F494368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1496 | 1067 | 2990 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0001126|Ga0395905_0001126_22280_22756 |
| Length | 158 |
| Sequence | MELDLQQGGRVLIMAAYWLFKSEPFKFSWQMLKDKGEAGQEWDGVRNYAARNNMRAMKIGDKGFFYHSNEGLEIVGITEVCALAHPDSTADAPTWECVDIRAVIDVPKPVTLDTVKNTASLSEMALVKLSRLSVQPVTEKEYLEICRMGGLENPPLSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 112 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 113 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 114 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 115 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 116 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 117 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 118 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 194 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 205 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 213 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 214 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 219 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 220 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 221 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 222 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 223 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 224 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 225 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 226 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 227 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 232 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 233 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 342 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 343 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 344 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 345 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 352 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 354 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 355 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 357 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 360 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 364 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 365 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 366 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 367 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 368 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 369 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 370 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 371 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 372 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 373 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 374 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 375 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 376 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 377 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 378 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 379 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 380 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 381 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 382 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 383 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 384 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 385 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 386 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 387 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 388 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 389 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 390 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 391 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 392 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 393 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 394 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 395 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 396 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 397 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 398 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 399 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 400 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 401 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 402 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 403 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 404 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 405 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 406 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 407 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 408 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 409 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 410 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 411 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 412 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 413 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 414 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 415 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 416 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 417 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 418 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 419 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 420 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 421 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 422 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 423 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 424 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 425 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 426 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 427 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 428 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 429 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 430 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 431 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 432 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 433 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 434 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 435 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 436 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 437 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 438 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 439 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 440 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 441 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 442 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 443 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 444 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 445 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 446 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 447 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 448 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 449 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 450 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 451 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 452 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 453 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 454 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 455 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 456 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 457 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 458 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 459 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 460 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 461 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 462 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 463 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 464 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 465 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 466 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 467 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 468 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 469 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 470 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 471 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 472 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 473 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 474 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 475 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 476 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 477 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 478 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 479 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 480 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 481 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 482 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 483 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 484 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 485 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 486 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 487 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 488 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 489 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 490 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 491 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 492 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 493 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 494 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 495 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 496 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 497 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 498 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 499 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 500 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 501 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 502 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 503 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 504 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 505 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 506 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 507 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 508 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 509 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 510 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 511 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 512 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 513 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 514 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 515 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 516 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 517 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 518 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 519 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 520 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 521 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 522 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 523 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 524 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 525 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 526 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 527 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 528 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 529 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 530 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 531 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 532 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 533 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 534 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 535 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 536 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 537 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 538 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 539 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 540 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 541 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 542 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 543 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 544 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 545 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 546 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 547 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 548 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 549 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 550 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 551 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 552 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 553 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 554 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 555 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 556 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 557 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 558 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 559 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 560 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 561 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 562 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 563 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 564 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 565 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 566 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 567 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 568 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 569 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 570 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 571 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 572 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 573 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 574 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 575 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 576 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 577 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 578 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 579 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 580 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 581 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 582 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 583 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 584 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 585 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 586 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 587 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 588 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 589 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 590 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 591 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 592 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 593 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 594 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 595 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 596 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 597 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 598 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 599 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 600 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 601 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 602 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 603 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 604 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 605 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 606 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 607 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 608 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 609 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 610 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 611 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 612 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 613 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 614 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 615 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 616 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 617 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 618 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 619 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 620 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 621 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 622 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 623 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 624 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 625 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 626 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 627 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 628 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 629 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 630 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 631 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 632 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 633 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 634 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 635 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 636 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 637 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 638 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 639 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 640 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 641 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 642 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 643 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 644 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 645 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 646 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 647 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 648 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 649 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 650 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 651 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 652 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 653 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 654 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 655 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 656 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 657 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 658 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 659 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 660 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 661 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 662 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 663 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 664 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 665 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 666 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 667 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 668 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 669 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 670 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 671 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 672 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 673 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 674 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 675 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 676 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 677 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 678 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 679 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 680 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 681 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 682 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 683 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 684 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 685 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 686 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 687 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 688 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 689 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 690 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 691 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 692 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 693 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 694 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 695 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 696 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 697 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 698 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 699 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 700 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 701 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 702 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 703 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 704 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 705 