F494368

General Info

Members Datasets Scaffolds Average Seq Length
1496 1067 2990 141

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0001126|Ga0395905_0001126_22280_22756
Length 158
Sequence MELDLQQGGRVLIMAAYWLFKSEPFKFSWQMLKDKGEAGQEWDGVRNYAARNNMRAMKIGDKGFFYHSNEGLEIVGITEVCALAHPDSTADAPTWECVDIRAVIDVPKPVTLDTVKNTASLSEMALVKLSRLSVQPVTEKEYLEICRMGGLENPPLSP

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
112 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
113 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
116 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
117 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
118 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
119 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
193 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
194 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
205 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
215 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
216 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
217 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
218 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
223 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
224 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
225 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
226 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
227 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
341 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
342 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
343 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
344 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
352 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
353 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
354 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
360 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
364 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
365 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
366 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
367 2509276019 Ensifer aridi TW10 Isolate Nodule
368 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
369 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
370 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
371 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
372 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
373 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
374 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
375 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
376 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
377 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
378 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
379 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
380 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
381 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
382 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
383 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
384 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
385 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
386 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
387 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
388 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
389 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
390 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
391 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
392 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
393 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
394 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
395 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
396 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
397 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
398 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
399 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
400 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
401 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
402 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
403 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
404 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
405 2516143018 Ensifer sp. BR816 Isolate Nodule
406 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
407 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
408 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
409 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
410 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
411 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
412 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
413 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
414 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
415 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
416 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
417 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
418 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
419 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
420 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
421 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
422 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
423 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
424 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
425 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
426 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
427 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
428 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
429 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
430 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
431 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
432 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
433 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
434 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
435 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
436 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
437 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
438 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
439 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
440 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
441 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
442 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
443 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
444 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
445 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
446 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
447 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
448 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
449 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
450 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
451 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
452 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
453 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
454 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
455 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
456 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
457 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
458 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
459 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
460 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
461 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
462 2643221557 Ensifer sp. Root558 Isolate Unclassified
463 2643221558 Rhizobium sp. Root149 Isolate Unclassified
464 2643221568 Rhizobium sp. Root564 Isolate Unclassified
465 2643221582 Rhizobium sp. Root651 Isolate Unclassified
466 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
467 2643221599 Rhizobium sp. Root708 Isolate Unclassified
468 2643221607 Rhizobium sp. Root73 Isolate Unclassified
469 2643221610 Ensifer sp. Root74 Isolate Unclassified
470 2643221618 Ensifer sp. Root231 Isolate Unclassified
471 2643221626 Ensifer sp. Root31 Isolate Unclassified
472 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
473 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
474 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
475 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
476 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
477 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
478 2643221655 Ensifer sp. Root1252 Isolate Unclassified
479 2643221659 Ensifer sp. Root127 Isolate Unclassified
480 2643221668 Ensifer sp. Root423 Isolate Unclassified
481 2643221675 Ensifer sp. Root1298 Isolate Unclassified
482 2643221680 Ensifer sp. Root1312 Isolate Unclassified
483 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
484 2643221688 Rhizobium sp. Root482 Isolate Unclassified
485 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
486 2643221693 Rhizobium sp. Root491 Isolate Unclassified
487 2643221698 Ensifer sp. Root142 Isolate Unclassified
488 2643221712 Ensifer sp. Root258 Isolate Unclassified
489 2643221718 Rhizobium sp. Root268 Isolate Unclassified
490 2643221719 Rhizobium sp. Root274 Isolate Unclassified
491 2643221723 Ensifer sp. Root278 Isolate Unclassified
492 2643221726 Ensifer sp. Root954 Isolate Unclassified
493 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
494 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
495 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
496 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
497 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
498 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
499 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
500 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
501 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
502 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
503 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
504 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
505 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
506 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
507 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
508 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
509 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
510 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
511 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
512 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
513 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
514 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
515 2791355266 Rhizobium sp. L43 Isolate Nodule
516 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
517 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
518 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
519 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
520 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
521 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
522 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
523 2802429633 Rhizobium anhuiense J3 Isolate Nodule
524 2802429634 Rhizobium anhuiense S10 Isolate Nodule
525 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
526 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
527 2802429637 Rhizobium anhuiense C15 Isolate Nodule
528 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
529 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
530 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
531 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
532 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
533 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
534 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
535 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
536 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
537 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
538 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
539 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
540 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
541 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
542 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
543 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
544 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
545 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
546 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
547 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
548 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
549 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
550 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
551 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
552 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
