga0496125_0013029	Ga0496125_0013029_6413_7345	308
683	3300048928	Ga0496125_0013553	Ga0496125_0013553_4161_5093	308
684	3300048928	Ga0496125_0062313	Ga0496125_0062313_785_1720	308
685	3300048928	Ga0496125_0083318	Ga0496125_0083318_450_1385	308
686	3300048929	Ga0496126_0133969	Ga0496126_0133969_94_1026	308
687	3300049459	Ga0495678_005129	Ga0495678_005129_6368_7300	308
688	3300049459	Ga0495678_072604	Ga0495678_072604_60_1109	308
689	3300053139	Ga0500568_0009162	Ga0500568_0009162_1524_2573	308
690	3300053161	Ga0500634_0040604	Ga0500634_0040604_634_1569	308
691	iso_pu_bacteria	2643221633	2644188654	308
692	iso_pu_bacteria	2919385768	2919388028	308
693	2162886007	SwRhRL2b_contig_1140398	SwRhRL2b_0167.00007120	309
694	3300002737	JGI25162J39368_1000327	JGI25162J39368_100032725	309
695	3300002737	JGI25162J39368_1000492	JGI25162J39368_100049210	309
696	3300002772	JGI25164J39214_1000241	JGI25164J39214_100024125	309
697	3300002772	JGI25164J39214_1000335	JGI25164J39214_100033510	309
698	3300003214	JGI25165J46597_1000442	JGI25165J46597_100044225	309
699	3300003214	JGI25165J46597_1000619	JGI25165J46597_100061920	309
700	3300003781	Ga0055536_1002107	Ga0055536_10021072	309
701	3300003781	Ga0055536_1003318	Ga0055536_10033182	309
702	3300003791	Ga0055530_10000398	Ga0055530_1000039822	309
703	3300003791	Ga0055530_10003488	Ga0055530_100034882	309
704	3300003791	Ga0055530_10004698	Ga0055530_100046988	309
705	3300003792	Ga0055540_1000330	Ga0055540_100033013	309
706	3300003792	Ga0055540_1002807	Ga0055540_10028072	309
707	3300003792	Ga0055540_1002885	Ga0055540_10028852	309
708	3300003794	Ga0055531_10000125	Ga0055531_1000012526	309
709	3300005288	Ga0065714_10000512	Ga0065714_100005124	309
710	3300005288	Ga0065714_10003529	Ga0065714_100035296	309
711	3300005288	Ga0065714_10005381	Ga0065714_100053812	309
712	3300005288	Ga0065714_10007146	Ga0065714_100071463	309
713	3300005288	Ga0065714_10013255	Ga0065714_100132553	309
714	3300005288	Ga0065714_10069657	Ga0065714_100696572	309
715	3300005288	Ga0065714_10086110	Ga0065714_100861102	309
716	3300005288	Ga0065714_10095905	Ga0065714_100959051	309
717	3300005289	Ga0065704_10076565	Ga0065704_100765653	309
718	3300005290	Ga0065712_10004870	Ga0065712_100048703	309
719	3300005290	Ga0065712_10067888	Ga0065712_1006788820	309
720	3300005353	Ga0070669_100001254	Ga0070669_1000012544	309
721	3300005457	Ga0070662_100238776	Ga0070662_1002387761	309
722	3300006051	Ga0075364_10058129	Ga0075364_100581293	309
723	3300006051	Ga0075364_10090518	Ga0075364_100905182	309
724	3300006058	Ga0075432_10001026	Ga0075432_100010262	309
725	3300006058	Ga0075432_10029314	Ga0075432_100293142	309
726	3300006058	Ga0075432_10041569	Ga0075432_100415692	309
727	3300006946	Ga0079104_1000478	Ga0079104_100047824	309
728	3300006946	Ga0079104_1000630	Ga0079104_100063014	309
729	3300006948	Ga0099826_10057411	Ga0099826_100574112	309
730	3300009011	Ga0105251_10000011	Ga0105251_10000011148	309
731	3300009011	Ga0105251_10000163	Ga0105251_1000016340	309
732	3300009011	Ga0105251_10001384	Ga0105251_1000138412	309
733	3300009011	Ga0105251_10050498	Ga0105251_100504982	309
734	3300009011	Ga0105251_10061060	Ga0105251_100610601	309
735	3300009011	Ga0105251_10086561	Ga0105251_100865612	309
736	3300009011	Ga0105251_10116600	Ga0105251_101166002	309
737	3300009036	Ga0105244_10000323	Ga0105244_1000032316	309
738	3300009036	Ga0105244_10043434	Ga0105244_100434342	309
739	3300009036	Ga0105244_10048930	Ga0105244_100489302	309
740	3300009036	Ga0105244_10106571	Ga0105244_101065712	309
741	3300009092	Ga0105250_10001071	Ga0105250_100010716	309
742	3300009092	Ga0105250_10001615	Ga0105250_100016152	309
743	3300009092	Ga0105250_10030228	Ga0105250_100302282	309
744	3300009092	Ga0105250_10107472	Ga0105250_101074721	309
745	3300009148	Ga0105243_10000449	Ga0105243_1000044925	309
746	3300009148	Ga0105243_10001384	Ga0105243_1000138424	309
747	3300009148	Ga0105243_10015598	Ga0105243_100155987	309
748	3300009148	Ga0105243_10033733	Ga0105243_100337333	309
749	3300009553	Ga0105249_10008133	Ga0105249_1000813310	309
750	3300011119	Ga0105246_10017623	Ga0105246_100176233	309
751	3300013100	Ga0157373_10000759	Ga0157373_1000075921	309
752	3300013100	Ga0157373_10015801	Ga0157373_100158013	309
753	3300013100	Ga0157373_10186584	Ga0157373_101865842	309
754	3300013100	Ga0157373_10289551	Ga0157373_102895511	309
755	3300013102	Ga0157371_10000243	Ga0157371_1000024313	309
756	3300013102	Ga0157371_10000814	Ga0157371_1000081410	309
757	3300013102	Ga0157371_10046171	Ga0157371_100461712	309
758	3300013104	Ga0157370_10002807	Ga0157370_1000280716	309
759	3300013104	Ga0157370_10075351	Ga0157370_100753513	309
760	3300013104	Ga0157370_10095733	Ga0157370_100957332	309
761	3300013104	Ga0157370_10159819	Ga0157370_101598192	309
762	3300013104	Ga0157370_10241996	Ga0157370_102419962	309
763	3300013104	Ga0157370_10245173	Ga0157370_102451732	309
764	3300013104	Ga0157370_10291909	Ga0157370_102919091	309
765	3300013306	Ga0163162_10011051	Ga0163162_1001105110	309
766	3300014497	Ga0182008_10002101	Ga0182008_100021013	309
767	3300014497	Ga0182008_10003486	Ga0182008_100034864	309
768	3300014497	Ga0182008_10009774	Ga0182008_100097746	309
769	3300014497	Ga0182008_10034963	Ga0182008_100349632	309
770	3300014497	Ga0182008_10042591	Ga0182008_100425912	309
771	3300015261	Ga0182006_1002946	Ga0182006_10029462	309
772	3300015261	Ga0182006_1014690	Ga0182006_10146903	309
773	3300015261	Ga0182006_1052286	Ga0182006_10522862	309
774	3300015262	Ga0182007_10000322	Ga0182007_1000032211	309
775	3300015265	Ga0182005_1001565	Ga0182005_100156510	309
776	3300015265	Ga0182005_1014239	Ga0182005_10142392	309
777	3300015265	Ga0182005_1022890	Ga0182005_10228902	309
778	3300017792	Ga0163161_10012783	Ga0163161_100127833	309
779	3300017792	Ga0163161_10049824	Ga0163161_100498242	309
780	3300017792	Ga0163161_10069881	Ga0163161_100698812	309
781	3300017792	Ga0163161_10094293	Ga0163161_100942932	309
782	3300017792	Ga0163161_10151060	Ga0163161_101510602	309
783	3300025207	Ga0209760_100117	Ga0209760_1001172	309
784	3300025207	Ga0209760_100153	Ga0209760_10015324	309
785	3300025230	Ga0209563_100242	Ga0209563_10024221	309
786	3300025231	Ga0207427_100056	Ga0207427_10005624	309
787	3300025231	Ga0207427_100063	Ga0207427_100063144	309
788	3300025233	Ga0209437_100065	Ga0209437_10006524	309
789	3300025233	Ga0209437_100133	Ga0209437_10013339	309
790	3300025261	Ga0209233_1000085	Ga0209233_100008524	309
791	3300025261	Ga0209233_1000133	Ga0209233_100013367	309
792	3300025291	Ga0209675_1006756	Ga0209675_10067565	309
793	3300025292	Ga0209676_1000076	Ga0209676_1000076265	309
794	3300025292	Ga0209676_1000337	Ga0209676_100033759	309
795	3300025292	Ga0209676_1014710	Ga0209676_10147103	309
796	3300025298	Ga0209050_1000063	Ga0209050_100006353	309
797	3300025298	Ga0209050_1000080	Ga0209050_100008022	309
798	3300025298	Ga0209050_1000106	Ga0209050_100010627	309
799	3300025303	Ga0209051_1000045	Ga0209051_100004527	309
800	3300025303	Ga0209051_1000260	Ga0209051_100026058	309
801	3300025303	Ga0209051_1000283	Ga0209051_100028323	309
802	3300025304	Ga0209257_1000185	Ga0209257_100018527	309
803	3300025711	Ga0207696_1000047	Ga0207696_1000047243	309
804	3300025711	Ga0207696_1000168	Ga0207696_100016892	309
805	3300025711	Ga0207696_1000587	Ga0207696_100058710	309
806	3300025711	Ga0207696_1008131	Ga0207696_10081313	309
807	3300025711	Ga0207696_1021070	Ga0207696_10210702	309
808	3300025711	Ga0207696_1046701	Ga0207696_10467011	309