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 706 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 707 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 708 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 709 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 710 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 711 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 712 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 713 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 714 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 715 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 716 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 717 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 718 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 719 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 720 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 721 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 722 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 723 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 724 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 725 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 726 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 727 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 728 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 729 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 730 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 731 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 732 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 733 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 734 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 735 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 736 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 737 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 738 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 739 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 740 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 741 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 742 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 743 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 744 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 745 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 746 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 747 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 748 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 749 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 750 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 751 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 752 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 753 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 754 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 755 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 756 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 757 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 758 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 759 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 760 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 761 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 762 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 763 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 764 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 765 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 766 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 767 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 768 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 769 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 770 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 771 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 772 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 773 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 774 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 775 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 776 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 777 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 778 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 779 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 780 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 781 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 782 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 783 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 784 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 785 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 786 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 787 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 788 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 789 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 790 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 791 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 792 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 793 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 794 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 795 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 796 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 797 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 798 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 799 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 800 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 801 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 802 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 803 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 804 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 805 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 806 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 807 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 808 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 809 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 810 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 811 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 812 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 813 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 814 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 815 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 816 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 817 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 818 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 819 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 820 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 821 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 822 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 823 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 824 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 825 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 826 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 827 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 828 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 829 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 830 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 831 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 832 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 833 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 834 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 835 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 836 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 837 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 838 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 839 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 840 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 841 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 842 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 843 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 844 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 845 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 846 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 847 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 848 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 849 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 850 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 851 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 852 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 853 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 854 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 855 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 856 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 857 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 858 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 859 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 860 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 861 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 862 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 863 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 864 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 865 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 866 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 867 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 868 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 869 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 870 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 871 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 872 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 873 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 874 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 875 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 876 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 877 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 878 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 879 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 880 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 881 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 882 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 883 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 884 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 885 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 886 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 887 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 888 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 889 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 890 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 891 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 892 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 893 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 894 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 895 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 896 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 897 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 898 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 899 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 900 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 901 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 902 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 903 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 904 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 905 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 906 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 907 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 908 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 909 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 910 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 911 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 912 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 913 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 914 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 915 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 916 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 917 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 918 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 919 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 920 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 921 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 922 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 923 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 924 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 925 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 926 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 927 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 928 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 929 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 930 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 931 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 932 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 933 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 934 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 935 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 936 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 937 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 938 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 939 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 940 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 941 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 942 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 943 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 944 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 945 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 946 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 947 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 948 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 949 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 950 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 951 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 952 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 953 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 954 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 955 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 956 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 957 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 958 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 959 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 960 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 961 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 962 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 963 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 964 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 965 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 966 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 967 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 968 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 969 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 970 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 971 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 972 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 973 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 974 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 975 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 976 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 977 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 978 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 979 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 980 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 981 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 982 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 983 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 984 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 985 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 986 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 987 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 988 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 989 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 990 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 991 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 992 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 993 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 994 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 995 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 996 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 997 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 998 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 999 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 1000 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 1001 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 1002 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 1003 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 1004 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 1005 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 1006 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 1007 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 1008 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 1009 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 1010 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 1011 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 1012 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 1013 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 1014 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 1015 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 1016 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 1017 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 1018 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 1019 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 1020 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 1021 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 1022 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1023 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1024 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1025 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1026 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1027 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1028 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1029 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1030 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1031 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1032 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1033 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1034 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1035 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1036 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1037 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1038 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1039 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1040 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1041 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1042 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1043 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1044 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1045 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1046 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1047 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1048 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1049 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1050 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1051 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1052 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1053 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1054 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1055 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1056 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1057 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1058 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1059 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1060 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1061 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1062 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1063 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1064 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1065 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1066 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1067 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.47 |
| Metatranscriptomes | 0.27 |
| Isolates | 47.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 15.04 |
| Nodule | 37.9 |
| Rhizoplane | 2.67 |
| Rhizosphere | 29.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0001126 | 3300037471 | Bacteria | 33477 |
| 2 | RicEn_FSXC42840_b1 | 2010549000 | Bacteria | 845 |
| 3 | JGI24740J21852_10000013 | 3300001979 | Bacteria | 62177 |
| 4 | JGI24740J21852_10003324 | 3300001979 | Bacteria | 7085 |
| 5 | JGI24737J22298_10257894 | 3300001990 | Bacteria | 515 |
| 6 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 7 | JGI25156J39149_1000102 | 3300002705 | Bacteria | 62463 |
| 8 | JGI25156J39149_1008662 | 3300002705 | Bacteria | 2540 |
| 9 | JGI25162J39368_1000879 | 3300002737 | Bacteria | 19691 |
| 10 | JGI25154J39366_1000184 | 3300002738 | Bacteria | 48243 |
| 11 | JGI25158J39367_1000526 | 3300002739 | Bacteria | 7697 |
| 12 | JGI25158J39367_1020635 | 3300002739 | Bacteria | 804 |