553 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
554 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
555 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
556 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
557 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
558 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
559 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
560 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
561 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
562 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
563 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
564 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
565 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
566 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
567 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
568 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
569 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
570 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
571 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
572 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
573 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
574 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
575 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
576 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
577 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
578 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
579 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
580 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
581 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
582 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
583 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
584 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
585 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
586 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
587 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
588 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
589 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
590 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
591 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
592 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
593 2844163670 Ensifer sp. 1H6 Isolate Unclassified
594 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
595 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
596 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
597 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
598 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
599 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
600 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
601 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
602 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
603 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
604 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
605 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
606 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
607 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
608 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
609 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
610 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
611 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
612 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
613 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
614 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
615 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
616 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
617 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
618 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
619 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
620 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
621 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
622 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
623 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
624 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
625 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
626 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
627 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
628 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
629 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
630 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
631 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
632 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
633 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
634 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
635 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
636 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
637 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
638 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
639 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
640 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
641 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
642 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
643 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
644 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
645 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
646 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
647 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
648 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
649 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
650 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
651 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
652 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
653 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
654 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
655 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
656 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
657 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
658 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
659 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
660 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
661 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
662 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
663 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
664 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
665 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
666 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
667 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
668 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
669 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
670 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
671 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
672 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
673 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
674 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
675 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
676 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
677 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
678 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
679 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
680 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
681 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
682 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
683 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
684 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
685 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
686 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
687 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
688 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
689 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
690 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
691 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
692 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
693 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
694 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
695 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
696 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
697 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
698 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
699 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
700 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
701 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
702 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
703 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
704 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
705 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
706 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
707 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
708 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
709 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
710 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
711 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
712 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
713 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
714 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
715 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
716 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
717 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
718 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
719 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
720 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
721 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
722 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
723 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
724 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
725 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
726 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
727 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
728 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
729 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
730 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
731 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
732 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
733 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
734 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
735 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
736 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
737 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
738 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
739 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
740 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
741 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
742 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
743 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
744 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
745 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
746 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
747 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
748 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
749 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
750 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
751 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
752 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
753 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
754 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
755 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
756 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
757 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
758 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
759 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
760 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
761 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
762 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
763 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
764 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
765 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
766 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
767 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
768 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
769 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
770 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
771 2936381700 Rhizobium chutanense C16 Isolate Unclassified
772 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