809	3300025728	Ga0207655_1000104	Ga0207655_100010426	309
810	3300025728	Ga0207655_1000606	Ga0207655_100060629	309
811	3300025728	Ga0207655_1000789	Ga0207655_10007893	309
812	3300025728	Ga0207655_1001528	Ga0207655_100152816	309
813	3300025728	Ga0207655_1009879	Ga0207655_10098793	309
814	3300025728	Ga0207655_1010191	Ga0207655_10101912	309
815	3300025728	Ga0207655_1012210	Ga0207655_10122104	309
816	3300025728	Ga0207655_1013479	Ga0207655_10134792	309
817	3300025728	Ga0207655_1029377	Ga0207655_10293772	309
818	3300025728	Ga0207655_1035913	Ga0207655_10359132	309
819	3300025735	Ga0207713_1000049	Ga0207713_1000049183	309
820	3300025735	Ga0207713_1000073	Ga0207713_1000073148	309
821	3300025735	Ga0207713_1001275	Ga0207713_10012759	309
822	3300025735	Ga0207713_1001528	Ga0207713_10015281	309
823	3300025735	Ga0207713_1012385	Ga0207713_10123853	309
824	3300025735	Ga0207713_1014590	Ga0207713_10145902	309
825	3300025735	Ga0207713_1051894	Ga0207713_10518942	309
826	3300025923	Ga0207681_10001746	Ga0207681_100017467	309
827	3300025933	Ga0207706_10247015	Ga0207706_102470152	309
828	3300025935	Ga0207709_10000030	Ga0207709_1000003047	309
829	3300025935	Ga0207709_10000343	Ga0207709_1000034325	309
830	3300025935	Ga0207709_10018499	Ga0207709_100184993	309
831	3300027111	Ga0209281_1000070	Ga0209281_100007018	309
832	3300027111	Ga0209281_1000127	Ga0209281_100012718	309
833	3300027666	Ga0209282_1049505	Ga0209282_10495052	309
834	3300027907	Ga0207428_10069683	Ga0207428_100696832	309
835	3300030521	Ga0307511_10097049	Ga0307511_100970491	309
836	3300030733	Ga0314311_1116775	Ga0314311_11167752	309
837	3300031548	Ga0307408_100037081	Ga0307408_1000370812	309
838	3300031548	Ga0307408_100144710	Ga0307408_1001447101	309
839	3300031548	Ga0307408_100447814	Ga0307408_1004478142	309
840	3300031731	Ga0307405_10002165	Ga0307405_100021653	309
841	3300031731	Ga0307405_10076842	Ga0307405_100768422	309
842	3300031731	Ga0307405_10099461	Ga0307405_100994612	309
843	3300031901	Ga0307406_10111057	Ga0307406_101110572	309
844	3300031911	Ga0307412_10003273	Ga0307412_100032732	309
845	3300031911	Ga0307412_10126603	Ga0307412_101266031	309
846	3300031911	Ga0307412_10150494	Ga0307412_101504942	309
847	3300032004	Ga0307414_10016387	Ga0307414_100163873	309
848	3300032004	Ga0307414_10076651	Ga0307414_100766512	309
849	3300032005	Ga0307411_10028463	Ga0307411_100284632	309
850	3300032005	Ga0307411_10093173	Ga0307411_100931732	309
851	3300038705	Ga0237819_02300	Ga0237819_02300_1910_2839	309
852	3300041405	Ga0439438_002027	Ga0439438_002027_4268_5197	309
853	3300041405	Ga0439438_004163	Ga0439438_004163_3843_4772	309
854	3300041405	Ga0439438_004780	Ga0439438_004780_938_1867	309
855	3300041405	Ga0439438_007708	Ga0439438_007708_1703_2632	309
856	3300041405	Ga0439438_008486	Ga0439438_008486_1474_2403	309
857	3300041405	Ga0439438_009822	Ga0439438_009822_1398_2327	309
858	3300041405	Ga0439438_027956	Ga0439438_027956_61_990	309
859	3300041407	Ga0439447_000984	Ga0439447_000984_7124_8053	309
860	3300041407	Ga0439447_003060	Ga0439447_003060_1262_2191	309
861	3300041407	Ga0439447_004828	Ga0439447_004828_2772_3701	309
862	3300041407	Ga0439447_032517	Ga0439447_032517_53_982	309
863	3300041407	Ga0439447_037707	Ga0439447_037707_91_1020	309
864	3300041411	Ga0439466_0001178	Ga0439466_0001178_3304_4233	309
865	3300041411	Ga0439466_0002860	Ga0439466_0002860_710_1639	309
866	3300041411	Ga0439466_0003123	Ga0439466_0003123_2938_3867	309
867	3300041411	Ga0439466_0003732	Ga0439466_0003732_4085_5014	309
868	3300041411	Ga0439466_0004845	Ga0439466_0004845_904_1833	309
869	3300041411	Ga0439466_0012679	Ga0439466_0012679_1345_2274	309
870	3300042000	Ga0439437_000847	Ga0439437_000847_1151_2080	309
871	3300042006	Ga0439432_000387	Ga0439432_000387_14942_15871	309
872	3300042006	Ga0439432_001599	Ga0439432_001599_5418_6347	309
873	3300042009	Ga0439451_002709	Ga0439451_002709_50_979	309
874	3300042009	Ga0439451_002935	Ga0439451_002935_400_1329	309
875	3300042009	Ga0439451_032958	Ga0439451_032958_66_1007	309
876	3300042010	Ga0439452_000339	Ga0439452_000339_7237_8166	309
877	3300042010	Ga0439452_006091	Ga0439452_006091_1039_1968	309
878	3300042010	Ga0439452_015387	Ga0439452_015387_668_1597	309
879	3300042010	Ga0439452_017608	Ga0439452_017608_945_1874	309
880	3300042010	Ga0439452_025163	Ga0439452_025163_24_953	309
881	3300042013	Ga0439456_000103	Ga0439456_000103_17026_17955	309
882	3300042013	Ga0439456_001527	Ga0439456_001527_2160_3089	309
883	3300042013	Ga0439456_003802	Ga0439456_003802_1087_2016	309
884	3300042013	Ga0439456_004429	Ga0439456_004429_1046_1975	309
885	3300042013	Ga0439456_014059	Ga0439456_014059_625_1554	309
886	3300042016	Ga0439463_000187	Ga0439463_000187_9866_10795	309
887	3300042016	Ga0439463_000495	Ga0439463_000495_326_1255	309
888	3300042016	Ga0439463_001747	Ga0439463_001747_1053_1982	309
889	3300042016	Ga0439463_021093	Ga0439463_021093_632_1561	309
890	3300042115	Ga0450911_000022	Ga0450911_000022_59159_60088	309
891	3300042115	Ga0450911_001266	Ga0450911_001266_2932_3861	309
892	3300042115	Ga0450911_003704	Ga0450911_003704_1467_2396	309
893	3300042121	Ga0450919_000403	Ga0450919_000403_4330_5259	309
894	3300042127	Ga0450890_000086	Ga0450890_000086_13653_14582	309
895	3300042137	Ga0450902_008347	Ga0450902_008347_399_1328	309
896	3300042137	Ga0450902_013308	Ga0450902_013308_43_972	309
897	3300042138	Ga0450903_006726	Ga0450903_006726_944_1873	309
898	3300042138	Ga0450903_011020	Ga0450903_011020_196_1125	309
899	3300042139	Ga0450904_000091	Ga0450904_000091_7392_8321	309
900	3300042145	Ga0450906_003802	Ga0450906_003802_1016_1945	309
901	3300042146	Ga0450907_000072	Ga0450907_000072_7098_8027	309
902	3300042146	Ga0450907_007095	Ga0450907_007095_35_964	309
903	3300042156	Ga0439446_0002571	Ga0439446_0002571_817_1746	309
904	3300042156	Ga0439446_0032414	Ga0439446_0032414_42_971	309
905	3300042184	Ga0450908_002778	Ga0450908_002778_18_947	309
906	3300042185	Ga0450909_000255	Ga0450909_000255_2293_3222	309
907	3300042185	Ga0450909_000990	Ga0450909_000990_2932_3861	309
908	3300042435	Ga0439434_0001139	Ga0439434_0001139_2787_3716	309
909	3300042435	Ga0439434_0003766	Ga0439434_0003766_3383_4312	309
910	3300042461	Ga0439460_0002716	Ga0439460_0002716_2154_3083	309
911	3300042532	Ga0450893_0025212	Ga0450893_0025212_53_982	309
912	3300042876	Ga0451577_0041688	Ga0451577_0041688_1666_2595	309
913	3300042993	Ga0439440_0002351	Ga0439440_0002351_331_1260	309
914	3300046452	Ga0495617_000462	Ga0495617_000462_13668_14597	309
915	3300046452	Ga0495617_033400	Ga0495617_033400_48_977	309
916	3300046452	Ga0495617_038861	Ga0495617_038861_219_1148	309
917	3300046453	Ga0495627_000037	Ga0495627_000037_19808_20737	309
918	3300046453	Ga0495627_004300	Ga0495627_004300_2574_3503	309
919	3300046453	Ga0495627_016803	Ga0495627_016803_274_1203	309
920	3300046453	Ga0495627_022059	Ga0495627_022059_593_1522	309
921	3300046455	Ga0495603_0000800	Ga0495603_0000800_9992_10921	309
922	3300046455	Ga0495603_0013173	Ga0495603_0013173_1359_2288	309
923	3300046457	Ga0495590_0001176	Ga0495590_0001176_8579_9508	309
924	3300046457	Ga0495590_0009185	Ga0495590_0009185_53_982	309
925	3300046457	Ga0495590_0014222	Ga0495590_0014222_779_1708	309
926	3300046457	Ga0495590_0016193	Ga0495590_0016193_542_1471	309
927	3300046458	Ga0495591_000036	Ga0495591_000036_116221_117150	309
928	3300046458	Ga0495591_000753	Ga0495591_000753_16772_17701	309