| 13 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 14 | JGI25157J39369_1000842 | 3300002741 | Bacteria | 15202 |
| 15 | JGI25152J39213_1002498 | 3300002773 | Bacteria | 6955 |
| 16 | JGI25152J39213_1003827 | 3300002773 | Bacteria | 4977 |
| 17 | JGI25152J39213_1016049 | 3300002773 | Bacteria | 1458 |
| 18 | JGI25150J39212_1012970 | 3300002774 | Bacteria | 1458 |
| 19 | JGI25159J45721_1000053 | 3300002987 | Bacteria | 56912 |
| 20 | JGI25159J45721_1009500 | 3300002987 | Bacteria | 2559 |
| 21 | JGI25151J46595_10001525 | 3300003187 | Bacteria | 15499 |
| 22 | JGI25151J46595_10005265 | 3300003187 | Bacteria | 6704 |
| 23 | JGI25151J46595_10010648 | 3300003187 | Bacteria | 4259 |
| 24 | JGI25151J46595_10014524 | 3300003187 | Bacteria | 3504 |
| 25 | JGI25165J46597_1000273 | 3300003214 | Bacteria | 66540 |
| 26 | JGI25165J46597_1001977 | 3300003214 | Bacteria | 7923 |
| 27 | JGI25153J46596_10070568 | 3300003215 | Bacteria | 906 |
| 28 | JGI25153J46596_10075202 | 3300003215 | Bacteria | 860 |
| 29 | rootH2_10104045 | 3300003320 | Bacteria | 1860 |
| 30 | rootL2_10029472 | 3300003322 | Bacteria | 2551 |
| 31 | rootH1_10215066 | 3300003323 | Bacteria | 1138 |
| 32 | JGI25160J50197_1000168 | 3300003354 | Bacteria | 56596 |
| 33 | JGI25160J50197_1000235 | 3300003354 | Bacteria | 43030 |
| 34 | JGI25160J50197_1018219 | 3300003354 | Bacteria | 2195 |
| 35 | JGI25161J50226_1000175 | 3300003374 | Bacteria | 43039 |
| 36 | JGI25161J50226_1001177 | 3300003374 | Bacteria | 8615 |
| 37 | Ga0055539_1014238 | 3300003752 | Bacteria | 971 |
| 38 | Ga0055526_1002546 | 3300003771 | Bacteria | 12243 |
| 39 | Ga0055526_1002690 | 3300003771 | Bacteria | 11842 |
| 40 | Ga0055526_1010815 | 3300003771 | Bacteria | 4196 |
| 41 | Ga0055526_1017168 | 3300003771 | Bacteria | 2784 |
| 42 | Ga0055526_1018522 | 3300003771 | Bacteria | 2594 |
| 43 | Ga0055524_1002053 | 3300003775 | Bacteria | 10695 |
| 44 | Ga0055524_1003375 | 3300003775 | Bacteria | 7777 |
| 45 | Ga0055524_1007952 | 3300003775 | Bacteria | 4451 |
| 46 | Ga0055524_1009037 | 3300003775 | Bacteria | 4089 |
| 47 | Ga0055524_1017569 | 3300003775 | Bacteria | 2519 |
| 48 | Ga0055524_1018474 | 3300003775 | Bacteria | 2419 |
| 49 | Ga0055524_1037117 | 3300003775 | Bacteria | 1297 |
| 50 | Ga0055536_1002743 | 3300003781 | Bacteria | 9744 |
| 51 | Ga0055528_1000369 | 3300003790 | Bacteria | 36582 |
| 52 | Ga0055528_1001991 | 3300003790 | Bacteria | 11495 |
| 53 | Ga0055528_1005279 | 3300003790 | Bacteria | 6051 |
| 54 | Ga0055528_1017003 | 3300003790 | Bacteria | 2541 |
| 55 | Ga0055528_1035258 | 3300003790 | Bacteria | 1218 |
| 56 | Ga0055530_10015001 | 3300003791 | Bacteria | 2554 |
| 57 | Ga0055540_1013494 | 3300003792 | Bacteria | 2493 |
| 58 | Ga0055540_1015856 | 3300003792 | Bacteria | 2171 |
| 59 | Ga0055531_10003576 | 3300003794 | Bacteria | 9857 |
| 60 | Ga0055531_10064627 | 3300003794 | Bacteria | 874 |
| 61 | Ga0058692_1002172 | 3300003856 | Bacteria | 6702 |
| 62 | Ga0058692_1006673 | 3300003856 | Bacteria | 3141 |
| 63 | Ga0058692_1007029 | 3300003856 | Bacteria | 3026 |
| 64 | Ga0058692_1028227 | 3300003856 | Bacteria | 1085 |
| 65 | Ga0055543_1000226 | 3300004625 | Bacteria | 44983 |
| 66 | Ga0055543_1000412 | 3300004625 | Bacteria | 26967 |
| 67 | Ga0065165_1000133 | 3300005262 | Bacteria | 128540 |
| 68 | Ga0065165_1002250 | 3300005262 | Bacteria | 17103 |
| 69 | Ga0065165_1005266 | 3300005262 | Bacteria | 7383 |
| 70 | Ga0065165_1052669 | 3300005262 | Bacteria | 1149 |
| 71 | Ga0065704_10763127 | 3300005289 | Bacteria | 532 |
| 72 | Ga0065715_10853871 | 3300005293 | Bacteria | 590 |
| 73 | Ga0070658_10344666 | 3300005327 | Bacteria | 1275 |
| 74 | Ga0070658_10386302 | 3300005327 | Bacteria | 1201 |
| 75 | Ga0070670_100000183 | 3300005331 | Bacteria | 57446 |
| 76 | Ga0068869_100309951 | 3300005334 | Bacteria | 1277 |
| 77 | Ga0070680_100027990 | 3300005336 | Bacteria | 4518 |
| 78 | Ga0070682_100000791 | 3300005337 | Bacteria | 18585 |
| 79 | Ga0070660_100045414 | 3300005339 | Bacteria | 3363 |
| 80 | Ga0070660_100153690 | 3300005339 | Bacteria | 1852 |
| 81 | Ga0070691_10016489 | 3300005341 | Bacteria | 3394 |
| 82 | Ga0070661_100705424 | 3300005344 | Bacteria | 822 |
| 83 | Ga0070692_10111921 | 3300005345 | Bacteria | 1511 |
| 84 | Ga0070668_100334991 | 3300005347 | Bacteria | 1277 |
| 85 | Ga0070668_100449344 | 3300005347 | Bacteria | 1108 |
| 86 | Ga0070668_100517355 | 3300005347 | Bacteria | 1035 |
| 87 | Ga0070668_101286691 | 3300005347 | Bacteria | 664 |
| 88 | Ga0070668_101341896 | 3300005347 | Bacteria | 651 |
| 89 | Ga0070669_100374603 | 3300005353 | Bacteria | 1160 |
| 90 | Ga0070671_100173508 | 3300005355 | Bacteria | 1824 |
| 91 | Ga0070674_100768454 | 3300005356 | Bacteria | 829 |
| 92 | Ga0070659_100081160 | 3300005366 | Bacteria | 2590 |
| 93 | Ga0070659_100892153 | 3300005366 | Bacteria | 777 |
| 94 | Ga0070705_100009688 | 3300005440 | Bacteria | 4797 |
| 95 | Ga0070700_100087920 | 3300005441 | Bacteria | 2021 |
| 96 | Ga0070694_100052405 | 3300005444 | Bacteria | 2758 |
| 97 | Ga0070663_100003763 | 3300005455 | Bacteria | 8809 |
| 98 | Ga0070678_100090978 | 3300005456 | Bacteria | 2340 |
| 99 | Ga0070662_100372795 | 3300005457 | Bacteria | 1173 |
| 100 | Ga0070662_101054725 | 3300005457 | Bacteria | 697 |
| 101 | Ga0070681_10008287 | 3300005458 | Bacteria | 10178 |
| 102 | Ga0068867_101612271 | 3300005459 | Bacteria | 607 |
| 103 | Ga0070679_100199832 | 3300005530 | Bacteria | 1966 |
| 104 | Ga0070684_100716527 | 3300005535 | Bacteria | 933 |
| 105 | Ga0068853_100040844 | 3300005539 | Bacteria | 3959 |
| 106 | Ga0068853_100702550 | 3300005539 | Bacteria | 965 |
| 107 | Ga0068853_101443730 | 3300005539 | Bacteria | 666 |
| 108 | Ga0070665_100083379 | 3300005548 | Bacteria | 3201 |
| 109 | Ga0070665_100389179 | 3300005548 | Bacteria | 1402 |
| 110 | Ga0070665_100668223 | 3300005548 | Bacteria | 1052 |
| 111 | Ga0068855_100476119 | 3300005563 | Bacteria | 1360 |
| 112 | Ga0068855_101313924 | 3300005563 | Bacteria | 748 |
| 113 | Ga0070664_100039603 | 3300005564 | Bacteria | 3972 |
| 114 | Ga0070664_100585780 | 3300005564 | Bacteria | 1034 |
| 115 | Ga0068857_100035472 | 3300005577 | Bacteria | 4417 |
| 116 | Ga0068854_100335999 | 3300005578 | Bacteria | 1232 |
| 117 | Ga0068856_100014117 | 3300005614 | Bacteria | 7725 |
| 118 | Ga0068856_100081792 | 3300005614 | Bacteria | 3205 |
| 119 | Ga0068856_100188981 | 3300005614 | Bacteria | 2073 |
| 120 | Ga0068852_100059446 | 3300005616 | Bacteria | 3315 |
| 121 | Ga0068852_100261305 | 3300005616 | Bacteria | 1662 |
| 122 | Ga0068852_100815066 | 3300005616 | Bacteria | 948 |
| 123 | Ga0068860_101068060 | 3300005843 | Bacteria | 826 |
| 124 | Ga0068860_102236096 | 3300005843 | Bacteria | 568 |
| 125 | Ga0068862_100519182 | 3300005844 | Bacteria | 1133 |
| 126 | Ga0081455_10441046 | 3300005937 | Bacteria | 892 |
| 127 | Ga0075365_10001999 | 3300006038 | Bacteria | 9664 |
| 128 | Ga0075365_10011804 | 3300006038 | Bacteria | 5156 |
| 129 | Ga0075365_10022037 | 3300006038 | Bacteria | 3984 |
| 130 | Ga0075365_10036005 | 3300006038 | Bacteria | 3206 |
| 131 | Ga0075365_10080809 | 3300006038 | Bacteria | 2201 |
| 132 | Ga0075365_10324910 | 3300006038 | Bacteria | 1083 |
| 133 | Ga0075365_10453340 | 3300006038 | Bacteria | 906 |
| 134 | Ga0075368_10000370 | 3300006042 | Bacteria | 13204 |
| 135 | Ga0075368_10006472 | 3300006042 | Bacteria | 4093 |
| 136 | Ga0075368_10060920 | 3300006042 | Bacteria | 1511 |
| 137 | Ga0075363_100097483 | 3300006048 | Bacteria | 1624 |
| 138 | Ga0075363_100249788 | 3300006048 | Bacteria | 1021 |
| 139 | Ga0075364_10000195 | 3300006051 | Bacteria | 28057 |
| 140 | Ga0075364_10064288 | 3300006051 | Bacteria | 2408 |
| 141 | Ga0075364_10107044 | 3300006051 | Bacteria | 1863 |
| 142 | Ga0075364_10614010 | 3300006051 | Bacteria | 743 |
| 143 | Ga0075362_10005758 | 3300006177 | Bacteria | 4564 |
| 144 | Ga0075362_10041266 | 3300006177 | Bacteria | 2035 |
| 145 | Ga0075367_10003513 | 3300006178 | Bacteria | 7488 |
| 146 | Ga0075367_10010829 | 3300006178 | Bacteria | 4805 |
| 147 | Ga0075367_10037942 | 3300006178 | Bacteria | 2802 |
| 148 | Ga0075367_10088137 | 3300006178 | Bacteria | 1885 |
| 149 | Ga0075367_10143891 | 3300006178 | Bacteria | 1477 |
| 150 | Ga0075367_10209748 | 3300006178 | Bacteria | 1218 |
| 151 | Ga0075369_10007006 | 3300006186 | Bacteria | 4280 |
| 152 | Ga0075369_10009506 | 3300006186 | Bacteria | 3780 |
| 153 | Ga0075369_10009744 | 3300006186 | Bacteria | 3741 |
| 154 | Ga0075369_10039071 | 3300006186 | Bacteria | 2026 |
| 155 | Ga0075369_10186025 | 3300006186 | Bacteria | 956 |
| 156 | Ga0075366_10015737 | 3300006195 | Bacteria | 4342 |
| 157 | Ga0075366_10153478 | 3300006195 | Bacteria | 1395 |
| 158 | Ga0097621_100872739 | 3300006237 | Bacteria | 837 |
| 159 | Ga0075370_10000923 | 3300006353 | Bacteria | 12065 |
| 160 | Ga0075370_10046667 | 3300006353 | Bacteria | 2452 |
| 161 | Ga0075370_10256009 | 3300006353 | Bacteria | 1038 |
| 162 | Ga0079104_1000195 | 3300006946 | Bacteria | 85244 |
| 163 | Ga0079104_1007315 | 3300006946 | Bacteria | 4027 |
| 164 | Ga0079104_1019653 | 3300006946 | Bacteria | 1881 |
| 165 | Ga0099826_10002340 | 3300006948 | Bacteria | 12184 |
| 166 | Ga0099826_10030104 | 3300006948 | Bacteria | 3947 |
| 167 | Ga0105251_10032824 | 3300009011 | Bacteria | 2583 |
| 168 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 169 | Ga0105245_10676194 | 3300009098 | Bacteria | 1064 |
| 170 | Ga0105247_10038391 | 3300009101 | Bacteria | 2924 |
| 171 | Ga0105243_10018422 | 3300009148 | Bacteria | 5289 |
| 172 | Ga0105243_10031359 | 3300009148 | Bacteria | 4098 |
| 173 | Ga0105243_11181347 | 3300009148 | Bacteria | 777 |
| 174 | Ga0105243_11206633 | 3300009148 | Bacteria | 770 |
| 175 | Ga0105241_10005600 | 3300009174 | Bacteria | 9273 |
| 176 | Ga0105241_10130804 | 3300009174 | Bacteria | 2032 |
| 177 | Ga0105241_11153113 | 3300009174 | Bacteria | 732 |
| 178 | Ga0105237_10012742 | 3300009545 | Bacteria | 8845 |
| 179 | Ga0105237_10017470 | 3300009545 | Bacteria | 7436 |
| 180 | Ga0105237_10083583 | 3300009545 | Bacteria | 3184 |
| 181 | Ga0105237_10314042 | 3300009545 | Bacteria | 1570 |
| 182 | Ga0105238_10010328 | 3300009551 | Bacteria | 9368 |
| 183 | Ga0105238_10021086 | 3300009551 | Bacteria | 6640 |
| 184 | Ga0105238_10201007 | 3300009551 | Bacteria | 1968 |
| 185 | Ga0105238_10258207 | 3300009551 | Bacteria | 1721 |
| 186 | Ga0105238_11427143 | 3300009551 | Bacteria | 720 |
| 187 | Ga0105249_10603127 | 3300009553 | Bacteria | 1153 |
| 188 | Ga0105249_11159140 | 3300009553 | Bacteria | 844 |
| 189 | Ga0105249_11771134 | 3300009553 | Bacteria | 690 |
| 190 | Ga0123342_1015184 | 3300009766 | Bacteria | 7094 |
| 191 | Ga0105239_10158935 | 3300010375 | Bacteria | 2524 |
| 192 | Ga0105239_10184102 | 3300010375 | Bacteria | 2337 |
| 193 | Ga0105239_10239809 | 3300010375 | Bacteria | 2035 |
| 194 | Ga0105239_10389948 | 3300010375 | Bacteria | 1575 |
| 195 | Ga0105239_10480594 | 3300010375 | Bacteria | 1411 |
| 196 | Ga0105246_10103527 | 3300011119 | Bacteria | 2077 |
| 197 | Ga0105246_10299020 | 3300011119 | Bacteria | 1298 |
| 198 | Ga0157373_10007612 | 3300013100 | Bacteria | 8048 |
| 199 | Ga0157373_10262877 | 3300013100 | Bacteria | 1221 |
| 200 | Ga0157371_10000108 | 3300013102 | Bacteria | 126288 |
| 201 | Ga0157371_10020668 | 3300013102 | Bacteria | 4843 |
| 202 | Ga0157370_10000720 | 3300013104 | Bacteria | 41451 |
| 203 | Ga0157370_10003357 | 3300013104 | Bacteria | 18853 |
| 204 | Ga0157370_10193891 | 3300013104 | Bacteria | 1885 |
| 205 | Ga0157370_10318199 | 3300013104 | Bacteria | 1435 |
| 206 | Ga0157370_10831338 | 3300013104 | Bacteria | 840 |
| 207 | Ga0157369_10023136 | 3300013105 | Bacteria | 6923 |
| 208 | Ga0157369_10082749 | 3300013105 | Bacteria | 3434 |
| 209 | Ga0157369_10537836 | 3300013105 | Bacteria | 1208 |
| 210 | Ga0157369_10853251 | 3300013105 | Bacteria | 935 |
| 211 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 212 | Ga0157374_11327888 | 3300013296 | Bacteria | 741 |
| 213 | Ga0157378_10357062 | 3300013297 | Bacteria | 1429 |
| 214 | Ga0157378_10579366 | 3300013297 | Bacteria | 1131 |
| 215 | Ga0157378_11604741 | 3300013297 | Bacteria | 696 |
| 216 | Ga0163162_10286000 | 3300013306 | Bacteria | 1781 |
| 217 | Ga0163162_10461997 | 3300013306 | Bacteria | 1401 |
| 218 | Ga0157372_11395879 | 3300013307 | Bacteria | 807 |
| 219 | Ga0157375_10182934 | 3300013308 | Bacteria | 2248 |
| 220 | Ga0157375_11764529 | 3300013308 | Bacteria | 733 |
| 221 | Ga0163163_11715603 | 3300014325 | Bacteria | 689 |
| 222 | Ga0182008_10066410 | 3300014497 | Bacteria | 1775 |
| 223 | Ga0157379_12244190 | 3300014968 | Bacteria | 543 |
| 224 | Ga0157376_11436206 | 3300014969 | Bacteria | 722 |
| 225 | Ga0182006_1051320 | 3300015261 | Bacteria | 1587 |
| 226 | Ga0182007_10001661 | 3300015262 | Bacteria | 11785 |
| 227 | Ga0182007_10079999 | 3300015262 | Bacteria | 1072 |
| 228 | Ga0182005_1001607 | 3300015265 | Bacteria | 8854 |
| 229 | Ga0183365_11151 | 3300015684 | Bacteria | 945 |
| 230 | Ga0183363_1208 | 3300015690 | Bacteria | 11915 |
| 231 | Ga0214544_1000024 | 3300021320 | Bacteria | 163562 |
| 232 | Ga0214542_1000008 | 3300021321 | Bacteria | 278895 |
| 233 | Ga0214543_1000031 | 3300021327 | Bacteria | 206436 |
| 234 | Ga0214543_1000053 | 3300021327 | Bacteria | 141797 |
| 235 | Ga0228711_1000050 | 3300022739 | Bacteria | 81399 |
| 236 | Ga0228710_1000063 | 3300022740 | Bacteria | 81399 |
| 237 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 238 | Ga0209436_101476 | 3300025208 | Bacteria | 8154 |
| 239 | Ga0209436_122632 | 3300025208 | Bacteria | 806 |
| 240 | Ga0209672_104990 | 3300025228 | Bacteria | 2350 |
| 241 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 242 | Ga0207425_1004647 | 3300025245 | Bacteria | 4062 |
| 243 | Ga0207425_1016579 | 3300025245 | Bacteria | 1633 |
| 244 | Ga0207425_1023523 | 3300025245 | Bacteria | 1289 |
| 245 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 246 | Ga0209646_1010312 | 3300025246 | Bacteria | 1465 |
| 247 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 248 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 249 | Ga0209677_100199 | 3300025253 | Bacteria | 48030 |
| 250 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 251 | Ga0209759_1000142 | 3300025256 | Bacteria | 124090 |
| 252 | Ga0209129_1000118 | 3300025258 | Bacteria | 139972 |
| 253 | Ga0209129_1001411 | 3300025258 | Bacteria | 13452 |
| 254 | Ga0209129_1003993 | 3300025258 | Bacteria | 6069 |
| 255 | Ga0209129_1044623 | 3300025258 | Bacteria | 692 |
| 256 | Ga0209233_1000030 | 3300025261 | Bacteria | 636702 |
| 257 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 258 | Ga0209233_1000331 | 3300025261 | Bacteria | 48397 |
| 259 | Ga0209233_1030002 | 3300025261 | Bacteria | 1285 |
| 260 | Ga0209455_1019748 | 3300025272 | Bacteria | 1353 |
| 261 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 262 | Ga0209673_1000052 | 3300025273 | Bacteria | 279795 |
| 263 | Ga0209673_1000459 | 3300025273 | Bacteria | 68727 |
| 264 | Ga0209673_1007582 | 3300025273 | Bacteria | 4966 |
| 265 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 266 | Ga0209130_1000132 | 3300025284 | Bacteria | 119765 |
| 267 | Ga0209130_1008806 | 3300025284 | Bacteria | 2941 |
| 268 | Ga0209130_1054352 | 3300025284 | Bacteria | 716 |
| 269 | Ga0209675_1041449 | 3300025291 | Bacteria | 1004 |
| 270 | Ga0209676_1001384 | 3300025292 | Bacteria | 23645 |
| 271 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 272 | Ga0209025_1000241 | 3300025294 | Bacteria | 128329 |
| 273 | Ga0209025_1000487 | 3300025294 | Bacteria | 76541 |
| 274 | Ga0209025_1001035 | 3300025294 | Bacteria | 40774 |
| 275 | Ga0209025_1004694 | 3300025294 | Bacteria | 11662 |
| 276 | Ga0209025_1004706 | 3300025294 | Bacteria | 11651 |
| 277 | Ga0209025_1014160 | 3300025294 | Bacteria | 4939 |
| 278 | Ga0209025_1027594 | 3300025294 | Bacteria | 2811 |
| 279 | Ga0209025_1056548 | 3300025294 | Bacteria | 1507 |
| 280 | Ga0209564_1000111 | 3300025295 | Bacteria | 212210 |
| 281 | Ga0209564_1000569 | 3300025295 | Bacteria | 58592 |
| 282 | Ga0209564_1002864 | 3300025295 | Bacteria | 12661 |
| 283 | Ga0209564_1012163 | 3300025295 | Bacteria | 3776 |
| 284 | Ga0209564_1054347 | 3300025295 | Bacteria | 946 |
| 285 | Ga0209564_1077488 | 3300025295 | Bacteria | 663 |
| 286 | Ga0209758_1002002 | 3300025297 | Bacteria | 21937 |
| 287 | Ga0209758_1010141 | 3300025297 | Bacteria | 5697 |
| 288 | Ga0209758_1015446 | 3300025297 | Bacteria | 3950 |
| 289 | Ga0209758_1027554 | 3300025297 | Bacteria | 2424 |
| 290 | Ga0209758_1028483 | 3300025297 | Bacteria | 2360 |
| 291 | Ga0209050_1008253 | 3300025298 | Bacteria | 5613 |
| 292 | Ga0209256_1000132 | 3300025299 | Bacteria | 160806 |
| 293 | Ga0209256_1000361 | 3300025299 | Bacteria | 73723 |
| 294 | Ga0209256_1000510 | 3300025299 | Bacteria | 57080 |
| 295 | Ga0209256_1002711 | 3300025299 | Bacteria | 13805 |
| 296 | Ga0209256_1011367 | 3300025299 | Bacteria | 3571 |
| 297 | Ga0209256_1019551 | 3300025299 | Bacteria | 2150 |
| 298 | Ga0209256_1019624 | 3300025299 | Bacteria | 2144 |
| 299 | Ga0209256_1047493 | 3300025299 | Bacteria | 1056 |
| 300 | Ga0209256_1063069 | 3300025299 | Bacteria | 856 |
| 301 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 302 | Ga0207426_1000246 | 3300025302 | Bacteria | 119765 |
| 303 | Ga0207426_1000595 | 3300025302 | Bacteria | 47697 |
| 304 | Ga0209051_1003461 | 3300025303 | Bacteria | 10338 |
| 305 | Ga0209051_1003573 | 3300025303 | Bacteria | 10112 |
| 306 | Ga0209051_1014030 | 3300025303 | Bacteria | 3766 |
| 307 | Ga0209051_1018700 | 3300025303 | Bacteria | 3056 |
| 308 | Ga0209051_1050455 | 3300025303 | Bacteria | 1393 |
| 309 | Ga0209051_1075244 | 3300025303 | Bacteria | 997 |
| 310 | Ga0209051_1085637 | 3300025303 | Bacteria | 893 |
| 311 | Ga0209257_1001613 | 3300025304 | Bacteria | 25850 |
| 312 | Ga0209257_1031551 | 3300025304 | Bacteria | 1693 |
| 313 | Ga0207656_10174216 | 3300025321 | Bacteria | 1030 |
| 314 | Ga0207642_10925415 | 3300025899 | Bacteria | 559 |
| 315 | Ga0207710_10440012 | 3300025900 | Bacteria | 672 |
| 316 | Ga0207680_10556528 | 3300025903 | Bacteria | 819 |
| 317 | Ga0207647_10017328 | 3300025904 | Bacteria | 4897 |
| 318 | Ga0207647_10035238 | 3300025904 | Bacteria | 3191 |
| 319 | Ga0207647_10173910 | 3300025904 | Bacteria | 1253 |
| 320 | Ga0207647_10206596 | 3300025904 | Bacteria | 1135 |
| 321 | Ga0207645_10457795 | 3300025907 | Bacteria | 862 |
| 322 | Ga0207705_10535669 | 3300025909 | Bacteria | 910 |
| 323 | Ga0207654_10068696 | 3300025911 | Bacteria | 2097 |
| 324 | Ga0207654_10198014 | 3300025911 | Bacteria | 1321 |
| 325 | Ga0207707_10250306 | 3300025912 | Bacteria | 1539 |
| 326 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 327 | Ga0207695_10705120 | 3300025913 | Bacteria | 890 |
| 328 | Ga0207671_10000226 | 3300025914 | Bacteria | 84886 |
| 329 | Ga0207671_10129928 | 3300025914 | Bacteria | 1933 |
| 330 | Ga0207671_10262382 | 3300025914 | Bacteria | 1360 |
| 331 | Ga0207671_10738293 | 3300025914 | Bacteria | 782 |
| 332 | Ga0207660_10260913 | 3300025917 | Bacteria | 1370 |
| 333 | Ga0207657_10027233 | 3300025919 | Bacteria | 5237 |
| 334 | Ga0207649_10315154 | 3300025920 | Bacteria | 1147 |
| 335 | Ga0207681_10557000 | 3300025923 | Bacteria | 944 |
| 336 | Ga0207694_10065714 | 3300025924 | Bacteria | 2828 |
| 337 | Ga0207694_10470302 | 3300025924 | Bacteria | 1051 |
| 338 | Ga0207694_10618405 | 3300025924 | Bacteria | 911 |
| 339 | Ga0207694_11146171 | 3300025924 | Bacteria | 658 |
| 340 | Ga0207694_11147228 | 3300025924 | Bacteria | 658 |
| 341 | Ga0207650_10000151 | 3300025925 | Bacteria | 83229 |
| 342 | Ga0207687_11300403 | 3300025927 | Bacteria | 625 |
| 343 | Ga0207644_10430036 | 3300025931 | Bacteria | 1082 |
| 344 | Ga0207690_10813937 | 3300025932 | Bacteria | 772 |
| 345 | Ga0207706_10361814 | 3300025933 | Bacteria | 1260 |
| 346 | Ga0207706_10984542 | 3300025933 | Bacteria | 709 |
| 347 | Ga0207709_10183972 | 3300025935 | Bacteria | 1478 |
| 348 | Ga0207704_11093092 | 3300025938 | Bacteria | 677 |
| 349 | Ga0207711_10248707 | 3300025941 | Bacteria | 1632 |
| 350 | Ga0207711_11046888 | 3300025941 | Bacteria | 756 |
| 351 | Ga0207689_10033428 | 3300025942 | Bacteria | 4273 |
| 352 | Ga0207661_11592418 | 3300025944 | Bacteria | 598 |
| 353 | Ga0207679_10124140 | 3300025945 | Bacteria | 2060 |
| 354 | Ga0207679_10734119 | 3300025945 | Bacteria | 897 |
| 355 | Ga0207667_10792086 | 3300025949 | Bacteria | 945 |
| 356 | Ga0207667_11161698 | 3300025949 | Bacteria | 753 |
| 357 | Ga0207712_10455288 | 3300025961 | Bacteria | 1086 |
| 358 | Ga0207712_10561879 | 3300025961 | Bacteria | 983 |
| 359 | Ga0207668_10065742 | 3300025972 | Bacteria | 2568 |
| 360 | Ga0207668_10465533 | 3300025972 | Bacteria | 1082 |
| 361 | Ga0207640_10222974 | 3300025981 | Bacteria | 1445 |
| 362 | Ga0207640_11667508 | 3300025981 | Bacteria | 575 |
| 363 | Ga0207703_10110024 | 3300026035 | Bacteria | 2349 |
| 364 | Ga0207639_10090669 | 3300026041 | Bacteria | 2445 |
| 365 | Ga0207639_10818469 | 3300026041 | Bacteria | 868 |
| 366 | Ga0207678_10001387 | 3300026067 | Bacteria | 22297 |
| 367 | Ga0207678_10178111 | 3300026067 | Bacteria | 1815 |
| 368 | Ga0207678_10333886 | 3300026067 | Bacteria | 1305 |
| 369 | Ga0207678_10449195 | 3300026067 | Bacteria | 1120 |
| 370 | Ga0207678_11725499 | 3300026067 | Bacteria | 549 |
| 371 | Ga0207708_10653067 | 3300026075 | Bacteria | 895 |
| 372 | Ga0207702_10014459 | 3300026078 | Bacteria | 6553 |
| 373 | Ga0207702_10081120 | 3300026078 | Bacteria | 2817 |
| 374 | Ga0207702_10099208 | 3300026078 | Bacteria | 2567 |
| 375 | Ga0207674_10052895 | 3300026116 | Bacteria | 4140 |
| 376 | Ga0207674_10628241 | 3300026116 | Bacteria | 1037 |
| 377 | Ga0207675_100826292 | 3300026118 | Bacteria | 941 |
| 378 | Ga0207683_10190699 | 3300026121 | Bacteria | 1861 |
| 379 | Ga0207683_10312408 | 3300026121 | Bacteria | 1439 |
| 380 | Ga0207683_10585914 | 3300026121 | Bacteria | 1032 |
| 381 | Ga0207698_10186223 | 3300026142 | Bacteria | 1844 |