773 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
774 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
775 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
776 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
777 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
778 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
779 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
780 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
781 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
782 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
783 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
784 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
785 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
786 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
787 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
788 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
789 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
790 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
791 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
792 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
793 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
794 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
795 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
796 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
797 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
798 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
799 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
800 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
801 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
802 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
803 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
804 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
805 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
806 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
807 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
808 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
809 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
810 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
811 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
812 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
813 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
814 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
815 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
816 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
817 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
818 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
819 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
820 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
821 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
822 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
823 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
824 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
825 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
826 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
827 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
828 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
829 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
830 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
831 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
832 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
833 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
834 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
835 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
836 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
837 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
838 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
839 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
840 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
841 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
842 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
843 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
844 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
845 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
846 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
847 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
848 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
849 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
850 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
851 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
852 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
853 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
854 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
855 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
856 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
857 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
858 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
859 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
860 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
861 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
862 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
863 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
864 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
865 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
866 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
867 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
868 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
869 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
870 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
871 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
872 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
873 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
874 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
875 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
876 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
877 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
878 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
879 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
880 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
881 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
882 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
883 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
884 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
885 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
886 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
887 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
888 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
889 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
890 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
891 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
892 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
893 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
894 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
895 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
896 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
897 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
898 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
899 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
900 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
901 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
902 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
903 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
904 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
905 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
906 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
907 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
908 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
909 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
910 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
911 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
912 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
913 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
914 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
915 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
916 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
917 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
918 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
919 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
920 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
921 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
922 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
923 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
924 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
925 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
926 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
927 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
928 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
929 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
930 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
931 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
932 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
933 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
934 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
935 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
936 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
937 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
938 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
939 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
940 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
941 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
942 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
943 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
944 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
945 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
946 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
947 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
948 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
949 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
950 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
951 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
952 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
953 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
954 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
955 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
956 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
957 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
958 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
959 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
960 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
961 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
962 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
963 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
964 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
965 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
966 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
967 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
968 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
969 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
970 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
971 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
972 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
973 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
974 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
975 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
976 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
977 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
978 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
979 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
980 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
981 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
982 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
983 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
984 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
985 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
986 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
987 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
988 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
989 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
990 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
991 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
992 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
993 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