929	3300046458	Ga0495591_002445	Ga0495591_002445_118_1047	309
930	3300046458	Ga0495591_010647	Ga0495591_010647_2139_3068	309
931	3300046458	Ga0495591_014537	Ga0495591_014537_1814_2743	309
932	3300046458	Ga0495591_015785	Ga0495591_015785_988_1917	309
933	3300046458	Ga0495591_016285	Ga0495591_016285_1439_2368	309
934	3300046458	Ga0495591_018010	Ga0495591_018010_1214_2143	309
935	3300046458	Ga0495591_047529	Ga0495591_047529_169_1098	309
936	3300046459	Ga0495629_0216928	Ga0495629_0216928_269_1198	309
937	3300046460	Ga0495638_0001683	Ga0495638_0001683_1793_2722	309
938	3300046460	Ga0495638_0012547	Ga0495638_0012547_2280_3209	309
939	3300046460	Ga0495638_0037075	Ga0495638_0037075_1898_2827	309
940	3300046460	Ga0495638_0041622	Ga0495638_0041622_1216_2145	309
941	3300046460	Ga0495638_0076687	Ga0495638_0076687_179_1108	309
942	3300046460	Ga0495638_0132994	Ga0495638_0132994_145_1074	309
943	3300046460	Ga0495638_0154899	Ga0495638_0154899_90_1019	309
944	3300046463	Ga0495653_0004321	Ga0495653_0004321_10178_11107	309
945	3300046463	Ga0495653_0012643	Ga0495653_0012643_2997_3926	309
946	3300046463	Ga0495653_0061487	Ga0495653_0061487_151_1080	309
947	3300046471	Ga0495650_0001743	Ga0495650_0001743_6856_7785	309
948	3300046471	Ga0495650_0012206	Ga0495650_0012206_2929_3858	309
949	3300046471	Ga0495650_0069233	Ga0495650_0069233_12_941	309
950	3300046473	Ga0495582_0011017	Ga0495582_0011017_51_980	309
951	3300046474	Ga0495605_0000033	Ga0495605_0000033_190116_191045	309
952	3300046474	Ga0495605_0000209	Ga0495605_0000209_53247_54176	309
953	3300046474	Ga0495605_0000724	Ga0495605_0000724_17943_18872	309
954	3300046474	Ga0495605_0001216	Ga0495605_0001216_5808_6737	309
955	3300046474	Ga0495605_0002110	Ga0495605_0002110_4830_5759	309
956	3300046474	Ga0495605_0002428	Ga0495605_0002428_9210_10139	309
957	3300046474	Ga0495605_0055683	Ga0495605_0055683_796_1725	309
958	3300046474	Ga0495605_0060262	Ga0495605_0060262_245_1174	309
959	3300046475	Ga0495639_0000248	Ga0495639_0000248_15205_16134	309
960	3300046491	Ga0495584_0003840	Ga0495584_0003840_7213_8142	309
961	3300046491	Ga0495584_0004092	Ga0495584_0004092_6053_6982	309
962	3300046491	Ga0495584_0005915	Ga0495584_0005915_5297_6226	309
963	3300046491	Ga0495584_0009286	Ga0495584_0009286_1229_2158	309
964	3300046491	Ga0495584_0012329	Ga0495584_0012329_820_1749	309
965	3300046491	Ga0495584_0046121	Ga0495584_0046121_467_1396	309
966	3300046491	Ga0495584_0070840	Ga0495584_0070840_192_1121	309
967	3300046492	Ga0495585_0000827	Ga0495585_0000827_18586_19515	309
968	3300046492	Ga0495585_0003238	Ga0495585_0003238_7654_8583	309
969	3300046492	Ga0495585_0010256	Ga0495585_0010256_1514_2443	309
970	3300046492	Ga0495585_0035645	Ga0495585_0035645_524_1453	309
971	3300046499	Ga0495594_0001886	Ga0495594_0001886_4898_5827	309
972	3300046499	Ga0495594_0028708	Ga0495594_0028708_785_1714	309
973	3300046499	Ga0495594_0074567	Ga0495594_0074567_561_1490	309
974	3300046499	Ga0495594_0210086	Ga0495594_0210086_62_991	309
975	3300046500	Ga0495596_0000258	Ga0495596_0000258_9899_10828	309
976	3300046501	Ga0495607_0000482	Ga0495607_0000482_23555_24484	309
977	3300046501	Ga0495607_0001003	Ga0495607_0001003_16392_17321	309
978	3300046501	Ga0495607_0002109	Ga0495607_0002109_6745_7674	309
979	3300046501	Ga0495607_0002221	Ga0495607_0002221_9469_10398	309
980	3300046501	Ga0495607_0003809	Ga0495607_0003809_878_1807	309
981	3300046501	Ga0495607_0006727	Ga0495607_0006727_2198_3127	309
982	3300046501	Ga0495607_0014898	Ga0495607_0014898_2612_3541	309
983	3300046501	Ga0495607_0020589	Ga0495607_0020589_1841_2770	309
984	3300046501	Ga0495607_0049175	Ga0495607_0049175_858_1787	309
985	3300046501	Ga0495607_0056587	Ga0495607_0056587_57_986	309
986	3300046501	Ga0495607_0063608	Ga0495607_0063608_851_1780	309
987	3300046501	Ga0495607_0089826	Ga0495607_0089826_694_1623	309
988	3300046506	Ga0495583_0000031	Ga0495583_0000031_50447_51376	309
989	3300046506	Ga0495583_0005408	Ga0495583_0005408_2202_3131	309
990	3300046507	Ga0495606_0001996	Ga0495606_0001996_11305_12264	309
991	3300046507	Ga0495606_0004534	Ga0495606_0004534_7046_7975	309
992	3300046507	Ga0495606_0008324	Ga0495606_0008324_3760_4689	309
993	3300046507	Ga0495606_0008615	Ga0495606_0008615_7062_7991	309
994	3300046507	Ga0495606_0010298	Ga0495606_0010298_1938_2867	309
995	3300046512	Ga0495610_0003091	Ga0495610_0003091_8330_9259	309
996	3300046512	Ga0495610_0004211	Ga0495610_0004211_2308_3237	309
997	3300046512	Ga0495610_0005602	Ga0495610_0005602_7067_7996	309
998	3300046512	Ga0495610_0010339	Ga0495610_0010339_3301_4230	309
999	3300046512	Ga0495610_0029984	Ga0495610_0029984_1184_2113	309
1000	3300046512	Ga0495610_0034423	Ga0495610_0034423_1000_1929	309
1001	3300046513	Ga0495616_0003090	Ga0495616_0003090_9076_10005	309
1002	3300046513	Ga0495616_0013441	Ga0495616_0013441_865_1794	309
1003	3300046513	Ga0495616_0013589	Ga0495616_0013589_1085_2014	309
1004	3300046515	Ga0495620_0000112	Ga0495620_0000112_49093_50022	309
1005	3300046515	Ga0495620_0000828	Ga0495620_0000828_15207_16136	309
1006	3300046515	Ga0495620_0008305	Ga0495620_0008305_2283_3212	309
1007	3300046515	Ga0495620_0011338	Ga0495620_0011338_2500_3429	309
1008	3300046515	Ga0495620_0039267	Ga0495620_0039267_1055_1984	309
1009	3300046516	Ga0495628_0289889	Ga0495628_0289889_67_996	309
1010	3300046517	Ga0495630_0066396	Ga0495630_0066396_503_1432	309
1011	3300046517	Ga0495630_0146721	Ga0495630_0146721_440_1369	309
1012	3300046518	Ga0495631_0000301	Ga0495631_0000301_7166_8095	309
1013	3300046518	Ga0495631_0062366	Ga0495631_0062366_653_1582	309
1014	3300046519	Ga0495632_0004714	Ga0495632_0004714_5647_6576	309
1015	3300046519	Ga0495632_0005896	Ga0495632_0005896_38_967	309
1016	3300046519	Ga0495632_0038139	Ga0495632_0038139_1258_2187	309
1017	3300046519	Ga0495632_0051797	Ga0495632_0051797_980_1909	309
1018	3300046519	Ga0495632_0089243	Ga0495632_0089243_74_1003	309
1019	3300046519	Ga0495632_0157459	Ga0495632_0157459_56_985	309
1020	3300046520	Ga0495637_0000110	Ga0495637_0000110_43670_44599	309
1021	3300046520	Ga0495637_0000992	Ga0495637_0000992_15821_16750	309
1022	3300046520	Ga0495637_0001007	Ga0495637_0001007_5634_6563	309
1023	3300046520	Ga0495637_0008873	Ga0495637_0008873_2025_2954	309
1024	3300046520	Ga0495637_0009654	Ga0495637_0009654_1757_2686	309
1025	3300046520	Ga0495637_0014118	Ga0495637_0014118_737_1666	309
1026	3300046520	Ga0495637_0014644	Ga0495637_0014644_820_1749	309
1027	3300046520	Ga0495637_0021635	Ga0495637_0021635_884_1852	309
1028	3300046520	Ga0495637_0040647	Ga0495637_0040647_486_1415	309
1029	3300046522	Ga0495643_0018938	Ga0495643_0018938_1971_2900	309
1030	3300046522	Ga0495643_0062683	Ga0495643_0062683_429_1358	309
1031	3300046522	Ga0495643_0065887	Ga0495643_0065887_215_1144	309
1032	3300046522	Ga0495643_0089057	Ga0495643_0089057_597_1526	309
1033	3300046523	Ga0495644_0005691	Ga0495644_0005691_2182_3111	309
1034	3300046523	Ga0495644_0011953	Ga0495644_0011953_454_1383	309
1035	3300046523	Ga0495644_0013449	Ga0495644_0013449_1156_2085	309
1036	3300046523	Ga0495644_0107453	Ga0495644_0107453_20_949	309
1037	3300046524	Ga0495648_0001399	Ga0495648_0001399_6729_7658	309
1038	3300046524	Ga0495648_0001400	Ga0495648_0001400_13138_14067	309
1039	3300046524	Ga0495648_0005266	Ga0495648_0005266_8009_8938	309
1040	3300046524	Ga0495648_0008111	Ga0495648_0008111_74_1003	309
1041	3300046524	Ga0495648_0018873	Ga0495648_0018873_894_1823	309
1042	3300046524	Ga0495648_0097842	Ga0495648_0097842_389_1318	309