| 382 | Ga0207698_10468803 | 3300026142 | Bacteria | 1219 |
| 383 | Ga0207698_10529533 | 3300026142 | Bacteria | 1151 |
| 384 | Ga0207698_10676570 | 3300026142 | Bacteria | 1025 |
| 385 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 386 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 387 | Ga0209281_1000840 | 3300027111 | Bacteria | 27410 |
| 388 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 389 | Ga0209371_1001857 | 3300027312 | Bacteria | 12997 |
| 390 | Ga0209371_1008497 | 3300027312 | Bacteria | 3402 |
| 391 | Ga0209371_1046644 | 3300027312 | Bacteria | 851 |
| 392 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 393 | Ga0209282_1000283 | 3300027666 | Bacteria | 25146 |
| 394 | Ga0209282_1039116 | 3300027666 | Bacteria | 2833 |
| 395 | Ga0209813_10000828 | 3300027866 | Bacteria | 7008 |
| 396 | Ga0209813_10109991 | 3300027866 | Bacteria | 948 |
| 397 | Ga0209813_10213878 | 3300027866 | Bacteria | 719 |
| 398 | Ga0209974_10386636 | 3300027876 | Bacteria | 547 |
| 399 | Ga0268266_10012307 | 3300028379 | Bacteria | 7403 |
| 400 | Ga0268266_10241317 | 3300028379 | Bacteria | 1668 |
| 401 | Ga0268266_10275690 | 3300028379 | Bacteria | 1562 |
| 402 | Ga0268266_10516927 | 3300028379 | Bacteria | 1141 |
| 403 | Ga0268266_11889092 | 3300028379 | Bacteria | 571 |
| 404 | Ga0268265_10359867 | 3300028380 | Bacteria | 1332 |
| 405 | Ga0268264_11166233 | 3300028381 | Bacteria | 779 |
| 406 | Ga0307517_10327943 | 3300028786 | Bacteria | 843 |
| 407 | Ga0307515_10000377 | 3300028794 | Bacteria | 109082 |
| 408 | Ga0307515_10000434 | 3300028794 | Bacteria | 100265 |
| 409 | Ga0307515_10016274 | 3300028794 | Bacteria | 13625 |
| 410 | Ga0307515_10033701 | 3300028794 | Bacteria | 8418 |
| 411 | Ga0307515_10394488 | 3300028794 | Bacteria | 1012 |
| 412 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 413 | Ga0268256_1002298 | 3300030500 | Bacteria | 9905 |
| 414 | Ga0268256_1008786 | 3300030500 | Bacteria | 3431 |
| 415 | Ga0268256_1052564 | 3300030500 | Bacteria | 851 |
| 416 | Ga0316176_1072425 | 3300030732 | Bacteria | 608 |
| 417 | Ga0316181_1261403 | 3300030744 | Bacteria | 2462 |
| 418 | Ga0307513_10001888 | 3300031456 | Bacteria | 29770 |
| 419 | Ga0307513_10192741 | 3300031456 | Bacteria | 1888 |
| 420 | Ga0307513_10442346 | 3300031456 | Bacteria | 1026 |
| 421 | Ga0307513_10529354 | 3300031456 | Bacteria | 893 |
| 422 | Ga0307408_100052252 | 3300031548 | Bacteria | 2947 |
| 423 | Ga0307408_100187346 | 3300031548 | Bacteria | 1664 |
| 424 | Ga0307408_101006931 | 3300031548 | Bacteria | 768 |
| 425 | Ga0307516_10315998 | 3300031730 | Bacteria | 1234 |
| 426 | Ga0307405_10512740 | 3300031731 | Bacteria | 963 |
| 427 | Ga0307413_11156467 | 3300031824 | Bacteria | 671 |
| 428 | Ga0307410_10188008 | 3300031852 | Bacteria | 1569 |
| 429 | Ga0307410_10834157 | 3300031852 | Bacteria | 786 |
| 430 | Ga0307412_10351845 | 3300031911 | Bacteria | 1183 |
| 431 | Ga0307412_10582268 | 3300031911 | Bacteria | 945 |
| 432 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 433 | Ga0307409_100489820 | 3300031995 | Bacteria | 1195 |
| 434 | Ga0307409_101096909 | 3300031995 | Bacteria | 817 |
| 435 | Ga0315913_1000024 | 3300033430 | Bacteria | 90863 |
| 436 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 437 | Ga0373941_0368889 | 3300035115 | Bacteria | 588 |
| 438 | Ga0316574_0054367 | 3300035398 | Bacteria | 2500 |
| 439 | Ga0316584_0407069 | 3300036712 | Bacteria | 968 |
| 440 | Ga0395900_0536357 | 3300037418 | Bacteria | 1116 |
| 441 | Ga0395898_0164394 | 3300037466 | Bacteria | 2123 |
| 442 | Ga0395905_0004591 | 3300037471 | Bacteria | 14285 |
| 443 | Ga0395905_0073479 | 3300037471 | Bacteria | 3205 |
| 444 | Ga0395905_0136682 | 3300037471 | Bacteria | 2306 |
| 445 | Ga0395905_0159911 | 3300037471 | Bacteria | 2117 |
| 446 | Ga0395905_0166954 | 3300037471 | Bacteria | 2068 |
| 447 | Ga0395905_0420019 | 3300037471 | Bacteria | 1233 |
| 448 | Ga0395905_0916404 | 3300037471 | Bacteria | 779 |
| 449 | Ga0395905_1457642 | 3300037471 | Bacteria | 589 |
| 450 | Ga0395901_0108029 | 3300038443 | Bacteria | 2921 |
| 451 | Ga0395901_0192399 | 3300038443 | Bacteria | 2139 |
| 452 | Ga0395901_0320823 | 3300038443 | Bacteria | 1603 |
| 453 | Ga0395901_0363975 | 3300038443 | Bacteria | 1491 |
| 454 | Ga0439436_0013306 | 3300041404 | Bacteria | 2489 |
| 455 | Ga0439465_0007940 | 3300041413 | Bacteria | 3359 |
| 456 | Ga0439465_0258020 | 3300041413 | Bacteria | 646 |
| 457 | Ga0451787_328280 | 3300041441 | Bacteria | 1979 |
| 458 | Ga0451791_1874397 | 3300041451 | Bacteria | 608 |
| 459 | Ga0451798_0190316 | 3300041458 | Bacteria | 2080 |
| 460 | Ga0451804_0509084 | 3300041463 | Bacteria | 504 |
| 461 | Ga0451833_0656247 | 3300041491 | Bacteria | 1721 |
| 462 | Ga0451839_0797687 | 3300041496 | Bacteria | 1771 |
| 463 | Ga0451840_02813 | 3300041497 | Bacteria | 1462 |
| 464 | Ga0451841_0317996 | 3300041498 | Bacteria | 2106 |
| 465 | Ga0451845_0142149 | 3300041501 | Bacteria | 629 |
| 466 | Ga0451846_33483 | 3300041502 | Bacteria | 1228 |
| 467 | Ga0451847_0149356 | 3300041503 | Bacteria | 2364 |
| 468 | Ga0451849_1233240 | 3300041505 | Bacteria | 1950 |
| 469 | Ga0451851_0041039 | 3300041507 | Bacteria | 2495 |
| 470 | Ga0451843_0950520 | 3300041509 | Bacteria | 1120 |
| 471 | Ga0451853_1752544 | 3300041512 | Bacteria | 3021 |
| 472 | Ga0439445_0255893 | 3300042004 | Bacteria | 523 |
| 473 | Ga0439449_0023273 | 3300042007 | Bacteria | 2317 |
| 474 | Ga0439449_0386849 | 3300042007 | Bacteria | 530 |
| 475 | Ga0439455_0199105 | 3300042012 | Bacteria | 580 |
| 476 | Ga0439462_0224245 | 3300042015 | Bacteria | 538 |
| 477 | Ga0450920_023890 | 3300042122 | Bacteria | 1186 |
| 478 | Ga0466972_0083314 | 3300044658 | Bacteria | 1521 |
| 479 | Ga0466965_0041976 | 3300044683 | Bacteria | 2255 |
| 480 | Ga0466965_0540303 | 3300044683 | Bacteria | 657 |
| 481 | Ga0466960_0156005 | 3300044901 | Bacteria | 1222 |
| 482 | Ga0466967_1292166 | 3300045976 | Bacteria | 727 |
| 483 | Ga0495617_045322 | 3300046452 | Bacteria | 1466 |
| 484 | Ga0495627_039264 | 3300046453 | Bacteria | 1461 |
| 485 | Ga0495627_083163 | 3300046453 | Bacteria | 926 |
| 486 | Ga0495592_0325386 | 3300046454 | Bacteria | 992 |
| 487 | Ga0495590_0008145 | 3300046457 | Bacteria | 4013 |
| 488 | Ga0495629_0239147 | 3300046459 | Bacteria | 1250 |
| 489 | Ga0495638_0001266 | 3300046460 | Bacteria | 23584 |
| 490 | Ga0495638_0061845 | 3300046460 | Bacteria | 2312 |
| 491 | Ga0495638_0188006 | 3300046460 | Bacteria | 1173 |
| 492 | Ga0495638_0200521 | 3300046460 | Bacteria | 1127 |
| 493 | Ga0495650_0022011 | 3300046471 | Bacteria | 3065 |
| 494 | Ga0495605_0001289 | 3300046474 | Bacteria | 16636 |
| 495 | Ga0495605_0201863 | 3300046474 | Bacteria | 866 |
| 496 | Ga0495662_0051558 | 3300046476 | Bacteria | 1986 |
| 497 | Ga0495584_0111263 | 3300046491 | Bacteria | 1386 |
| 498 | Ga0495585_0003047 | 3300046492 | Bacteria | 11546 |
| 499 | Ga0495585_0014299 | 3300046492 | Bacteria | 4628 |
| 500 | Ga0495585_0044472 | 3300046492 | Bacteria | 2481 |
| 501 | Ga0495585_0355542 | 3300046492 | Bacteria | 711 |
| 502 | Ga0495607_0070406 | 3300046501 | Bacteria | 1955 |
| 503 | Ga0495607_0223498 | 3300046501 | Bacteria | 919 |
| 504 | Ga0495583_0003099 | 3300046506 | Bacteria | 13147 |
| 505 | Ga0495583_0129631 | 3300046506 | Bacteria | 1056 |
| 506 | Ga0495583_0275303 | 3300046506 | Bacteria | 672 |
| 507 | Ga0495606_0011138 | 3300046507 | Bacteria | 7371 |
| 508 | Ga0495606_0055573 | 3300046507 | Bacteria | 2560 |
| 509 | Ga0495606_0066095 | 3300046507 | Bacteria | 2295 |
| 510 | Ga0495606_0077128 | 3300046507 | Bacteria | 2081 |
| 511 | Ga0495610_0002597 | 3300046512 | Bacteria | 14977 |
| 512 | Ga0495610_0019307 | 3300046512 | Bacteria | 3821 |
| 513 | Ga0495610_0023092 | 3300046512 | Bacteria | 3389 |
| 514 | Ga0495610_0026275 | 3300046512 | Bacteria | 3111 |
| 515 | Ga0495616_0002338 | 3300046513 | Bacteria | 12653 |
| 516 | Ga0495616_0103543 | 3300046513 | Bacteria | 1332 |
| 517 | Ga0495616_0114020 | 3300046513 | Bacteria | 1253 |
| 518 | Ga0495620_0016883 | 3300046515 | Bacteria | 3651 |
| 519 | Ga0495620_0017309 | 3300046515 | Bacteria | 3596 |
| 520 | Ga0495620_0018102 | 3300046515 | Bacteria | 3494 |
| 521 | Ga0495620_0170758 | 3300046515 | Bacteria | 843 |
| 522 | Ga0495631_0001859 | 3300046518 | Bacteria | 12472 |
| 523 | Ga0495632_0012884 | 3300046519 | Bacteria | 4797 |
| 524 | Ga0495632_0015553 | 3300046519 | Bacteria | 4260 |
| 525 | Ga0495632_0026520 | 3300046519 | Bacteria | 3049 |
| 526 | Ga0495632_0303681 | 3300046519 | Bacteria | 707 |
| 527 | Ga0495632_0484135 | 3300046519 | Bacteria | 535 |
| 528 | Ga0495643_0011972 | 3300046522 | Bacteria | 5251 |
| 529 | Ga0495643_0030466 | 3300046522 | Bacteria | 3012 |
| 530 | Ga0495643_0097990 | 3300046522 | Bacteria | 1505 |
| 531 | Ga0495644_0019675 | 3300046523 | Bacteria | 2578 |
| 532 | Ga0495648_0122865 | 3300046524 | Bacteria | 1392 |
| 533 | Ga0495648_0164547 | 3300046524 | Bacteria | 1143 |
| 534 | Ga0495652_0060749 | 3300046529 | Bacteria | 3193 |
| 535 | Ga0495654_0000308 | 3300046530 | Bacteria | 42986 |
| 536 | Ga0495654_0078466 | 3300046530 | Bacteria | 1552 |
| 537 | Ga0495654_0119438 | 3300046530 | Bacteria | 1195 |
| 538 | Ga0495654_0147827 | 3300046530 | Bacteria | 1042 |
| 539 | Ga0495609_0012502 | 3300046538 | Bacteria | 4027 |
| 540 | Ga0495609_0070523 | 3300046538 | Bacteria | 1536 |
| 541 | Ga0495597_0024478 | 3300046542 | Bacteria | 2786 |
| 542 | Ga0495622_0029699 | 3300046557 | Bacteria | 2554 |
| 543 | Ga0495633_0019083 | 3300046558 | Bacteria | 3471 |
| 544 | Ga0495633_0038782 | 3300046558 | Bacteria | 2274 |
| 545 | Ga0495633_0053812 | 3300046558 | Bacteria | 1894 |
| 546 | Ga0495633_0242892 | 3300046558 | Bacteria | 822 |
| 547 | Ga0495656_0014722 | 3300046615 | Bacteria | 2938 |
| 548 | Ga0495656_0071441 | 3300046615 | Bacteria | 1543 |
| 549 | Ga0495668_0022717 | 3300046616 | Bacteria | 3584 |
| 550 | Ga0495668_0025481 | 3300046616 | Bacteria | 3360 |
| 551 | Ga0495668_0046473 | 3300046616 | Bacteria | 2412 |
| 552 | Ga0495668_0066618 | 3300046616 | Bacteria | 1981 |
| 553 | Ga0495668_0393198 | 3300046616 | Bacteria | 762 |
| 554 | Ga0495625_0014610 | 3300046660 | Bacteria | 6256 |
| 555 | Ga0495625_0029614 | 3300046660 | Bacteria | 4091 |
| 556 | Ga0495625_0052613 | 3300046660 | Bacteria | 2915 |
| 557 | Ga0495625_0136309 | 3300046660 | Bacteria | 1659 |
| 558 | Ga0495625_0261524 | 3300046660 | Bacteria | 1119 |
| 559 | Ga0495625_0477356 | 3300046660 | Bacteria | 766 |
| 560 | Ga0495661_0251451 | 3300046665 | Bacteria | 902 |
| 561 | Ga0495661_0488210 | 3300046665 | Bacteria | 589 |
| 562 | Ga0495588_0000643 | 3300046674 | Bacteria | 16231 |
| 563 | Ga0495588_0011541 | 3300046674 | Bacteria | 4149 |
| 564 | Ga0495670_0013208 | 3300046691 | Bacteria | 4062 |
| 565 | Ga0495671_0061710 | 3300046692 | Bacteria | 1849 |
| 566 | Ga0495671_0131517 | 3300046692 | Bacteria | 1220 |
| 567 | Ga0495649_0013866 | 3300046694 | Bacteria | 4634 |
| 568 | Ga0495649_0034639 | 3300046694 | Bacteria | 2778 |
| 569 | Ga0495649_0191142 | 3300046694 | Bacteria | 1066 |
| 570 | Ga0495649_0372293 | 3300046694 | Bacteria | 720 |
| 571 | Ga0495660_0015869 | 3300046810 | Bacteria | 4346 |
| 572 | Ga0495660_0055768 | 3300046810 | Bacteria | 2138 |
| 573 | Ga0495604_0016659 | 3300047317 | Bacteria | 5877 |
| 574 | Ga0495636_0015190 | 3300047318 | Bacteria | 3068 |
| 575 | Ga0495636_0029106 | 3300047318 | Bacteria | 2254 |
| 576 | Ga0495672_0024621 | 3300047320 | Bacteria | 3873 |
| 577 | Ga0495683_0042349 | 3300047323 | Bacteria | 2296 |
| 578 | Ga0495687_130338 | 3300047443 | Bacteria | 891 |
| 579 | Ga0495677_0184821 | 3300047445 | Bacteria | 808 |
| 580 | Ga0495673_0084463 | 3300047469 | Bacteria | 1309 |
| 581 | Ga0495681_0126581 | 3300047470 | Bacteria | 1091 |
| 582 | Ga0495686_0002454 | 3300047472 | Bacteria | 17478 |
| 583 | Ga0495686_0045229 | 3300047472 | Bacteria | 2785 |
| 584 | Ga0495686_0267362 | 3300047472 | Bacteria | 955 |
| 585 | Ga0495626_0136317 | 3300048091 | Bacteria | 1044 |
| 586 | Ga0496100_0663184 | 3300048903 | Bacteria | 813 |
| 587 | Ga0496102_0147383 | 3300048905 | Bacteria | 2209 |
| 588 | Ga0496102_0246818 | 3300048905 | Bacteria | 1683 |
| 589 | Ga0496102_0641635 | 3300048905 | Bacteria | 985 |
| 590 | Ga0496103_0149178 | 3300048906 | Bacteria | 1497 |
| 591 | Ga0496103_0501194 | 3300048906 | Bacteria | 777 |
| 592 | Ga0496103_0702337 | 3300048906 | Bacteria | 641 |
| 593 | Ga0496104_0989843 | 3300048907 | Bacteria | 745 |
| 594 | Ga0496105_0119676 | 3300048908 | Bacteria | 2172 |
| 595 | Ga0496105_0476381 | 3300048908 | Bacteria | 983 |
| 596 | Ga0496105_0634908 | 3300048908 | Bacteria | 825 |
| 597 | Ga0496106_0089525 | 3300048909 | Bacteria | 2373 |
| 598 | Ga0496107_0003241 | 3300048910 | Bacteria | 10827 |
| 599 | Ga0496107_0694442 | 3300048910 | Bacteria | 749 |
| 600 | Ga0496109_1225340 | 3300048912 | Bacteria | 687 |
| 601 | Ga0496110_0088309 | 3300048913 | Bacteria | 2769 |
| 602 | Ga0496110_0527091 | 3300048913 | Bacteria | 1074 |
| 603 | Ga0496110_1136013 | 3300048913 | Bacteria | 690 |
| 604 | Ga0496111_0003486 | 3300048914 | Bacteria | 9732 |
| 605 | Ga0496111_0649468 | 3300048914 | Bacteria | 770 |
| 606 | Ga0496112_0321351 | 3300048915 | Bacteria | 1492 |
| 607 | Ga0496113_0346349 | 3300048916 | Bacteria | 1192 |
| 608 | Ga0496113_0480525 | 3300048916 | Bacteria | 998 |
| 609 | Ga0496114_0411267 | 3300048917 | Bacteria | 1198 |
| 610 | Ga0496115_0002734 | 3300048918 | Bacteria | 12667 |
| 611 | Ga0496115_0212934 | 3300048918 | Bacteria | 1596 |
| 612 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 613 | Ga0496116_0016742 | 3300048919 | Bacteria | 5722 |
| 614 | Ga0496116_0020118 | 3300048919 | Bacteria | 5079 |
| 615 | Ga0496116_0134513 | 3300048919 | Bacteria | 1403 |
| 616 | Ga0496116_0401047 | 3300048919 | Bacteria | 607 |
| 617 | Ga0496116_0425930 | 3300048919 | Bacteria | 578 |
| 618 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 619 | Ga0496117_0004678 | 3300048920 | Bacteria | 14866 |
| 620 | Ga0496117_0017870 | 3300048920 | Bacteria | 5908 |
| 621 | Ga0496117_0022715 | 3300048920 | Bacteria | 5023 |
| 622 | Ga0496117_0194704 | 3300048920 | Bacteria | 1151 |
| 623 | Ga0496117_0519429 | 3300048920 | Bacteria | 573 |
| 624 | Ga0496118_0001884 | 3300048921 | Bacteria | 29940 |
| 625 | Ga0496118_0004259 | 3300048921 | Bacteria | 17116 |
| 626 | Ga0496118_0013516 | 3300048921 | Bacteria | 7712 |
| 627 | Ga0496118_0017624 | 3300048921 | Bacteria | 6488 |
| 628 | Ga0496118_0165226 | 3300048921 | Bacteria | 1361 |
| 629 | Ga0496118_0368325 | 3300048921 | Bacteria | 759 |
| 630 | Ga0496119_0032290 | 3300048922 | Bacteria | 3492 |
| 631 | Ga0496119_0036562 | 3300048922 | Bacteria | 3203 |
| 632 | Ga0496119_0049122 | 3300048922 | Bacteria | 2611 |
| 633 | Ga0496119_0053854 | 3300048922 | Bacteria | 2454 |
| 634 | Ga0496119_0081628 | 3300048922 | Bacteria | 1861 |
| 635 | Ga0496119_0091575 | 3300048922 | Bacteria | 1726 |
| 636 | Ga0496119_0278767 | 3300048922 | Bacteria | 832 |
| 637 | Ga0496120_0001817 | 3300048923 | Bacteria | 23874 |
| 638 | Ga0496120_0003907 | 3300048923 | Bacteria | 13026 |
| 639 | Ga0496120_0014950 | 3300048923 | Bacteria | 5143 |
| 640 | Ga0496120_0021746 | 3300048923 | Bacteria | 4046 |
| 641 | Ga0496120_0043423 | 3300048923 | Bacteria | 2619 |
| 642 | Ga0496120_0056595 | 3300048923 | Bacteria | 2212 |
| 643 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 644 | Ga0496121_0005856 | 3300048924 | Bacteria | 15572 |
| 645 | Ga0496121_0008693 | 3300048924 | Bacteria | 11856 |
| 646 | Ga0496121_0020154 | 3300048924 | Bacteria | 6620 |
| 647 | Ga0496121_0030144 | 3300048924 | Bacteria | 4990 |
| 648 | Ga0496121_0048825 | 3300048924 | Bacteria | 3596 |
| 649 | Ga0496121_0072725 | 3300048924 | Bacteria | 2759 |
| 650 | Ga0496121_0102152 | 3300048924 | Bacteria | 2209 |
| 651 | Ga0496121_0319092 | 3300048924 | Bacteria | 1047 |
| 652 | Ga0496121_0490596 | 3300048924 | Bacteria | 782 |
| 653 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 654 | Ga0496122_0000074 | 3300048925 | Bacteria | 219900 |
| 655 | Ga0496122_0002284 | 3300048925 | Bacteria | 27720 |
| 656 | Ga0496122_0020124 | 3300048925 | Bacteria | 6055 |
| 657 | Ga0496122_0032494 | 3300048925 | Bacteria | 4313 |
| 658 | Ga0496122_0061360 | 3300048925 | Bacteria | 2760 |
| 659 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 660 | Ga0496123_0000062 | 3300048926 | Bacteria | 219882 |
| 661 | Ga0496123_0000290 | 3300048926 | Bacteria | 98053 |
| 662 | Ga0496123_0017802 | 3300048926 | Bacteria | 5691 |
| 663 | Ga0496123_0031088 | 3300048926 | Bacteria | 3892 |
| 664 | Ga0496123_0044983 | 3300048926 | Bacteria | 3012 |
| 665 | Ga0496123_0053721 | 3300048926 | Bacteria | 2660 |
| 666 | Ga0496123_0073264 | 3300048926 | Bacteria | 2125 |
| 667 | Ga0496123_0096986 | 3300048926 | Bacteria | 1729 |
| 668 | Ga0496124_0008017 | 3300048927 | Bacteria | 11111 |
| 669 | Ga0496124_0009644 | 3300048927 | Bacteria | 9889 |
| 670 | Ga0496124_0013702 | 3300048927 | Bacteria | 7897 |
| 671 | Ga0496124_0026371 | 3300048927 | Bacteria | 5241 |
| 672 | Ga0496124_0039353 | 3300048927 | Bacteria | 4099 |
| 673 | Ga0496124_0041824 | 3300048927 | Bacteria | 3950 |
| 674 | Ga0496124_0083621 | 3300048927 | Bacteria | 2618 |
| 675 | Ga0496124_0106942 | 3300048927 | Bacteria | 2258 |
| 676 | Ga0496124_0215472 | 3300048927 | Bacteria | 1449 |
| 677 | Ga0496124_0406245 | 3300048927 | Bacteria | 943 |
| 678 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 679 | Ga0496125_0003346 | 3300048928 | Bacteria | 19530 |
| 680 | Ga0496125_0014218 | 3300048928 | Bacteria | 7760 |
| 681 | Ga0496125_0044581 | 3300048928 | Bacteria | 3748 |
| 682 | Ga0496125_0047815 | 3300048928 | Bacteria | 3573 |
| 683 | Ga0496125_0097190 | 3300048928 | Bacteria | 2183 |
| 684 | Ga0496125_0133085 | 3300048928 | Bacteria | 1746 |
| 685 | Ga0496125_0337932 | 3300048928 | Bacteria | 905 |
| 686 | Ga0496125_0415778 | 3300048928 | Bacteria | 781 |
| 687 | Ga0496126_0002222 | 3300048929 | Bacteria | 26858 |
| 688 | Ga0496126_0004878 | 3300048929 | Bacteria | 15705 |
| 689 | Ga0496126_0009461 | 3300048929 | Bacteria | 10344 |
| 690 | Ga0496126_0034327 | 3300048929 | Bacteria | 4764 |
| 691 | Ga0496126_0081220 | 3300048929 | Bacteria | 2866 |
| 692 | Ga0496126_0091895 | 3300048929 | Bacteria | 2667 |
| 693 | Ga0496126_0192147 | 3300048929 | Bacteria | 1728 |
| 694 | Ga0496126_0251933 | 3300048929 | Bacteria | 1471 |
| 695 | Ga0496126_0253787 | 3300048929 | Bacteria | 1464 |
| 696 | Ga0496126_1240570 | 3300048929 | Bacteria | 546 |
| 697 | Ga0495678_016040 | 3300049459 | Bacteria | 3437 |
| 698 | Ga0495678_016669 | 3300049459 | Bacteria | 3352 |
| 699 | Ga0495678_018645 | 3300049459 | Bacteria | 3115 |
| 700 | Ga0495682_0007963 | 3300049460 | Bacteria | 4190 |
| 701 | Ga0501034_1010067 | 3300049571 | Bacteria | 715 |
| 702 | Ga0501036_0075608 | 3300049572 | Bacteria | 2848 |
| 703 | Ga0501038_0035627 | 3300049574 | Bacteria | 4368 |
| 704 | Ga0501039_0058415 | 3300049575 | Bacteria | 2988 |
| 705 | Ga0501040_0440760 | 3300049576 | Bacteria | 937 |
| 706 | Ga0501043_0161588 | 3300049579 | Bacteria | 1750 |
| 707 | Ga0501046_0139157 | 3300049580 | Bacteria | 1838 |
| 708 | Ga0501047_0174214 | 3300049581 | Bacteria | 2020 |
| 709 | Ga0501048_0047427 | 3300049582 | Bacteria | 3066 |
| 710 | Ga0501067_0330681 | 3300049583 | Bacteria | 849 |
| 711 | Ga0501067_0512461 | 3300049583 | Bacteria | 671 |
| 712 | Ga0501073_0255407 | 3300049589 | Bacteria | 1210 |
| 713 | Ga0501074_1003793 | 3300049590 | Bacteria | 587 |
| 714 | Ga0501080_0226294 | 3300049742 | Bacteria | 1710 |
| 715 | Ga0501083_0089443 | 3300049744 | Bacteria | 2034 |
| 716 | Ga0501280_001760 | 3300049776 | Bacteria | 3806 |
| 717 | Ga0501035_0213079 | 3300049822 | Bacteria | 1652 |
| 718 | nmdc:mga03683_10202_c1 | 3300050489 | Bacteria | 3364 |
| 719 | nmdc:mga03n38_136758_c1 | 3300050490 | Bacteria | 1220 |
| 720 | nmdc:mga03n38_74528_c1 | 3300050490 | Bacteria | 1579 |
| 721 | nmdc:mga00v17_211955_c1 | 3300050491 | Bacteria | 1253 |
| 722 | nmdc:mga00v17_285428_c1 | 3300050491 | Bacteria | 1072 |
| 723 | nmdc:mga00v17_330716_c1 | 3300050491 | Bacteria | 990 |
| 724 | nmdc:mga00v17_360_c1 | 3300050491 | Bacteria | 25745 |
| 725 | nmdc:mga00v17_378440_c1 | 3300050491 | Bacteria | 920 |
| 726 | nmdc:mga00v17_4292_c1 | 3300050491 | Bacteria | 7401 |
| 727 | nmdc:mga00v17_439014_c1 | 3300050491 | Bacteria | 848 |
| 728 | nmdc:mga00v17_75888_c2 | 3300050491 | Bacteria | 1601 |
| 729 | nmdc:mga0yw44_13168_c1 | 3300050492 | Bacteria | 4345 |
| 730 | nmdc:mga0yw44_180104_c1 | 3300050492 | Bacteria | 1391 |
| 731 | nmdc:mga0yw44_456761_c1 | 3300050492 | Bacteria | 866 |
| 732 | nmdc:mga0yw44_6773_c1 | 3300050492 | Bacteria | 5568 |
| 733 | nmdc:mga0k408_176025_c1 | 3300050493 | Bacteria | 1275 |
| 734 | nmdc:mga0k408_437589_c1 | 3300050493 | Bacteria | 777 |
| 735 | nmdc:mga0k408_68217_c1 | 3300050493 | Bacteria | 2074 |
| 736 | nmdc:mga0k408_794579_c1 | 3300050493 | Bacteria | 552 |
| 737 | nmdc:mga06z11_137765_c1 | 3300050494 | Bacteria | 1377 |
| 738 | nmdc:mga06z11_174112_c1 | 3300050494 | Bacteria | 1237 |
| 739 | nmdc:mga06z11_372201_c1 | 3300050494 | Bacteria | 857 |
| 740 | nmdc:mga06z11_423545_c1 | 3300050494 | Bacteria | 803 |
| 741 | nmdc:mga04h51_85095_c1 | 3300050495 | Bacteria | 1129 |
| 742 | nmdc:mga04h51_99504_c1 | 3300050495 | Bacteria | 1058 |
| 743 | nmdc:mga07m45_2146_c1 | 3300050496 | Bacteria | 2716 |
| 744 | nmdc:mga07m45_698220_c1 | 3300050496 | Bacteria | 584 |
| 745 | nmdc:mga0sz30_1057_c1 | 3300050516 | Bacteria | 9929 |
| 746 | nmdc:mga0sz30_14896_c1 | 3300050516 | Bacteria | 3067 |
| 747 | nmdc:mga0sz30_273541_c1 | 3300050516 | Bacteria | 752 |
| 748 | nmdc:mga0sz30_33473_c1 | 3300050516 | Bacteria | 2136 |
| 749 | nmdc:mga0sz30_40559_c1 | 3300050516 | Bacteria | 1957 |
| 750 | Ga0500610_0036361 | 3300053079 | Bacteria | 2531 |
| 751 | Ga0500610_0070121 | 3300053079 | Bacteria | 1828 |
| 752 | Ga0495655_0015995 | 3300053083 | Bacteria | 1607 |