994 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
995 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
996 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
997 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
998 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
999 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1000 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1001 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1002 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
1003 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1004 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1005 2996887358 Rhizobium sp. R711 Isolate Nodule
1006 2996893221 Rhizobium sp. R635 Isolate Nodule
1007 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1008 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1009 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1010 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1011 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1012 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1013 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1014 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1015 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1016 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1017 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1018 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1019 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1020 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1021 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1022 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1023 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1024 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1025 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1026 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1027 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1028 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1029 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1030 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1031 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1032 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1033 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1034 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1035 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1036 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1037 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1038 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1039 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1040 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1041 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1042 8005258706 Rhizobium sp. R693 Isolate Nodule
1043 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1044 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1045 8005321885 Rhizobium sp. R72 Isolate Nodule
1046 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1047 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1048 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1049 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1050 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1051 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1052 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1053 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1054 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1055 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1056 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1057 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1058 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1059 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1060 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1061 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1062 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1063 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1064 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1065 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1066 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1067 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.47
Metatranscriptomes 0.27
Isolates 47.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 15.04
Nodule 37.9
Rhizoplane 2.67
Rhizosphere 29.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0001126 3300037471 Bacteria 33477
2 RicEn_FSXC42840_b1 2010549000 Bacteria 845
3 JGI24740J21852_10000013 3300001979 Bacteria 62177
4 JGI24740J21852_10003324 3300001979 Bacteria 7085
5 JGI24737J22298_10257894 3300001990 Bacteria 515
6 JGI25155J39150_1000010 3300002704 Bacteria 207717
7 JGI25156J39149_1000102 3300002705 Bacteria 62463
8 JGI25156J39149_1008662 3300002705 Bacteria 2540
9 JGI25162J39368_1000879 3300002737 Bacteria 19691
10 JGI25154J39366_1000184 3300002738 Bacteria 48243
11 JGI25158J39367_1000526 3300002739 Bacteria 7697
12 JGI25158J39367_1020635 3300002739 Bacteria 804
13 JGI25157J39369_1000009 3300002741 Bacteria 207868
14 JGI25157J39369_1000842 3300002741 Bacteria 15202
15 JGI25152J39213_1002498 3300002773 Bacteria 6955
16 JGI25152J39213_1003827 3300002773 Bacteria 4977
17 JGI25152J39213_1016049 3300002773 Bacteria 1458
18 JGI25150J39212_1012970 3300002774 Bacteria 1458
19 JGI25159J45721_1000053 3300002987 Bacteria 56912
20 JGI25159J45721_1009500 3300002987 Bacteria 2559
21 JGI25151J46595_10001525 3300003187 Bacteria 15499
22 JGI25151J46595_10005265 3300003187 Bacteria 6704
23 JGI25151J46595_10010648 3300003187 Bacteria 4259
24 JGI25151J46595_10014524 3300003187 Bacteria 3504
25 JGI25165J46597_1000273 3300003214 Bacteria 66540
26 JGI25165J46597_1001977 3300003214 Bacteria 7923
27 JGI25153J46596_10070568 3300003215 Bacteria 906
28 JGI25153J46596_10075202 3300003215 Bacteria 860
29 rootH2_10104045 3300003320 Bacteria 1860
30 rootL2_10029472 3300003322 Bacteria 2551
31 rootH1_10215066 3300003323 Bacteria 1138
32 JGI25160J50197_1000168 3300003354 Bacteria 56596
33 JGI25160J50197_1000235 3300003354 Bacteria 43030
34 JGI25160J50197_1018219 3300003354 Bacteria 2195
35 JGI25161J50226_1000175 3300003374 Bacteria 43039
36 JGI25161J50226_1001177 3300003374 Bacteria 8615
37 Ga0055539_1014238 3300003752 Bacteria 971
38 Ga0055526_1002546 3300003771 Bacteria 12243
39 Ga0055526_1002690 3300003771 Bacteria 11842
40 Ga0055526_1010815 3300003771 Bacteria 4196
41 Ga0055526_1017168 3300003771 Bacteria 2784
42 Ga0055526_1018522 3300003771 Bacteria 2594
43 Ga0055524_1002053 3300003775 Bacteria 10695
44 Ga0055524_1003375 3300003775 Bacteria 7777
45 Ga0055524_1007952 3300003775 Bacteria 4451
46 Ga0055524_1009037 3300003775 Bacteria 4089
47 Ga0055524_1017569 3300003775 Bacteria 2519
48 Ga0055524_1018474 3300003775 Bacteria 2419
49 Ga0055524_1037117 3300003775 Bacteria 1297
50 Ga0055536_1002743 3300003781 Bacteria 9744
51 Ga0055528_1000369 3300003790 Bacteria 36582
52 Ga0055528_1001991 3300003790 Bacteria 11495
53 Ga0055528_1005279 3300003790 Bacteria 6051
54 Ga0055528_1017003 3300003790 Bacteria 2541
55 Ga0055528_1035258 3300003790 Bacteria 1218
56 Ga0055530_10015001 3300003791 Bacteria 2554
57 Ga0055540_1013494 3300003792 Bacteria 2493
58 Ga0055540_1015856 3300003792 Bacteria 2171
59 Ga0055531_10003576 3300003794 Bacteria 9857
60 Ga0055531_10064627 3300003794 Bacteria 874
61 Ga0058692_1002172 3300003856 Bacteria 6702
62 Ga0058692_1006673 3300003856 Bacteria 3141
63 Ga0058692_1007029 3300003856 Bacteria 3026
64 Ga0058692_1028227 3300003856 Bacteria 1085
65 Ga0055543_1000226 3300004625 Bacteria 44983
66 Ga0055543_1000412 3300004625 Bacteria 26967
67 Ga0065165_1000133 3300005262 Bacteria 128540
68 Ga0065165_1002250 3300005262 Bacteria 17103
69 Ga0065165_1005266 3300005262 Bacteria 7383
70 Ga0065165_1052669 3300005262 Bacteria 1149
71 Ga0065704_10763127 3300005289 Bacteria 532
72 Ga0065715_10853871 3300005293 Bacteria 590
73 Ga0070658_10344666 3300005327 Bacteria 1275
74 Ga0070658_10386302 3300005327 Bacteria 1201
75 Ga0070670_100000183 3300005331 Bacteria 57446
76 Ga0068869_100309951 3300005334 Bacteria 1277
77 Ga0070680_100027990 3300005336 Bacteria 4518
78 Ga0070682_100000791 3300005337 Bacteria 18585
79 Ga0070660_100045414 3300005339 Bacteria 3363
80 Ga0070660_100153690 3300005339 Bacteria 1852
81 Ga0070691_10016489 3300005341 Bacteria 3394
82 Ga0070661_100705424 3300005344 Bacteria 822
83 Ga0070692_10111921 3300005345 Bacteria 1511
84 Ga0070668_100334991 3300005347 Bacteria 1277
85 Ga0070668_100449344 3300005347 Bacteria 1108
86 Ga0070668_100517355 3300005347 Bacteria 1035
87 Ga0070668_101286691 3300005347 Bacteria 664
88 Ga0070668_101341896 3300005347 Bacteria 651
89 Ga0070669_100374603 3300005353 Bacteria 1160
90 Ga0070671_100173508 3300005355 Bacteria 1824
91 Ga0070674_100768454 3300005356 Bacteria 829
92 Ga0070659_100081160 3300005366 Bacteria 2590
93 Ga0070659_100892153 3300005366 Bacteria 777
94 Ga0070705_100009688 3300005440 Bacteria 4797
95 Ga0070700_100087920 3300005441 Bacteria 2021
96 Ga0070694_100052405 3300005444 Bacteria 2758
97 Ga0070663_100003763 3300005455 Bacteria 8809
98 Ga0070678_100090978 3300005456 Bacteria 2340
99 Ga0070662_100372795 3300005457 Bacteria 1173
100 Ga0070662_101054725 3300005457 Bacteria 697
101 Ga0070681_10008287 3300005458 Bacteria 10178
102 Ga0068867_101612271 3300005459 Bacteria 607
103 Ga0070679_100199832 3300005530 Bacteria 1966
104 Ga0070684_100716527 3300005535 Bacteria 933
105 Ga0068853_100040844 3300005539 Bacteria 3959
106 Ga0068853_100702550 3300005539 Bacteria 965
107 Ga0068853_101443730 3300005539 Bacteria 666
108 Ga0070665_100083379 3300005548 Bacteria 3201
109 Ga0070665_100389179 3300005548 Bacteria 1402
110 Ga0070665_100668223 3300005548 Bacteria 1052
111 Ga0068855_100476119 3300005563 Bacteria 1360
112 Ga0068855_101313924 3300005563 Bacteria 748
113 Ga0070664_100039603 3300005564 Bacteria 3972
114 Ga0070664_100585780 3300005564 Bacteria 1034
115 Ga0068857_100035472 3300005577 Bacteria 4417
116 Ga0068854_100335999 3300005578 Bacteria 1232
117 Ga0068856_100014117 3300005614 Bacteria 7725
118 Ga0068856_100081792 3300005614 Bacteria 3205
119 Ga0068856_100188981 3300005614 Bacteria 2073
120 Ga0068852_100059446 3300005616 Bacteria 3315
121 Ga0068852_100261305 3300005616 Bacteria 1662
122 Ga0068852_100815066 3300005616 Bacteria 948
123 Ga0068860_101068060 3300005843 Bacteria 826
124 Ga0068860_102236096 3300005843 Bacteria 568
125 Ga0068862_100519182 3300005844 Bacteria 1133
126 Ga0081455_10441046 3300005937 Bacteria 892
127 Ga0075365_10001999 3300006038 Bacteria 9664
128 Ga0075365_10011804 3300006038 Bacteria 5156
129 Ga0075365_10022037 3300006038 Bacteria 3984
130 Ga0075365_10036005 3300006038 Bacteria 3206
131 Ga0075365_10080809 3300006038 Bacteria 2201
132 Ga0075365_10324910 3300006038 Bacteria 1083
133 Ga0075365_10453340 3300006038 Bacteria 906
134 Ga0075368_10000370 3300006042 Bacteria 13204
135 Ga0075368_10006472 3300006042 Bacteria 4093
136 Ga0075368_10060920 3300006042 Bacteria 1511
137 Ga0075363_100097483 3300006048 Bacteria 1624
138 Ga0075363_100249788 3300006048 Bacteria 1021
139 Ga0075364_10000195 3300006051 Bacteria 28057
140 Ga0075364_10064288 3300006051 Bacteria 2408
141 Ga0075364_10107044 3300006051 Bacteria 1863
142 Ga0075364_10614010 3300006051 Bacteria 743
143 Ga0075362_10005758 3300006177 Bacteria 4564
144 Ga0075362_10041266 3300006177 Bacteria 2035
145 Ga0075367_10003513 3300006178 Bacteria 7488
146 Ga0075367_10010829 3300006178 Bacteria 4805
147 Ga0075367_10037942 3300006178 Bacteria 2802
148 Ga0075367_10088137 3300006178 Bacteria 1885
149 Ga0075367_10143891 3300006178 Bacteria 1477
150 Ga0075367_10209748 3300006178 Bacteria 1218
151 Ga0075369_10007006 3300006186 Bacteria 4280
152 Ga0075369_10009506 3300006186 Bacteria 3780
153 Ga0075369_10009744 3300006186 Bacteria 3741
154 Ga0075369_10039071 3300006186 Bacteria 2026
155 Ga0075369_10186025 3300006186 Bacteria 956
156 Ga0075366_10015737 3300006195 Bacteria 4342
157 Ga0075366_10153478 3300006195 Bacteria 1395
158 Ga0097621_100872739 3300006237 Bacteria 837
159 Ga0075370_10000923 3300006353 Bacteria 12065
160 Ga0075370_10046667 3300006353 Bacteria 2452
161 Ga0075370_10256009 3300006353 Bacteria 1038
162 Ga0079104_1000195 3300006946 Bacteria 85244
163 Ga0079104_1007315 3300006946 Bacteria 4027
164 Ga0079104_1019653 3300006946 Bacteria 1881
165 Ga0099826_10002340 3300006948 Bacteria 12184
166 Ga0099826_10030104 3300006948 Bacteria 3947
167 Ga0105251_10032824 3300009011 Bacteria 2583
168 Ga0105240_10000013 3300009093 Bacteria 483458
169 Ga0105245_10676194 3300009098 Bacteria 1064
170 Ga0105247_10038391 3300009101 Bacteria 2924
171 Ga0105243_10018422 3300009148 Bacteria 5289
172 Ga0105243_10031359 3300009148 Bacteria 4098
173 Ga0105243_11181347 3300009148 Bacteria 777