1043	3300046526	Ga0495666_0044267	Ga0495666_0044267_1089_2018	309
1044	3300046528	Ga0495642_0000266	Ga0495642_0000266_19187_20116	309
1045	3300046528	Ga0495642_0001492	Ga0495642_0001492_580_1509	309
1046	3300046530	Ga0495654_0002156	Ga0495654_0002156_2153_3082	309
1047	3300046530	Ga0495654_0003548	Ga0495654_0003548_6533_7462	309
1048	3300046530	Ga0495654_0004669	Ga0495654_0004669_4998_5927	309
1049	3300046530	Ga0495654_0008678	Ga0495654_0008678_3747_4676	309
1050	3300046530	Ga0495654_0018367	Ga0495654_0018367_2156_3085	309
1051	3300046530	Ga0495654_0019267	Ga0495654_0019267_2235_3164	309
1052	3300046530	Ga0495654_0023606	Ga0495654_0023606_32_961	309
1053	3300046530	Ga0495654_0036053	Ga0495654_0036053_1383_2447	309
1054	3300046530	Ga0495654_0056814	Ga0495654_0056814_641_1570	309
1055	3300046530	Ga0495654_0119556	Ga0495654_0119556_23_1087	309
1056	3300046535	Ga0495586_0003234	Ga0495586_0003234_7302_8231	309
1057	3300046536	Ga0495587_0003138	Ga0495587_0003138_3042_3971	309
1058	3300046536	Ga0495587_0097658	Ga0495587_0097658_174_1103	309
1059	3300046538	Ga0495609_0000018	Ga0495609_0000018_289848_290777	309
1060	3300046538	Ga0495609_0000089	Ga0495609_0000089_87545_88474	309
1061	3300046538	Ga0495609_0005970	Ga0495609_0005970_2039_2968	309
1062	3300046538	Ga0495609_0022644	Ga0495609_0022644_835_1764	309
1063	3300046542	Ga0495597_0000026	Ga0495597_0000026_19419_20348	309
1064	3300046542	Ga0495597_0000450	Ga0495597_0000450_13716_14669	309
1065	3300046542	Ga0495597_0023840	Ga0495597_0023840_1051_1980	309
1066	3300046542	Ga0495597_0024352	Ga0495597_0024352_1036_1965	309
1067	3300046542	Ga0495597_0032304	Ga0495597_0032304_88_1017	309
1068	3300046542	Ga0495597_0033502	Ga0495597_0033502_822_1751	309
1069	3300046542	Ga0495597_0055286	Ga0495597_0055286_367_1296	309
1070	3300046542	Ga0495597_0062982	Ga0495597_0062982_69_998	309
1071	3300046543	Ga0495645_0184199	Ga0495645_0184199_371_1300	309
1072	3300046557	Ga0495622_0000572	Ga0495622_0000572_5939_6868	309
1073	3300046557	Ga0495622_0021670	Ga0495622_0021670_1003_1932	309
1074	3300046557	Ga0495622_0094731	Ga0495622_0094731_14_943	309
1075	3300046558	Ga0495633_0000062	Ga0495633_0000062_45379_46308	309
1076	3300046558	Ga0495633_0014096	Ga0495633_0014096_2587_3516	309
1077	3300046558	Ga0495633_0058601	Ga0495633_0058601_429_1358	309
1078	3300046615	Ga0495656_0001543	Ga0495656_0001543_3421_4350	309
1079	3300046615	Ga0495656_0093794	Ga0495656_0093794_384_1313	309
1080	3300046616	Ga0495668_0001154	Ga0495668_0001154_6990_7919	309
1081	3300046616	Ga0495668_0010735	Ga0495668_0010735_2965_3894	309
1082	3300046616	Ga0495668_0017093	Ga0495668_0017093_782_1711	309
1083	3300046616	Ga0495668_0069639	Ga0495668_0069639_202_1131	309
1084	3300046616	Ga0495668_0119799	Ga0495668_0119799_51_980	309
1085	3300046642	Ga0495634_0011635	Ga0495634_0011635_3352_4281	309
1086	3300046642	Ga0495634_0050087	Ga0495634_0050087_1050_1979	309
1087	3300046642	Ga0495634_0167399	Ga0495634_0167399_239_1168	309
1088	3300046648	Ga0495611_0002957	Ga0495611_0002957_6375_7304	309
1089	3300046648	Ga0495611_0109178	Ga0495611_0109178_229_1158	309
1090	3300046660	Ga0495625_0007579	Ga0495625_0007579_7141_8070	309
1091	3300046660	Ga0495625_0033955	Ga0495625_0033955_1019_1948	309
1092	3300046660	Ga0495625_0066780	Ga0495625_0066780_1026_1955	309
1093	3300046660	Ga0495625_0092520	Ga0495625_0092520_983_1912	309
1094	3300046660	Ga0495625_0167870	Ga0495625_0167870_497_1426	309
1095	3300046663	Ga0495635_0019967	Ga0495635_0019967_460_1389	309
1096	3300046664	Ga0495659_0000153	Ga0495659_0000153_22621_23550	309
1097	3300046664	Ga0495659_0007174	Ga0495659_0007174_180_1109	309
1098	3300046665	Ga0495661_0000016	Ga0495661_0000016_174791_175720	309
1099	3300046665	Ga0495661_0009333	Ga0495661_0009333_4939_5868	309
1100	3300046665	Ga0495661_0018665	Ga0495661_0018665_2529_3458	309
1101	3300046665	Ga0495661_0041493	Ga0495661_0041493_987_1916	309
1102	3300046665	Ga0495661_0081585	Ga0495661_0081585_592_1521	309
1103	3300046665	Ga0495661_0106470	Ga0495661_0106470_566_1495	309
1104	3300046674	Ga0495588_0084267	Ga0495588_0084267_40_969	309
1105	3300046679	Ga0495623_0016837	Ga0495623_0016837_2143_3072	309
1106	3300046679	Ga0495623_0084013	Ga0495623_0084013_364_1293	309
1107	3300046680	Ga0495646_0006936	Ga0495646_0006936_5227_6156	309
1108	3300046680	Ga0495646_0084552	Ga0495646_0084552_160_1089	309
1109	3300046684	Ga0495669_0004547	Ga0495669_0004547_939_1868	309
1110	3300046689	Ga0495613_0028408	Ga0495613_0028408_3063_3992	309
1111	3300046689	Ga0495613_0103787	Ga0495613_0103787_742_1671	309
1112	3300046689	Ga0495613_0132213	Ga0495613_0132213_40_969	309
1113	3300046690	Ga0495624_0000545	Ga0495624_0000545_8846_9775	309
1114	3300046691	Ga0495670_0001158	Ga0495670_0001158_5761_6690	309
1115	3300046691	Ga0495670_0008168	Ga0495670_0008168_866_1795	309
1116	3300046691	Ga0495670_0014622	Ga0495670_0014622_894_1823	309
1117	3300046691	Ga0495670_0120822	Ga0495670_0120822_158_1087	309
1118	3300046692	Ga0495671_0000336	Ga0495671_0000336_31083_32012	309
1119	3300046692	Ga0495671_0001377	Ga0495671_0001377_1435_2364	309
1120	3300046692	Ga0495671_0003558	Ga0495671_0003558_1559_2488	309
1121	3300046692	Ga0495671_0037758	Ga0495671_0037758_581_1510	309
1122	3300046694	Ga0495649_0005075	Ga0495649_0005075_770_1699	309
1123	3300046694	Ga0495649_0034486	Ga0495649_0034486_1589_2518	309
1124	3300046694	Ga0495649_0067717	Ga0495649_0067717_602_1531	309
1125	3300046694	Ga0495649_0205567	Ga0495649_0205567_55_984	309
1126	3300046794	Ga0495589_0001485	Ga0495589_0001485_8184_9113	309
1127	3300046794	Ga0495589_0002334	Ga0495589_0002334_1535_2464	309
1128	3300046794	Ga0495589_0003113	Ga0495589_0003113_7168_8097	309
1129	3300046794	Ga0495589_0048920	Ga0495589_0048920_750_1679	309
1130	3300046794	Ga0495589_0058747	Ga0495589_0058747_692_1621	309
1131	3300046794	Ga0495589_0083614	Ga0495589_0083614_547_1476	309
1132	3300046809	Ga0495600_0082079	Ga0495600_0082079_791_1720	309
1133	3300046809	Ga0495600_0259674	Ga0495600_0259674_93_1022	309
1134	3300046810	Ga0495660_0000540	Ga0495660_0000540_10075_11004	309
1135	3300046810	Ga0495660_0001212	Ga0495660_0001212_9924_10853	309
1136	3300046810	Ga0495660_0011701	Ga0495660_0011701_384_1313	309
1137	3300046810	Ga0495660_0015075	Ga0495660_0015075_807_1736	309
1138	3300046810	Ga0495660_0049237	Ga0495660_0049237_385_1314	309
1139	3300046810	Ga0495660_0056937	Ga0495660_0056937_468_1397	309
1140	3300046810	Ga0495660_0093128	Ga0495660_0093128_482_1411	309
1141	3300046810	Ga0495660_0111976	Ga0495660_0111976_189_1118	309
1142	3300046810	Ga0495660_0121857	Ga0495660_0121857_96_1025	309
1143	3300047315	Ga0495581_0187298	Ga0495581_0187298_222_1151	309
1144	3300047317	Ga0495604_0028990	Ga0495604_0028990_386_1315	309
1145	3300047317	Ga0495604_0155797	Ga0495604_0155797_175_1104	309
1146	3300047317	Ga0495604_0225927	Ga0495604_0225927_174_1103	309
1147	3300047318	Ga0495636_0019750	Ga0495636_0019750_981_1910	309
1148	3300047319	Ga0495674_0037309	Ga0495674_0037309_3022_3951	309
1149	3300047320	Ga0495672_0009359	Ga0495672_0009359_160_1089	309
1150	3300047320	Ga0495672_0013087	Ga0495672_0013087_4427_5356	309
1151	3300047320	Ga0495672_0020811	Ga0495672_0020811_1292_2221	309
1152	3300047320	Ga0495672_0023220	Ga0495672_0023220_2523_3452	309
1153	3300047320	Ga0495672_0043403	Ga0495672_0043403_179_1108	309
1154	3300047320	Ga0495672_0051953	Ga0495672_0051953_866_1795	309