| 753 | Ga0495619_0082511 | 3300053085 | Bacteria | 2167 |
| 754 | Ga0500644_0004951 | 3300053088 | Bacteria | 3350 |
| 755 | Ga0500560_000732 | 3300053107 | Bacteria | 4959 |
| 756 | Ga0500569_021327 | 3300053109 | Bacteria | 1711 |
| 757 | Ga0500594_0001734 | 3300053118 | Bacteria | 4745 |
| 758 | Ga0500594_0135948 | 3300053118 | Bacteria | 782 |
| 759 | Ga0500594_0151021 | 3300053118 | Bacteria | 746 |
| 760 | Ga0500607_258895 | 3300053121 | Bacteria | 684 |
| 761 | Ga0500608_034722 | 3300053122 | Bacteria | 2403 |
| 762 | Ga0500618_000862 | 3300053125 | Bacteria | 16226 |
| 763 | Ga0500618_003034 | 3300053125 | Bacteria | 5964 |
| 764 | Ga0500618_009427 | 3300053125 | Bacteria | 2665 |
| 765 | Ga0500658_0000112 | 3300053134 | Bacteria | 38407 |
| 766 | Ga0500559_0002392 | 3300053136 | Bacteria | 9741 |
| 767 | Ga0500561_0000170 | 3300053137 | Bacteria | 12023 |
| 768 | Ga0500568_0001609 | 3300053139 | Bacteria | 14286 |
| 769 | Ga0500568_0116614 | 3300053139 | Bacteria | 996 |
| 770 | Ga0500568_0145161 | 3300053139 | Bacteria | 879 |
| 771 | Ga0500573_0001302 | 3300053140 | Bacteria | 11807 |
| 772 | Ga0500573_0237604 | 3300053140 | Bacteria | 947 |
| 773 | Ga0500577_0467478 | 3300053142 | Bacteria | 551 |
| 774 | Ga0500590_024567 | 3300053148 | Bacteria | 3127 |
| 775 | Ga0500604_0010862 | 3300053151 | Bacteria | 2440 |
| 776 | Ga0500616_0002690 | 3300053153 | Bacteria | 14450 |
| 777 | Ga0500616_0048868 | 3300053153 | Bacteria | 2241 |
| 778 | Ga0500616_0136208 | 3300053153 | Bacteria | 1153 |
| 779 | Ga0500622_0001156 | 3300053156 | Bacteria | 21912 |
| 780 | Ga0500622_0001966 | 3300053156 | Bacteria | 15471 |
| 781 | Ga0500622_0036863 | 3300053156 | Bacteria | 2555 |
| 782 | Ga0500624_000401 | 3300053157 | Bacteria | 13438 |
| 783 | Ga0500627_0115000 | 3300053158 | Bacteria | 1212 |
| 784 | Ga0500634_0001225 | 3300053161 | Bacteria | 9685 |
| 785 | Ga0500634_0004081 | 3300053161 | Bacteria | 6672 |
| 786 | Ga0587091_099795 | 3300059511 | Bacteria | 679 |
| 787 | Ga0587072_015315 | 3300059643 | Bacteria | 1301 |
| 788 | Ga0501082_0055900 | 3300060353 | Bacteria | 3399 |
| 789 | 2503199089 | 2503198000 | Bacteria | 6884444 |
| 790 | 2509109489 | 2508501122 | Bacteria | 6292184 |
| 791 | 2509116619 | 2508501123 | Bacteria | 6283661 |
| 792 | 2509370067 | 2509276018 | Bacteria | 6910194 |
| 793 | 2509378201 | 2509276019 | Bacteria | 6802256 |
| 794 | 2509394039 | 2509276022 | Bacteria | 6200534 |
| 795 | 2510135185 | 2510065019 | Bacteria | 6903379 |
| 796 | 2510305358 | 2510065057 | Bacteria | 6649661 |
| 797 | 2510318290 | 2510065059 | Bacteria | 6847884 |
| 798 | 2510843661 | 2510461069 | Bacteria | 5505000 |
| 799 | 2510896636 | 2510461076 | Bacteria | 8618824 |
| 800 | 2511132093 | 2510917022 | Bacteria | 6504556 |
| 801 | 2511183936 | 2510917028 | Bacteria | 6185411 |
| 802 | 2511503226 | 2511231052 | Bacteria | 6974333 |
| 803 | 2512534497 | 2512047086 | Bacteria | 6850303 |
| 804 | 2512973692 | 2512875026 | Bacteria | 6861065 |
| 805 | 2513571562 | 2513237084 | Bacteria | 7231967 |
| 806 | 2513578602 | 2513237085 | Bacteria | 7695351 |
| 807 | 2513586098 | 2513237086 | Bacteria | 7265287 |
| 808 | 2513598141 | 2513237088 | Bacteria | 6927906 |
| 809 | 2513601790 | 2513237089 | Bacteria | 6553624 |
| 810 | 2513613313 | 2513237090 | Bacteria | 7096802 |
| 811 | 2513615616 | 2513237091 | Bacteria | 6900273 |
| 812 | 2513630215 | 2513237093 | Bacteria | 7545552 |
| 813 | 2513711287 | 2513237103 | Bacteria | 7647401 |
| 814 | 2513869177 | 2513237138 | Bacteria | 7368160 |
| 815 | 2513884191 | 2513237140 | Bacteria | 7076289 |
| 816 | 2513903520 | 2513237143 | Bacteria | 6664116 |
| 817 | 2513912321 | 2513237144 | Bacteria | 7530820 |
| 818 | 2513928494 | 2513237146 | Bacteria | 7166346 |
| 819 | 2513984065 | 2513237156 | Bacteria | 6402557 |
| 820 | 2513998547 | 2513237159 | Bacteria | 6810126 |
| 821 | 2514003626 | 2513237160 | Bacteria | 6650282 |
| 822 | 2514019332 | 2513237162 | Bacteria | 7468464 |
| 823 | 2514035669 | 2513237164 | Bacteria | 7563725 |
| 824 | 2514418073 | 2513237305 | Bacteria | 7293571 |
| 825 | 2515114340 | 2515075009 | Bacteria | 7288508 |
| 826 | 2515610964 | 2515154107 | Bacteria | 6795637 |
| 827 | 2515636259 | 2515154113 | Bacteria | 7807172 |
| 828 | 2515643247 | 2515154114 | Bacteria | 7848616 |
| 829 | 2515657714 | 2515154116 | Bacteria | 7552979 |
| 830 | 2515741528 | 2515154134 | Bacteria | 7220242 |
| 831 | 2516205494 | 2516143018 | Bacteria | 6951533 |
| 832 | 2516894657 | 2516653046 | Bacteria | 6989037 |
| 833 | 2517037983 | 2516653077 | Bacteria | 7555578 |
| 834 | 2517078251 | 2516653085 | Bacteria | 7346596 |
| 835 | 2517097016 | 2517093000 | Bacteria | 7412387 |
| 836 | 2517408599 | 2517287029 | Bacteria | 6905599 |
| 837 | 2517571305 | 2517487022 | Bacteria | 7227575 |
| 838 | 2524450551 | 2524023207 | Bacteria | 6813453 |
| 839 | 2524458404 | 2524023209 | Bacteria | 6679728 |
| 840 | 2535518955 | 2534681796 | Bacteria | 7146037 |
| 841 | 2537876645 | 2537561587 | Bacteria | 5425293 |
| 842 | 2551675886 | 2551306084 | Bacteria | 8942552 |
| 843 | 2551689614 | 2551306085 | Bacteria | 7347181 |
| 844 | 2551693319 | 2551306086 | Bacteria | 6843938 |
| 845 | 2551703302 | 2551306087 | Bacteria | 7351905 |
| 846 | 2551709409 | 2551306089 | Bacteria | 7162724 |
| 847 | 2551723759 | 2551306090 | Bacteria | 7953713 |
| 848 | 2551727295 | 2551306091 | Bacteria | 7086830 |
| 849 | 2551734705 | 2551306092 | Bacteria | 6992595 |
| 850 | 2551741023 | 2551306093 | Bacteria | 7064773 |
| 851 | 2554248810 | 2554235003 | Bacteria | 5877155 |
| 852 | 2559295898 | 2558860242 | Bacteria | 5568029 |
| 853 | 2561467054 | 2558860983 | Bacteria | 4133860 |
| 854 | 2585166784 | 2582581283 | Bacteria | 6030556 |
| 855 | 2585201802 | 2582581294 | Bacteria | 6626667 |
| 856 | 2585228802 | 2582581299 | Bacteria | 6518058 |
| 857 | 2585266868 | 2582581306 | Bacteria | 6450535 |
| 858 | 2585271605 | 2582581307 | Bacteria | 6597605 |
| 859 | 2585280668 | 2582581308 | Bacteria | 7413247 |
| 860 | 2585326453 | 2582581315 | Bacteria | 7318924 |
| 861 | 2585334209 | 2582581316 | Bacteria | 7774528 |
| 862 | 2585387911 | 2582581865 | Bacteria | 6644329 |
| 863 | 2585396006 | 2582581866 | Bacteria | 6859583 |
| 864 | 2585399687 | 2582581867 | Bacteria | 7184437 |
| 865 | 2585526106 | 2585427526 | Bacteria | 7258840 |
| 866 | 2585531602 | 2585427527 | Bacteria | 7273426 |
| 867 | 2585540719 | 2585427528 | Bacteria | 6842387 |
| 868 | 2585551451 | 2585427530 | Bacteria | 7383882 |
| 869 | 2585563155 | 2585427531 | Bacteria | 6992870 |
| 870 | 2585820774 | 2585427590 | Bacteria | 6824633 |
| 871 | 2585838988 | 2585427593 | Bacteria | 7141551 |
| 872 | 2585902793 | 2585427608 | Bacteria | 6544331 |
| 873 | 2585907374 | 2585427609 | Bacteria | 6667127 |
| 874 | 2587982632 | 2585428125 | Bacteria | 6662905 |
| 875 | 2588519586 | 2588253730 | Bacteria | 6881675 |
| 876 | 2599335031 | 2599185156 | Bacteria | 5403036 |
| 877 | 2599420206 | 2599185170 | Bacteria | 7295545 |
| 878 | 2599603310 | 2599185210 | Bacteria | 5624189 |
| 879 | 2599720273 | 2599185236 | Bacteria | 6875203 |
| 880 | 2599937021 | 2599185301 | Bacteria | 6161860 |
| 881 | 2600193462 | 2599185352 | Bacteria | 7228948 |
| 882 | 2600373292 | 2600254933 | Bacteria | 4750527 |
| 883 | 2601610784 | 2600255279 | Bacteria | 5605316 |
| 884 | 2601747558 | 2600255308 | Bacteria | 5611129 |
| 885 | 2616306787 | 2615840626 | Bacteria | 7921970 |
| 886 | 2616557639 | 2615840698 | Bacteria | 7319877 |
| 887 | 2617383307 | 2617270742 | Bacteria | 6808054 |
| 888 | 2643808153 | 2643221557 | Bacteria | 7184309 |
| 889 | 2643813697 | 2643221558 | Bacteria | 5460675 |
| 890 | 2643855026 | 2643221568 | Bacteria | 5187270 |
| 891 | 2643921423 | 2643221582 | Bacteria | 5804683 |
| 892 | 2643988465 | 2643221595 | Bacteria | 6565519 |
| 893 | 2644002408 | 2643221599 | Bacteria | 6292121 |
| 894 | 2644051981 | 2643221607 | Bacteria | 6314006 |
| 895 | 2644068658 | 2643221610 | Bacteria | 7480339 |
| 896 | 2644110063 | 2643221618 | Bacteria | 7717186 |
| 897 | 2644150339 | 2643221626 | Bacteria | 8069654 |
| 898 | 2644154618 | 2643221627 | Bacteria | 6761570 |
| 899 | 2644194884 | 2643221634 | Bacteria | 6705461 |
| 900 | 2644201463 | 2643221636 | Bacteria | 6583769 |
| 901 | 2644209414 | 2643221637 | Bacteria | 5345260 |
| 902 | 2644240565 | 2643221643 | Bacteria | 5749658 |
| 903 | 2644299937 | 2643221653 | Bacteria | 4569637 |
| 904 | 2644312943 | 2643221655 | Bacteria | 7722067 |
| 905 | 2644336491 | 2643221659 | Bacteria | 7890716 |
| 906 | 2644379587 | 2643221668 | Bacteria | 7306521 |
| 907 | 2644419727 | 2643221675 | Bacteria | 7473456 |
| 908 | 2644453084 | 2643221680 | Bacteria | 7473610 |
| 909 | 2644484433 | 2643221686 | Bacteria | 6310811 |
| 910 | 2644492444 | 2643221688 | Bacteria | 5260751 |
| 911 | 2644499836 | 2643221689 | Bacteria | 6042950 |
| 912 | 2644521476 | 2643221693 | Bacteria | 5513853 |
| 913 | 2644546137 | 2643221698 | Bacteria | 7756764 |
| 914 | 2644618673 | 2643221712 | Bacteria | 7729434 |
| 915 | 2644652942 | 2643221718 | Bacteria | 5345506 |
| 916 | 2644658164 | 2643221719 | Bacteria | 4568197 |
| 917 | 2644677181 | 2643221723 | Bacteria | 7095460 |
| 918 | 2644688887 | 2643221726 | Bacteria | 7455827 |
| 919 | 2657682512 | 2657244999 | Bacteria | 5946535 |
| 920 | 2671113533 | 2667528174 | Bacteria | 6435400 |
| 921 | 2688596363 | 2687453392 | Bacteria | 6880454 |
| 922 | 2692319971 | 2690316117 | Bacteria | 6800650 |
| 923 | 2694630166 | 2693429783 | Bacteria | 7019804 |
| 924 | 2723028562 | 2721755556 | Bacteria | 6745503 |
| 925 | 2723573483 | 2721755686 | Bacteria | 7343952 |
| 926 | 2725947473 | 2724679232 | Bacteria | 7646494 |
| 927 | 2730109498 | 2728369352 | Bacteria | 6745171 |
| 928 | 2738947575 | 2738541317 | Bacteria | 5340176 |
| 929 | 2739037215 | 2738541333 | Bacteria | 7106503 |
| 930 | 2753463724 | 2751185821 | Bacteria | 6189929 |
| 931 | 2756673752 | 2756170246 | Bacteria | 7451806 |
| 932 | 2766064336 | 2765235942 | Bacteria | 7445910 |
| 933 | 2776915420 | 2775507049 | Bacteria | 6284736 |
| 934 | 2778173694 | 2775507266 | Bacteria | 7392367 |
| 935 | 2792582137 | 2791355082 | Bacteria | 5973319 |
| 936 | 2792622002 | 2791355091 | Bacteria | 6135441 |
| 937 | 2792628741 | 2791355092 | Bacteria | 6248105 |
| 938 | 2792641331 | 2791355094 | Bacteria | 7011481 |
| 939 | 2792747611 | 2791355123 | Bacteria | 8049106 |
| 940 | 2793281109 | 2791355253 | Bacteria | 5171699 |
| 941 | 2793359457 | 2791355266 | Bacteria | 7116587 |
| 942 | 2802717328 | 2802428858 | Bacteria | 6636079 |
| 943 | 2802724683 | 2802428859 | Bacteria | 6667919 |
| 944 | 2802729435 | 2802428860 | Bacteria | 6525526 |
| 945 | 2802736780 | 2802428861 | Bacteria | 6534206 |
| 946 | 2802743186 | 2802428862 | Bacteria | 6633353 |
| 947 | 2802749688 | 2802428863 | Bacteria | 6410669 |
| 948 | 2804753597 | 2802429268 | Bacteria | 6094027 |
| 949 | 2806047306 | 2802429633 | Bacteria | 7341974 |
| 950 | 2806054161 | 2802429634 | Bacteria | 7083200 |
| 951 | 2806060255 | 2802429635 | Bacteria | 7650140 |
| 952 | 2806068866 | 2802429636 | Bacteria | 7597525 |
| 953 | 2806077191 | 2802429637 | Bacteria | 7067217 |
| 954 | 2808988278 | 2808606387 | Bacteria | 5697198 |
| 955 | 2819244720 | 2818991272 | Bacteria | 4622173 |
| 956 | 2819560908 | 2818991439 | Bacteria | 6907412 |
| 957 | 2819611184 | 2818991448 | Bacteria | 6772224 |
| 958 | 2819638881 | 2818991453 | Bacteria | 7181617 |
| 959 | 2821128661 | 2821123053 | Bacteria | 7836056 |
| 960 | 2837651320 | 2837651117 | Bacteria | 3772164 |
| 961 | 2838030877 | 2838029111 | Bacteria | 6603031 |
| 962 | 2838040412 | 2838035591 | Bacteria | 7166484 |
| 963 | 2838048409 | 2838042994 | Bacteria | 6046894 |
| 964 | 2838078266 | 2838074704 | Bacteria | 6785777 |
| 965 | 2838667826 | 2838661181 | Bacteria | 7385261 |
| 966 | 2838678729 | 2838675328 | Bacteria | 4909118 |
| 967 | 2838683955 | 2838680041 | Bacteria | 6545511 |
| 968 | 2838690215 | 2838686498 | Bacteria | 7807632 |
| 969 | 2838698484 | 2838694306 | Bacteria | 6853137 |
| 970 | 2838711599 | 2838707686 | Bacteria | 6619912 |
| 971 | 2838718182 | 2838714209 | Bacteria | 5525906 |
| 972 | 2838723026 | 2838719591 | Bacteria | 5523910 |
| 973 | 2838728249 | 2838724970 | Bacteria | 4908691 |
| 974 | 2838731990 | 2838729681 | Bacteria | 7400765 |
| 975 | 2838741678 | 2838736955 | Bacteria | 5760694 |
| 976 | 2838744886 | 2838742623 | Bacteria | 7396178 |
| 977 | 2839993311 | 2839993093 | Bacteria | 5512535 |
| 978 | 2841845488 | 2841840854 | Bacteria | 5761912 |
| 979 | 2841850582 | 2841846520 | Bacteria | 5345850 |
| 980 | 2841855943 | 2841851746 | Bacteria | 7532261 |
| 981 | 2841863165 | 2841859092 | Bacteria | 5436171 |
| 982 | 2842081400 | 2842077413 | Bacteria | 6508645 |
| 983 | 2842116924 | 2842110456 | Bacteria | 7656360 |
| 984 | 2842121823 | 2842118031 | Bacteria | 7033875 |
| 985 | 2842128908 | 2842124991 | Bacteria | 5346824 |
| 986 | 2842133621 | 2842130223 | Bacteria | 4909145 |
| 987 | 2842145191 | 2842140634 | Bacteria | 5759631 |
| 988 | 2842155467 | 2842152218 | Bacteria | 4908957 |
| 989 | 2842161113 | 2842156927 | Bacteria | 6894975 |
| 990 | 2842166631 | 2842163707 | Bacteria | 6916235 |
| 991 | 2842174576 | 2842170452 | Bacteria | 5525737 |
| 992 | 2842179235 | 2842175837 | Bacteria | 4908771 |
| 993 | 2842184729 | 2842180545 | Bacteria | 6888678 |
| 994 | 2842190606 | 2842187318 | Bacteria | 5524014 |
| 995 | 2842215070 | 2842211629 | Bacteria | 5523832 |
| 996 | 2842223301 | 2842217011 | Bacteria | 7497767 |
| 997 | 2842227791 | 2842224351 | Bacteria | 5524473 |
| 998 | 2842232312 | 2842229732 | Bacteria | 7475766 |
| 999 | 2842240838 | 2842237096 | Bacteria | 6620661 |
| 1000 | 2842246727 | 2842243621 | Bacteria | 7421798 |
| 1001 | 2842261171 | 2842257432 | Bacteria | 7401195 |
| 1002 | 2842274235 | 2842271015 | Bacteria | 7807131 |
| 1003 | 2842295057 | 2842291075 | Bacteria | 7076806 |
| 1004 | 2842300340 | 2842298080 | Bacteria | 6123127 |
| 1005 | 2842305918 | 2842304105 | Bacteria | 7023636 |
| 1006 | 2842361143 | 2842357229 | Bacteria | 6485165 |
| 1007 | 2842374925 | 2842370503 | Bacteria | 7038661 |
| 1008 | 2842381456 | 2842377471 | Bacteria | 7140707 |
| 1009 | 2842388526 | 2842384541 | Bacteria | 7057858 |
| 1010 | 2842477609 | 2842475841 | Bacteria | 6603183 |
| 1011 | 2842487952 | 2842482326 | Bacteria | 7212537 |
| 1012 | 2842504518 | 2842502639 | Bacteria | 6604161 |
| 1013 | 2842511768 | 2842509118 | Bacteria | 6850950 |
| 1014 | 2842520097 | 2842515876 | Bacteria | 5436280 |
| 1015 | 2842524422 | 2842521101 | Bacteria | 6569494 |
| 1016 | 2842926220 | 2842922631 | Bacteria | 5824079 |
| 1017 | 2844003069 | 2844002411 | Bacteria | 7168230 |
| 1018 | 2844011188 | 2844009547 | Bacteria | 6728125 |
| 1019 | 2844164262 | 2844163670 | Bacteria | 7266046 |
| 1020 | 2844457087 | 2844454524 | Bacteria | 7952546 |
| 1021 | 2847420806 | 2847417321 | Bacteria | 6913799 |
| 1022 | 2847673807 | 2847670302 | Bacteria | 6165597 |
| 1023 | 2847690288 | 2847686936 | Bacteria | 6278406 |
| 1024 | 2848995631 | 2848992105 | Bacteria | 6810864 |
| 1025 | 2850082549 | 2850079185 | Bacteria | 6848280 |
| 1026 | 2852391637 | 2852387548 | Bacteria | 8025568 |
| 1027 | 2855827283 | 2855825444 | Bacteria | 6785811 |
| 1028 | 2855842665 | 2855839649 | Bacteria | 7135830 |
| 1029 | 2855878169 | 2855872281 | Bacteria | 6964271 |
| 1030 | 2856320542 | 2856314179 | Bacteria | 6477897 |
| 1031 | 2856328493 | 2856328259 | Bacteria | 6528202 |
| 1032 | 2856341453 | 2856334872 | Bacteria | 7037011 |
| 1033 | 2856353542 | 2856349417 | Bacteria | 6230045 |
| 1034 | 2856363509 | 2856356410 | Bacteria | 6297484 |
| 1035 | 2856365015 | 2856364286 | Bacteria | 6939991 |
| 1036 | 2857353306 | 2857349434 | Bacteria | 7926032 |
| 1037 | 2857371909 | 2857367948 | Bacteria | 6965560 |
| 1038 | 2857519503 | 2857516855 | Bacteria | 7787325 |
| 1039 | 2857534186 | 2857531043 | Bacteria | 6754041 |
| 1040 | 2858803476 | 2858800743 | Bacteria | 6603254 |
| 1041 | 2869169006 | 2869162929 | Bacteria | 6399702 |
| 1042 | 2869174583 | 2869169390 | Bacteria | 6659796 |
| 1043 | 2869236895 | 2869234852 | Bacteria | 6654993 |
| 1044 | 2869246793 | 2869242130 | Bacteria | 6609239 |
| 1045 | 2869253457 | 2869249662 | Bacteria | 6868783 |
| 1046 | 2869258172 | 2869256925 | Bacteria | 6981691 |
| 1047 | 2869268020 | 2869264136 | Bacteria | 6880765 |
| 1048 | 2869276173 | 2869271264 | Bacteria | 6908218 |
| 1049 | 2869279539 | 2869278585 | Bacteria | 7077053 |
| 1050 | 2869286360 | 2869285874 | Bacteria | 6901219 |
| 1051 | 2871430329 | 2871429161 | Bacteria | 6547891 |
| 1052 | 2871442333 | 2871435913 | Bacteria | 6880295 |
| 1053 | 2871454263 | 2871451962 | Bacteria | 7336357 |
| 1054 | 2871465365 | 2871459585 | Bacteria | 6866887 |
| 1055 | 2871472318 | 2871466892 | Bacteria | 6923287 |
| 1056 | 2871486923 | 2871481445 | Bacteria | 6700002 |
| 1057 | 2871494887 | 2871488783 | Bacteria | 6929816 |
| 1058 | 2871500922 | 2871495908 | Bacteria | 6935695 |
| 1059 | 2874104738 | 2874102143 | Bacteria | 6342645 |
| 1060 | 2874115852 | 2874109183 | Bacteria | 6517025 |
| 1061 | 2874118239 | 2874116593 | Bacteria | 6674494 |
| 1062 | 2874137997 | 2874131515 | Bacteria | 6820270 |
| 1063 | 2874139471 | 2874139085 | Bacteria | 7021506 |
| 1064 | 2874146747 | 2874146452 | Bacteria | 7533118 |
| 1065 | 2874155820 | 2874155637 | Bacteria | 6724144 |
| 1066 | 2874166461 | 2874162495 | Bacteria | 6174670 |
| 1067 | 2874176796 | 2874168670 | Bacteria | 8062617 |
| 1068 | 2876370599 | 2876369609 | Bacteria | 6807521 |
| 1069 | 2876385308 | 2876377896 | Bacteria | 6565995 |
| 1070 | 2876388607 | 2876386047 | Bacteria | 6698674 |
| 1071 | 2876399268 | 2876392853 | Bacteria | 6660880 |
| 1072 | 2876402294 | 2876399893 | Bacteria | 6927900 |
| 1073 | 2876409448 | 2876406927 | Bacteria | 6191900 |
| 1074 | 2876414149 | 2876413966 | Bacteria | 6831344 |
| 1075 | 2876427306 | 2876420981 | Bacteria | 6687741 |
| 1076 | 2878038957 | 2878035449 | Bacteria | 6555736 |
| 1077 | 2878742065 | 2878738818 | Bacteria | 7136951 |
| 1078 | 2878746525 | 2878745973 | Bacteria | 6867388 |
| 1079 | 2878760012 | 2878753008 | Bacteria | 6922523 |
| 1080 | 2878764969 | 2878760144 | Bacteria | 6823465 |
| 1081 | 2878772113 | 2878767105 | Bacteria | 6898628 |
| 1082 | 2878778878 | 2878774303 | Bacteria | 6108671 |
| 1083 | 2878786505 | 2878781027 | Bacteria | 6834456 |
| 1084 | 2881148583 | 2881147464 | Bacteria | 7779814 |
| 1085 | 2881159674 | 2881155292 | Bacteria | 6461656 |
| 1086 | 2881165368 | 2881161766 | Bacteria | 7127907 |
| 1087 | 2881852883 | 2881845957 | Bacteria | 6611900 |
| 1088 | 2881858572 | 2881853255 | Bacteria | 6698367 |
| 1089 | 2881867186 | 2881861095 | Bacteria | 7128710 |
| 1090 | 2882640317 | 2882632389 | Bacteria | 8154593 |
| 1091 | 2882916817 | 2882912400 | Bacteria | 6801539 |
| 1092 | 2885307226 | 2885305155 | Bacteria | 7348390 |
| 1093 | 2885313766 | 2885312484 | Bacteria | 6415165 |
| 1094 | 2885324479 | 2885318864 | Bacteria | 6729568 |
| 1095 | 2885332409 | 2885326080 | Bacteria | 7134805 |
| 1096 | 2885337564 | 2885334103 | Bacteria | 7216818 |
| 1097 | 2885344914 | 2885342637 | Bacteria | 7011821 |
| 1098 | 2885357741 | 2885350715 | Bacteria | 6787678 |
| 1099 | 2888337052 | 2888337043 | Bacteria | 6629336 |
| 1100 | 2888353578 | 2888350351 | Bacteria | 7372807 |
| 1101 | 2889015294 | 2889010040 | Bacteria | 6749192 |
| 1102 | 2889019628 | 2889016732 | Bacteria | 6700763 |
| 1103 | 2891051150 | 2891048133 | Bacteria | 4447501 |
| 1104 | 2891373845 | 2891373044 | Bacteria | 5202277 |
| 1105 | 2896390295 | 2896384573 | Bacteria | 7700774 |
| 1106 | 2899795264 | 2899792073 | Bacteria | 4926588 |
| 1107 | 2899808095 | 2899803654 | Bacteria | 5577784 |
| 1108 | 2899849245 | 2899845264 | Bacteria | 5672268 |
| 1109 | 2903494246 | 2903492973 | Bacteria | 13473544 |
| 1110 | 2903499715 | 2903492973 | Bacteria | 13473544 |
| 1111 | 2903517621 | 2903513507 | Bacteria | 6344008 |
| 1112 | 2903545737 | 2903540706 | Bacteria | 7062119 |
| 1113 | 2904665795 | 2904659560 | Bacteria | 6685615 |
| 1114 | 2906308926 | 2906308376 | Bacteria | 6841989 |
| 1115 | 2906322207 | 2906321335 | Bacteria | 6579571 |
| 1116 | 2906333851 | 2906328253 | Bacteria | 6585166 |
| 1117 | 2906362035 | 2906354277 | Bacteria | 6991324 |
| 1118 | 2906364421 | 2906363423 | Bacteria | 6856682 |
| 1119 | 2906371869 | 2906370794 | Bacteria | 6881062 |
| 1120 | 2906393202 | 2906386501 | Bacteria | 5977019 |
| 1121 | 2906395619 | 2906393657 | Bacteria | 6790866 |
| 1122 | 2906405462 | 2906401398 | Bacteria | 6693206 |
| 1123 | 2906410059 | 2906408224 | Bacteria | 6162342 |
| 1124 | 2906421321 | 2906414383 | Bacteria | 6580790 |
| 1125 | 2906434899 | 2906427513 | Bacteria | 6375796 |
| 1126 | 2913300075 | 2913295892 | Bacteria | 6333755 |
| 1127 | 2913312484 | 2913308742 | Bacteria | 5350706 |
| 1128 | 2915982543 | 2915980308 | Bacteria | 6624279 |
| 1129 | 2915988260 | 2915986958 | Bacteria | 6739310 |
| 1130 | 2915994496 | 2915993759 | Bacteria | 7016183 |
| 1131 | 2916007067 | 2916000859 | Bacteria | 6865702 |
| 1132 | 2916008750 | 2916007675 | Bacteria | 6898660 |
| 1133 | 2916015254 | 2916014648 | Bacteria | 6946486 |
| 1134 | 2916024398 | 2916021584 | Bacteria | 6854472 |
| 1135 | 2916031237 | 2916028427 | Bacteria | 6748433 |
| 1136 | 2916037663 | 2916035215 | Bacteria | 6755766 |
| 1137 | 2916047503 | 2916041962 | Bacteria | 6820487 |
| 1138 | 2916051728 | 2916048683 | Bacteria | 6543552 |
| 1139 | 2916058427 | 2916055098 | Bacteria | 6758838 |
| 1140 | 2916066205 | 2916061851 | Bacteria | 6737736 |
| 1141 | 2916075307 | 2916068649 | Bacteria | 6943657 |
| 1142 | 2916082046 | 2916076590 | Bacteria | 6596108 |
| 1143 | 2919105326 | 2919100787 | Bacteria | 7710546 |
| 1144 | 2919118560 | 2919114240 | Bacteria | 5700270 |
| 1145 | 2919170640 | 2919166419 | Bacteria | 4952238 |
| 1146 | 2919411009 | 2919408235 | Bacteria | 6149349 |
| 1147 | 2920760447 | 2920760137 | Bacteria | 7427611 |