174 Ga0105243_11206633 3300009148 Bacteria 770
175 Ga0105241_10005600 3300009174 Bacteria 9273
176 Ga0105241_10130804 3300009174 Bacteria 2032
177 Ga0105241_11153113 3300009174 Bacteria 732
178 Ga0105237_10012742 3300009545 Bacteria 8845
179 Ga0105237_10017470 3300009545 Bacteria 7436
180 Ga0105237_10083583 3300009545 Bacteria 3184
181 Ga0105237_10314042 3300009545 Bacteria 1570
182 Ga0105238_10010328 3300009551 Bacteria 9368
183 Ga0105238_10021086 3300009551 Bacteria 6640
184 Ga0105238_10201007 3300009551 Bacteria 1968
185 Ga0105238_10258207 3300009551 Bacteria 1721
186 Ga0105238_11427143 3300009551 Bacteria 720
187 Ga0105249_10603127 3300009553 Bacteria 1153
188 Ga0105249_11159140 3300009553 Bacteria 844
189 Ga0105249_11771134 3300009553 Bacteria 690
190 Ga0123342_1015184 3300009766 Bacteria 7094
191 Ga0105239_10158935 3300010375 Bacteria 2524
192 Ga0105239_10184102 3300010375 Bacteria 2337
193 Ga0105239_10239809 3300010375 Bacteria 2035
194 Ga0105239_10389948 3300010375 Bacteria 1575
195 Ga0105239_10480594 3300010375 Bacteria 1411
196 Ga0105246_10103527 3300011119 Bacteria 2077
197 Ga0105246_10299020 3300011119 Bacteria 1298
198 Ga0157373_10007612 3300013100 Bacteria 8048
199 Ga0157373_10262877 3300013100 Bacteria 1221
200 Ga0157371_10000108 3300013102 Bacteria 126288
201 Ga0157371_10020668 3300013102 Bacteria 4843
202 Ga0157370_10000720 3300013104 Bacteria 41451
203 Ga0157370_10003357 3300013104 Bacteria 18853
204 Ga0157370_10193891 3300013104 Bacteria 1885
205 Ga0157370_10318199 3300013104 Bacteria 1435
206 Ga0157370_10831338 3300013104 Bacteria 840
207 Ga0157369_10023136 3300013105 Bacteria 6923
208 Ga0157369_10082749 3300013105 Bacteria 3434
209 Ga0157369_10537836 3300013105 Bacteria 1208
210 Ga0157369_10853251 3300013105 Bacteria 935
211 Ga0171463_1004 3300013249 Bacteria 437207
212 Ga0157374_11327888 3300013296 Bacteria 741
213 Ga0157378_10357062 3300013297 Bacteria 1429
214 Ga0157378_10579366 3300013297 Bacteria 1131
215 Ga0157378_11604741 3300013297 Bacteria 696
216 Ga0163162_10286000 3300013306 Bacteria 1781
217 Ga0163162_10461997 3300013306 Bacteria 1401
218 Ga0157372_11395879 3300013307 Bacteria 807
219 Ga0157375_10182934 3300013308 Bacteria 2248
220 Ga0157375_11764529 3300013308 Bacteria 733
221 Ga0163163_11715603 3300014325 Bacteria 689
222 Ga0182008_10066410 3300014497 Bacteria 1775
223 Ga0157379_12244190 3300014968 Bacteria 543
224 Ga0157376_11436206 3300014969 Bacteria 722
225 Ga0182006_1051320 3300015261 Bacteria 1587
226 Ga0182007_10001661 3300015262 Bacteria 11785
227 Ga0182007_10079999 3300015262 Bacteria 1072
228 Ga0182005_1001607 3300015265 Bacteria 8854
229 Ga0183365_11151 3300015684 Bacteria 945
230 Ga0183363_1208 3300015690 Bacteria 11915
231 Ga0214544_1000024 3300021320 Bacteria 163562
232 Ga0214542_1000008 3300021321 Bacteria 278895
233 Ga0214543_1000031 3300021327 Bacteria 206436
234 Ga0214543_1000053 3300021327 Bacteria 141797
235 Ga0228711_1000050 3300022739 Bacteria 81399
236 Ga0228710_1000063 3300022740 Bacteria 81399
237 Ga0209435_100009 3300025206 Bacteria 476614
238 Ga0209436_101476 3300025208 Bacteria 8154
239 Ga0209436_122632 3300025208 Bacteria 806
240 Ga0209672_104990 3300025228 Bacteria 2350
241 Ga0209437_100057 3300025233 Bacteria 362922
242 Ga0207425_1004647 3300025245 Bacteria 4062
243 Ga0207425_1016579 3300025245 Bacteria 1633
244 Ga0207425_1023523 3300025245 Bacteria 1289
245 Ga0209646_1000018 3300025246 Bacteria 476716
246 Ga0209646_1010312 3300025246 Bacteria 1465
247 Ga0209026_1000032 3300025250 Bacteria 322378
248 Ga0209026_1000068 3300025250 Bacteria 207601
249 Ga0209677_100199 3300025253 Bacteria 48030
250 Ga0209759_1000007 3300025256 Bacteria 476614
251 Ga0209759_1000142 3300025256 Bacteria 124090
252 Ga0209129_1000118 3300025258 Bacteria 139972
253 Ga0209129_1001411 3300025258 Bacteria 13452
254 Ga0209129_1003993 3300025258 Bacteria 6069
255 Ga0209129_1044623 3300025258 Bacteria 692
256 Ga0209233_1000030 3300025261 Bacteria 636702
257 Ga0209233_1000134 3300025261 Bacteria 202535
258 Ga0209233_1000331 3300025261 Bacteria 48397
259 Ga0209233_1030002 3300025261 Bacteria 1285
260 Ga0209455_1019748 3300025272 Bacteria 1353
261 Ga0209673_1000033 3300025273 Bacteria 335369
262 Ga0209673_1000052 3300025273 Bacteria 279795
263 Ga0209673_1000459 3300025273 Bacteria 68727
264 Ga0209673_1007582 3300025273 Bacteria 4966
265 Ga0209130_1000027 3300025284 Bacteria 327700
266 Ga0209130_1000132 3300025284 Bacteria 119765
267 Ga0209130_1008806 3300025284 Bacteria 2941
268 Ga0209130_1054352 3300025284 Bacteria 716
269 Ga0209675_1041449 3300025291 Bacteria 1004
270 Ga0209676_1001384 3300025292 Bacteria 23645
271 Ga0209025_1000042 3300025294 Bacteria 370577
272 Ga0209025_1000241 3300025294 Bacteria 128329
273 Ga0209025_1000487 3300025294 Bacteria 76541
274 Ga0209025_1001035 3300025294 Bacteria 40774
275 Ga0209025_1004694 3300025294 Bacteria 11662
276 Ga0209025_1004706 3300025294 Bacteria 11651
277 Ga0209025_1014160 3300025294 Bacteria 4939
278 Ga0209025_1027594 3300025294 Bacteria 2811
279 Ga0209025_1056548 3300025294 Bacteria 1507
280 Ga0209564_1000111 3300025295 Bacteria 212210
281 Ga0209564_1000569 3300025295 Bacteria 58592
282 Ga0209564_1002864 3300025295 Bacteria 12661
283 Ga0209564_1012163 3300025295 Bacteria 3776
284 Ga0209564_1054347 3300025295 Bacteria 946
285 Ga0209564_1077488 3300025295 Bacteria 663
286 Ga0209758_1002002 3300025297 Bacteria 21937
287 Ga0209758_1010141 3300025297 Bacteria 5697
288 Ga0209758_1015446 3300025297 Bacteria 3950
289 Ga0209758_1027554 3300025297 Bacteria 2424
290 Ga0209758_1028483 3300025297 Bacteria 2360
291 Ga0209050_1008253 3300025298 Bacteria 5613
292 Ga0209256_1000132 3300025299 Bacteria 160806
293 Ga0209256_1000361 3300025299 Bacteria 73723
294 Ga0209256_1000510 3300025299 Bacteria 57080
295 Ga0209256_1002711 3300025299 Bacteria 13805
296 Ga0209256_1011367 3300025299 Bacteria 3571
297 Ga0209256_1019551 3300025299 Bacteria 2150
298 Ga0209256_1019624 3300025299 Bacteria 2144
299 Ga0209256_1047493 3300025299 Bacteria 1056
300 Ga0209256_1063069 3300025299 Bacteria 856
301 Ga0207426_1000072 3300025302 Bacteria 327700
302 Ga0207426_1000246 3300025302 Bacteria 119765
303 Ga0207426_1000595 3300025302 Bacteria 47697
304 Ga0209051_1003461 3300025303 Bacteria 10338
305 Ga0209051_1003573 3300025303 Bacteria 10112
306 Ga0209051_1014030 3300025303 Bacteria 3766
307 Ga0209051_1018700 3300025303 Bacteria 3056
308 Ga0209051_1050455 3300025303 Bacteria 1393
309 Ga0209051_1075244 3300025303 Bacteria 997
310 Ga0209051_1085637 3300025303 Bacteria 893
311 Ga0209257_1001613 3300025304 Bacteria 25850
312 Ga0209257_1031551 3300025304 Bacteria 1693
313 Ga0207656_10174216 3300025321 Bacteria 1030
314 Ga0207642_10925415 3300025899 Bacteria 559
315 Ga0207710_10440012 3300025900 Bacteria 672
316 Ga0207680_10556528 3300025903 Bacteria 819
317 Ga0207647_10017328 3300025904 Bacteria 4897
318 Ga0207647_10035238 3300025904 Bacteria 3191
319 Ga0207647_10173910 3300025904 Bacteria 1253
320 Ga0207647_10206596 3300025904 Bacteria 1135
321 Ga0207645_10457795 3300025907 Bacteria 862
322 Ga0207705_10535669 3300025909 Bacteria 910
323 Ga0207654_10068696 3300025911 Bacteria 2097
324 Ga0207654_10198014 3300025911 Bacteria 1321
325 Ga0207707_10250306 3300025912 Bacteria 1539
326 Ga0207695_10000044 3300025913 Bacteria 440819
327 Ga0207695_10705120 3300025913 Bacteria 890
328 Ga0207671_10000226 3300025914 Bacteria 84886
329 Ga0207671_10129928 3300025914 Bacteria 1933
330 Ga0207671_10262382 3300025914 Bacteria 1360
331 Ga0207671_10738293 3300025914 Bacteria 782
332 Ga0207660_10260913 3300025917 Bacteria 1370
333 Ga0207657_10027233 3300025919 Bacteria 5237
334 Ga0207649_10315154 3300025920 Bacteria 1147
335 Ga0207681_10557000 3300025923 Bacteria 944
336 Ga0207694_10065714 3300025924 Bacteria 2828
337 Ga0207694_10470302 3300025924 Bacteria 1051
338 Ga0207694_10618405 3300025924 Bacteria 911
339 Ga0207694_11146171 3300025924 Bacteria 658
340 Ga0207694_11147228 3300025924 Bacteria 658
341 Ga0207650_10000151 3300025925 Bacteria 83229
342 Ga0207687_11300403 3300025927 Bacteria 625
343 Ga0207644_10430036 3300025931 Bacteria 1082
344 Ga0207690_10813937 3300025932 Bacteria 772
345 Ga0207706_10361814 3300025933 Bacteria 1260
346 Ga0207706_10984542 3300025933 Bacteria 709
347 Ga0207709_10183972 3300025935 Bacteria 1478
348 Ga0207704_11093092 3300025938 Bacteria 677
349 Ga0207711_10248707 3300025941 Bacteria 1632
350 Ga0207711_11046888 3300025941 Bacteria 756
351 Ga0207689_10033428 3300025942 Bacteria 4273
352 Ga0207661_11592418 3300025944 Bacteria 598
353 Ga0207679_10124140 3300025945 Bacteria 2060
354 Ga0207679_10734119 3300025945 Bacteria 897
355 Ga0207667_10792086 3300025949 Bacteria 945
356 Ga0207667_11161698 3300025949 Bacteria 753
357 Ga0207712_10455288 3300025961 Bacteria 1086
358 Ga0207712_10561879 3300025961 Bacteria 983
359 Ga0207668_10065742 3300025972 Bacteria 2568
360 Ga0207668_10465533 3300025972 Bacteria 1082
361 Ga0207640_10222974 3300025981 Bacteria 1445
362 Ga0207640_11667508 3300025981 Bacteria 575
363 Ga0207703_10110024 3300026035 Bacteria 2349
364 Ga0207639_10090669 3300026041 Bacteria 2445
365 Ga0207639_10818469 3300026041 Bacteria 868
366 Ga0207678_10001387 3300026067 Bacteria 22297
367 Ga0207678_10178111 3300026067 Bacteria 1815
368 Ga0207678_10333886 3300026067 Bacteria 1305
369 Ga0207678_10449195 3300026067 Bacteria 1120
370 Ga0207678_11725499 3300026067 Bacteria 549
371 Ga0207708_10653067 3300026075 Bacteria 895
372 Ga0207702_10014459 3300026078 Bacteria 6553
373 Ga0207702_10081120 3300026078 Bacteria 2817
374 Ga0207702_10099208 3300026078 Bacteria 2567
375 Ga0207674_10052895 3300026116 Bacteria 4140
376 Ga0207674_10628241 3300026116 Bacteria 1037
377 Ga0207675_100826292 3300026118 Bacteria 941
378 Ga0207683_10190699 3300026121 Bacteria 1861
379 Ga0207683_10312408 3300026121 Bacteria 1439
380 Ga0207683_10585914 3300026121 Bacteria 1032
381 Ga0207698_10186223 3300026142 Bacteria 1844
382 Ga0207698_10468803 3300026142 Bacteria 1219
383 Ga0207698_10529533 3300026142 Bacteria 1151
384 Ga0207698_10676570 3300026142 Bacteria 1025
385 Ga0209281_1000028 3300027111 Bacteria 440027
386 Ga0209281_1000030 3300027111 Bacteria 425931
387 Ga0209281_1000840 3300027111 Bacteria 27410
388 Ga0209371_1000037 3300027312 Bacteria 367074
389 Ga0209371_1001857 3300027312 Bacteria 12997
390 Ga0209371_1008497 3300027312 Bacteria 3402
391 Ga0209371_1046644 3300027312 Bacteria 851
392 Ga0209282_1000004 3300027666 Bacteria 425931
393 Ga0209282_1000283 3300027666 Bacteria 25146
394 Ga0209282_1039116 3300027666 Bacteria 2833
395 Ga0209813_10000828 3300027866 Bacteria 7008
396 Ga0209813_10109991 3300027866 Bacteria 948
397 Ga0209813_10213878 3300027866 Bacteria 719
398 Ga0209974_10386636 3300027876 Bacteria 547
399 Ga0268266_10012307 3300028379 Bacteria 7403
400 Ga0268266_10241317 3300028379 Bacteria 1668
401 Ga0268266_10275690 3300028379 Bacteria 1562
402 Ga0268266_10516927 3300028379 Bacteria 1141
403 Ga0268266_11889092 3300028379 Bacteria 571
404 Ga0268265_10359867 3300028380 Bacteria 1332
405 Ga0268264_11166233 3300028381 Bacteria 779
406 Ga0307517_10327943 3300028786 Bacteria 843
407 Ga0307515_10000377 3300028794 Bacteria 109082
408 Ga0307515_10000434 3300028794 Bacteria 100265
409 Ga0307515_10016274 3300028794 Bacteria 13625
410 Ga0307515_10033701 3300028794 Bacteria 8418
411 Ga0307515_10394488 3300028794 Bacteria 1012
412 Ga0268256_1000039 3300030500 Bacteria 354969
413 Ga0268256_1002298 3300030500 Bacteria 9905
414 Ga0268256_1008786 3300030500 Bacteria 3431
415 Ga0268256_1052564 3300030500 Bacteria 851
416 Ga0316176_1072425 3300030732 Bacteria 608
417 Ga0316181_1261403 3300030744 Bacteria 2462
418 Ga0307513_10001888 3300031456 Bacteria 29770
419 Ga0307513_10192741 3300031456 Bacteria 1888
420 Ga0307513_10442346 3300031456 Bacteria 1026
421 Ga0307513_10529354 3300031456 Bacteria 893
422 Ga0307408_100052252 3300031548 Bacteria 2947
423 Ga0307408_100187346 3300031548 Bacteria 1664
424 Ga0307408_101006931 3300031548 Bacteria 768
425 Ga0307516_10315998 3300031730 Bacteria 1234
426 Ga0307405_10512740 3300031731 Bacteria 963
427 Ga0307413_11156467 3300031824 Bacteria 671
428 Ga0307410_10188008 3300031852 Bacteria 1569
429 Ga0307410_10834157 3300031852 Bacteria 786
430 Ga0307412_10351845 3300031911 Bacteria 1183
431 Ga0307412_10582268 3300031911 Bacteria 945
432 Ga0315914_1000001 3300031967 Bacteria 416633
433 Ga0307409_100489820 3300031995 Bacteria 1195
434 Ga0307409_101096909 3300031995 Bacteria 817
435 Ga0315913_1000024 3300033430 Bacteria 90863
436 Ga0315915_1000002 3300033464 Bacteria 425854
437 Ga0373941_0368889 3300035115 Bacteria 588
438 Ga0316574_0054367 3300035398 Bacteria 2500
439 Ga0316584_0407069 3300036712 Bacteria 968
440 Ga0395900_0536357 3300037418 Bacteria 1116
441 Ga0395898_0164394 3300037466 Bacteria 2123