1155	3300047320	Ga0495672_0061160	Ga0495672_0061160_1215_2144	309
1156	3300047321	Ga0495676_0068030	Ga0495676_0068030_1449_2378	309
1157	3300047322	Ga0495680_0014916	Ga0495680_0014916_386_1315	309
1158	3300047322	Ga0495680_0050466	Ga0495680_0050466_816_1745	309
1159	3300047322	Ga0495680_0293275	Ga0495680_0293275_116_1045	309
1160	3300047323	Ga0495683_0000137	Ga0495683_0000137_21332_22261	309
1161	3300047323	Ga0495683_0000404	Ga0495683_0000404_26570_27499	309
1162	3300047323	Ga0495683_0003719	Ga0495683_0003719_824_1753	309
1163	3300047323	Ga0495683_0021554	Ga0495683_0021554_2064_2993	309
1164	3300047323	Ga0495683_0045419	Ga0495683_0045419_409_1338	309
1165	3300047323	Ga0495683_0065787	Ga0495683_0065787_716_1645	309
1166	3300047443	Ga0495687_041371	Ga0495687_041371_290_1219	309
1167	3300047444	Ga0495675_0083259	Ga0495675_0083259_116_1045	309
1168	3300047445	Ga0495677_0000491	Ga0495677_0000491_8959_9888	309
1169	3300047446	Ga0495679_000368	Ga0495679_000368_21370_22299	309
1170	3300047446	Ga0495679_019569	Ga0495679_019569_665_1594	309
1171	3300047469	Ga0495673_0000487	Ga0495673_0000487_17792_18721	309
1172	3300047469	Ga0495673_0000630	Ga0495673_0000630_26599_27528	309
1173	3300047469	Ga0495673_0000858	Ga0495673_0000858_17518_18447	309
1174	3300047469	Ga0495673_0002165	Ga0495673_0002165_7718_8647	309
1175	3300047469	Ga0495673_0002217	Ga0495673_0002217_10153_11082	309
1176	3300047469	Ga0495673_0017963	Ga0495673_0017963_891_1820	309
1177	3300047469	Ga0495673_0019827	Ga0495673_0019827_2196_3125	309
1178	3300047469	Ga0495673_0024704	Ga0495673_0024704_903_1832	309
1179	3300047469	Ga0495673_0062817	Ga0495673_0062817_429_1358	309
1180	3300047469	Ga0495673_0102535	Ga0495673_0102535_161_1090	309
1181	3300047470	Ga0495681_0004112	Ga0495681_0004112_5914_6843	309
1182	3300047470	Ga0495681_0004409	Ga0495681_0004409_7893_8822	309
1183	3300047470	Ga0495681_0005030	Ga0495681_0005030_853_1782	309
1184	3300047470	Ga0495681_0011714	Ga0495681_0011714_730_1659	309
1185	3300047470	Ga0495681_0012841	Ga0495681_0012841_2375_3304	309
1186	3300047470	Ga0495681_0014402	Ga0495681_0014402_3204_4133	309
1187	3300047470	Ga0495681_0014427	Ga0495681_0014427_977_1906	309
1188	3300047470	Ga0495681_0014790	Ga0495681_0014790_929_1858	309
1189	3300047470	Ga0495681_0016828	Ga0495681_0016828_2320_3249	309
1190	3300047470	Ga0495681_0035744	Ga0495681_0035744_1246_2175	309
1191	3300047470	Ga0495681_0101470	Ga0495681_0101470_31_960	309
1192	3300047471	Ga0495684_0108031	Ga0495684_0108031_357_1286	309
1193	3300047472	Ga0495686_0004777	Ga0495686_0004777_2956_3885	309
1194	3300047472	Ga0495686_0051787	Ga0495686_0051787_800_1729	309
1195	3300047673	Ga0495593_0005579	Ga0495593_0005579_6119_7048	309
1196	3300047673	Ga0495593_0007312	Ga0495593_0007312_2169_3098	309
1197	3300047673	Ga0495593_0114204	Ga0495593_0114204_105_1034	309
1198	3300048088	Ga0495602_0117762	Ga0495602_0117762_828_1757	309
1199	3300048091	Ga0495626_0001022	Ga0495626_0001022_17289_18218	309
1200	3300048091	Ga0495626_0001131	Ga0495626_0001131_1236_2165	309
1201	3300048091	Ga0495626_0004273	Ga0495626_0004273_7040_7969	309
1202	3300048091	Ga0495626_0007133	Ga0495626_0007133_939_1868	309
1203	3300048091	Ga0495626_0023186	Ga0495626_0023186_13_942	309
1204	3300048091	Ga0495626_0096152	Ga0495626_0096152_325_1254	309
1205	3300048091	Ga0495626_0145040	Ga0495626_0145040_52_981	309
1206	3300048905	Ga0496102_0004886	Ga0496102_0004886_7045_7974	309
1207	3300048906	Ga0496103_0007615	Ga0496103_0007615_3250_4179	309
1208	3300048906	Ga0496103_0218552	Ga0496103_0218552_205_1134	309
1209	3300048913	Ga0496110_0206313	Ga0496110_0206313_495_1424	309
1210	3300048913	Ga0496110_0264895	Ga0496110_0264895_32_961	309
1211	3300048919	Ga0496116_0000488	Ga0496116_0000488_34914_35843	309
1212	3300048919	Ga0496116_0002272	Ga0496116_0002272_15292_16221	309
1213	3300048919	Ga0496116_0041202	Ga0496116_0041202_973_1902	309
1214	3300048919	Ga0496116_0072929	Ga0496116_0072929_850_1779	309
1215	3300048919	Ga0496116_0115501	Ga0496116_0115501_193_1122	309
1216	3300048920	Ga0496117_0001488	Ga0496117_0001488_29944_30873	309
1217	3300048920	Ga0496117_0032142	Ga0496117_0032142_232_1161	309
1218	3300048921	Ga0496118_0019679	Ga0496118_0019679_3017_3946	309
1219	3300048921	Ga0496118_0021406	Ga0496118_0021406_1990_2919	309
1220	3300048921	Ga0496118_0022135	Ga0496118_0022135_2946_3875	309
1221	3300048921	Ga0496118_0034789	Ga0496118_0034789_2786_3715	309
1222	3300048922	Ga0496119_0128542	Ga0496119_0128542_68_997	309
1223	3300048924	Ga0496121_0000867	Ga0496121_0000867_35071_36000	309
1224	3300048924	Ga0496121_0002170	Ga0496121_0002170_19276_20205	309
1225	3300048924	Ga0496121_0006946	Ga0496121_0006946_8439_9368	309
1226	3300048924	Ga0496121_0106211	Ga0496121_0106211_849_1778	309
1227	3300048925	Ga0496122_0000434	Ga0496122_0000434_74154_75083	309
1228	3300048925	Ga0496122_0005011	Ga0496122_0005011_6912_7841	309
1229	3300048925	Ga0496122_0008822	Ga0496122_0008822_2913_3842	309
1230	3300048925	Ga0496122_0020676	Ga0496122_0020676_3157_4086	309
1231	3300048925	Ga0496122_0034709	Ga0496122_0034709_559_1488	309
1232	3300048926	Ga0496123_0000318	Ga0496123_0000318_12454_13383	309
1233	3300048926	Ga0496123_0002268	Ga0496123_0002268_16104_17033	309
1234	3300048926	Ga0496123_0006054	Ga0496123_0006054_2725_3654	309
1235	3300048926	Ga0496123_0019029	Ga0496123_0019029_2660_3589	309
1236	3300048926	Ga0496123_0207078	Ga0496123_0207078_55_984	309
1237	3300048927	Ga0496124_0006570	Ga0496124_0006570_6774_7703	309
1238	3300048927	Ga0496124_0028084	Ga0496124_0028084_3458_4387	309
1239	3300048927	Ga0496124_0212017	Ga0496124_0212017_401_1330	309
1240	3300048927	Ga0496124_0216433	Ga0496124_0216433_135_1064	309
1241	3300048927	Ga0496124_0278934	Ga0496124_0278934_243_1172	309
1242	3300048928	Ga0496125_0032717	Ga0496125_0032717_2647_3576	309
1243	3300048928	Ga0496125_0087632	Ga0496125_0087632_327_1256	309
1244	3300048928	Ga0496125_0116206	Ga0496125_0116206_749_1678	309
1245	3300048928	Ga0496125_0154703	Ga0496125_0154703_70_999	309
1246	3300048928	Ga0496125_0157548	Ga0496125_0157548_572_1501	309
1247	3300048929	Ga0496126_0136923	Ga0496126_0136923_531_1460	309
1248	3300049459	Ga0495678_000021	Ga0495678_000021_192482_193411	309
1249	3300049459	Ga0495678_000169	Ga0495678_000169_60091_61020	309
1250	3300049459	Ga0495678_012904	Ga0495678_012904_1629_2558	309
1251	3300049459	Ga0495678_014590	Ga0495678_014590_1925_2854	309
1252	3300049459	Ga0495678_021234	Ga0495678_021234_759_1688	309
1253	3300049459	Ga0495678_035109	Ga0495678_035109_592_1521	309
1254	3300049460	Ga0495682_0000597	Ga0495682_0000597_15229_16158	309
1255	3300049569	Ga0501032_0003203	Ga0501032_0003203_8753_9682	309
1256	3300049571	Ga0501034_0275061	Ga0501034_0275061_181_1110	309
1257	3300049853	Ga0501226_000004	Ga0501226_000004_230022_230951	309
1258	3300050491	nmdc:mga00v17_33145_c1	nmdc:mga00v17_33145_c1_100_1029	309
1259	3300053140	Ga0500573_0008058	Ga0500573_0008058_1331_2260	309
1260	iso_pu_bacteria	2511231022	2511362945	309
1261	iso_pu_bacteria	2554235341	2555672429	309
1262	2162886007	SwRhRL2b_contig_1545246	SwRhRL2b_0617.00001610	310
1263	3300003781	Ga0055536_1002037	Ga0055536_10020372	310
1264	3300003856	Ga0058692_1013102	Ga0058692_10131022	310
1265	3300005288	Ga0065714_10002270	Ga0065714_1000227025	310
1266	3300005289	Ga0065704_10006911	Ga0065704_100069112	310
1267	3300005289	Ga0065704_10081410	Ga0065704_100814104	310
1268	3300005347	Ga0070668_100411024	Ga0070668_1004110241	310