| 1148 | 2920825844 | 2920822456 | Bacteria | 6897201 |
| 1149 | 2921205897 | 2921201388 | Bacteria | 6926299 |
| 1150 | 2921209521 | 2921208531 | Bacteria | 6745326 |
| 1151 | 2921239596 | 2921237296 | Bacteria | 6876710 |
| 1152 | 2921245434 | 2921244191 | Bacteria | 6568419 |
| 1153 | 2921254554 | 2921250672 | Bacteria | 6677771 |
| 1154 | 2921257703 | 2921257292 | Bacteria | 6808382 |
| 1155 | 2921267019 | 2921263974 | Bacteria | 6864552 |
| 1156 | 2921285571 | 2921282425 | Bacteria | 6826397 |
| 1157 | 2921293166 | 2921289301 | Bacteria | 7316391 |
| 1158 | 2921298760 | 2921296804 | Bacteria | 7176999 |
| 1159 | 2922132573 | 2922130491 | Bacteria | 7173936 |
| 1160 | 2922157290 | 2922151315 | Bacteria | 6902399 |
| 1161 | 2922177056 | 2922172374 | Bacteria | 6167644 |
| 1162 | 2922183237 | 2922178524 | Bacteria | 6025201 |
| 1163 | 2922191487 | 2922185730 | Bacteria | 7113964 |
| 1164 | 2923559554 | 2923556063 | Bacteria | 6793593 |
| 1165 | 2924150567 | 2924144063 | Bacteria | 6883928 |
| 1166 | 2924155482 | 2924150972 | Bacteria | 7169444 |
| 1167 | 2924161154 | 2924158325 | Bacteria | 7188855 |
| 1168 | 2924169927 | 2924165586 | Bacteria | 7260590 |
| 1169 | 2924173346 | 2924172951 | Bacteria | 6749356 |
| 1170 | 2924180676 | 2924179722 | Bacteria | 6843264 |
| 1171 | 2924186925 | 2924186466 | Bacteria | 6876637 |
| 1172 | 2924193692 | 2924193448 | Bacteria | 6955718 |
| 1173 | 2924206569 | 2924200457 | Bacteria | 6757188 |
| 1174 | 2924209342 | 2924207177 | Bacteria | 6917007 |
| 1175 | 2924214475 | 2924214083 | Bacteria | 7080103 |
| 1176 | 2924226170 | 2924221636 | Bacteria | 7113495 |
| 1177 | 2924231761 | 2924228884 | Bacteria | 6633132 |
| 1178 | 2924710341 | 2924710171 | Bacteria | 6752351 |
| 1179 | 2924722913 | 2924718760 | Bacteria | 6331356 |
| 1180 | 2924737575 | 2924733363 | Bacteria | 7574837 |
| 1181 | 2924748186 | 2924741084 | Bacteria | 6661321 |
| 1182 | 2924751617 | 2924748358 | Bacteria | 6154725 |
| 1183 | 2924779749 | 2924776078 | Bacteria | 7492003 |
| 1184 | 2924790816 | 2924784321 | Bacteria | 7416538 |
| 1185 | 2926755090 | 2926754445 | Bacteria | 5964435 |
| 1186 | 2926762250 | 2926760298 | Bacteria | 5505990 |
| 1187 | 2929141808 | 2929138655 | Bacteria | 5810547 |
| 1188 | 2933010683 | 2933006813 | Bacteria | 4912075 |
| 1189 | 2933015643 | 2933011516 | Bacteria | 5439334 |
| 1190 | 2933021914 | 2933016740 | Bacteria | 6355406 |
| 1191 | 2933572423 | 2933570622 | Bacteria | 7023390 |
| 1192 | 2933593072 | 2933586486 | Bacteria | 7667493 |
| 1193 | 2933597616 | 2933594066 | Bacteria | 5594265 |
| 1194 | 2935897867 | 2935894831 | Bacteria | 6620579 |
| 1195 | 2935903697 | 2935901341 | Bacteria | 7341747 |
| 1196 | 2936369823 | 2936367885 | Bacteria | 7324495 |
| 1197 | 2936379010 | 2936375103 | Bacteria | 6652732 |
| 1198 | 2936382013 | 2936381700 | Bacteria | 7006523 |
| 1199 | 2936997558 | 2936996657 | Bacteria | 6298727 |
| 1200 | 2937009422 | 2937002841 | Bacteria | 6934057 |
| 1201 | 2937013675 | 2937009748 | Bacteria | 6746052 |
| 1202 | 2937019107 | 2937016420 | Bacteria | 6782579 |
| 1203 | 2937024783 | 2937023124 | Bacteria | 6815156 |
| 1204 | 2937034873 | 2937029754 | Bacteria | 6424026 |
| 1205 | 2937036098 | 2937036028 | Bacteria | 6846469 |
| 1206 | 2937044064 | 2937042894 | Bacteria | 6741576 |
| 1207 | 2937051126 | 2937049772 | Bacteria | 6757901 |
| 1208 | 2937062096 | 2937056579 | Bacteria | 7107896 |
| 1209 | 2937064802 | 2937063883 | Bacteria | 7199456 |
| 1210 | 2937074353 | 2937071275 | Bacteria | 6984483 |
| 1211 | 2937081933 | 2937078374 | Bacteria | 6610289 |
| 1212 | 2937086140 | 2937084907 | Bacteria | 6618516 |
| 1213 | 2937097720 | 2937091812 | Bacteria | 6979387 |
| 1214 | 2937101348 | 2937098957 | Bacteria | 7249374 |
| 1215 | 2937106701 | 2937106411 | Bacteria | 6947143 |
| 1216 | 2937119581 | 2937113482 | Bacteria | 6505872 |
| 1217 | 2937123160 | 2937119839 | Bacteria | 6597547 |
| 1218 | 2937132664 | 2937126314 | Bacteria | 6771275 |
| 1219 | 2937822266 | 2937813078 | Bacteria | 7783518 |
| 1220 | 2937823934 | 2937822353 | Bacteria | 7290551 |
| 1221 | 2937848640 | 2937843397 | Bacteria | 5256375 |
| 1222 | 2937864836 | 2937861824 | Bacteria | 6660327 |
| 1223 | 2937877053 | 2937868953 | Bacteria | 6639878 |
| 1224 | 2937880107 | 2937877337 | Bacteria | 7246526 |
| 1225 | 2937895206 | 2937891427 | Bacteria | 6357007 |
| 1226 | 2937988140 | 2937980651 | Bacteria | 6517427 |
| 1227 | 2937999587 | 2937994558 | Bacteria | 7036190 |
| 1228 | 2938018655 | 2938014810 | Bacteria | 6700592 |
| 1229 | 2941501259 | 2941499720 | Bacteria | 7599444 |
| 1230 | 2957381944 | 2957375807 | Bacteria | 6425588 |
| 1231 | 2957384595 | 2957382221 | Bacteria | 6737050 |
| 1232 | 2957391365 | 2957388812 | Bacteria | 6778072 |
| 1233 | 2957400516 | 2957395598 | Bacteria | 6822399 |
| 1234 | 2957404335 | 2957402308 | Bacteria | 6741770 |
| 1235 | 2957413729 | 2957408893 | Bacteria | 6558585 |
| 1236 | 2957416602 | 2957415311 | Bacteria | 6991633 |
| 1237 | 2957425730 | 2957422303 | Bacteria | 7172205 |
| 1238 | 2957434577 | 2957430029 | Bacteria | 7022557 |
| 1239 | 2957442201 | 2957437181 | Bacteria | 6568994 |
| 1240 | 2957447904 | 2957443900 | Bacteria | 6869977 |
| 1241 | 2957455047 | 2957450854 | Bacteria | 6765715 |
| 1242 | 2957463744 | 2957457609 | Bacteria | 6967680 |
| 1243 | 2957470679 | 2957464669 | Bacteria | 6568877 |
| 1244 | 2957473282 | 2957471148 | Bacteria | 6797643 |
| 1245 | 2957483962 | 2957478035 | Bacteria | 6756658 |
| 1246 | 2957485693 | 2957484790 | Bacteria | 6703082 |
| 1247 | 2957494132 | 2957491536 | Bacteria | 6695180 |
| 1248 | 2957502981 | 2957498199 | Bacteria | 7126688 |
| 1249 | 2957510130 | 2957505466 | Bacteria | 7253085 |
| 1250 | 2958035117 | 2958034702 | Bacteria | 6989922 |
| 1251 | 2958044148 | 2958041894 | Bacteria | 13082850 |
| 1252 | 2958046616 | 2958041894 | Bacteria | 13082850 |
| 1253 | 2958065755 | 2958064165 | Bacteria | 7158582 |
| 1254 | 2958087160 | 2958084443 | Bacteria | 7312792 |
| 1255 | 2958094196 | 2958092219 | Bacteria | 6861151 |
| 1256 | 2958104339 | 2958100919 | Bacteria | 6800575 |
| 1257 | 2958108402 | 2958108152 | Bacteria | 6681128 |
| 1258 | 2958120461 | 2958115193 | Bacteria | 6923548 |
| 1259 | 2958124893 | 2958122699 | Bacteria | 7280457 |
| 1260 | 2958130760 | 2958130278 | Bacteria | 6897202 |
| 1261 | 2958145600 | 2958144490 | Bacteria | 6677056 |
| 1262 | 2958161404 | 2958158011 | Bacteria | 6058449 |
| 1263 | 2958170061 | 2958165035 | Bacteria | 6906348 |
| 1264 | 2958176778 | 2958172287 | Bacteria | 6716688 |
| 1265 | 2958180098 | 2958179912 | Bacteria | 6874908 |
| 1266 | 2960587001 | 2960584000 | Bacteria | 6864594 |
| 1267 | 2960592121 | 2960591022 | Bacteria | 6622873 |
| 1268 | 2960599305 | 2960597568 | Bacteria | 6550735 |
| 1269 | 2960609671 | 2960603979 | Bacteria | 6898737 |
| 1270 | 2960616199 | 2960610863 | Bacteria | 6691244 |
| 1271 | 2960623557 | 2960617483 | Bacteria | 6727748 |
| 1272 | 2960624929 | 2960624210 | Bacteria | 6875384 |
| 1273 | 2960633517 | 2960631154 | Bacteria | 6732508 |
| 1274 | 2960642465 | 2960637947 | Bacteria | 7296468 |
| 1275 | 2960650304 | 2960645483 | Bacteria | 7211087 |
| 1276 | 2960654219 | 2960652885 | Bacteria | 7083688 |
| 1277 | 2960664287 | 2960660292 | Bacteria | 7041660 |
| 1278 | 2960671914 | 2960667422 | Bacteria | 6763020 |
| 1279 | 2960676766 | 2960674078 | Bacteria | 6609048 |
| 1280 | 2960687348 | 2960680706 | Bacteria | 6624464 |
| 1281 | 2960693233 | 2960687367 | Bacteria | 6535474 |
| 1282 | 2960698988 | 2960693952 | Bacteria | 6749742 |
| 1283 | 2961077925 | 2961077736 | Bacteria | 7079850 |
| 1284 | 2961121138 | 2961114664 | Bacteria | 6680456 |
| 1285 | 2961134371 | 2961127735 | Bacteria | 7196641 |
| 1286 | 2961141605 | 2961136820 | Bacteria | 6775228 |
| 1287 | 2961168515 | 2961163497 | Bacteria | 6901077 |
| 1288 | 2961177283 | 2961170736 | Bacteria | 7072258 |
| 1289 | 2961188928 | 2961183825 | Bacteria | 6688536 |
| 1290 | 2964609625 | 2964607997 | Bacteria | 7101408 |
| 1291 | 2964616275 | 2964615318 | Bacteria | 6809089 |
| 1292 | 2964622586 | 2964621998 | Bacteria | 6834995 |
| 1293 | 2964633284 | 2964628898 | Bacteria | 7083044 |
| 1294 | 2964639876 | 2964636051 | Bacteria | 7091832 |
| 1295 | 2964645832 | 2964643177 | Bacteria | 6820887 |
| 1296 | 2964654123 | 2964649959 | Bacteria | 6675118 |
| 1297 | 2964657403 | 2964656573 | Bacteria | 7100150 |
| 1298 | 2964664470 | 2964663802 | Bacteria | 7019362 |
| 1299 | 2964674247 | 2964670856 | Bacteria | 6851364 |
| 1300 | 2964683084 | 2964678106 | Bacteria | 6792020 |
| 1301 | 2964685543 | 2964685014 | Bacteria | 6839111 |
| 1302 | 2964694619 | 2964691889 | Bacteria | 6802758 |
| 1303 | 2964700770 | 2964698721 | Bacteria | 6765331 |
| 1304 | 2964707907 | 2964705432 | Bacteria | 7114648 |
| 1305 | 2964712886 | 2964712639 | Bacteria | 6695970 |
| 1306 | 2964725042 | 2964719344 | Bacteria | 7286602 |
| 1307 | 2965023335 | 2965018300 | Bacteria | 6883036 |
| 1308 | 2965031026 | 2965025482 | Bacteria | 6532201 |
| 1309 | 2965032183 | 2965032056 | Bacteria | 6887443 |
| 1310 | 2965045829 | 2965040258 | Bacteria | 6855979 |
| 1311 | 2965050784 | 2965047637 | Bacteria | 6623551 |
| 1312 | 2965065706 | 2965062239 | Bacteria | 7412989 |
| 1313 | 2965095267 | 2965089291 | Bacteria | 6866420 |
| 1314 | 2965103395 | 2965102966 | Bacteria | 6800987 |
| 1315 | 2965111373 | 2965110997 | Bacteria | 6693150 |
| 1316 | 2965121122 | 2965119406 | Bacteria | 6956431 |
| 1317 | 2967667800 | 2967664464 | Bacteria | 6948836 |
| 1318 | 2967673514 | 2967671571 | Bacteria | 7021409 |
| 1319 | 2967680876 | 2967678726 | Bacteria | 7264382 |
| 1320 | 2967687599 | 2967686174 | Bacteria | 6678622 |
| 1321 | 2967695373 | 2967693043 | Bacteria | 6804451 |
| 1322 | 2967700444 | 2967699805 | Bacteria | 6854538 |
| 1323 | 2967711411 | 2967706974 | Bacteria | 7186053 |
| 1324 | 2967718867 | 2967714385 | Bacteria | 7000047 |
| 1325 | 2967722582 | 2967721400 | Bacteria | 7073753 |
| 1326 | 2967733678 | 2967728569 | Bacteria | 6641507 |
| 1327 | 2967739023 | 2967735183 | Bacteria | 6827012 |
| 1328 | 2967742588 | 2967742019 | Bacteria | 6794534 |
| 1329 | 2967749873 | 2967748971 | Bacteria | 6733771 |
| 1330 | 2967756311 | 2967755722 | Bacteria | 6814706 |
| 1331 | 2967768121 | 2967762386 | Bacteria | 6923502 |
| 1332 | 2967775310 | 2967769361 | Bacteria | 6587838 |
| 1333 | 2967777522 | 2967775926 | Bacteria | 6738189 |
| 1334 | 2968002386 | 2967996073 | Bacteria | 6787468 |
| 1335 | 2968009617 | 2968003550 | Bacteria | 6929263 |
| 1336 | 2968023537 | 2968016561 | Bacteria | 7022047 |
| 1337 | 2968093137 | 2968091066 | Bacteria | 6052692 |
| 1338 | 2968102440 | 2968097103 | Bacteria | 6107094 |
| 1339 | 2968117288 | 2968110612 | Bacteria | 6814636 |
| 1340 | 2968122286 | 2968117919 | Bacteria | 6536078 |
| 1341 | 2968132043 | 2968128360 | Bacteria | 6270294 |
| 1342 | 2968141743 | 2968138860 | Bacteria | 6605449 |
| 1343 | 2968176923 | 2968171901 | Bacteria | 6894245 |
| 1344 | 2970020970 | 2970019648 | Bacteria | 7072033 |
| 1345 | 2970029847 | 2970026789 | Bacteria | 6785236 |
| 1346 | 2970034253 | 2970033650 | Bacteria | 7118744 |
| 1347 | 2970047654 | 2970040964 | Bacteria | 6731123 |
| 1348 | 2970048435 | 2970047711 | Bacteria | 7088379 |
| 1349 | 2970059429 | 2970054988 | Bacteria | 6611507 |
| 1350 | 2970062356 | 2970061556 | Bacteria | 7099761 |
| 1351 | 2970075562 | 2970068827 | Bacteria | 7123112 |
| 1352 | 2970078757 | 2970076120 | Bacteria | 6697332 |
| 1353 | 2970086370 | 2970082768 | Bacteria | 6183754 |
| 1354 | 2970093647 | 2970088815 | Bacteria | 6933825 |
| 1355 | 2970096491 | 2970095765 | Bacteria | 6936963 |
| 1356 | 2970108979 | 2970102677 | Bacteria | 6812532 |
| 1357 | 2970114130 | 2970109326 | Bacteria | 6863976 |
| 1358 | 2970122352 | 2970116247 | Bacteria | 6501857 |
| 1359 | 2970123842 | 2970122695 | Bacteria | 6625855 |
| 1360 | 2970133728 | 2970129317 | Bacteria | 6806560 |
| 1361 | 2970138160 | 2970136068 | Bacteria | 7207982 |
| 1362 | 2970143716 | 2970143518 | Bacteria | 6446480 |
| 1363 | 2970153343 | 2970149975 | Bacteria | 6779706 |
| 1364 | 2970163697 | 2970156795 | Bacteria | 7168044 |
| 1365 | 2970167212 | 2970164137 | Bacteria | 6861252 |
| 1366 | 2970175014 | 2970170962 | Bacteria | 6876229 |
| 1367 | 2970178821 | 2970177841 | Bacteria | 6768001 |
| 1368 | 2970186911 | 2970184632 | Bacteria | 7054431 |
| 1369 | 2970196564 | 2970191845 | Bacteria | 7032787 |
| 1370 | 2970476119 | 2970469710 | Bacteria | 6969209 |
| 1371 | 2970490765 | 2970489779 | Bacteria | 6517260 |
| 1372 | 2970509957 | 2970503327 | Bacteria | 7099517 |
| 1373 | 2970511858 | 2970510686 | Bacteria | 7006402 |
| 1374 | 2970537234 | 2970532167 | Bacteria | 6553173 |
| 1375 | 2970552129 | 2970547951 | Bacteria | 6931819 |
| 1376 | 2970559817 | 2970554993 | Bacteria | 6814252 |
| 1377 | 2970594139 | 2970593180 | Bacteria | 7073582 |
| 1378 | 2970623945 | 2970619444 | Bacteria | 6986144 |
| 1379 | 2970630142 | 2970627176 | Bacteria | 6680862 |
| 1380 | 2977517323 | 2977516862 | Bacteria | 6940108 |
| 1381 | 2977525426 | 2977523885 | Bacteria | 6960446 |
| 1382 | 2977535196 | 2977530762 | Bacteria | 6951399 |
| 1383 | 2977540278 | 2977537788 | Bacteria | 6929320 |
| 1384 | 2977550410 | 2977544691 | Bacteria | 6875412 |
| 1385 | 2977558972 | 2977551784 | Bacteria | 7125765 |
| 1386 | 2977559692 | 2977558990 | Bacteria | 6863948 |
| 1387 | 2977570308 | 2977565890 | Bacteria | 6901543 |
| 1388 | 2977577461 | 2977572785 | Bacteria | 6763888 |
| 1389 | 2977585492 | 2977579622 | Bacteria | 6772100 |
| 1390 | 2977828534 | 2977821940 | Bacteria | 6906439 |
| 1391 | 2977829662 | 2977828996 | Bacteria | 7007971 |
| 1392 | 2977844238 | 2977843712 | Bacteria | 6753583 |
| 1393 | 2977855444 | 2977851361 | Bacteria | 6694324 |
| 1394 | 2977859643 | 2977858184 | Bacteria | 6215359 |
| 1395 | 2977865541 | 2977864932 | Bacteria | 7534097 |
| 1396 | 2977879469 | 2977872689 | Bacteria | 7270173 |
| 1397 | 2977898831 | 2977898635 | Bacteria | 6675551 |
| 1398 | 2977908451 | 2977907340 | Bacteria | 6577984 |
| 1399 | 2977917611 | 2977915119 | Bacteria | 6829656 |
| 1400 | 2977929465 | 2977922695 | Bacteria | 6956781 |
| 1401 | 2977935803 | 2977935797 | Bacteria | 6252826 |
| 1402 | 2977942360 | 2977942078 | Bacteria | 7570577 |
| 1403 | 2977954590 | 2977950692 | Bacteria | 6893264 |
| 1404 | 2977960966 | 2977957713 | Bacteria | 6877875 |
| 1405 | 2977988069 | 2977986579 | Bacteria | 6581278 |
| 1406 | 2978972550 | 2978969890 | Bacteria | 5400756 |
| 1407 | 2979092480 | 2979089926 | Bacteria | 5670289 |
| 1408 | 2979100129 | 2979095461 | Bacteria | 5669583 |
| 1409 | 2979104451 | 2979100975 | Bacteria | 5423623 |
| 1410 | 2979711578 | 2979710463 | Bacteria | 6785254 |
| 1411 | 2979751870 | 2979742915 | Bacteria | 7301278 |
| 1412 | 2979769346 | 2979764755 | Bacteria | 6610066 |
| 1413 | 2979776589 | 2979772303 | Bacteria | 6618277 |
| 1414 | 2979781371 | 2979779861 | Bacteria | 6219781 |
| 1415 | 2979800560 | 2979793036 | Bacteria | 6808957 |
| 1416 | 2979814833 | 2979808191 | Bacteria | 7179355 |
| 1417 | 2984513753 | 2984509177 | Bacteria | 5274802 |
| 1418 | 2984522669 | 2984518228 | Bacteria | 5277463 |
| 1419 | 2984541975 | 2984537506 | Bacteria | 5277481 |
| 1420 | 2984590803 | 2984587000 | Bacteria | 5263363 |
| 1421 | 2984601405 | 2984601300 | Bacteria | 5455244 |
| 1422 | 2987641899 | 2987636660 | Bacteria | 8088555 |
| 1423 | 2987648588 | 2987645492 | Bacteria | 6117018 |
| 1424 | 2987653451 | 2987652177 | Bacteria | 6969023 |
| 1425 | 2987664538 | 2987659509 | Bacteria | 6966464 |
| 1426 | 2987678118 | 2987673487 | Bacteria | 6884027 |
| 1427 | 2989354837 | 2989349275 | Bacteria | 6349068 |
| 1428 | 2989771505 | 2989771324 | Bacteria | 5605128 |
| 1429 | 2989780022 | 2989776772 | Bacteria | 4843317 |
| 1430 | 2995394778 | 2995392953 | Bacteria | 4539380 |
| 1431 | 2996354699 | 2996348954 | Bacteria | 7239054 |
| 1432 | 2996389895 | 2996386984 | Bacteria | 6978667 |
| 1433 | 2996890177 | 2996887358 | Bacteria | 5795980 |
| 1434 | 2996895219 | 2996893221 | Bacteria | 5823108 |
| 1435 | 3000137758 | 3000135777 | Bacteria | 6891109 |
| 1436 | 3003930919 | 3003930520 | Bacteria | 5667563 |
| 1437 | 3004173697 | 3004167301 | Bacteria | 8330599 |
| 1438 | 3004193592 | 3004188549 | Bacteria | 6952365 |
| 1439 | 3004202174 | 3004195979 | Bacteria | 6776956 |
| 1440 | 3004209290 | 3004203850 | Bacteria | 7307914 |
| 1441 | 3004236608 | 3004232784 | Bacteria | 6662140 |
| 1442 | 3004244379 | 3004239961 | Bacteria | 6892290 |
| 1443 | 3004249476 | 3004248173 | Bacteria | 6563236 |
| 1444 | 3004275373 | 3004268573 | Bacteria | 7043476 |
| 1445 | 3004281347 | 3004275668 | Bacteria | 7114440 |
| 1446 | 3004290429 | 3004289098 | Bacteria | 6135450 |
| 1447 | 3004336839 | 3004334049 | Bacteria | 8449246 |
| 1448 | 3005415734 | 3005409236 | Bacteria | 7188837 |
| 1449 | 3005421681 | 3005416602 | Bacteria | 7064308 |
| 1450 | 639650370 | 639633055 | Bacteria | 7751309 |
| 1451 | 643827402 | 643692032 | Bacteria | 6891900 |
| 1452 | 648737105 | 648276728 | Bacteria | 6968865 |
| 1453 | 649870914 | 649633066 | Bacteria | 6690028 |
| 1454 | 650741112 | 650716007 | Bacteria | 5573770 |
| 1455 | 8003573829 | 8003570095 | Bacteria | 5747666 |
| 1456 | 8003995247 | 8003992118 | Bacteria | 7266902 |
| 1457 | 8004002965 | 8003999396 | Bacteria | 7063185 |
| 1458 | 8004306798 | 8004300914 | Bacteria | 6132239 |
| 1459 | 8004315209 | 8004312739 | Bacteria | 7444653 |
| 1460 | 8004367049 | 8004361976 | Bacteria | 6858373 |
| 1461 | 8004381511 | 8004374579 | Bacteria | 6898112 |
| 1462 | 8004388560 | 8004387939 | Bacteria | 7049250 |
| 1463 | 8004447660 | 8004445564 | Bacteria | 6322258 |
| 1464 | 8004646448 | 8004640170 | Bacteria | 6723001 |
| 1465 | 8004700703 | 8004695233 | Bacteria | 6731676 |
| 1466 | 8004706381 | 8004703790 | Bacteria | 8006957 |
| 1467 | 8004715182 | 8004714634 | Bacteria | 6776161 |
| 1468 | 8004731309 | 8004727605 | Bacteria | 6643904 |
| 1469 | 8005249165 | 8005246636 | Bacteria | 4933972 |
| 1470 | 8005262361 | 8005258706 | Bacteria | 6184835 |
| 1471 | 8005313636 | 8005307578 | Bacteria | 7395396 |
| 1472 | 8005319615 | 8005314921 | Bacteria | 7072929 |
| 1473 | 8005324704 | 8005321885 | Bacteria | 5795980 |
| 1474 | 8005381632 | 8005376324 | Bacteria | 6590079 |
| 1475 | 8005465031 | 8005460587 | Bacteria | 7157962 |
| 1476 | 8005490237 | 8005484373 | Bacteria | 6297373 |
| 1477 | 8005546605 | 8005542996 | Bacteria | 7077758 |
| 1478 | 8005561104 | 8005556819 | Bacteria | 6908598 |
| 1479 | 8005565730 | 8005563573 | Bacteria | 7153261 |
| 1480 | 8005571782 | 8005570704 | Bacteria | 6957481 |
| 1481 | 8005646894 | 8005645114 | Bacteria | 6950293 |
| 1482 | 8005660753 | 8005658619 | Bacteria | 4500593 |
| 1483 | 8018128849 | 8018127388 | Bacteria | 7351159 |
| 1484 | 8018155120 | 8018150411 | Bacteria | 5549903 |
| 1485 | 8018165160 | 8018163183 | Bacteria | 7277977 |
| 1486 | 8023686474 | 8023680758 | Bacteria | 7729763 |
| 1487 | 8024484302 | 8024479707 | Bacteria | 6954785 |
| 1488 | 8024490793 | 8024486573 | Bacteria | 6540512 |
| 1489 | 8046768088 | 8046767195 | Bacteria | 7547379 |
| 1490 | 8049296166 | 8049293176 | Bacteria | 6128433 |
| 1491 | 8054560173 | 8054558443 | Bacteria | 5204801 |
| 1492 | 8055435633 | 8055431914 | Bacteria | 4551896 |
| 1493 | 8056878182 | 8056875544 | Bacteria | 4355797 |
| 1494 | 8057581553 | 8057575449 | Bacteria | 7367519 |
| 1495 | 8057879222 | 8057874678 | Bacteria | 7494653 |
| 1496 | Ga0395905_0001126 | |||
| 1497 | RicEn_FSXC42840_b1 | |||
| 1498 | JGI24740J21852_10000013 | |||
| 1499 | JGI24740J21852_10003324 | |||
| 1500 | JGI24737J22298_10257894 | |||
| 1501 | JGI25155J39150_1000010 | |||
| 1502 | JGI25156J39149_1000102 | |||
| 1503 | JGI25156J39149_1008662 | |||
| 1504 | JGI25162J39368_1000879 | |||
| 1505 | JGI25154J39366_1000184 | |||
| 1506 | JGI25158J39367_1000526 | |||
| 1507 | JGI25158J39367_1020635 | |||
| 1508 | JGI25157J39369_1000009 | |||
| 1509 | JGI25157J39369_1000842 | |||
| 1510 | JGI25152J39213_1002498 | |||
| 1511 | JGI25152J39213_1003827 | |||
| 1512 | JGI25152J39213_1016049 | |||
| 1513 | JGI25150J39212_1012970 | |||
| 1514 | JGI25159J45721_1000053 | |||
| 1515 | JGI25159J45721_1009500 | |||
| 1516 | JGI25151J46595_10001525 | |||
| 1517 | JGI25151J46595_10005265 | |||
| 1518 | JGI25151J46595_10010648 | |||
| 1519 | JGI25151J46595_10014524 | |||
| 1520 | JGI25165J46597_1000273 | |||
| 1521 | JGI25165J46597_1001977 | |||
| 1522 | JGI25153J46596_10070568 | |||
| 1523 | JGI25153J46596_10075202 | |||
| 1524 | rootH2_10104045 | |||
| 1525 | rootL2_10029472 | |||
| 1526 | rootH1_10215066 | |||
| 1527 | JGI25160J50197_1000168 | |||
| 1528 | JGI25160J50197_1000235 | |||
| 1529 | JGI25160J50197_1018219 | |||
| 1530 | JGI25161J50226_1000175 | |||
| 1531 | JGI25161J50226_1001177 | |||
| 1532 | Ga0055539_1014238 | |||
| 1533 | Ga0055526_1002546 | |||
| 1534 | Ga0055526_1002690 | |||
| 1535 | Ga0055526_1010815 | |||
| 1536 | Ga0055526_1017168 | |||
| 1537 | Ga0055526_1018522 | |||
| 1538 | Ga0055524_1002053 | |||
| 1539 | Ga0055524_1003375 | |||
| 1540 | Ga0055524_1007952 | |||
| 1541 | Ga0055524_1009037 | |||
| 1542 | Ga0055524_1017569 | |||
| 1543 | Ga0055524_1018474 | |||
| 1544 | Ga0055524_1037117 | |||
| 1545 | Ga0055536_1002743 | |||
| 1546 | Ga0055528_1000369 | |||
| 1547 | Ga0055528_1001991 | |||
| 1548 | Ga0055528_1005279 | |||
| 1549 | Ga0055528_1017003 | |||
| 1550 | Ga0055528_1035258 | |||
| 1551 | Ga0055530_10015001 | |||
| 1552 | Ga0055540_1013494 | |||
| 1553 | Ga0055540_1015856 | |||
| 1554 | Ga0055531_10003576 | |||
| 1555 | Ga0055531_10064627 | |||
| 1556 | Ga0058692_1002172 | |||
| 1557 | Ga0058692_1006673 | |||
| 1558 | Ga0058692_1007029 | |||
| 1559 | Ga0058692_1028227 | |||
| 1560 | Ga0055543_1000226 | |||
| 1561 | Ga0055543_1000412 | |||
| 1562 | Ga0065165_1000133 | |||
| 1563 | Ga0065165_1002250 | |||
| 1564 | Ga0065165_1005266 | |||
| 1565 | Ga0065165_1052669 | |||
| 1566 | Ga0065704_10763127 | |||