442 Ga0395905_0004591 3300037471 Bacteria 14285
443 Ga0395905_0073479 3300037471 Bacteria 3205
444 Ga0395905_0136682 3300037471 Bacteria 2306
445 Ga0395905_0159911 3300037471 Bacteria 2117
446 Ga0395905_0166954 3300037471 Bacteria 2068
447 Ga0395905_0420019 3300037471 Bacteria 1233
448 Ga0395905_0916404 3300037471 Bacteria 779
449 Ga0395905_1457642 3300037471 Bacteria 589
450 Ga0395901_0108029 3300038443 Bacteria 2921
451 Ga0395901_0192399 3300038443 Bacteria 2139
452 Ga0395901_0320823 3300038443 Bacteria 1603
453 Ga0395901_0363975 3300038443 Bacteria 1491
454 Ga0439436_0013306 3300041404 Bacteria 2489
455 Ga0439465_0007940 3300041413 Bacteria 3359
456 Ga0439465_0258020 3300041413 Bacteria 646
457 Ga0451787_328280 3300041441 Bacteria 1979
458 Ga0451791_1874397 3300041451 Bacteria 608
459 Ga0451798_0190316 3300041458 Bacteria 2080
460 Ga0451804_0509084 3300041463 Bacteria 504
461 Ga0451833_0656247 3300041491 Bacteria 1721
462 Ga0451839_0797687 3300041496 Bacteria 1771
463 Ga0451840_02813 3300041497 Bacteria 1462
464 Ga0451841_0317996 3300041498 Bacteria 2106
465 Ga0451845_0142149 3300041501 Bacteria 629
466 Ga0451846_33483 3300041502 Bacteria 1228
467 Ga0451847_0149356 3300041503 Bacteria 2364
468 Ga0451849_1233240 3300041505 Bacteria 1950
469 Ga0451851_0041039 3300041507 Bacteria 2495
470 Ga0451843_0950520 3300041509 Bacteria 1120
471 Ga0451853_1752544 3300041512 Bacteria 3021
472 Ga0439445_0255893 3300042004 Bacteria 523
473 Ga0439449_0023273 3300042007 Bacteria 2317
474 Ga0439449_0386849 3300042007 Bacteria 530
475 Ga0439455_0199105 3300042012 Bacteria 580
476 Ga0439462_0224245 3300042015 Bacteria 538
477 Ga0450920_023890 3300042122 Bacteria 1186
478 Ga0466972_0083314 3300044658 Bacteria 1521
479 Ga0466965_0041976 3300044683 Bacteria 2255
480 Ga0466965_0540303 3300044683 Bacteria 657
481 Ga0466960_0156005 3300044901 Bacteria 1222
482 Ga0466967_1292166 3300045976 Bacteria 727
483 Ga0495617_045322 3300046452 Bacteria 1466
484 Ga0495627_039264 3300046453 Bacteria 1461
485 Ga0495627_083163 3300046453 Bacteria 926
486 Ga0495592_0325386 3300046454 Bacteria 992
487 Ga0495590_0008145 3300046457 Bacteria 4013
488 Ga0495629_0239147 3300046459 Bacteria 1250
489 Ga0495638_0001266 3300046460 Bacteria 23584
490 Ga0495638_0061845 3300046460 Bacteria 2312
491 Ga0495638_0188006 3300046460 Bacteria 1173
492 Ga0495638_0200521 3300046460 Bacteria 1127
493 Ga0495650_0022011 3300046471 Bacteria 3065
494 Ga0495605_0001289 3300046474 Bacteria 16636
495 Ga0495605_0201863 3300046474 Bacteria 866
496 Ga0495662_0051558 3300046476 Bacteria 1986
497 Ga0495584_0111263 3300046491 Bacteria 1386
498 Ga0495585_0003047 3300046492 Bacteria 11546
499 Ga0495585_0014299 3300046492 Bacteria 4628
500 Ga0495585_0044472 3300046492 Bacteria 2481
501 Ga0495585_0355542 3300046492 Bacteria 711
502 Ga0495607_0070406 3300046501 Bacteria 1955
503 Ga0495607_0223498 3300046501 Bacteria 919
504 Ga0495583_0003099 3300046506 Bacteria 13147
505 Ga0495583_0129631 3300046506 Bacteria 1056
506 Ga0495583_0275303 3300046506 Bacteria 672
507 Ga0495606_0011138 3300046507 Bacteria 7371
508 Ga0495606_0055573 3300046507 Bacteria 2560
509 Ga0495606_0066095 3300046507 Bacteria 2295
510 Ga0495606_0077128 3300046507 Bacteria 2081
511 Ga0495610_0002597 3300046512 Bacteria 14977
512 Ga0495610_0019307 3300046512 Bacteria 3821
513 Ga0495610_0023092 3300046512 Bacteria 3389
514 Ga0495610_0026275 3300046512 Bacteria 3111
515 Ga0495616_0002338 3300046513 Bacteria 12653
516 Ga0495616_0103543 3300046513 Bacteria 1332
517 Ga0495616_0114020 3300046513 Bacteria 1253
518 Ga0495620_0016883 3300046515 Bacteria 3651
519 Ga0495620_0017309 3300046515 Bacteria 3596
520 Ga0495620_0018102 3300046515 Bacteria 3494
521 Ga0495620_0170758 3300046515 Bacteria 843
522 Ga0495631_0001859 3300046518 Bacteria 12472
523 Ga0495632_0012884 3300046519 Bacteria 4797
524 Ga0495632_0015553 3300046519 Bacteria 4260
525 Ga0495632_0026520 3300046519 Bacteria 3049
526 Ga0495632_0303681 3300046519 Bacteria 707
527 Ga0495632_0484135 3300046519 Bacteria 535
528 Ga0495643_0011972 3300046522 Bacteria 5251
529 Ga0495643_0030466 3300046522 Bacteria 3012
530 Ga0495643_0097990 3300046522 Bacteria 1505
531 Ga0495644_0019675 3300046523 Bacteria 2578
532 Ga0495648_0122865 3300046524 Bacteria 1392
533 Ga0495648_0164547 3300046524 Bacteria 1143
534 Ga0495652_0060749 3300046529 Bacteria 3193
535 Ga0495654_0000308 3300046530 Bacteria 42986
536 Ga0495654_0078466 3300046530 Bacteria 1552
537 Ga0495654_0119438 3300046530 Bacteria 1195
538 Ga0495654_0147827 3300046530 Bacteria 1042
539 Ga0495609_0012502 3300046538 Bacteria 4027
540 Ga0495609_0070523 3300046538 Bacteria 1536
541 Ga0495597_0024478 3300046542 Bacteria 2786
542 Ga0495622_0029699 3300046557 Bacteria 2554
543 Ga0495633_0019083 3300046558 Bacteria 3471
544 Ga0495633_0038782 3300046558 Bacteria 2274
545 Ga0495633_0053812 3300046558 Bacteria 1894
546 Ga0495633_0242892 3300046558 Bacteria 822
547 Ga0495656_0014722 3300046615 Bacteria 2938
548 Ga0495656_0071441 3300046615 Bacteria 1543
549 Ga0495668_0022717 3300046616 Bacteria 3584
550 Ga0495668_0025481 3300046616 Bacteria 3360
551 Ga0495668_0046473 3300046616 Bacteria 2412
552 Ga0495668_0066618 3300046616 Bacteria 1981
553 Ga0495668_0393198 3300046616 Bacteria 762
554 Ga0495625_0014610 3300046660 Bacteria 6256
555 Ga0495625_0029614 3300046660 Bacteria 4091
556 Ga0495625_0052613 3300046660 Bacteria 2915
557 Ga0495625_0136309 3300046660 Bacteria 1659
558 Ga0495625_0261524 3300046660 Bacteria 1119
559 Ga0495625_0477356 3300046660 Bacteria 766
560 Ga0495661_0251451 3300046665 Bacteria 902
561 Ga0495661_0488210 3300046665 Bacteria 589
562 Ga0495588_0000643 3300046674 Bacteria 16231
563 Ga0495588_0011541 3300046674 Bacteria 4149
564 Ga0495670_0013208 3300046691 Bacteria 4062
565 Ga0495671_0061710 3300046692 Bacteria 1849
566 Ga0495671_0131517 3300046692 Bacteria 1220
567 Ga0495649_0013866 3300046694 Bacteria 4634
568 Ga0495649_0034639 3300046694 Bacteria 2778
569 Ga0495649_0191142 3300046694 Bacteria 1066
570 Ga0495649_0372293 3300046694 Bacteria 720
571 Ga0495660_0015869 3300046810 Bacteria 4346
572 Ga0495660_0055768 3300046810 Bacteria 2138
573 Ga0495604_0016659 3300047317 Bacteria 5877
574 Ga0495636_0015190 3300047318 Bacteria 3068
575 Ga0495636_0029106 3300047318 Bacteria 2254
576 Ga0495672_0024621 3300047320 Bacteria 3873
577 Ga0495683_0042349 3300047323 Bacteria 2296
578 Ga0495687_130338 3300047443 Bacteria 891
579 Ga0495677_0184821 3300047445 Bacteria 808
580 Ga0495673_0084463 3300047469 Bacteria 1309
581 Ga0495681_0126581 3300047470 Bacteria 1091
582 Ga0495686_0002454 3300047472 Bacteria 17478
583 Ga0495686_0045229 3300047472 Bacteria 2785
584 Ga0495686_0267362 3300047472 Bacteria 955
585 Ga0495626_0136317 3300048091 Bacteria 1044
586 Ga0496100_0663184 3300048903 Bacteria 813
587 Ga0496102_0147383 3300048905 Bacteria 2209
588 Ga0496102_0246818 3300048905 Bacteria 1683
589 Ga0496102_0641635 3300048905 Bacteria 985
590 Ga0496103_0149178 3300048906 Bacteria 1497
591 Ga0496103_0501194 3300048906 Bacteria 777
592 Ga0496103_0702337 3300048906 Bacteria 641
593 Ga0496104_0989843 3300048907 Bacteria 745
594 Ga0496105_0119676 3300048908 Bacteria 2172
595 Ga0496105_0476381 3300048908 Bacteria 983
596 Ga0496105_0634908 3300048908 Bacteria 825
597 Ga0496106_0089525 3300048909 Bacteria 2373
598 Ga0496107_0003241 3300048910 Bacteria 10827
599 Ga0496107_0694442 3300048910 Bacteria 749
600 Ga0496109_1225340 3300048912 Bacteria 687
601 Ga0496110_0088309 3300048913 Bacteria 2769
602 Ga0496110_0527091 3300048913 Bacteria 1074
603 Ga0496110_1136013 3300048913 Bacteria 690
604 Ga0496111_0003486 3300048914 Bacteria 9732
605 Ga0496111_0649468 3300048914 Bacteria 770
606 Ga0496112_0321351 3300048915 Bacteria 1492
607 Ga0496113_0346349 3300048916 Bacteria 1192
608 Ga0496113_0480525 3300048916 Bacteria 998
609 Ga0496114_0411267 3300048917 Bacteria 1198
610 Ga0496115_0002734 3300048918 Bacteria 12667
611 Ga0496115_0212934 3300048918 Bacteria 1596
612 Ga0496116_0000057 3300048919 Bacteria 281652
613 Ga0496116_0016742 3300048919 Bacteria 5722
614 Ga0496116_0020118 3300048919 Bacteria 5079
615 Ga0496116_0134513 3300048919 Bacteria 1403
616 Ga0496116_0401047 3300048919 Bacteria 607
617 Ga0496116_0425930 3300048919 Bacteria 578
618 Ga0496117_0000031 3300048920 Bacteria 381048
619 Ga0496117_0004678 3300048920 Bacteria 14866
620 Ga0496117_0017870 3300048920 Bacteria 5908
621 Ga0496117_0022715 3300048920 Bacteria 5023
622 Ga0496117_0194704 3300048920 Bacteria 1151
623 Ga0496117_0519429 3300048920 Bacteria 573
624 Ga0496118_0001884 3300048921 Bacteria 29940
625 Ga0496118_0004259 3300048921 Bacteria 17116
626 Ga0496118_0013516 3300048921 Bacteria 7712
627 Ga0496118_0017624 3300048921 Bacteria 6488
628 Ga0496118_0165226 3300048921 Bacteria 1361
629 Ga0496118_0368325 3300048921 Bacteria 759
630 Ga0496119_0032290 3300048922 Bacteria 3492
631 Ga0496119_0036562 3300048922 Bacteria 3203
632 Ga0496119_0049122 3300048922 Bacteria 2611
633 Ga0496119_0053854 3300048922 Bacteria 2454
634 Ga0496119_0081628 3300048922 Bacteria 1861
635 Ga0496119_0091575 3300048922 Bacteria 1726
636 Ga0496119_0278767 3300048922 Bacteria 832
637 Ga0496120_0001817 3300048923 Bacteria 23874
638 Ga0496120_0003907 3300048923 Bacteria 13026
639 Ga0496120_0014950 3300048923 Bacteria 5143
640 Ga0496120_0021746 3300048923 Bacteria 4046
641 Ga0496120_0043423 3300048923 Bacteria 2619
642 Ga0496120_0056595 3300048923 Bacteria 2212
643 Ga0496121_0000034 3300048924 Bacteria 377095
644 Ga0496121_0005856 3300048924 Bacteria 15572
645 Ga0496121_0008693 3300048924 Bacteria 11856
646 Ga0496121_0020154 3300048924 Bacteria 6620
647 Ga0496121_0030144 3300048924 Bacteria 4990
648 Ga0496121_0048825 3300048924 Bacteria 3596
649 Ga0496121_0072725 3300048924 Bacteria 2759
650 Ga0496121_0102152 3300048924 Bacteria 2209
651 Ga0496121_0319092 3300048924 Bacteria 1047
652 Ga0496121_0490596 3300048924 Bacteria 782
653 Ga0496122_0000023 3300048925 Bacteria 381035
654 Ga0496122_0000074 3300048925 Bacteria 219900
655 Ga0496122_0002284 3300048925 Bacteria 27720
656 Ga0496122_0020124 3300048925 Bacteria 6055
657 Ga0496122_0032494 3300048925 Bacteria 4313
658 Ga0496122_0061360 3300048925 Bacteria 2760
659 Ga0496123_0000027 3300048926 Bacteria 306773
660 Ga0496123_0000062 3300048926 Bacteria 219882
661 Ga0496123_0000290 3300048926 Bacteria 98053
662 Ga0496123_0017802 3300048926 Bacteria 5691
663 Ga0496123_0031088 3300048926 Bacteria 3892
664 Ga0496123_0044983 3300048926 Bacteria 3012
665 Ga0496123_0053721 3300048926 Bacteria 2660
666 Ga0496123_0073264 3300048926 Bacteria 2125
667 Ga0496123_0096986 3300048926 Bacteria 1729
668 Ga0496124_0008017 3300048927 Bacteria 11111
669 Ga0496124_0009644 3300048927 Bacteria 9889
670 Ga0496124_0013702 3300048927 Bacteria 7897
671 Ga0496124_0026371 3300048927 Bacteria 5241
672 Ga0496124_0039353 3300048927 Bacteria 4099
673 Ga0496124_0041824 3300048927 Bacteria 3950
674 Ga0496124_0083621 3300048927 Bacteria 2618
675 Ga0496124_0106942 3300048927 Bacteria 2258
676 Ga0496124_0215472 3300048927 Bacteria 1449
677 Ga0496124_0406245 3300048927 Bacteria 943
678 Ga0496125_0000030 3300048928 Bacteria 375023
679 Ga0496125_0003346 3300048928 Bacteria 19530
680 Ga0496125_0014218 3300048928 Bacteria 7760
681 Ga0496125_0044581 3300048928 Bacteria 3748
682 Ga0496125_0047815 3300048928 Bacteria 3573
683 Ga0496125_0097190 3300048928 Bacteria 2183
684 Ga0496125_0133085 3300048928 Bacteria 1746
685 Ga0496125_0337932 3300048928 Bacteria 905
686 Ga0496125_0415778 3300048928 Bacteria 781
687 Ga0496126_0002222 3300048929 Bacteria 26858
688 Ga0496126_0004878 3300048929 Bacteria 15705
689 Ga0496126_0009461 3300048929 Bacteria 10344
690 Ga0496126_0034327 3300048929 Bacteria 4764
691 Ga0496126_0081220 3300048929 Bacteria 2866
692 Ga0496126_0091895 3300048929 Bacteria 2667
693 Ga0496126_0192147 3300048929 Bacteria 1728
694 Ga0496126_0251933 3300048929 Bacteria 1471
695 Ga0496126_0253787 3300048929 Bacteria 1464
696 Ga0496126_1240570 3300048929 Bacteria 546
697 Ga0495678_016040 3300049459 Bacteria 3437
698 Ga0495678_016669 3300049459 Bacteria 3352
699 Ga0495678_018645 3300049459 Bacteria 3115
700 Ga0495682_0007963 3300049460 Bacteria 4190
701 Ga0501034_1010067 3300049571 Bacteria 715
702 Ga0501036_0075608 3300049572 Bacteria 2848
703 Ga0501038_0035627 3300049574 Bacteria 4368
704 Ga0501039_0058415 3300049575 Bacteria 2988
705 Ga0501040_0440760 3300049576 Bacteria 937
706 Ga0501043_0161588 3300049579 Bacteria 1750
707 Ga0501046_0139157 3300049580 Bacteria 1838
708 Ga0501047_0174214 3300049581 Bacteria 2020
709 Ga0501048_0047427 3300049582 Bacteria 3066
710 Ga0501067_0330681 3300049583 Bacteria 849
711 Ga0501067_0512461 3300049583 Bacteria 671
712 Ga0501073_0255407 3300049589 Bacteria 1210
713 Ga0501074_1003793 3300049590 Bacteria 587
714 Ga0501080_0226294 3300049742 Bacteria 1710