1269	3300005548	Ga0070665_100072536	Ga0070665_1000725363	310
1270	3300005548	Ga0070665_100122588	Ga0070665_1001225882	310
1271	3300006944	Ga0099823_1000360	Ga0099823_100036014	310
1272	3300006946	Ga0079104_1030300	Ga0079104_10303001	310
1273	3300009011	Ga0105251_10012324	Ga0105251_100123244	310
1274	3300009011	Ga0105251_10020575	Ga0105251_100205753	310
1275	3300009011	Ga0105251_10038764	Ga0105251_100387642	310
1276	3300009036	Ga0105244_10018231	Ga0105244_100182312	310
1277	3300009036	Ga0105244_10053027	Ga0105244_100530271	310
1278	3300009036	Ga0105244_10060701	Ga0105244_100607012	310
1279	3300009036	Ga0105244_10079259	Ga0105244_100792592	310
1280	3300009036	Ga0105244_10097145	Ga0105244_100971452	310
1281	3300009092	Ga0105250_10005432	Ga0105250_100054325	310
1282	3300009148	Ga0105243_10073289	Ga0105243_100732893	310
1283	3300009148	Ga0105243_10140003	Ga0105243_101400031	310
1284	3300012498	Ga0157345_1000195	Ga0157345_10001952	310
1285	3300013100	Ga0157373_10005866	Ga0157373_100058662	310
1286	3300013102	Ga0157371_10001343	Ga0157371_100013437	310
1287	3300013102	Ga0157371_10050747	Ga0157371_100507472	310
1288	3300013105	Ga0157369_10015739	Ga0157369_100157399	310
1289	3300013306	Ga0163162_10010341	Ga0163162_100103412	310
1290	3300014497	Ga0182008_10012415	Ga0182008_100124154	310
1291	3300015261	Ga0182006_1013082	Ga0182006_10130822	310
1292	3300017792	Ga0163161_10109447	Ga0163161_101094471	310
1293	3300025292	Ga0209676_1000314	Ga0209676_100031424	310
1294	3300025292	Ga0209676_1001941	Ga0209676_10019415	310
1295	3300025711	Ga0207696_1000118	Ga0207696_100011853	310
1296	3300025711	Ga0207696_1005288	Ga0207696_10052884	310
1297	3300025711	Ga0207696_1009034	Ga0207696_10090343	310
1298	3300025728	Ga0207655_1000415	Ga0207655_100041520	310
1299	3300025728	Ga0207655_1000921	Ga0207655_100092117	310
1300	3300025728	Ga0207655_1008138	Ga0207655_10081383	310
1301	3300025728	Ga0207655_1048622	Ga0207655_10486222	310
1302	3300025735	Ga0207713_1002325	Ga0207713_100232515	310
1303	3300025735	Ga0207713_1013089	Ga0207713_10130893	310
1304	3300025935	Ga0207709_10003423	Ga0207709_100034232	310
1305	3300027111	Ga0209281_1016651	Ga0209281_10166512	310
1306	3300027296	Ga0209389_1000020	Ga0209389_100002073	310
1307	3300027312	Ga0209371_1000302	Ga0209371_100030222	310
1308	3300028379	Ga0268266_10008566	Ga0268266_100085663	310
1309	3300030500	Ga0268256_1000669	Ga0268256_100066910	310
1310	3300030734	Ga0316179_1066345	Ga0316179_10663453	310
1311	3300031548	Ga0307408_100094552	Ga0307408_1000945522	310
1312	3300031731	Ga0307405_10059983	Ga0307405_100599832	310
1313	3300031903	Ga0307407_10219198	Ga0307407_102191981	310
1314	3300031911	Ga0307412_10111492	Ga0307412_101114922	310
1315	3300031911	Ga0307412_10127891	Ga0307412_101278912	310
1316	3300031911	Ga0307412_10247852	Ga0307412_102478522	310
1317	3300032002	Ga0307416_100282968	Ga0307416_1002829682	310
1318	3300032004	Ga0307414_10164071	Ga0307414_101640712	310
1319	3300033180	Ga0307510_10014907	Ga0307510_100149072	310
1320	3300041405	Ga0439438_002662	Ga0439438_002662_5951_6883	310
1321	3300041405	Ga0439438_016233	Ga0439438_016233_420_1352	310
1322	3300042004	Ga0439445_0007177	Ga0439445_0007177_247_1179	310
1323	3300042006	Ga0439432_001292	Ga0439432_001292_5231_6163	310
1324	3300042006	Ga0439432_037011	Ga0439432_037011_171_1103	310
1325	3300042006	Ga0439432_058000	Ga0439432_058000_204_1136	310
1326	3300042010	Ga0439452_002361	Ga0439452_002361_848_1780	310
1327	3300042115	Ga0450911_000160	Ga0450911_000160_16599_17531	310
1328	3300042137	Ga0450902_000289	Ga0450902_000289_4647_5579	310
1329	3300042139	Ga0450904_004817	Ga0450904_004817_219_1151	310
1330	3300042142	Ga0450905_000440	Ga0450905_000440_459_1391	310
1331	3300042439	Ga0439464_0010708	Ga0439464_0010708_779_1711	310
1332	3300042533	Ga0450901_000091	Ga0450901_000091_4024_4956	310
1333	3300046452	Ga0495617_028745	Ga0495617_028745_791_1723	310
1334	3300046452	Ga0495617_034018	Ga0495617_034018_233_1165	310
1335	3300046453	Ga0495627_005759	Ga0495627_005759_780_1712	310
1336	3300046453	Ga0495627_020390	Ga0495627_020390_485_1417	310
1337	3300046453	Ga0495627_023831	Ga0495627_023831_798_1730	310
1338	3300046457	Ga0495590_0045746	Ga0495590_0045746_262_1194	310
1339	3300046458	Ga0495591_002812	Ga0495591_002812_366_1298	310
1340	3300046458	Ga0495591_004908	Ga0495591_004908_4640_5572	310
1341	3300046458	Ga0495591_016854	Ga0495591_016854_751_1683	310
1342	3300046458	Ga0495591_022401	Ga0495591_022401_783_1715	310
1343	3300046458	Ga0495591_037789	Ga0495591_037789_287_1219	310
1344	3300046458	Ga0495591_047496	Ga0495591_047496_171_1103	310
1345	3300046460	Ga0495638_0004957	Ga0495638_0004957_796_1728	310
1346	3300046460	Ga0495638_0025060	Ga0495638_0025060_786_1718	310
1347	3300046463	Ga0495653_0126780	Ga0495653_0126780_314_1246	310
1348	3300046471	Ga0495650_0070179	Ga0495650_0070179_175_1107	310
1349	3300046474	Ga0495605_0006812	Ga0495605_0006812_3631_4563	310
1350	3300046491	Ga0495584_0040440	Ga0495584_0040440_673_1605	310
1351	3300046491	Ga0495584_0060272	Ga0495584_0060272_758_1690	310
1352	3300046492	Ga0495585_0026275	Ga0495585_0026275_132_1064	310
1353	3300046492	Ga0495585_0055804	Ga0495585_0055804_944_1876	310
1354	3300046492	Ga0495585_0061632	Ga0495585_0061632_327_1259	310
1355	3300046500	Ga0495596_0034997	Ga0495596_0034997_272_1204	310
1356	3300046501	Ga0495607_0066820	Ga0495607_0066820_784_1716	310
1357	3300046501	Ga0495607_0146276	Ga0495607_0146276_171_1103	310
1358	3300046506	Ga0495583_0003344	Ga0495583_0003344_4259_5191	310
1359	3300046506	Ga0495583_0020352	Ga0495583_0020352_1724_2656	310
1360	3300046507	Ga0495606_0013937	Ga0495606_0013937_757_1689	310
1361	3300046507	Ga0495606_0020705	Ga0495606_0020705_796_1728	310
1362	3300046507	Ga0495606_0045420	Ga0495606_0045420_737_1669	310
1363	3300046507	Ga0495606_0051663	Ga0495606_0051663_68_1000	310
1364	3300046512	Ga0495610_0009045	Ga0495610_0009045_804_1736	310
1365	3300046512	Ga0495610_0047751	Ga0495610_0047751_783_1715	310
1366	3300046513	Ga0495616_0019873	Ga0495616_0019873_2010_2942	310
1367	3300046513	Ga0495616_0028861	Ga0495616_0028861_787_1719	310
1368	3300046513	Ga0495616_0060620	Ga0495616_0060620_781_1713	310
1369	3300046515	Ga0495620_0000222	Ga0495620_0000222_2777_3709	310
1370	3300046515	Ga0495620_0002192	Ga0495620_0002192_782_1714	310
1371	3300046515	Ga0495620_0016733	Ga0495620_0016733_1968_2900	310
1372	3300046515	Ga0495620_0044472	Ga0495620_0044472_221_1153	310
1373	3300046515	Ga0495620_0094108	Ga0495620_0094108_197_1129	310
1374	3300046518	Ga0495631_0011250	Ga0495631_0011250_795_1727	310
1375	3300046519	Ga0495632_0001768	Ga0495632_0001768_2575_3507	310
1376	3300046519	Ga0495632_0041456	Ga0495632_0041456_785_1717	310
1377	3300046519	Ga0495632_0042661	Ga0495632_0042661_562_1494	310
1378	3300046519	Ga0495632_0060000	Ga0495632_0060000_136_1068	310
1379	3300046519	Ga0495632_0094903	Ga0495632_0094903_222_1154	310
1380	3300046520	Ga0495637_0005733	Ga0495637_0005733_794_1726	310
1381	3300046520	Ga0495637_0041076	Ga0495637_0041076_12_944	310
1382	3300046520	Ga0495637_0044783	Ga0495637_0044783_170_1102	310
1383	3300046522	Ga0495643_0001951	Ga0495643_0001951_2851_3783	310
1384	3300046522	Ga0495643_0009583	Ga0495643_0009583_4795_5727	310
1385	3300046522	Ga0495643_0022277	Ga0495643_0022277_786_1718	310
1386	3300046522	Ga0495643_0050316	Ga0495643_0050316_724_1656	310