| 1567 | Ga0065715_10853871 | |||
| 1568 | Ga0070658_10344666 | |||
| 1569 | Ga0070658_10386302 | |||
| 1570 | Ga0070670_100000183 | |||
| 1571 | Ga0068869_100309951 | |||
| 1572 | Ga0070680_100027990 | |||
| 1573 | Ga0070682_100000791 | |||
| 1574 | Ga0070660_100045414 | |||
| 1575 | Ga0070660_100153690 | |||
| 1576 | Ga0070691_10016489 | |||
| 1577 | Ga0070661_100705424 | |||
| 1578 | Ga0070692_10111921 | |||
| 1579 | Ga0070668_100334991 | |||
| 1580 | Ga0070668_100449344 | |||
| 1581 | Ga0070668_100517355 | |||
| 1582 | Ga0070668_101286691 | |||
| 1583 | Ga0070668_101341896 | |||
| 1584 | Ga0070669_100374603 | |||
| 1585 | Ga0070671_100173508 | |||
| 1586 | Ga0070674_100768454 | |||
| 1587 | Ga0070659_100081160 | |||
| 1588 | Ga0070659_100892153 | |||
| 1589 | Ga0070705_100009688 | |||
| 1590 | Ga0070700_100087920 | |||
| 1591 | Ga0070694_100052405 | |||
| 1592 | Ga0070663_100003763 | |||
| 1593 | Ga0070678_100090978 | |||
| 1594 | Ga0070662_100372795 | |||
| 1595 | Ga0070662_101054725 | |||
| 1596 | Ga0070681_10008287 | |||
| 1597 | Ga0068867_101612271 | |||
| 1598 | Ga0070679_100199832 | |||
| 1599 | Ga0070684_100716527 | |||
| 1600 | Ga0068853_100040844 | |||
| 1601 | Ga0068853_100702550 | |||
| 1602 | Ga0068853_101443730 | |||
| 1603 | Ga0070665_100083379 | |||
| 1604 | Ga0070665_100389179 | |||
| 1605 | Ga0070665_100668223 | |||
| 1606 | Ga0068855_100476119 | |||
| 1607 | Ga0068855_101313924 | |||
| 1608 | Ga0070664_100039603 | |||
| 1609 | Ga0070664_100585780 | |||
| 1610 | Ga0068857_100035472 | |||
| 1611 | Ga0068854_100335999 | |||
| 1612 | Ga0068856_100014117 | |||
| 1613 | Ga0068856_100081792 | |||
| 1614 | Ga0068856_100188981 | |||
| 1615 | Ga0068852_100059446 | |||
| 1616 | Ga0068852_100261305 | |||
| 1617 | Ga0068852_100815066 | |||
| 1618 | Ga0068860_101068060 | |||
| 1619 | Ga0068860_102236096 | |||
| 1620 | Ga0068862_100519182 | |||
| 1621 | Ga0081455_10441046 | |||
| 1622 | Ga0075365_10001999 | |||
| 1623 | Ga0075365_10011804 | |||
| 1624 | Ga0075365_10022037 | |||
| 1625 | Ga0075365_10036005 | |||
| 1626 | Ga0075365_10080809 | |||
| 1627 | Ga0075365_10324910 | |||
| 1628 | Ga0075365_10453340 | |||
| 1629 | Ga0075368_10000370 | |||
| 1630 | Ga0075368_10006472 | |||
| 1631 | Ga0075368_10060920 | |||
| 1632 | Ga0075363_100097483 | |||
| 1633 | Ga0075363_100249788 | |||
| 1634 | Ga0075364_10000195 | |||
| 1635 | Ga0075364_10064288 | |||
| 1636 | Ga0075364_10107044 | |||
| 1637 | Ga0075364_10614010 | |||
| 1638 | Ga0075362_10005758 | |||
| 1639 | Ga0075362_10041266 | |||
| 1640 | Ga0075367_10003513 | |||
| 1641 | Ga0075367_10010829 | |||
| 1642 | Ga0075367_10037942 | |||
| 1643 | Ga0075367_10088137 | |||
| 1644 | Ga0075367_10143891 | |||
| 1645 | Ga0075367_10209748 | |||
| 1646 | Ga0075369_10007006 | |||
| 1647 | Ga0075369_10009506 | |||
| 1648 | Ga0075369_10009744 | |||
| 1649 | Ga0075369_10039071 | |||
| 1650 | Ga0075369_10186025 | |||
| 1651 | Ga0075366_10015737 | |||
| 1652 | Ga0075366_10153478 | |||
| 1653 | Ga0097621_100872739 | |||
| 1654 | Ga0075370_10000923 | |||
| 1655 | Ga0075370_10046667 | |||
| 1656 | Ga0075370_10256009 | |||
| 1657 | Ga0079104_1000195 | |||
| 1658 | Ga0079104_1007315 | |||
| 1659 | Ga0079104_1019653 | |||
| 1660 | Ga0099826_10002340 | |||
| 1661 | Ga0099826_10030104 | |||
| 1662 | Ga0105251_10032824 | |||
| 1663 | Ga0105240_10000013 | |||
| 1664 | Ga0105245_10676194 | |||
| 1665 | Ga0105247_10038391 | |||
| 1666 | Ga0105243_10018422 | |||
| 1667 | Ga0105243_10031359 | |||
| 1668 | Ga0105243_11181347 | |||
| 1669 | Ga0105243_11206633 | |||
| 1670 | Ga0105241_10005600 | |||
| 1671 | Ga0105241_10130804 | |||
| 1672 | Ga0105241_11153113 | |||
| 1673 | Ga0105237_10012742 | |||
| 1674 | Ga0105237_10017470 | |||
| 1675 | Ga0105237_10083583 | |||
| 1676 | Ga0105237_10314042 | |||
| 1677 | Ga0105238_10010328 | |||
| 1678 | Ga0105238_10021086 | |||
| 1679 | Ga0105238_10201007 | |||
| 1680 | Ga0105238_10258207 | |||
| 1681 | Ga0105238_11427143 | |||
| 1682 | Ga0105249_10603127 | |||
| 1683 | Ga0105249_11159140 | |||
| 1684 | Ga0105249_11771134 | |||
| 1685 | Ga0123342_1015184 | |||
| 1686 | Ga0105239_10158935 | |||
| 1687 | Ga0105239_10184102 | |||
| 1688 | Ga0105239_10239809 | |||
| 1689 | Ga0105239_10389948 | |||
| 1690 | Ga0105239_10480594 | |||
| 1691 | Ga0105246_10103527 | |||
| 1692 | Ga0105246_10299020 | |||
| 1693 | Ga0157373_10007612 | |||
| 1694 | Ga0157373_10262877 | |||
| 1695 | Ga0157371_10000108 | |||
| 1696 | Ga0157371_10020668 | |||
| 1697 | Ga0157370_10000720 | |||
| 1698 | Ga0157370_10003357 | |||
| 1699 | Ga0157370_10193891 | |||
| 1700 | Ga0157370_10318199 | |||
| 1701 | Ga0157370_10831338 | |||
| 1702 | Ga0157369_10023136 | |||
| 1703 | Ga0157369_10082749 | |||
| 1704 | Ga0157369_10537836 | |||
| 1705 | Ga0157369_10853251 | |||
| 1706 | Ga0171463_1004 | |||
| 1707 | Ga0157374_11327888 | |||
| 1708 | Ga0157378_10357062 | |||
| 1709 | Ga0157378_10579366 | |||
| 1710 | Ga0157378_11604741 | |||
| 1711 | Ga0163162_10286000 | |||
| 1712 | Ga0163162_10461997 | |||
| 1713 | Ga0157372_11395879 | |||
| 1714 | Ga0157375_10182934 | |||
| 1715 | Ga0157375_11764529 | |||
| 1716 | Ga0163163_11715603 | |||
| 1717 | Ga0182008_10066410 | |||
| 1718 | Ga0157379_12244190 | |||
| 1719 | Ga0157376_11436206 | |||
| 1720 | Ga0182006_1051320 | |||
| 1721 | Ga0182007_10001661 | |||
| 1722 | Ga0182007_10079999 | |||
| 1723 | Ga0182005_1001607 | |||
| 1724 | Ga0183365_11151 | |||
| 1725 | Ga0183363_1208 | |||
| 1726 | Ga0214544_1000024 | |||
| 1727 | Ga0214542_1000008 | |||
| 1728 | Ga0214543_1000031 | |||
| 1729 | Ga0214543_1000053 | |||
| 1730 | Ga0228711_1000050 | |||
| 1731 | Ga0228710_1000063 | |||
| 1732 | Ga0209435_100009 | |||
| 1733 | Ga0209436_101476 | |||
| 1734 | Ga0209436_122632 | |||
| 1735 | Ga0209672_104990 | |||
| 1736 | Ga0209437_100057 | |||
| 1737 | Ga0207425_1004647 | |||
| 1738 | Ga0207425_1016579 | |||
| 1739 | Ga0207425_1023523 | |||
| 1740 | Ga0209646_1000018 | |||
| 1741 | Ga0209646_1010312 | |||
| 1742 | Ga0209026_1000032 | |||
| 1743 | Ga0209026_1000068 | |||
| 1744 | Ga0209677_100199 | |||
| 1745 | Ga0209759_1000007 | |||
| 1746 | Ga0209759_1000142 | |||
| 1747 | Ga0209129_1000118 | |||
| 1748 | Ga0209129_1001411 | |||
| 1749 | Ga0209129_1003993 | |||
| 1750 | Ga0209129_1044623 | |||
| 1751 | Ga0209233_1000030 | |||
| 1752 | Ga0209233_1000134 | |||
| 1753 | Ga0209233_1000331 | |||
| 1754 | Ga0209233_1030002 | |||
| 1755 | Ga0209455_1019748 | |||
| 1756 | Ga0209673_1000033 | |||
| 1757 | Ga0209673_1000052 | |||
| 1758 | Ga0209673_1000459 | |||
| 1759 | Ga0209673_1007582 | |||
| 1760 | Ga0209130_1000027 | |||
| 1761 | Ga0209130_1000132 | |||
| 1762 | Ga0209130_1008806 | |||
| 1763 | Ga0209130_1054352 | |||
| 1764 | Ga0209675_1041449 | |||
| 1765 | Ga0209676_1001384 | |||
| 1766 | Ga0209025_1000042 | |||
| 1767 | Ga0209025_1000241 | |||
| 1768 | Ga0209025_1000487 | |||
| 1769 | Ga0209025_1001035 | |||
| 1770 | Ga0209025_1004694 | |||
| 1771 | Ga0209025_1004706 | |||
| 1772 | Ga0209025_1014160 | |||
| 1773 | Ga0209025_1027594 | |||
| 1774 | Ga0209025_1056548 | |||
| 1775 | Ga0209564_1000111 | |||
| 1776 | Ga0209564_1000569 | |||
| 1777 | Ga0209564_1002864 | |||
| 1778 | Ga0209564_1012163 | |||
| 1779 | Ga0209564_1054347 | |||
| 1780 | Ga0209564_1077488 | |||
| 1781 | Ga0209758_1002002 | |||
| 1782 | Ga0209758_1010141 | |||
| 1783 | Ga0209758_1015446 | |||
| 1784 | Ga0209758_1027554 | |||
| 1785 | Ga0209758_1028483 | |||
| 1786 | Ga0209050_1008253 | |||
| 1787 | Ga0209256_1000132 | |||
| 1788 | Ga0209256_1000361 | |||
| 1789 | Ga0209256_1000510 | |||
| 1790 | Ga0209256_1002711 | |||
| 1791 | Ga0209256_1011367 | |||
| 1792 | Ga0209256_1019551 | |||
| 1793 | Ga0209256_1019624 | |||
| 1794 | Ga0209256_1047493 | |||
| 1795 | Ga0209256_1063069 | |||
| 1796 | Ga0207426_1000072 | |||
| 1797 | Ga0207426_1000246 | |||
| 1798 | Ga0207426_1000595 | |||
| 1799 | Ga0209051_1003461 | |||
| 1800 | Ga0209051_1003573 | |||
| 1801 | Ga0209051_1014030 | |||
| 1802 | Ga0209051_1018700 | |||
| 1803 | Ga0209051_1050455 | |||
| 1804 | Ga0209051_1075244 | |||
| 1805 | Ga0209051_1085637 | |||
| 1806 | Ga0209257_1001613 | |||
| 1807 | Ga0209257_1031551 | |||
| 1808 | Ga0207656_10174216 | |||
| 1809 | Ga0207642_10925415 | |||
| 1810 | Ga0207710_10440012 | |||
| 1811 | Ga0207680_10556528 | |||
| 1812 | Ga0207647_10017328 | |||
| 1813 | Ga0207647_10035238 | |||
| 1814 | Ga0207647_10173910 | |||
| 1815 | Ga0207647_10206596 | |||
| 1816 | Ga0207645_10457795 | |||
| 1817 | Ga0207705_10535669 | |||
| 1818 | Ga0207654_10068696 | |||
| 1819 | Ga0207654_10198014 | |||
| 1820 | Ga0207707_10250306 | |||
| 1821 | Ga0207695_10000044 | |||
| 1822 | Ga0207695_10705120 | |||
| 1823 | Ga0207671_10000226 | |||
| 1824 | Ga0207671_10129928 | |||
| 1825 | Ga0207671_10262382 | |||
| 1826 | Ga0207671_10738293 | |||
| 1827 | Ga0207660_10260913 | |||
| 1828 | Ga0207657_10027233 | |||
| 1829 | Ga0207649_10315154 | |||
| 1830 | Ga0207681_10557000 | |||
| 1831 | Ga0207694_10065714 | |||
| 1832 | Ga0207694_10470302 | |||
| 1833 | Ga0207694_10618405 | |||
| 1834 | Ga0207694_11146171 | |||
| 1835 | Ga0207694_11147228 | |||
| 1836 | Ga0207650_10000151 | |||
| 1837 | Ga0207687_11300403 | |||
| 1838 | Ga0207644_10430036 | |||
| 1839 | Ga0207690_10813937 | |||
| 1840 | Ga0207706_10361814 | |||
| 1841 | Ga0207706_10984542 | |||
| 1842 | Ga0207709_10183972 | |||
| 1843 | Ga0207704_11093092 | |||
| 1844 | Ga0207711_10248707 | |||
| 1845 | Ga0207711_11046888 | |||
| 1846 | Ga0207689_10033428 | |||
| 1847 | Ga0207661_11592418 | |||
| 1848 | Ga0207679_10124140 | |||
| 1849 | Ga0207679_10734119 | |||
| 1850 | Ga0207667_10792086 | |||
| 1851 | Ga0207667_11161698 | |||
| 1852 | Ga0207712_10455288 | |||
| 1853 | Ga0207712_10561879 | |||
| 1854 | Ga0207668_10065742 | |||
| 1855 | Ga0207668_10465533 | |||
| 1856 | Ga0207640_10222974 | |||
| 1857 | Ga0207640_11667508 | |||
| 1858 | Ga0207703_10110024 | |||
| 1859 | Ga0207639_10090669 | |||
| 1860 | Ga0207639_10818469 | |||
| 1861 | Ga0207678_10001387 | |||
| 1862 | Ga0207678_10178111 | |||
| 1863 | Ga0207678_10333886 | |||
| 1864 | Ga0207678_10449195 | |||
| 1865 | Ga0207678_11725499 | |||
| 1866 | Ga0207708_10653067 | |||
| 1867 | Ga0207702_10014459 | |||
| 1868 | Ga0207702_10081120 | |||
| 1869 | Ga0207702_10099208 | |||
| 1870 | Ga0207674_10052895 | |||
| 1871 | Ga0207674_10628241 | |||
| 1872 | Ga0207675_100826292 | |||
| 1873 | Ga0207683_10190699 | |||
| 1874 | Ga0207683_10312408 | |||
| 1875 | Ga0207683_10585914 | |||
| 1876 | Ga0207698_10186223 | |||
| 1877 | Ga0207698_10468803 | |||
| 1878 | Ga0207698_10529533 | |||
| 1879 | Ga0207698_10676570 | |||
| 1880 | Ga0209281_1000028 | |||
| 1881 | Ga0209281_1000030 | |||
| 1882 | Ga0209281_1000840 | |||
| 1883 | Ga0209371_1000037 | |||
| 1884 | Ga0209371_1001857 | |||
| 1885 | Ga0209371_1008497 | |||
| 1886 | Ga0209371_1046644 | |||
| 1887 | Ga0209282_1000004 | |||
| 1888 | Ga0209282_1000283 | |||
| 1889 | Ga0209282_1039116 | |||
| 1890 | Ga0209813_10000828 | |||
| 1891 | Ga0209813_10109991 | |||
| 1892 | Ga0209813_10213878 | |||
| 1893 | Ga0209974_10386636 | |||
| 1894 | Ga0268266_10012307 | |||
| 1895 | Ga0268266_10241317 | |||
| 1896 | Ga0268266_10275690 | |||
| 1897 | Ga0268266_10516927 | |||
| 1898 | Ga0268266_11889092 | |||
| 1899 | Ga0268265_10359867 | |||
| 1900 | Ga0268264_11166233 | |||
| 1901 | Ga0307517_10327943 | |||
| 1902 | Ga0307515_10000377 | |||
| 1903 | Ga0307515_10000434 | |||
| 1904 | Ga0307515_10016274 | |||
| 1905 | Ga0307515_10033701 | |||
| 1906 | Ga0307515_10394488 | |||
| 1907 | Ga0268256_1000039 | |||
| 1908 | Ga0268256_1002298 | |||
| 1909 | Ga0268256_1008786 | |||
| 1910 | Ga0268256_1052564 | |||
| 1911 | Ga0316176_1072425 | |||
| 1912 | Ga0316181_1261403 | |||
| 1913 | Ga0307513_10001888 | |||
| 1914 | Ga0307513_10192741 | |||
| 1915 | Ga0307513_10442346 | |||
| 1916 | Ga0307513_10529354 | |||
| 1917 | Ga0307408_100052252 | |||
| 1918 | Ga0307408_100187346 | |||
| 1919 | Ga0307408_101006931 | |||
| 1920 | Ga0307516_10315998 | |||
| 1921 | Ga0307405_10512740 | |||
| 1922 | Ga0307413_11156467 | |||
| 1923 | Ga0307410_10188008 | |||
| 1924 | Ga0307410_10834157 | |||
| 1925 | Ga0307412_10351845 | |||
| 1926 | Ga0307412_10582268 | |||
| 1927 | Ga0315914_1000001 | |||
| 1928 | Ga0307409_100489820 | |||
| 1929 | Ga0307409_101096909 | |||
| 1930 | Ga0315913_1000024 | |||
| 1931 | Ga0315915_1000002 | |||
| 1932 | Ga0373941_0368889 | |||
| 1933 | Ga0316574_0054367 | |||
| 1934 | Ga0316584_0407069 | |||
| 1935 | Ga0395900_0536357 | |||
| 1936 | Ga0395898_0164394 | |||
| 1937 | Ga0395905_0004591 | |||
| 1938 | Ga0395905_0073479 | |||
| 1939 | Ga0395905_0136682 | |||
| 1940 | Ga0395905_0159911 | |||
| 1941 | Ga0395905_0166954 | |||
| 1942 | Ga0395905_0420019 | |||
| 1943 | Ga0395905_0916404 | |||
| 1944 | Ga0395905_1457642 | |||
| 1945 | Ga0395901_0108029 | |||
| 1946 | Ga0395901_0192399 | |||
| 1947 | Ga0395901_0320823 | |||
| 1948 | Ga0395901_0363975 | |||
| 1949 | Ga0439436_0013306 | |||
| 1950 | Ga0439465_0007940 | |||
| 1951 | Ga0439465_0258020 | |||
| 1952 | Ga0451787_328280 | |||
| 1953 | Ga0451791_1874397 | |||
| 1954 | Ga0451798_0190316 | |||
| 1955 | Ga0451804_0509084 | |||
| 1956 | Ga0451833_0656247 | |||
| 1957 | Ga0451839_0797687 | |||
| 1958 | Ga0451840_02813 | |||
| 1959 | Ga0451841_0317996 | |||
| 1960 | Ga0451845_0142149 | |||
| 1961 | Ga0451846_33483 | |||
| 1962 | Ga0451847_0149356 | |||
| 1963 | Ga0451849_1233240 | |||
| 1964 | Ga0451851_0041039 | |||
| 1965 | Ga0451843_0950520 | |||
| 1966 | Ga0451853_1752544 | |||
| 1967 | Ga0439445_0255893 | |||
| 1968 | Ga0439449_0023273 | |||
| 1969 | Ga0439449_0386849 | |||
| 1970 | Ga0439455_0199105 | |||
| 1971 | Ga0439462_0224245 | |||
| 1972 | Ga0450920_023890 | |||
| 1973 | Ga0466972_0083314 | |||
| 1974 | Ga0466965_0041976 | |||
| 1975 | Ga0466965_0540303 | |||
| 1976 | Ga0466960_0156005 | |||
| 1977 | Ga0466967_1292166 | |||
| 1978 | Ga0495617_045322 | |||
| 1979 | Ga0495627_039264 | |||
| 1980 | Ga0495627_083163 | |||
| 1981 | Ga0495592_0325386 | |||
| 1982 | Ga0495590_0008145 | |||
| 1983 | Ga0495629_0239147 | |||
| 1984 | Ga0495638_0001266 | |||
| 1985 | Ga0495638_0061845 | |||
| 1986 | Ga0495638_0188006 | |||
| 1987 | Ga0495638_0200521 | |||
| 1988 | Ga0495650_0022011 | |||
| 1989 | Ga0495605_0001289 | |||
| 1990 | Ga0495605_0201863 | |||
| 1991 | Ga0495662_0051558 | |||
| 1992 | Ga0495584_0111263 | |||
| 1993 | Ga0495585_0003047 | |||
| 1994 | Ga0495585_0014299 | |||
| 1995 | Ga0495585_0044472 | |||
| 1996 | Ga0495585_0355542 | |||
| 1997 | Ga0495607_0070406 | |||
| 1998 | Ga0495607_0223498 | |||
| 1999 | Ga0495583_0003099 | |||
| 2000 | Ga0495583_0129631 | |||
| 2001 | Ga0495583_0275303 | |||
| 2002 | Ga0495606_0011138 | |||
| 2003 | Ga0495606_0055573 | |||
| 2004 | Ga0495606_0066095 | |||
| 2005 | Ga0495606_0077128 | |||
| 2006 | Ga0495610_0002597 | |||
| 2007 | Ga0495610_0019307 | |||
| 2008 | Ga0495610_0023092 | |||
| 2009 | Ga0495610_0026275 | |||
| 2010 | Ga0495616_0002338 | |||
| 2011 | Ga0495616_0103543 | |||
| 2012 | Ga0495616_0114020 | |||
| 2013 | Ga0495620_0016883 | |||
| 2014 | Ga0495620_0017309 | |||
| 2015 | Ga0495620_0018102 | |||
| 2016 | Ga0495620_0170758 | |||
| 2017 | Ga0495631_0001859 | |||
| 2018 | Ga0495632_0012884 | |||
| 2019 | Ga0495632_0015553 | |||
| 2020 | Ga0495632_0026520 | |||
| 2021 | Ga0495632_0303681 | |||
| 2022 | Ga0495632_0484135 | |||
| 2023 | Ga0495643_0011972 | |||
| 2024 | Ga0495643_0030466 | |||
| 2025 | Ga0495643_0097990 | |||
| 2026 | Ga0495644_0019675 | |||
| 2027 | Ga0495648_0122865 | |||
| 2028 | Ga0495648_0164547 | |||
| 2029 | Ga0495652_0060749 | |||
| 2030 | Ga0495654_0000308 | |||
| 2031 | Ga0495654_0078466 | |||
| 2032 | Ga0495654_0119438 | |||
| 2033 | Ga0495654_0147827 | |||
| 2034 | Ga0495609_0012502 | |||
| 2035 | Ga0495609_0070523 | |||
| 2036 | Ga0495597_0024478 | |||
| 2037 | Ga0495622_0029699 | |||
| 2038 | Ga0495633_0019083 | |||
| 2039 | Ga0495633_0038782 | |||
| 2040 | Ga0495633_0053812 | |||
| 2041 | Ga0495633_0242892 | |||
| 2042 | Ga0495656_0014722 | |||
| 2043 | Ga0495656_0071441 | |||
| 2044 | Ga0495668_0022717 | |||
| 2045 | Ga0495668_0025481 | |||
| 2046 | Ga0495668_0046473 | |||
| 2047 | Ga0495668_0066618 | |||
| 2048 | Ga0495668_0393198 | |||
| 2049 | Ga0495625_0014610 | |||
| 2050 | Ga0495625_0029614 | |||
| 2051 | Ga0495625_0052613 | |||
| 2052 | Ga0495625_0136309 | |||
| 2053 | Ga0495625_0261524 | |||
| 2054 | Ga0495625_0477356 | |||
| 2055 | Ga0495661_0251451 | |||
| 2056 | Ga0495661_0488210 | |||
| 2057 | Ga0495588_0000643 | |||
| 2058 | Ga0495588_0011541 | |||
| 2059 | Ga0495670_0013208 | |||
| 2060 | Ga0495671_0061710 | |||
| 2061 | Ga0495671_0131517 | |||
| 2062 | Ga0495649_0013866 | |||
| 2063 | Ga0495649_0034639 | |||
| 2064 | Ga0495649_0191142 | |||
| 2065 | Ga0495649_0372293 | |||
| 2066 | Ga0495660_0015869 | |||
| 2067 | Ga0495660_0055768 | |||
| 2068 | Ga0495604_0016659 | |||
| 2069 | Ga0495636_0015190 | |||
| 2070 | Ga0495636_0029106 | |||
| 2071 | Ga0495672_0024621 | |||
| 2072 | Ga0495683_0042349 | |||
| 2073 | Ga0495687_130338 | |||
| 2074 | Ga0495677_0184821 | |||
| 2075 | Ga0495673_0084463 | |||
| 2076 | Ga0495681_0126581 | |||
| 2077 | Ga0495686_0002454 | |||
| 2078 | Ga0495686_0045229 | |||
| 2079 | Ga0495686_0267362 | |||
| 2080 | Ga0495626_0136317 | |||
| 2081 | Ga0496100_0663184 | |||
| 2082 | Ga0496102_0147383 | |||
| 2083 | Ga0496102_0246818 | |||
| 2084 | Ga0496102_0641635 | |||
| 2085 | Ga0496103_0149178 | |||
| 2086 | Ga0496103_0501194 | |||
| 2087 | Ga0496103_0702337 | |||
| 2088 | Ga0496104_0989843 | |||
| 2089 | Ga0496105_0119676 | |||
| 2090 | Ga0496105_0476381 | |||
| 2091 | Ga0496105_0634908 | |||
| 2092 | Ga0496106_0089525 | |||
| 2093 | Ga0496107_0003241 | |||
| 2094 | Ga0496107_0694442 | |||
| 2095 | Ga0496109_1225340 | |||
| 2096 | Ga0496110_0088309 | |||
| 2097 | Ga0496110_0527091 | |||
| 2098 | Ga0496110_1136013 | |||
| 2099 | Ga0496111_0003486 | |||
| 2100 | Ga0496111_0649468 | |||
| 2101 | Ga0496112_0321351 | |||
| 2102 | Ga0496113_0346349 | |||
| 2103 | Ga0496113_0480525 | |||
| 2104 | Ga0496114_0411267 | |||
| 2105 | Ga0496115_0002734 | |||
| 2106 | Ga0496115_0212934 | |||
| 2107 | Ga0496116_0000057 | |||
| 2108 | Ga0496116_0016742 | |||
| 2109 | Ga0496116_0020118 | |||
| 2110 | Ga0496116_0134513 | |||
| 2111 | Ga0496116_0401047 | |||
| 2112 | Ga0496116_0425930 | |||
| 2113 | Ga0496117_0000031 | |||
| 2114 | Ga0496117_0004678 | |||
| 2115 | Ga0496117_0017870 | |||
| 2116 | Ga0496117_0022715 | |||
| 2117 | Ga0496117_0194704 | |||
| 2118 | Ga0496117_0519429 | |||
| 2119 | Ga0496118_0001884 | |||
| 2120 | Ga0496118_0004259 | |||
| 2121 | Ga0496118_0013516 | |||
| 2122 | Ga0496118_0017624 | |||
| 2123 | Ga0496118_0165226 | |||
| 2124 | Ga0496118_0368325 | |||
| 2125 | Ga0496119_0032290 | |||
| 2126 | Ga0496119_0036562 | |||
| 2127 | Ga0496119_0049122 | |||
| 2128 | Ga0496119_0053854 | |||
| 2129 | Ga0496119_0081628 | |||
| 2130 | Ga0496119_0091575 | |||
| 2131 | Ga0496119_0278767 | |||
| 2132 | Ga0496120_0001817 | |||
| 2133 | Ga0496120_0003907 | |||
| 2134 | Ga0496120_0014950 | |||
| 2135 | Ga0496120_0021746 | |||
| 2136 | Ga0496120_0043423 | |||
| 2137 | Ga0496120_0056595 | |||
| 2138 | Ga0496121_0000034 | |||
| 2139 | Ga0496121_0005856 | |||
| 2140 | Ga0496121_0008693 | |||
| 2141 | Ga0496121_0020154 | |||
| 2142 | Ga0496121_0030144 | |||
| 2143 | Ga0496121_0048825 | |||
| 2144 | Ga0496121_0072725 | |||
| 2145 | Ga0496121_0102152 | |||
| 2146 | Ga0496121_0319092 | |||
| 2147 | Ga0496121_0490596 | |||
| 2148 | Ga0496122_0000023 | |||
| 2149 | Ga0496122_0000074 | |||
| 2150 | Ga0496122_0002284 | |||
| 2151 | Ga0496122_0020124 | |||
| 2152 | Ga0496122_0032494 | |||
| 2153 | Ga0496122_0061360 | |||
| 2154 | Ga0496123_0000027 | |||
| 2155 | Ga0496123_0000062 | |||
| 2156 | Ga0496123_0000290 | |||
| 2157 | Ga0496123_0017802 | |||
| 2158 | Ga0496123_0031088 | |||
| 2159 | Ga0496123_0044983 | |||
| 2160 | Ga0496123_0053721 | |||
| 2161 | Ga0496123_0073264 | |||
| 2162 | Ga0496123_0096986 | |||
| 2163 | Ga0496124_0008017 | |||
| 2164 | Ga0496124_0009644 | |||
| 2165 | Ga0496124_0013702 | |||
| 2166 | Ga0496124_0026371 | |||
| 2167 | Ga0496124_0039353 | |||
| 2168 | Ga0496124_0041824 | |||
| 2169 | Ga0496124_0083621 | |||
| 2170 | Ga0496124_0106942 | |||
| 2171 | Ga0496124_0215472 | |||
| 2172 | Ga0496124_0406245 | |||
| 2173 | Ga0496125_0000030 | |||
| 2174 | Ga0496125_0003346 | |||
| 2175 | Ga0496125_0014218 | |||
| 2176 | Ga0496125_0044581 | |||
| 2177 | Ga0496125_0047815 | |||
| 2178 | Ga0496125_0097190 | |||
| 2179 | Ga0496125_0133085 | |||
| 2180 | Ga0496125_0337932 | |||
| 2181 | Ga0496125_0415778 | |||
| 2182 | Ga0496126_0002222 | |||
| 2183 | Ga0496126_0004878 | |||
| 2184 | Ga0496126_0009461 | |||
| 2185 | Ga0496126_0034327 | |||
| 2186 | Ga0496126_0081220 | |||
| 2187 | Ga0496126_0091895 | |||
| 2188 | Ga0496126_0192147 | |||
| 2189 | Ga0496126_0251933 | |||
| 2190 | Ga0496126_0253787 | |||
| 2191 | Ga0496126_1240570 | |||
| 2192 | Ga0495678_016040 | |||
| 2193 | Ga0495678_016669 | |||
| 2194 | Ga0495678_018645 | |||
| 2195 | Ga0495682_0007963 | |||
| 2196 | Ga0501034_1010067 | |||
| 2197 | Ga0501036_0075608 | |||
| 2198 | Ga0501038_0035627 | |||
| 2199 | Ga0501039_0058415 | |||
| 2200 | Ga0501040_0440760 | |||
| 2201 | Ga0501043_0161588 | |||
| 2202 | Ga0501046_0139157 | |||
| 2203 | Ga0501047_0174214 | |||
| 2204 | Ga0501048_0047427 | |||
| 2205 | Ga0501067_0330681 | |||
| 2206 | Ga0501067_0512461 | |||
| 2207 | Ga0501073_0255407 | |||
| 2208 | Ga0501074_1003793 | |||
| 2209 | Ga0501080_0226294 | |||
| 2210 | Ga0501083_0089443 | |||
| 2211 | Ga0501280_001760 | |||
| 2212 | Ga0501035_0213079 | |||
| 2213 | nmdc:mga03683_10202_c1 | |||
| 2214 | nmdc:mga03n38_136758_c1 | |||
| 2215 | nmdc:mga03n38_74528_c1 | |||
| 2216 | nmdc:mga00v17_211955_c1 | |||
| 2217 | nmdc:mga00v17_285428_c1 | |||
| 2218 | nmdc:mga00v17_330716_c1 | |||
| 2219 | nmdc:mga00v17_360_c1 | |||
| 2220 | nmdc:mga00v17_378440_c1 | |||
| 2221 | nmdc:mga00v17_4292_c1 | |||
| 2222 | nmdc:mga00v17_439014_c1 | |||
| 2223 | nmdc:mga00v17_75888_c2 | |||