715 Ga0501083_0089443 3300049744 Bacteria 2034
716 Ga0501280_001760 3300049776 Bacteria 3806
717 Ga0501035_0213079 3300049822 Bacteria 1652
718 nmdc:mga03683_10202_c1 3300050489 Bacteria 3364
719 nmdc:mga03n38_136758_c1 3300050490 Bacteria 1220
720 nmdc:mga03n38_74528_c1 3300050490 Bacteria 1579
721 nmdc:mga00v17_211955_c1 3300050491 Bacteria 1253
722 nmdc:mga00v17_285428_c1 3300050491 Bacteria 1072
723 nmdc:mga00v17_330716_c1 3300050491 Bacteria 990
724 nmdc:mga00v17_360_c1 3300050491 Bacteria 25745
725 nmdc:mga00v17_378440_c1 3300050491 Bacteria 920
726 nmdc:mga00v17_4292_c1 3300050491 Bacteria 7401
727 nmdc:mga00v17_439014_c1 3300050491 Bacteria 848
728 nmdc:mga00v17_75888_c2 3300050491 Bacteria 1601
729 nmdc:mga0yw44_13168_c1 3300050492 Bacteria 4345
730 nmdc:mga0yw44_180104_c1 3300050492 Bacteria 1391
731 nmdc:mga0yw44_456761_c1 3300050492 Bacteria 866
732 nmdc:mga0yw44_6773_c1 3300050492 Bacteria 5568
733 nmdc:mga0k408_176025_c1 3300050493 Bacteria 1275
734 nmdc:mga0k408_437589_c1 3300050493 Bacteria 777
735 nmdc:mga0k408_68217_c1 3300050493 Bacteria 2074
736 nmdc:mga0k408_794579_c1 3300050493 Bacteria 552
737 nmdc:mga06z11_137765_c1 3300050494 Bacteria 1377
738 nmdc:mga06z11_174112_c1 3300050494 Bacteria 1237
739 nmdc:mga06z11_372201_c1 3300050494 Bacteria 857
740 nmdc:mga06z11_423545_c1 3300050494 Bacteria 803
741 nmdc:mga04h51_85095_c1 3300050495 Bacteria 1129
742 nmdc:mga04h51_99504_c1 3300050495 Bacteria 1058
743 nmdc:mga07m45_2146_c1 3300050496 Bacteria 2716
744 nmdc:mga07m45_698220_c1 3300050496 Bacteria 584
745 nmdc:mga0sz30_1057_c1 3300050516 Bacteria 9929
746 nmdc:mga0sz30_14896_c1 3300050516 Bacteria 3067
747 nmdc:mga0sz30_273541_c1 3300050516 Bacteria 752
748 nmdc:mga0sz30_33473_c1 3300050516 Bacteria 2136
749 nmdc:mga0sz30_40559_c1 3300050516 Bacteria 1957
750 Ga0500610_0036361 3300053079 Bacteria 2531
751 Ga0500610_0070121 3300053079 Bacteria 1828
752 Ga0495655_0015995 3300053083 Bacteria 1607
753 Ga0495619_0082511 3300053085 Bacteria 2167
754 Ga0500644_0004951 3300053088 Bacteria 3350
755 Ga0500560_000732 3300053107 Bacteria 4959
756 Ga0500569_021327 3300053109 Bacteria 1711
757 Ga0500594_0001734 3300053118 Bacteria 4745
758 Ga0500594_0135948 3300053118 Bacteria 782
759 Ga0500594_0151021 3300053118 Bacteria 746
760 Ga0500607_258895 3300053121 Bacteria 684
761 Ga0500608_034722 3300053122 Bacteria 2403
762 Ga0500618_000862 3300053125 Bacteria 16226
763 Ga0500618_003034 3300053125 Bacteria 5964
764 Ga0500618_009427 3300053125 Bacteria 2665
765 Ga0500658_0000112 3300053134 Bacteria 38407
766 Ga0500559_0002392 3300053136 Bacteria 9741
767 Ga0500561_0000170 3300053137 Bacteria 12023
768 Ga0500568_0001609 3300053139 Bacteria 14286
769 Ga0500568_0116614 3300053139 Bacteria 996
770 Ga0500568_0145161 3300053139 Bacteria 879
771 Ga0500573_0001302 3300053140 Bacteria 11807
772 Ga0500573_0237604 3300053140 Bacteria 947
773 Ga0500577_0467478 3300053142 Bacteria 551
774 Ga0500590_024567 3300053148 Bacteria 3127
775 Ga0500604_0010862 3300053151 Bacteria 2440
776 Ga0500616_0002690 3300053153 Bacteria 14450
777 Ga0500616_0048868 3300053153 Bacteria 2241
778 Ga0500616_0136208 3300053153 Bacteria 1153
779 Ga0500622_0001156 3300053156 Bacteria 21912
780 Ga0500622_0001966 3300053156 Bacteria 15471
781 Ga0500622_0036863 3300053156 Bacteria 2555
782 Ga0500624_000401 3300053157 Bacteria 13438
783 Ga0500627_0115000 3300053158 Bacteria 1212
784 Ga0500634_0001225 3300053161 Bacteria 9685
785 Ga0500634_0004081 3300053161 Bacteria 6672
786 Ga0587091_099795 3300059511 Bacteria 679
787 Ga0587072_015315 3300059643 Bacteria 1301
788 Ga0501082_0055900 3300060353 Bacteria 3399
789 2503199089 2503198000 Bacteria 6884444
790 2509109489 2508501122 Bacteria 6292184
791 2509116619 2508501123 Bacteria 6283661
792 2509370067 2509276018 Bacteria 6910194
793 2509378201 2509276019 Bacteria 6802256
794 2509394039 2509276022 Bacteria 6200534
795 2510135185 2510065019 Bacteria 6903379
796 2510305358 2510065057 Bacteria 6649661
797 2510318290 2510065059 Bacteria 6847884
798 2510843661 2510461069 Bacteria 5505000
799 2510896636 2510461076 Bacteria 8618824
800 2511132093 2510917022 Bacteria 6504556
801 2511183936 2510917028 Bacteria 6185411
802 2511503226 2511231052 Bacteria 6974333
803 2512534497 2512047086 Bacteria 6850303
804 2512973692 2512875026 Bacteria 6861065
805 2513571562 2513237084 Bacteria 7231967
806 2513578602 2513237085 Bacteria 7695351
807 2513586098 2513237086 Bacteria 7265287
808 2513598141 2513237088 Bacteria 6927906
809 2513601790 2513237089 Bacteria 6553624
810 2513613313 2513237090 Bacteria 7096802
811 2513615616 2513237091 Bacteria 6900273
812 2513630215 2513237093 Bacteria 7545552
813 2513711287 2513237103 Bacteria 7647401
814 2513869177 2513237138 Bacteria 7368160
815 2513884191 2513237140 Bacteria 7076289
816 2513903520 2513237143 Bacteria 6664116
817 2513912321 2513237144 Bacteria 7530820
818 2513928494 2513237146 Bacteria 7166346
819 2513984065 2513237156 Bacteria 6402557
820 2513998547 2513237159 Bacteria 6810126
821 2514003626 2513237160 Bacteria 6650282
822 2514019332 2513237162 Bacteria 7468464
823 2514035669 2513237164 Bacteria 7563725
824 2514418073 2513237305 Bacteria 7293571
825 2515114340 2515075009 Bacteria 7288508
826 2515610964 2515154107 Bacteria 6795637
827 2515636259 2515154113 Bacteria 7807172
828 2515643247 2515154114 Bacteria 7848616
829 2515657714 2515154116 Bacteria 7552979
830 2515741528 2515154134 Bacteria 7220242
831 2516205494 2516143018 Bacteria 6951533
832 2516894657 2516653046 Bacteria 6989037
833 2517037983 2516653077 Bacteria 7555578
834 2517078251 2516653085 Bacteria 7346596
835 2517097016 2517093000 Bacteria 7412387
836 2517408599 2517287029 Bacteria 6905599
837 2517571305 2517487022 Bacteria 7227575
838 2524450551 2524023207 Bacteria 6813453
839 2524458404 2524023209 Bacteria 6679728
840 2535518955 2534681796 Bacteria 7146037
841 2537876645 2537561587 Bacteria 5425293
842 2551675886 2551306084 Bacteria 8942552
843 2551689614 2551306085 Bacteria 7347181
844 2551693319 2551306086 Bacteria 6843938
845 2551703302 2551306087 Bacteria 7351905
846 2551709409 2551306089 Bacteria 7162724
847 2551723759 2551306090 Bacteria 7953713
848 2551727295 2551306091 Bacteria 7086830
849 2551734705 2551306092 Bacteria 6992595
850 2551741023 2551306093 Bacteria 7064773
851 2554248810 2554235003 Bacteria 5877155
852 2559295898 2558860242 Bacteria 5568029
853 2561467054 2558860983 Bacteria 4133860
854 2585166784 2582581283 Bacteria 6030556
855 2585201802 2582581294 Bacteria 6626667
856 2585228802 2582581299 Bacteria 6518058
857 2585266868 2582581306 Bacteria 6450535
858 2585271605 2582581307 Bacteria 6597605
859 2585280668 2582581308 Bacteria 7413247
860 2585326453 2582581315 Bacteria 7318924
861 2585334209 2582581316 Bacteria 7774528
862 2585387911 2582581865 Bacteria 6644329
863 2585396006 2582581866 Bacteria 6859583
864 2585399687 2582581867 Bacteria 7184437
865 2585526106 2585427526 Bacteria 7258840
866 2585531602 2585427527 Bacteria 7273426
867 2585540719 2585427528 Bacteria 6842387
868 2585551451 2585427530 Bacteria 7383882
869 2585563155 2585427531 Bacteria 6992870
870 2585820774 2585427590 Bacteria 6824633
871 2585838988 2585427593 Bacteria 7141551
872 2585902793 2585427608 Bacteria 6544331
873 2585907374 2585427609 Bacteria 6667127
874 2587982632 2585428125 Bacteria 6662905
875 2588519586 2588253730 Bacteria 6881675
876 2599335031 2599185156 Bacteria 5403036
877 2599420206 2599185170 Bacteria 7295545
878 2599603310 2599185210 Bacteria 5624189
879 2599720273 2599185236 Bacteria 6875203
880 2599937021 2599185301 Bacteria 6161860
881 2600193462 2599185352 Bacteria 7228948
882 2600373292 2600254933 Bacteria 4750527
883 2601610784 2600255279 Bacteria 5605316
884 2601747558 2600255308 Bacteria 5611129
885 2616306787 2615840626 Bacteria 7921970
886 2616557639 2615840698 Bacteria 7319877
887 2617383307 2617270742 Bacteria 6808054
888 2643808153 2643221557 Bacteria 7184309
889 2643813697 2643221558 Bacteria 5460675
890 2643855026 2643221568 Bacteria 5187270
891 2643921423 2643221582 Bacteria 5804683
892 2643988465 2643221595 Bacteria 6565519
893 2644002408 2643221599 Bacteria 6292121
894 2644051981 2643221607 Bacteria 6314006
895 2644068658 2643221610 Bacteria 7480339
896 2644110063 2643221618 Bacteria 7717186
897 2644150339 2643221626 Bacteria 8069654
898 2644154618 2643221627 Bacteria 6761570
899 2644194884 2643221634 Bacteria 6705461
900 2644201463 2643221636 Bacteria 6583769
901 2644209414 2643221637 Bacteria 5345260
902 2644240565 2643221643 Bacteria 5749658
903 2644299937 2643221653 Bacteria 4569637
904 2644312943 2643221655 Bacteria 7722067
905 2644336491 2643221659 Bacteria 7890716
906 2644379587 2643221668 Bacteria 7306521
907 2644419727 2643221675 Bacteria 7473456
908 2644453084 2643221680 Bacteria 7473610
909 2644484433 2643221686 Bacteria 6310811
910 2644492444 2643221688 Bacteria 5260751
911 2644499836 2643221689 Bacteria 6042950
912 2644521476 2643221693 Bacteria 5513853
913 2644546137 2643221698 Bacteria 7756764
914 2644618673 2643221712 Bacteria 7729434
915 2644652942 2643221718 Bacteria 5345506
916 2644658164 2643221719 Bacteria 4568197
917 2644677181 2643221723 Bacteria 7095460
918 2644688887 2643221726 Bacteria 7455827
919 2657682512 2657244999 Bacteria 5946535
920 2671113533 2667528174 Bacteria 6435400
921 2688596363 2687453392 Bacteria 6880454
922 2692319971 2690316117 Bacteria 6800650
923 2694630166 2693429783 Bacteria 7019804
924 2723028562 2721755556 Bacteria 6745503
925 2723573483 2721755686 Bacteria 7343952
926 2725947473 2724679232 Bacteria 7646494
927 2730109498 2728369352 Bacteria 6745171
928 2738947575 2738541317 Bacteria 5340176
929 2739037215 2738541333 Bacteria 7106503
930 2753463724 2751185821 Bacteria 6189929
931 2756673752 2756170246 Bacteria 7451806
932 2766064336 2765235942 Bacteria 7445910
933 2776915420 2775507049 Bacteria 6284736
934 2778173694 2775507266 Bacteria 7392367
935 2792582137 2791355082 Bacteria 5973319
936 2792622002 2791355091 Bacteria 6135441
937 2792628741 2791355092 Bacteria 6248105
938 2792641331 2791355094 Bacteria 7011481
939 2792747611 2791355123 Bacteria 8049106
940 2793281109 2791355253 Bacteria 5171699
941 2793359457 2791355266 Bacteria 7116587
942 2802717328 2802428858 Bacteria 6636079
943 2802724683 2802428859 Bacteria 6667919
944 2802729435 2802428860 Bacteria 6525526
945 2802736780 2802428861 Bacteria 6534206
946 2802743186 2802428862 Bacteria 6633353
947 2802749688 2802428863 Bacteria 6410669
948 2804753597 2802429268 Bacteria 6094027
949 2806047306 2802429633 Bacteria 7341974
950 2806054161 2802429634 Bacteria 7083200
951 2806060255 2802429635 Bacteria 7650140
952 2806068866 2802429636 Bacteria 7597525
953 2806077191 2802429637 Bacteria 7067217
954 2808988278 2808606387 Bacteria 5697198
955 2819244720 2818991272 Bacteria 4622173
956 2819560908 2818991439 Bacteria 6907412
957 2819611184 2818991448 Bacteria 6772224
958 2819638881 2818991453 Bacteria 7181617
959 2821128661 2821123053 Bacteria 7836056
960 2837651320 2837651117 Bacteria 3772164
961 2838030877 2838029111 Bacteria 6603031
962 2838040412 2838035591 Bacteria 7166484
963 2838048409 2838042994 Bacteria 6046894
964 2838078266 2838074704 Bacteria 6785777
965 2838667826 2838661181 Bacteria 7385261
966 2838678729 2838675328 Bacteria 4909118
967 2838683955 2838680041 Bacteria 6545511
968 2838690215 2838686498 Bacteria 7807632
969 2838698484 2838694306 Bacteria 6853137
970 2838711599 2838707686 Bacteria 6619912
971 2838718182 2838714209 Bacteria 5525906
972 2838723026 2838719591 Bacteria 5523910
973 2838728249 2838724970 Bacteria 4908691
974 2838731990 2838729681 Bacteria 7400765
975 2838741678 2838736955 Bacteria 5760694
976 2838744886 2838742623 Bacteria 7396178
977 2839993311 2839993093 Bacteria 5512535
978 2841845488 2841840854 Bacteria 5761912
979 2841850582 2841846520 Bacteria 5345850
980 2841855943 2841851746 Bacteria 7532261
981 2841863165 2841859092 Bacteria 5436171
982 2842081400 2842077413 Bacteria 6508645
983 2842116924 2842110456 Bacteria 7656360
984 2842121823 2842118031 Bacteria 7033875
985 2842128908 2842124991 Bacteria 5346824
986 2842133621 2842130223 Bacteria 4909145
987 2842145191 2842140634 Bacteria 5759631
988 2842155467 2842152218 Bacteria 4908957
989 2842161113 2842156927 Bacteria 6894975
990 2842166631 2842163707 Bacteria 6916235
991 2842174576 2842170452 Bacteria 5525737
992 2842179235 2842175837 Bacteria 4908771
993 2842184729 2842180545 Bacteria 6888678
994 2842190606 2842187318 Bacteria 5524014
995 2842215070 2842211629 Bacteria 5523832
996 2842223301 2842217011 Bacteria 7497767
997 2842227791 2842224351 Bacteria 5524473
998 2842232312 2842229732 Bacteria 7475766
999 2842240838 2842237096 Bacteria 6620661
1000 2842246727 2842243621 Bacteria 7421798
1001 2842261171 2842257432 Bacteria 7401195
1002 2842274235 2842271015 Bacteria 7807131