1387	3300046524	Ga0495648_0002582	Ga0495648_0002582_2903_3835	310
1388	3300046524	Ga0495648_0007113	Ga0495648_0007113_7300_8232	310
1389	3300046524	Ga0495648_0029634	Ga0495648_0029634_802_1734	310
1390	3300046524	Ga0495648_0081481	Ga0495648_0081481_146_1078	310
1391	3300046530	Ga0495654_0056787	Ga0495654_0056787_146_1078	310
1392	3300046538	Ga0495609_0001507	Ga0495609_0001507_8654_9586	310
1393	3300046538	Ga0495609_0002962	Ga0495609_0002962_813_1745	310
1394	3300046538	Ga0495609_0015645	Ga0495609_0015645_1912_2844	310
1395	3300046538	Ga0495609_0031445	Ga0495609_0031445_735_1667	310
1396	3300046542	Ga0495597_0003744	Ga0495597_0003744_6956_7888	310
1397	3300046557	Ga0495622_0004628	Ga0495622_0004628_784_1716	310
1398	3300046558	Ga0495633_0028755	Ga0495633_0028755_817_1749	310
1399	3300046616	Ga0495668_0133758	Ga0495668_0133758_258_1190	310
1400	3300046648	Ga0495611_0044049	Ga0495611_0044049_267_1199	310
1401	3300046660	Ga0495625_0006553	Ga0495625_0006553_1088_2020	310
1402	3300046660	Ga0495625_0033683	Ga0495625_0033683_794_1726	310
1403	3300046660	Ga0495625_0108174	Ga0495625_0108174_775_1707	310
1404	3300046660	Ga0495625_0128231	Ga0495625_0128231_565_1497	310
1405	3300046665	Ga0495661_0051451	Ga0495661_0051451_1511_2443	310
1406	3300046665	Ga0495661_0064284	Ga0495661_0064284_629_1561	310
1407	3300046691	Ga0495670_0002586	Ga0495670_0002586_7276_8208	310
1408	3300046692	Ga0495671_0019377	Ga0495671_0019377_562_1494	310
1409	3300046692	Ga0495671_0032365	Ga0495671_0032365_973_1905	310
1410	3300046692	Ga0495671_0034800	Ga0495671_0034800_674_1606	310
1411	3300046692	Ga0495671_0042966	Ga0495671_0042966_777_1709	310
1412	3300046694	Ga0495649_0017584	Ga0495649_0017584_715_1647	310
1413	3300046694	Ga0495649_0020553	Ga0495649_0020553_1967_2899	310
1414	3300046694	Ga0495649_0050820	Ga0495649_0050820_167_1099	310
1415	3300046694	Ga0495649_0054409	Ga0495649_0054409_787_1719	310
1416	3300046794	Ga0495589_0002188	Ga0495589_0002188_9276_10208	310
1417	3300046794	Ga0495589_0058205	Ga0495589_0058205_85_1017	310
1418	3300046810	Ga0495660_0016509	Ga0495660_0016509_798_1730	310
1419	3300046810	Ga0495660_0020736	Ga0495660_0020736_2606_3538	310
1420	3300046810	Ga0495660_0064392	Ga0495660_0064392_713_1645	310
1421	3300046810	Ga0495660_0144418	Ga0495660_0144418_223_1155	310
1422	3300047320	Ga0495672_0122588	Ga0495672_0122588_430_1362	310
1423	3300047321	Ga0495676_0033322	Ga0495676_0033322_789_1721	310
1424	3300047323	Ga0495683_0050251	Ga0495683_0050251_986_1918	310
1425	3300047323	Ga0495683_0063146	Ga0495683_0063146_711_1643	310
1426	3300047446	Ga0495679_010290	Ga0495679_010290_794_1726	310
1427	3300047469	Ga0495673_0003174	Ga0495673_0003174_8107_9039	310
1428	3300047469	Ga0495673_0023994	Ga0495673_0023994_792_1724	310
1429	3300047469	Ga0495673_0057258	Ga0495673_0057258_582_1514	310
1430	3300047470	Ga0495681_0001494	Ga0495681_0001494_16387_17319	310
1431	3300047470	Ga0495681_0019914	Ga0495681_0019914_792_1724	310
1432	3300047470	Ga0495681_0043972	Ga0495681_0043972_318_1250	310
1433	3300047472	Ga0495686_0013097	Ga0495686_0013097_800_1732	310
1434	3300047472	Ga0495686_0062333	Ga0495686_0062333_706_1638	310
1435	3300048091	Ga0495626_0025509	Ga0495626_0025509_1174_2106	310
1436	3300048091	Ga0495626_0053358	Ga0495626_0053358_146_1078	310
1437	3300048913	Ga0496110_0134625	Ga0496110_0134625_703_1635	310
1438	3300048917	Ga0496114_0006009	Ga0496114_0006009_4543_5475	310
1439	3300048917	Ga0496114_0017826	Ga0496114_0017826_516_1448	310
1440	3300048919	Ga0496116_0001579	Ga0496116_0001579_16638_17570	310
1441	3300048919	Ga0496116_0127135	Ga0496116_0127135_287_1219	310
1442	3300048919	Ga0496116_0127381	Ga0496116_0127381_454_1386	310
1443	3300048920	Ga0496117_0003907	Ga0496117_0003907_5222_6154	310
1444	3300048920	Ga0496117_0004300	Ga0496117_0004300_12086_13018	310
1445	3300048920	Ga0496117_0007696	Ga0496117_0007696_925_1857	310
1446	3300048921	Ga0496118_0003760	Ga0496118_0003760_12436_13368	310
1447	3300048921	Ga0496118_0004272	Ga0496118_0004272_3575_4507	310
1448	3300048921	Ga0496118_0150230	Ga0496118_0150230_457_1389	310
1449	3300048924	Ga0496121_0253137	Ga0496121_0253137_82_1014	310
1450	3300048925	Ga0496122_0002929	Ga0496122_0002929_5683_6615	310
1451	3300048925	Ga0496122_0134906	Ga0496122_0134906_177_1109	310
1452	3300048926	Ga0496123_0003514	Ga0496123_0003514_11659_12591	310
1453	3300048926	Ga0496123_0107032	Ga0496123_0107032_236_1168	310
1454	3300048927	Ga0496124_0004244	Ga0496124_0004244_10622_11554	310
1455	3300048927	Ga0496124_0004692	Ga0496124_0004692_4297_5229	310
1456	3300048927	Ga0496124_0005898	Ga0496124_0005898_1954_2886	310
1457	3300048927	Ga0496124_0014385	Ga0496124_0014385_3384_4316	310
1458	3300048928	Ga0496125_0004780	Ga0496125_0004780_10662_11594	310
1459	3300048929	Ga0496126_0018460	Ga0496126_0018460_2470_3402	310
1460	3300049459	Ga0495678_003645	Ga0495678_003645_1314_2246	310
1461	3300049459	Ga0495678_012262	Ga0495678_012262_779_1711	310
1462	3300049459	Ga0495678_023289	Ga0495678_023289_781_1713	310
1463	3300049459	Ga0495678_041062	Ga0495678_041062_320_1252	310
1464	3300049459	Ga0495678_077705	Ga0495678_077705_83_1054	310
1465	3300049460	Ga0495682_0005934	Ga0495682_0005934_3287_4219	310
1466	3300049460	Ga0495682_0010026	Ga0495682_0010026_2580_3512	310
1467	3300049460	Ga0495682_0037452	Ga0495682_0037452_618_1550	310
1468	3300049460	Ga0495682_0084471	Ga0495682_0084471_14_946	310
1469	3300049571	Ga0501034_0000214	Ga0501034_0000214_104631_105563	310
1470	3300053111	Ga0500572_007525	Ga0500572_007525_788_1720	310
1471	3300053135	Ga0500659_0002191	Ga0500659_0002191_5535_6467	310
1472	3300013307	Ga0157372_10024915	Ga0157372_100249153	311
1473	3300048922	Ga0496119_0000220	Ga0496119_0000220_25651_26586	311
1474	3300048923	Ga0496120_0008468	Ga0496120_0008468_2962_3897	311
1475	2124908027	MRS2a_Contig_1387	MRS2a_00277070	312
1476	3300005288	Ga0065714_10004837	Ga0065714_100048373	312
1477	3300005288	Ga0065714_10010074	Ga0065714_100100741	312
1478	3300005290	Ga0065712_10110281	Ga0065712_101102811	312
1479	3300009011	Ga0105251_10000844	Ga0105251_1000084421	312
1480	3300009092	Ga0105250_10000617	Ga0105250_1000061717	312
1481	3300013102	Ga0157371_10143027	Ga0157371_101430271	312
1482	3300013104	Ga0157370_10086212	Ga0157370_100862122	312
1483	3300013306	Ga0163162_10034142	Ga0163162_100341423	312
1484	3300013308	Ga0157375_10000664	Ga0157375_100006642	312
1485	3300014497	Ga0182008_10042300	Ga0182008_100423002	312
1486	3300015262	Ga0182007_10000296	Ga0182007_100002963	312
1487	3300025711	Ga0207696_1001474	Ga0207696_10014743	312
1488	3300025735	Ga0207713_1000874	Ga0207713_10008742	312
1489	3300041407	Ga0439447_018779	Ga0439447_018779_627_1565	312
1490	3300042013	Ga0439456_003352	Ga0439456_003352_681_1619	312
1491	3300042137	Ga0450902_018900	Ga0450902_018900_128_1066	312
1492	3300042184	Ga0450908_017595	Ga0450908_017595_188_1126	312
1493	3300046455	Ga0495603_0045539	Ga0495603_0045539_964_1902	312
1494	3300046460	Ga0495638_0081014	Ga0495638_0081014_490_1428	312
1495	3300046492	Ga0495585_0000754	Ga0495585_0000754_23393_24331	312
1496	3300046499	Ga0495594_0007124	Ga0495594_0007124_2116_3054	312
1497	3300046557	Ga0495622_0000585	Ga0495622_0000585_991_1929	312
1498	3300046674	Ga0495588_0000332	Ga0495588_0000332_1487_2425	312
1499	3300046810	Ga0495660_0004771	Ga0495660_0004771_1656_2597	312
1500	3300048927	Ga0496124_0000471	Ga0496124_0000471_51112_52053	312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