| 2224 | nmdc:mga0yw44_13168_c1 | |||
| 2225 | nmdc:mga0yw44_180104_c1 | |||
| 2226 | nmdc:mga0yw44_456761_c1 | |||
| 2227 | nmdc:mga0yw44_6773_c1 | |||
| 2228 | nmdc:mga0k408_176025_c1 | |||
| 2229 | nmdc:mga0k408_437589_c1 | |||
| 2230 | nmdc:mga0k408_68217_c1 | |||
| 2231 | nmdc:mga0k408_794579_c1 | |||
| 2232 | nmdc:mga06z11_137765_c1 | |||
| 2233 | nmdc:mga06z11_174112_c1 | |||
| 2234 | nmdc:mga06z11_372201_c1 | |||
| 2235 | nmdc:mga06z11_423545_c1 | |||
| 2236 | nmdc:mga04h51_85095_c1 | |||
| 2237 | nmdc:mga04h51_99504_c1 | |||
| 2238 | nmdc:mga07m45_2146_c1 | |||
| 2239 | nmdc:mga07m45_698220_c1 | |||
| 2240 | nmdc:mga0sz30_1057_c1 | |||
| 2241 | nmdc:mga0sz30_14896_c1 | |||
| 2242 | nmdc:mga0sz30_273541_c1 | |||
| 2243 | nmdc:mga0sz30_33473_c1 | |||
| 2244 | nmdc:mga0sz30_40559_c1 | |||
| 2245 | Ga0500610_0036361 | |||
| 2246 | Ga0500610_0070121 | |||
| 2247 | Ga0495655_0015995 | |||
| 2248 | Ga0495619_0082511 | |||
| 2249 | Ga0500644_0004951 | |||
| 2250 | Ga0500560_000732 | |||
| 2251 | Ga0500569_021327 | |||
| 2252 | Ga0500594_0001734 | |||
| 2253 | Ga0500594_0135948 | |||
| 2254 | Ga0500594_0151021 | |||
| 2255 | Ga0500607_258895 | |||
| 2256 | Ga0500608_034722 | |||
| 2257 | Ga0500618_000862 | |||
| 2258 | Ga0500618_003034 | |||
| 2259 | Ga0500618_009427 | |||
| 2260 | Ga0500658_0000112 | |||
| 2261 | Ga0500559_0002392 | |||
| 2262 | Ga0500561_0000170 | |||
| 2263 | Ga0500568_0001609 | |||
| 2264 | Ga0500568_0116614 | |||
| 2265 | Ga0500568_0145161 | |||
| 2266 | Ga0500573_0001302 | |||
| 2267 | Ga0500573_0237604 | |||
| 2268 | Ga0500577_0467478 | |||
| 2269 | Ga0500590_024567 | |||
| 2270 | Ga0500604_0010862 | |||
| 2271 | Ga0500616_0002690 | |||
| 2272 | Ga0500616_0048868 | |||
| 2273 | Ga0500616_0136208 | |||
| 2274 | Ga0500622_0001156 | |||
| 2275 | Ga0500622_0001966 | |||
| 2276 | Ga0500622_0036863 | |||
| 2277 | Ga0500624_000401 | |||
| 2278 | Ga0500627_0115000 | |||
| 2279 | Ga0500634_0001225 | |||
| 2280 | Ga0500634_0004081 | |||
| 2281 | Ga0587091_099795 | |||
| 2282 | Ga0587072_015315 | |||
| 2283 | Ga0501082_0055900 | |||
| 2284 | 2503199089 | |||
| 2285 | 2509109489 | |||
| 2286 | 2509116619 | |||
| 2287 | 2509370067 | |||
| 2288 | 2509378201 | |||
| 2289 | 2509394039 | |||
| 2290 | 2510135185 | |||
| 2291 | 2510305358 | |||
| 2292 | 2510318290 | |||
| 2293 | 2510843661 | |||
| 2294 | 2510896636 | |||
| 2295 | 2511132093 | |||
| 2296 | 2511183936 | |||
| 2297 | 2511503226 | |||
| 2298 | 2512534497 | |||
| 2299 | 2512973692 | |||
| 2300 | 2513571562 | |||
| 2301 | 2513578602 | |||
| 2302 | 2513586098 | |||
| 2303 | 2513598141 | |||
| 2304 | 2513601790 | |||
| 2305 | 2513613313 | |||
| 2306 | 2513615616 | |||
| 2307 | 2513630215 | |||
| 2308 | 2513711287 | |||
| 2309 | 2513869177 | |||
| 2310 | 2513884191 | |||
| 2311 | 2513903520 | |||
| 2312 | 2513912321 | |||
| 2313 | 2513928494 | |||
| 2314 | 2513984065 | |||
| 2315 | 2513998547 | |||
| 2316 | 2514003626 | |||
| 2317 | 2514019332 | |||
| 2318 | 2514035669 | |||
| 2319 | 2514418073 | |||
| 2320 | 2515114340 | |||
| 2321 | 2515610964 | |||
| 2322 | 2515636259 | |||
| 2323 | 2515643247 | |||
| 2324 | 2515657714 | |||
| 2325 | 2515741528 | |||
| 2326 | 2516205494 | |||
| 2327 | 2516894657 | |||
| 2328 | 2517037983 | |||
| 2329 | 2517078251 | |||
| 2330 | 2517097016 | |||
| 2331 | 2517408599 | |||
| 2332 | 2517571305 | |||
| 2333 | 2524450551 | |||
| 2334 | 2524458404 | |||
| 2335 | 2535518955 | |||
| 2336 | 2537876645 | |||
| 2337 | 2551675886 | |||
| 2338 | 2551689614 | |||
| 2339 | 2551693319 | |||
| 2340 | 2551703302 | |||
| 2341 | 2551709409 | |||
| 2342 | 2551723759 | |||
| 2343 | 2551727295 | |||
| 2344 | 2551734705 | |||
| 2345 | 2551741023 | |||
| 2346 | 2554248810 | |||
| 2347 | 2559295898 | |||
| 2348 | 2561467054 | |||
| 2349 | 2585166784 | |||
| 2350 | 2585201802 | |||
| 2351 | 2585228802 | |||
| 2352 | 2585266868 | |||
| 2353 | 2585271605 | |||
| 2354 | 2585280668 | |||
| 2355 | 2585326453 | |||
| 2356 | 2585334209 | |||
| 2357 | 2585387911 | |||
| 2358 | 2585396006 | |||
| 2359 | 2585399687 | |||
| 2360 | 2585526106 | |||
| 2361 | 2585531602 | |||
| 2362 | 2585540719 | |||
| 2363 | 2585551451 | |||
| 2364 | 2585563155 | |||
| 2365 | 2585820774 | |||
| 2366 | 2585838988 | |||
| 2367 | 2585902793 | |||
| 2368 | 2585907374 | |||
| 2369 | 2587982632 | |||
| 2370 | 2588519586 | |||
| 2371 | 2599335031 | |||
| 2372 | 2599420206 | |||
| 2373 | 2599603310 | |||
| 2374 | 2599720273 | |||
| 2375 | 2599937021 | |||
| 2376 | 2600193462 | |||
| 2377 | 2600373292 | |||
| 2378 | 2601610784 | |||
| 2379 | 2601747558 | |||
| 2380 | 2616306787 | |||
| 2381 | 2616557639 | |||
| 2382 | 2617383307 | |||
| 2383 | 2643808153 | |||
| 2384 | 2643813697 | |||
| 2385 | 2643855026 | |||
| 2386 | 2643921423 | |||
| 2387 | 2643988465 | |||
| 2388 | 2644002408 | |||
| 2389 | 2644051981 | |||
| 2390 | 2644068658 | |||
| 2391 | 2644110063 | |||
| 2392 | 2644150339 | |||
| 2393 | 2644154618 | |||
| 2394 | 2644194884 | |||
| 2395 | 2644201463 | |||
| 2396 | 2644209414 | |||
| 2397 | 2644240565 | |||
| 2398 | 2644299937 | |||
| 2399 | 2644312943 | |||
| 2400 | 2644336491 | |||
| 2401 | 2644379587 | |||
| 2402 | 2644419727 | |||
| 2403 | 2644453084 | |||
| 2404 | 2644484433 | |||
| 2405 | 2644492444 | |||
| 2406 | 2644499836 | |||
| 2407 | 2644521476 | |||
| 2408 | 2644546137 | |||
| 2409 | 2644618673 | |||
| 2410 | 2644652942 | |||
| 2411 | 2644658164 | |||
| 2412 | 2644677181 | |||
| 2413 | 2644688887 | |||
| 2414 | 2657682512 | |||
| 2415 | 2671113533 | |||
| 2416 | 2688596363 | |||
| 2417 | 2692319971 | |||
| 2418 | 2694630166 | |||
| 2419 | 2723028562 | |||
| 2420 | 2723573483 | |||
| 2421 | 2725947473 | |||
| 2422 | 2730109498 | |||
| 2423 | 2738947575 | |||
| 2424 | 2739037215 | |||
| 2425 | 2753463724 | |||
| 2426 | 2756673752 | |||
| 2427 | 2766064336 | |||
| 2428 | 2776915420 | |||
| 2429 | 2778173694 | |||
| 2430 | 2792582137 | |||
| 2431 | 2792622002 | |||
| 2432 | 2792628741 | |||
| 2433 | 2792641331 | |||
| 2434 | 2792747611 | |||
| 2435 | 2793281109 | |||
| 2436 | 2793359457 | |||
| 2437 | 2802717328 | |||
| 2438 | 2802724683 | |||
| 2439 | 2802729435 | |||
| 2440 | 2802736780 | |||
| 2441 | 2802743186 | |||
| 2442 | 2802749688 | |||
| 2443 | 2804753597 | |||
| 2444 | 2806047306 | |||
| 2445 | 2806054161 | |||
| 2446 | 2806060255 | |||
| 2447 | 2806068866 | |||
| 2448 | 2806077191 | |||
| 2449 | 2808988278 | |||
| 2450 | 2819244720 | |||
| 2451 | 2819560908 | |||
| 2452 | 2819611184 | |||
| 2453 | 2819638881 | |||
| 2454 | 2821128661 | |||
| 2455 | 2837651320 | |||
| 2456 | 2838030877 | |||
| 2457 | 2838040412 | |||
| 2458 | 2838048409 | |||
| 2459 | 2838078266 | |||
| 2460 | 2838667826 | |||
| 2461 | 2838678729 | |||
| 2462 | 2838683955 | |||
| 2463 | 2838690215 | |||
| 2464 | 2838698484 | |||
| 2465 | 2838711599 | |||
| 2466 | 2838718182 | |||
| 2467 | 2838723026 | |||
| 2468 | 2838728249 | |||
| 2469 | 2838731990 | |||
| 2470 | 2838741678 | |||
| 2471 | 2838744886 | |||
| 2472 | 2839993311 | |||
| 2473 | 2841845488 | |||
| 2474 | 2841850582 | |||
| 2475 | 2841855943 | |||
| 2476 | 2841863165 | |||
| 2477 | 2842081400 | |||
| 2478 | 2842116924 | |||
| 2479 | 2842121823 | |||
| 2480 | 2842128908 | |||
| 2481 | 2842133621 | |||
| 2482 | 2842145191 | |||
| 2483 | 2842155467 | |||
| 2484 | 2842161113 | |||
| 2485 | 2842166631 | |||
| 2486 | 2842174576 | |||
| 2487 | 2842179235 | |||
| 2488 | 2842184729 | |||
| 2489 | 2842190606 | |||
| 2490 | 2842215070 | |||
| 2491 | 2842223301 | |||
| 2492 | 2842227791 | |||
| 2493 | 2842232312 | |||
| 2494 | 2842240838 | |||
| 2495 | 2842246727 | |||
| 2496 | 2842261171 | |||
| 2497 | 2842274235 | |||
| 2498 | 2842295057 | |||
| 2499 | 2842300340 | |||
| 2500 | 2842305918 | |||
| 2501 | 2842361143 | |||
| 2502 | 2842374925 | |||
| 2503 | 2842381456 | |||
| 2504 | 2842388526 | |||
| 2505 | 2842477609 | |||
| 2506 | 2842487952 | |||
| 2507 | 2842504518 | |||
| 2508 | 2842511768 | |||
| 2509 | 2842520097 | |||
| 2510 | 2842524422 | |||
| 2511 | 2842926220 | |||
| 2512 | 2844003069 | |||
| 2513 | 2844011188 | |||
| 2514 | 2844164262 | |||
| 2515 | 2844457087 | |||
| 2516 | 2847420806 | |||
| 2517 | 2847673807 | |||
| 2518 | 2847690288 | |||
| 2519 | 2848995631 | |||
| 2520 | 2850082549 | |||
| 2521 | 2852391637 | |||
| 2522 | 2855827283 | |||
| 2523 | 2855842665 | |||
| 2524 | 2855878169 | |||
| 2525 | 2856320542 | |||
| 2526 | 2856328493 | |||
| 2527 | 2856341453 | |||
| 2528 | 2856353542 | |||
| 2529 | 2856363509 | |||
| 2530 | 2856365015 | |||
| 2531 | 2857353306 | |||
| 2532 | 2857371909 | |||
| 2533 | 2857519503 | |||
| 2534 | 2857534186 | |||
| 2535 | 2858803476 | |||
| 2536 | 2869169006 | |||
| 2537 | 2869174583 | |||
| 2538 | 2869236895 | |||
| 2539 | 2869246793 | |||
| 2540 | 2869253457 | |||
| 2541 | 2869258172 | |||
| 2542 | 2869268020 | |||
| 2543 | 2869276173 | |||
| 2544 | 2869279539 | |||
| 2545 | 2869286360 | |||
| 2546 | 2871430329 | |||
| 2547 | 2871442333 | |||
| 2548 | 2871454263 | |||
| 2549 | 2871465365 | |||
| 2550 | 2871472318 | |||
| 2551 | 2871486923 | |||
| 2552 | 2871494887 | |||
| 2553 | 2871500922 | |||
| 2554 | 2874104738 | |||
| 2555 | 2874115852 | |||
| 2556 | 2874118239 | |||
| 2557 | 2874137997 | |||
| 2558 | 2874139471 | |||
| 2559 | 2874146747 | |||
| 2560 | 2874155820 | |||
| 2561 | 2874166461 | |||
| 2562 | 2874176796 | |||
| 2563 | 2876370599 | |||
| 2564 | 2876385308 | |||
| 2565 | 2876388607 | |||
| 2566 | 2876399268 | |||
| 2567 | 2876402294 | |||
| 2568 | 2876409448 | |||
| 2569 | 2876414149 | |||
| 2570 | 2876427306 | |||
| 2571 | 2878038957 | |||
| 2572 | 2878742065 | |||
| 2573 | 2878746525 | |||
| 2574 | 2878760012 | |||
| 2575 | 2878764969 | |||
| 2576 | 2878772113 | |||
| 2577 | 2878778878 | |||
| 2578 | 2878786505 | |||
| 2579 | 2881148583 | |||
| 2580 | 2881159674 | |||
| 2581 | 2881165368 | |||
| 2582 | 2881852883 | |||
| 2583 | 2881858572 | |||
| 2584 | 2881867186 | |||
| 2585 | 2882640317 | |||
| 2586 | 2882916817 | |||
| 2587 | 2885307226 | |||
| 2588 | 2885313766 | |||
| 2589 | 2885324479 | |||
| 2590 | 2885332409 | |||
| 2591 | 2885337564 | |||
| 2592 | 2885344914 | |||
| 2593 | 2885357741 | |||
| 2594 | 2888337052 | |||
| 2595 | 2888353578 | |||
| 2596 | 2889015294 | |||
| 2597 | 2889019628 | |||
| 2598 | 2891051150 | |||
| 2599 | 2891373845 | |||
| 2600 | 2896390295 | |||
| 2601 | 2899795264 | |||
| 2602 | 2899808095 | |||
| 2603 | 2899849245 | |||
| 2604 | 2903494246 | |||
| 2605 | 2903499715 | |||
| 2606 | 2903517621 | |||
| 2607 | 2903545737 | |||
| 2608 | 2904665795 | |||
| 2609 | 2906308926 | |||
| 2610 | 2906322207 | |||
| 2611 | 2906333851 | |||
| 2612 | 2906362035 | |||
| 2613 | 2906364421 | |||
| 2614 | 2906371869 | |||
| 2615 | 2906393202 | |||
| 2616 | 2906395619 | |||
| 2617 | 2906405462 | |||
| 2618 | 2906410059 | |||
| 2619 | 2906421321 | |||
| 2620 | 2906434899 | |||
| 2621 | 2913300075 | |||
| 2622 | 2913312484 | |||
| 2623 | 2915982543 | |||
| 2624 | 2915988260 | |||
| 2625 | 2915994496 | |||
| 2626 | 2916007067 | |||
| 2627 | 2916008750 | |||
| 2628 | 2916015254 | |||
| 2629 | 2916024398 | |||
| 2630 | 2916031237 | |||
| 2631 | 2916037663 | |||
| 2632 | 2916047503 | |||
| 2633 | 2916051728 | |||
| 2634 | 2916058427 | |||
| 2635 | 2916066205 | |||
| 2636 | 2916075307 | |||
| 2637 | 2916082046 | |||
| 2638 | 2919105326 | |||
| 2639 | 2919118560 | |||
| 2640 | 2919170640 | |||
| 2641 | 2919411009 | |||
| 2642 | 2920760447 | |||
| 2643 | 2920825844 | |||
| 2644 | 2921205897 | |||
| 2645 | 2921209521 | |||
| 2646 | 2921239596 | |||
| 2647 | 2921245434 | |||
| 2648 | 2921254554 | |||
| 2649 | 2921257703 | |||
| 2650 | 2921267019 | |||
| 2651 | 2921285571 | |||
| 2652 | 2921293166 | |||
| 2653 | 2921298760 | |||
| 2654 | 2922132573 | |||
| 2655 | 2922157290 | |||
| 2656 | 2922177056 | |||
| 2657 | 2922183237 | |||
| 2658 | 2922191487 | |||
| 2659 | 2923559554 | |||
| 2660 | 2924150567 | |||
| 2661 | 2924155482 | |||
| 2662 | 2924161154 | |||
| 2663 | 2924169927 | |||
| 2664 | 2924173346 | |||
| 2665 | 2924180676 | |||
| 2666 | 2924186925 | |||
| 2667 | 2924193692 | |||
| 2668 | 2924206569 | |||
| 2669 | 2924209342 | |||
| 2670 | 2924214475 | |||
| 2671 | 2924226170 | |||
| 2672 | 2924231761 | |||
| 2673 | 2924710341 | |||
| 2674 | 2924722913 | |||
| 2675 | 2924737575 | |||
| 2676 | 2924748186 | |||
| 2677 | 2924751617 | |||
| 2678 | 2924779749 | |||
| 2679 | 2924790816 | |||
| 2680 | 2926755090 | |||
| 2681 | 2926762250 | |||
| 2682 | 2929141808 | |||
| 2683 | 2933010683 | |||
| 2684 | 2933015643 | |||
| 2685 | 2933021914 | |||
| 2686 | 2933572423 | |||
| 2687 | 2933593072 | |||
| 2688 | 2933597616 | |||
| 2689 | 2935897867 | |||
| 2690 | 2935903697 | |||
| 2691 | 2936369823 | |||
| 2692 | 2936379010 | |||
| 2693 | 2936382013 | |||
| 2694 | 2936997558 | |||
| 2695 | 2937009422 | |||
| 2696 | 2937013675 | |||
| 2697 | 2937019107 | |||
| 2698 | 2937024783 | |||
| 2699 | 2937034873 | |||
| 2700 | 2937036098 | |||
| 2701 | 2937044064 | |||
| 2702 | 2937051126 | |||
| 2703 | 2937062096 | |||
| 2704 | 2937064802 | |||
| 2705 | 2937074353 | |||
| 2706 | 2937081933 | |||
| 2707 | 2937086140 | |||
| 2708 | 2937097720 | |||
| 2709 | 2937101348 | |||
| 2710 | 2937106701 | |||
| 2711 | 2937119581 | |||
| 2712 | 2937123160 | |||
| 2713 | 2937132664 | |||
| 2714 | 2937822266 | |||
| 2715 | 2937823934 | |||
| 2716 | 2937848640 | |||
| 2717 | 2937864836 | |||
| 2718 | 2937877053 | |||
| 2719 | 2937880107 | |||
| 2720 | 2937895206 | |||
| 2721 | 2937988140 | |||
| 2722 | 2937999587 | |||
| 2723 | 2938018655 | |||
| 2724 | 2941501259 | |||
| 2725 | 2957381944 | |||
| 2726 | 2957384595 | |||
| 2727 | 2957391365 | |||
| 2728 | 2957400516 | |||
| 2729 | 2957404335 | |||
| 2730 | 2957413729 | |||
| 2731 | 2957416602 | |||
| 2732 | 2957425730 | |||
| 2733 | 2957434577 | |||
| 2734 | 2957442201 | |||
| 2735 | 2957447904 | |||
| 2736 | 2957455047 | |||
| 2737 | 2957463744 | |||
| 2738 | 2957470679 | |||
| 2739 | 2957473282 | |||
| 2740 | 2957483962 | |||
| 2741 | 2957485693 | |||
| 2742 | 2957494132 | |||
| 2743 | 2957502981 | |||
| 2744 | 2957510130 | |||
| 2745 | 2958035117 | |||
| 2746 | 2958044148 | |||
| 2747 | 2958046616 | |||
| 2748 | 2958065755 | |||
| 2749 | 2958087160 | |||
| 2750 | 2958094196 | |||
| 2751 | 2958104339 | |||
| 2752 | 2958108402 | |||
| 2753 | 2958120461 | |||
| 2754 | 2958124893 | |||
| 2755 | 2958130760 | |||
| 2756 | 2958145600 | |||
| 2757 | 2958161404 | |||
| 2758 | 2958170061 | |||
| 2759 | 2958176778 | |||
| 2760 | 2958180098 | |||
| 2761 | 2960587001 | |||
| 2762 | 2960592121 | |||
| 2763 | 2960599305 | |||
| 2764 | 2960609671 | |||
| 2765 | 2960616199 | |||
| 2766 | 2960623557 | |||
| 2767 | 2960624929 | |||
| 2768 | 2960633517 | |||
| 2769 | 2960642465 | |||
| 2770 | 2960650304 | |||
| 2771 | 2960654219 | |||
| 2772 | 2960664287 | |||
| 2773 | 2960671914 | |||
| 2774 | 2960676766 | |||
| 2775 | 2960687348 | |||
| 2776 | 2960693233 | |||
| 2777 | 2960698988 | |||
| 2778 | 2961077925 | |||
| 2779 | 2961121138 | |||
| 2780 | 2961134371 | |||
| 2781 | 2961141605 | |||
| 2782 | 2961168515 | |||
| 2783 | 2961177283 | |||
| 2784 | 2961188928 | |||
| 2785 | 2964609625 | |||
| 2786 | 2964616275 | |||
| 2787 | 2964622586 | |||
| 2788 | 2964633284 | |||
| 2789 | 2964639876 | |||
| 2790 | 2964645832 | |||
| 2791 | 2964654123 | |||
| 2792 | 2964657403 | |||
| 2793 | 2964664470 | |||
| 2794 | 2964674247 | |||
| 2795 | 2964683084 | |||
| 2796 | 2964685543 | |||
| 2797 | 2964694619 | |||
| 2798 | 2964700770 | |||
| 2799 | 2964707907 | |||
| 2800 | 2964712886 | |||
| 2801 | 2964725042 | |||
| 2802 | 2965023335 | |||
| 2803 | 2965031026 | |||
| 2804 | 2965032183 | |||
| 2805 | 2965045829 | |||
| 2806 | 2965050784 | |||
| 2807 | 2965065706 | |||
| 2808 | 2965095267 | |||
| 2809 | 2965103395 | |||
| 2810 | 2965111373 | |||
| 2811 | 2965121122 | |||
| 2812 | 2967667800 | |||
| 2813 | 2967673514 | |||
| 2814 | 2967680876 | |||
| 2815 | 2967687599 | |||
| 2816 | 2967695373 | |||
| 2817 | 2967700444 | |||
| 2818 | 2967711411 | |||
| 2819 | 2967718867 | |||
| 2820 | 2967722582 | |||
| 2821 | 2967733678 | |||
| 2822 | 2967739023 | |||
| 2823 | 2967742588 | |||
| 2824 | 2967749873 | |||
| 2825 | 2967756311 | |||
| 2826 | 2967768121 | |||
| 2827 | 2967775310 | |||
| 2828 | 2967777522 | |||
| 2829 | 2968002386 | |||
| 2830 | 2968009617 | |||
| 2831 | 2968023537 | |||
| 2832 | 2968093137 | |||
| 2833 | 2968102440 | |||
| 2834 | 2968117288 | |||
| 2835 | 2968122286 | |||
| 2836 | 2968132043 | |||
| 2837 | 2968141743 | |||
| 2838 | 2968176923 | |||
| 2839 | 2970020970 | |||
| 2840 | 2970029847 | |||
| 2841 | 2970034253 | |||
| 2842 | 2970047654 | |||
| 2843 | 2970048435 | |||
| 2844 | 2970059429 | |||
| 2845 | 2970062356 | |||
| 2846 | 2970075562 | |||
| 2847 | 2970078757 | |||
| 2848 | 2970086370 | |||
| 2849 | 2970093647 | |||
| 2850 | 2970096491 | |||
| 2851 | 2970108979 | |||
| 2852 | 2970114130 | |||
| 2853 | 2970122352 | |||
| 2854 | 2970123842 | |||
| 2855 | 2970133728 | |||
| 2856 | 2970138160 | |||
| 2857 | 2970143716 | |||
| 2858 | 2970153343 | |||
| 2859 | 2970163697 | |||
| 2860 | 2970167212 | |||
| 2861 | 2970175014 | |||
| 2862 | 2970178821 | |||
| 2863 | 2970186911 | |||
| 2864 | 2970196564 | |||
| 2865 | 2970476119 | |||
| 2866 | 2970490765 | |||
| 2867 | 2970509957 | |||
| 2868 | 2970511858 | |||
| 2869 | 2970537234 | |||
| 2870 | 2970552129 | |||
| 2871 | 2970559817 | |||
| 2872 | 2970594139 | |||
| 2873 | 2970623945 | |||
| 2874 | 2970630142 | |||
| 2875 | 2977517323 | |||
| 2876 | 2977525426 | |||
| 2877 | 2977535196 | |||
| 2878 | 2977540278 | |||
| 2879 | 2977550410 | |||
| 2880 | 2977558972 | |||
| 2881 | 2977559692 | |||
| 2882 | 2977570308 | |||
| 2883 | 2977577461 | |||
| 2884 | 2977585492 | |||
| 2885 | 2977828534 | |||
| 2886 | 2977829662 | |||
| 2887 | 2977844238 | |||
| 2888 | 2977855444 | |||
| 2889 | 2977859643 | |||
| 2890 | 2977865541 | |||
| 2891 | 2977879469 | |||
| 2892 | 2977898831 | |||
| 2893 | 2977908451 | |||
| 2894 | 2977917611 | |||
| 2895 | 2977929465 | |||
| 2896 | 2977935803 | |||
| 2897 | 2977942360 | |||
| 2898 | 2977954590 | |||
| 2899 | 2977960966 | |||
| 2900 | 2977988069 | |||
| 2901 | 2978972550 | |||
| 2902 | 2979092480 | |||
| 2903 | 2979100129 | |||
| 2904 | 2979104451 | |||
| 2905 | 2979711578 | |||
| 2906 | 2979751870 | |||
| 2907 | 2979769346 | |||
| 2908 | 2979776589 | |||
| 2909 | 2979781371 | |||
| 2910 | 2979800560 | |||
| 2911 | 2979814833 | |||
| 2912 | 2984513753 | |||
| 2913 | 2984522669 | |||
| 2914 | 2984541975 | |||
| 2915 | 2984590803 | |||
| 2916 | 2984601405 | |||
| 2917 | 2987641899 | |||
| 2918 | 2987648588 | |||
| 2919 | 2987653451 | |||
| 2920 | 2987664538 | |||
| 2921 | 2987678118 | |||
| 2922 | 2989354837 | |||
| 2923 | 2989771505 | |||
| 2924 | 2989780022 | |||
| 2925 | 2995394778 | |||
| 2926 | 2996354699 | |||
| 2927 | 2996389895 | |||
| 2928 | 2996890177 | |||
| 2929 | 2996895219 | |||
| 2930 | 3000137758 | |||
| 2931 | 3003930919 | |||
| 2932 | 3004173697 | |||
| 2933 | 3004193592 | |||
| 2934 | 3004202174 | |||
| 2935 | 3004209290 | |||
| 2936 | 3004236608 | |||
| 2937 | 3004244379 | |||
| 2938 | 3004249476 | |||
| 2939 | 3004275373 | |||
| 2940 | 3004281347 | |||
| 2941 | 3004290429 | |||
| 2942 | 3004336839 | |||
| 2943 | 3005415734 | |||
| 2944 | 3005421681 | |||
| 2945 | 639650370 | |||
| 2946 | 643827402 | |||
| 2947 | 648737105 | |||
| 2948 | 649870914 | |||
| 2949 | 650741112 | |||
| 2950 | 8003573829 | |||
| 2951 | 8003995247 | |||
| 2952 | 8004002965 | |||
| 2953 | 8004306798 | |||
| 2954 | 8004315209 | |||
| 2955 | 8004367049 | |||
| 2956 | 8004381511 | |||
| 2957 | 8004388560 | |||
| 2958 | 8004447660 | |||
| 2959 | 8004646448 | |||
| 2960 | 8004700703 | |||
| 2961 | 8004706381 | |||
| 2962 | 8004715182 | |||
| 2963 | 8004731309 | |||
| 2964 | 8005249165 | |||
| 2965 | 8005262361 | |||
| 2966 | 8005313636 | |||
| 2967 | 8005319615 | |||
| 2968 | 8005324704 | |||
| 2969 | 8005381632 | |||
| 2970 | 8005465031 | |||
| 2971 | 8005490237 | |||
| 2972 | 8005546605 | |||
| 2973 | 8005561104 | |||
| 2974 | 8005565730 | |||
| 2975 | 8005571782 | |||
| 2976 | 8005646894 | |||
| 2977 | 8005660753 | |||
| 2978 | 8018128849 | |||
| 2979 | 8018155120 | |||
| 2980 | 8018165160 | |||
| 2981 | 8023686474 | |||
| 2982 | 8024484302 | |||
| 2983 | 8024490793 | |||
| 2984 | 8046768088 | |||
| 2985 | 8049296166 | |||
| 2986 | 8054560173 | |||
| 2987 | 8055435633 | |||
| 2988 | 8056878182 | |||
| 2989 | 8057581553 | |||
| 2990 | 8057879222 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zce-assembly1.cif.gz_A | x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. | 0.9384 | 3 | 107 |
| 2eve-assembly1.cif.gz_A | x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 | 0.8868 | 2 | 105 |
| 2ar1-assembly1.cif.gz_A | structure of hypothetical protein from leishmania major | 0.8865 | 3 | 105 |
| 2gbs-assembly1.cif.gz_A | nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 | 0.8652 | 1 | 107 |
| 2g2x-assembly3.cif.gz_C | x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. | 0.8613 | 2 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zceA00 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.9266 | 3 | 107 | 3.10.590.10 |
| af_I1JAX2_1_77_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.9135 | 2 | 73 | 3.10.590.10 |
| af_A4ICC8_1_164_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.8919 | 3 | 105 | 3.10.590.10 |
| af_O94645_8_177_3.10.590.10 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.8656 | 3 | 107 | 3.10.590.10 |
| 2eveA00 | Alpha Beta;Roll;ph1033 like fold;ph1033 like domains | 0.8651 | 2 | 105 | 3.10.590.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1ZEQ7-F1-model_v4 | EVE domain-containing protein | 0.9802 | 1 | 85 |
|
| AF-A0A6A9UMG2-F1-model_v4 | deleted | 0.9802 | 1 | 73 |
|
| AF-A0A530GD66-F1-model_v4 | EVE domain-containing protein | 0.9796 | 1 | 72 |
|
| AF-A0A444ME55-F1-model_v4 | EVE domain-containing protein | 0.9793 | 1 | 100 |
|
| AF-A0A316KAS7-F1-model_v4 | EVE domain-containing protein | 0.9768 | 1 | 63 |
|