14

253

0.94 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

15

294

0.87 PF04321

RmlD_sub_bind

RmlD substrate binding domain

12

225

0.87 PF08659

KR

KR domain

12

143

0.83 PF07993

NAD_binding_4

Male sterility protein

16

227

0.81 PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

14

290

0.8 PF05368

NmrA

NmrA-like family

14

138

0.79 PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

15

242

0.76 PF13460

NAD_binding_10

NAD(P)H-binding

18

186

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6wja-assembly1.cif.gz_A	udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac	0.9765	5	308
6wjb-assembly1.cif.gz_A	udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac	0.9764	5	308
6wjb-assembly1.cif.gz_A	udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac	0.964	5	308
6wja-assembly1.cif.gz_A	udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac	0.964	5	308
6dnt-assembly1.cif.gz_A-2	udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid	0.9381	1	308

ID	Description	Score	Start	End	Superfamily
6dntA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9326	1	243	3.40.50.720
af_Q2G289_4_319_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9292	4	308	3.40.50.720
6dntA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9282	1	243	3.40.50.720
2p5yA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9206	5	243	3.40.50.720
1r6dA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9164	6	173	3.40.50.720

ID	Description	Score	Start	End
AF-A0A0P9IVJ0-F1-model_v4	deleted	0.9776	2	309
AF-A0A656JLD4-F1-model_v4	UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase)	0.9703	24	126
AF-A0A0P9IVJ0-F1-model_v4	deleted	0.9622	2	309
AF-A0A7L4RD89-F1-model_v4	NAD-dependent epimerase/dehydratase family protein	0.9542	5	308
AF-A0A2G6J3U6-F1-model_v4	LPS biosynthesis protein WbpP	0.9529	5	308

Feature Viewer

pLDDT	pTM	Quality
91.3	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

Map

F494405

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

14

253

0.94

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

15

294

0.87

PF04321

RmlD_sub_bind

RmlD substrate binding domain

12

225

0.87

PF08659

KR

KR domain

12

143

0.83

PF07993

NAD_binding_4

Male sterility protein

16

227

0.81

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

14

290

0.8

PF05368

NmrA

NmrA-like family

14

138

0.79

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

15

242

0.76

PF13460

NAD_binding_10

NAD(P)H-binding

18

186

0.73

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map