1003 2842295057 2842291075 Bacteria 7076806
1004 2842300340 2842298080 Bacteria 6123127
1005 2842305918 2842304105 Bacteria 7023636
1006 2842361143 2842357229 Bacteria 6485165
1007 2842374925 2842370503 Bacteria 7038661
1008 2842381456 2842377471 Bacteria 7140707
1009 2842388526 2842384541 Bacteria 7057858
1010 2842477609 2842475841 Bacteria 6603183
1011 2842487952 2842482326 Bacteria 7212537
1012 2842504518 2842502639 Bacteria 6604161
1013 2842511768 2842509118 Bacteria 6850950
1014 2842520097 2842515876 Bacteria 5436280
1015 2842524422 2842521101 Bacteria 6569494
1016 2842926220 2842922631 Bacteria 5824079
1017 2844003069 2844002411 Bacteria 7168230
1018 2844011188 2844009547 Bacteria 6728125
1019 2844164262 2844163670 Bacteria 7266046
1020 2844457087 2844454524 Bacteria 7952546
1021 2847420806 2847417321 Bacteria 6913799
1022 2847673807 2847670302 Bacteria 6165597
1023 2847690288 2847686936 Bacteria 6278406
1024 2848995631 2848992105 Bacteria 6810864
1025 2850082549 2850079185 Bacteria 6848280
1026 2852391637 2852387548 Bacteria 8025568
1027 2855827283 2855825444 Bacteria 6785811
1028 2855842665 2855839649 Bacteria 7135830
1029 2855878169 2855872281 Bacteria 6964271
1030 2856320542 2856314179 Bacteria 6477897
1031 2856328493 2856328259 Bacteria 6528202
1032 2856341453 2856334872 Bacteria 7037011
1033 2856353542 2856349417 Bacteria 6230045
1034 2856363509 2856356410 Bacteria 6297484
1035 2856365015 2856364286 Bacteria 6939991
1036 2857353306 2857349434 Bacteria 7926032
1037 2857371909 2857367948 Bacteria 6965560
1038 2857519503 2857516855 Bacteria 7787325
1039 2857534186 2857531043 Bacteria 6754041
1040 2858803476 2858800743 Bacteria 6603254
1041 2869169006 2869162929 Bacteria 6399702
1042 2869174583 2869169390 Bacteria 6659796
1043 2869236895 2869234852 Bacteria 6654993
1044 2869246793 2869242130 Bacteria 6609239
1045 2869253457 2869249662 Bacteria 6868783
1046 2869258172 2869256925 Bacteria 6981691
1047 2869268020 2869264136 Bacteria 6880765
1048 2869276173 2869271264 Bacteria 6908218
1049 2869279539 2869278585 Bacteria 7077053
1050 2869286360 2869285874 Bacteria 6901219
1051 2871430329 2871429161 Bacteria 6547891
1052 2871442333 2871435913 Bacteria 6880295
1053 2871454263 2871451962 Bacteria 7336357
1054 2871465365 2871459585 Bacteria 6866887
1055 2871472318 2871466892 Bacteria 6923287
1056 2871486923 2871481445 Bacteria 6700002
1057 2871494887 2871488783 Bacteria 6929816
1058 2871500922 2871495908 Bacteria 6935695
1059 2874104738 2874102143 Bacteria 6342645
1060 2874115852 2874109183 Bacteria 6517025
1061 2874118239 2874116593 Bacteria 6674494
1062 2874137997 2874131515 Bacteria 6820270
1063 2874139471 2874139085 Bacteria 7021506
1064 2874146747 2874146452 Bacteria 7533118
1065 2874155820 2874155637 Bacteria 6724144
1066 2874166461 2874162495 Bacteria 6174670
1067 2874176796 2874168670 Bacteria 8062617
1068 2876370599 2876369609 Bacteria 6807521
1069 2876385308 2876377896 Bacteria 6565995
1070 2876388607 2876386047 Bacteria 6698674
1071 2876399268 2876392853 Bacteria 6660880
1072 2876402294 2876399893 Bacteria 6927900
1073 2876409448 2876406927 Bacteria 6191900
1074 2876414149 2876413966 Bacteria 6831344
1075 2876427306 2876420981 Bacteria 6687741
1076 2878038957 2878035449 Bacteria 6555736
1077 2878742065 2878738818 Bacteria 7136951
1078 2878746525 2878745973 Bacteria 6867388
1079 2878760012 2878753008 Bacteria 6922523
1080 2878764969 2878760144 Bacteria 6823465
1081 2878772113 2878767105 Bacteria 6898628
1082 2878778878 2878774303 Bacteria 6108671
1083 2878786505 2878781027 Bacteria 6834456
1084 2881148583 2881147464 Bacteria 7779814
1085 2881159674 2881155292 Bacteria 6461656
1086 2881165368 2881161766 Bacteria 7127907
1087 2881852883 2881845957 Bacteria 6611900
1088 2881858572 2881853255 Bacteria 6698367
1089 2881867186 2881861095 Bacteria 7128710
1090 2882640317 2882632389 Bacteria 8154593
1091 2882916817 2882912400 Bacteria 6801539
1092 2885307226 2885305155 Bacteria 7348390
1093 2885313766 2885312484 Bacteria 6415165
1094 2885324479 2885318864 Bacteria 6729568
1095 2885332409 2885326080 Bacteria 7134805
1096 2885337564 2885334103 Bacteria 7216818
1097 2885344914 2885342637 Bacteria 7011821
1098 2885357741 2885350715 Bacteria 6787678
1099 2888337052 2888337043 Bacteria 6629336
1100 2888353578 2888350351 Bacteria 7372807
1101 2889015294 2889010040 Bacteria 6749192
1102 2889019628 2889016732 Bacteria 6700763
1103 2891051150 2891048133 Bacteria 4447501
1104 2891373845 2891373044 Bacteria 5202277
1105 2896390295 2896384573 Bacteria 7700774
1106 2899795264 2899792073 Bacteria 4926588
1107 2899808095 2899803654 Bacteria 5577784
1108 2899849245 2899845264 Bacteria 5672268
1109 2903494246 2903492973 Bacteria 13473544
1110 2903499715 2903492973 Bacteria 13473544
1111 2903517621 2903513507 Bacteria 6344008
1112 2903545737 2903540706 Bacteria 7062119
1113 2904665795 2904659560 Bacteria 6685615
1114 2906308926 2906308376 Bacteria 6841989
1115 2906322207 2906321335 Bacteria 6579571
1116 2906333851 2906328253 Bacteria 6585166
1117 2906362035 2906354277 Bacteria 6991324
1118 2906364421 2906363423 Bacteria 6856682
1119 2906371869 2906370794 Bacteria 6881062
1120 2906393202 2906386501 Bacteria 5977019
1121 2906395619 2906393657 Bacteria 6790866
1122 2906405462 2906401398 Bacteria 6693206
1123 2906410059 2906408224 Bacteria 6162342
1124 2906421321 2906414383 Bacteria 6580790
1125 2906434899 2906427513 Bacteria 6375796
1126 2913300075 2913295892 Bacteria 6333755
1127 2913312484 2913308742 Bacteria 5350706
1128 2915982543 2915980308 Bacteria 6624279
1129 2915988260 2915986958 Bacteria 6739310
1130 2915994496 2915993759 Bacteria 7016183
1131 2916007067 2916000859 Bacteria 6865702
1132 2916008750 2916007675 Bacteria 6898660
1133 2916015254 2916014648 Bacteria 6946486
1134 2916024398 2916021584 Bacteria 6854472
1135 2916031237 2916028427 Bacteria 6748433
1136 2916037663 2916035215 Bacteria 6755766
1137 2916047503 2916041962 Bacteria 6820487
1138 2916051728 2916048683 Bacteria 6543552
1139 2916058427 2916055098 Bacteria 6758838
1140 2916066205 2916061851 Bacteria 6737736
1141 2916075307 2916068649 Bacteria 6943657
1142 2916082046 2916076590 Bacteria 6596108
1143 2919105326 2919100787 Bacteria 7710546
1144 2919118560 2919114240 Bacteria 5700270
1145 2919170640 2919166419 Bacteria 4952238
1146 2919411009 2919408235 Bacteria 6149349
1147 2920760447 2920760137 Bacteria 7427611
1148 2920825844 2920822456 Bacteria 6897201
1149 2921205897 2921201388 Bacteria 6926299
1150 2921209521 2921208531 Bacteria 6745326
1151 2921239596 2921237296 Bacteria 6876710
1152 2921245434 2921244191 Bacteria 6568419
1153 2921254554 2921250672 Bacteria 6677771
1154 2921257703 2921257292 Bacteria 6808382
1155 2921267019 2921263974 Bacteria 6864552
1156 2921285571 2921282425 Bacteria 6826397
1157 2921293166 2921289301 Bacteria 7316391
1158 2921298760 2921296804 Bacteria 7176999
1159 2922132573 2922130491 Bacteria 7173936
1160 2922157290 2922151315 Bacteria 6902399
1161 2922177056 2922172374 Bacteria 6167644
1162 2922183237 2922178524 Bacteria 6025201
1163 2922191487 2922185730 Bacteria 7113964
1164 2923559554 2923556063 Bacteria 6793593
1165 2924150567 2924144063 Bacteria 6883928
1166 2924155482 2924150972 Bacteria 7169444
1167 2924161154 2924158325 Bacteria 7188855
1168 2924169927 2924165586 Bacteria 7260590
1169 2924173346 2924172951 Bacteria 6749356
1170 2924180676 2924179722 Bacteria 6843264
1171 2924186925 2924186466 Bacteria 6876637
1172 2924193692 2924193448 Bacteria 6955718
1173 2924206569 2924200457 Bacteria 6757188
1174 2924209342 2924207177 Bacteria 6917007
1175 2924214475 2924214083 Bacteria 7080103
1176 2924226170 2924221636 Bacteria 7113495
1177 2924231761 2924228884 Bacteria 6633132
1178 2924710341 2924710171 Bacteria 6752351
1179 2924722913 2924718760 Bacteria 6331356
1180 2924737575 2924733363 Bacteria 7574837
1181 2924748186 2924741084 Bacteria 6661321
1182 2924751617 2924748358 Bacteria 6154725
1183 2924779749 2924776078 Bacteria 7492003
1184 2924790816 2924784321 Bacteria 7416538
1185 2926755090 2926754445 Bacteria 5964435
1186 2926762250 2926760298 Bacteria 5505990
1187 2929141808 2929138655 Bacteria 5810547
1188 2933010683 2933006813 Bacteria 4912075
1189 2933015643 2933011516 Bacteria 5439334
1190 2933021914 2933016740 Bacteria 6355406
1191 2933572423 2933570622 Bacteria 7023390
1192 2933593072 2933586486 Bacteria 7667493
1193 2933597616 2933594066 Bacteria 5594265
1194 2935897867 2935894831 Bacteria 6620579
1195 2935903697 2935901341 Bacteria 7341747
1196 2936369823 2936367885 Bacteria 7324495
1197 2936379010 2936375103 Bacteria 6652732
1198 2936382013 2936381700 Bacteria 7006523
1199 2936997558 2936996657 Bacteria 6298727
1200 2937009422 2937002841 Bacteria 6934057
1201 2937013675 2937009748 Bacteria 6746052
1202 2937019107 2937016420 Bacteria 6782579
1203 2937024783 2937023124 Bacteria 6815156
1204 2937034873 2937029754 Bacteria 6424026
1205 2937036098 2937036028 Bacteria 6846469
1206 2937044064 2937042894 Bacteria 6741576
1207 2937051126 2937049772 Bacteria 6757901
1208 2937062096 2937056579 Bacteria 7107896
1209 2937064802 2937063883 Bacteria 7199456
1210 2937074353 2937071275 Bacteria 6984483
1211 2937081933 2937078374 Bacteria 6610289
1212 2937086140 2937084907 Bacteria 6618516
1213 2937097720 2937091812 Bacteria 6979387
1214 2937101348 2937098957 Bacteria 7249374
1215 2937106701 2937106411 Bacteria 6947143
1216 2937119581 2937113482 Bacteria 6505872
1217 2937123160 2937119839 Bacteria 6597547
1218 2937132664 2937126314 Bacteria 6771275
1219 2937822266 2937813078 Bacteria 7783518
1220 2937823934 2937822353 Bacteria 7290551
1221 2937848640 2937843397 Bacteria 5256375
1222 2937864836 2937861824 Bacteria 6660327
1223 2937877053 2937868953 Bacteria 6639878
1224 2937880107 2937877337 Bacteria 7246526
1225 2937895206 2937891427 Bacteria 6357007
1226 2937988140 2937980651 Bacteria 6517427
1227 2937999587 2937994558 Bacteria 7036190
1228 2938018655 2938014810 Bacteria 6700592
1229 2941501259 2941499720 Bacteria 7599444
1230 2957381944 2957375807 Bacteria 6425588
1231 2957384595 2957382221 Bacteria 6737050
1232 2957391365 2957388812 Bacteria 6778072
1233 2957400516 2957395598 Bacteria 6822399
1234 2957404335 2957402308 Bacteria 6741770
1235 2957413729 2957408893 Bacteria 6558585
1236 2957416602 2957415311 Bacteria 6991633
1237 2957425730 2957422303 Bacteria 7172205
1238 2957434577 2957430029 Bacteria 7022557
1239 2957442201 2957437181 Bacteria 6568994
1240 2957447904 2957443900 Bacteria 6869977
1241 2957455047 2957450854 Bacteria 6765715
1242 2957463744 2957457609 Bacteria 6967680
1243 2957470679 2957464669 Bacteria 6568877
1244 2957473282 2957471148 Bacteria 6797643
1245 2957483962 2957478035 Bacteria 6756658
1246 2957485693 2957484790 Bacteria 6703082
1247 2957494132 2957491536 Bacteria 6695180
1248 2957502981 2957498199 Bacteria 7126688
1249 2957510130 2957505466 Bacteria 7253085
1250 2958035117 2958034702 Bacteria 6989922
1251 2958044148 2958041894 Bacteria 13082850
1252 2958046616 2958041894 Bacteria 13082850
1253 2958065755 2958064165 Bacteria 7158582
1254 2958087160 2958084443 Bacteria 7312792
1255 2958094196 2958092219 Bacteria 6861151
1256 2958104339 2958100919 Bacteria 6800575
1257 2958108402 2958108152 Bacteria 6681128
1258 2958120461 2958115193 Bacteria 6923548
1259 2958124893 2958122699 Bacteria 7280457
1260 2958130760 2958130278 Bacteria 6897202
1261 2958145600 2958144490 Bacteria 6677056
1262 2958161404 2958158011 Bacteria 6058449
1263 2958170061 2958165035 Bacteria 6906348
1264 2958176778 2958172287 Bacteria 6716688
1265 2958180098 2958179912 Bacteria 6874908
1266 2960587001 2960584000 Bacteria 6864594
1267 2960592121 2960591022 Bacteria 6622873
1268 2960599305 2960597568 Bacteria 6550735
1269 2960609671 2960603979 Bacteria 6898737
1270 2960616199 2960610863 Bacteria 6691244
1271 2960623557 2960617483 Bacteria 6727748
1272 2960624929 2960624210 Bacteria 6875384
1273 2960633517 2960631154 Bacteria 6732508
1274 2960642465 2960637947 Bacteria 7296468
1275 2960650304 2960645483 Bacteria 7211087
1276 2960654219 2960652885 Bacteria 7083688
1277 2960664287 2960660292 Bacteria 7041660
1278 2960671914 2960667422 Bacteria 6763020
1279 2960676766 2960674078 Bacteria 6609048
1280 2960687348 2960680706 Bacteria 6624464
1281 2960693233 2960687367 Bacteria 6535474
1282 2960698988 2960693952 Bacteria 6749742
1283 2961077925 2961077736 Bacteria 7079850
1284 2961121138 2961114664 Bacteria 6680456
1285 2961134371 2961127735 Bacteria 7196641
1286 2961141605 2961136820 Bacteria 6775228
1287 2961168515 2961163497 Bacteria 6901077
1288 2961177283 2961170736 Bacteria 7072258
1289 2961188928 2961183825 Bacteria 6688536
1290 2964609625 2964607997 Bacteria 7101408
1291 2964616275 2964615318 Bacteria 6809089
1292 2964622586 2964621998 Bacteria 6834995
1293 2964633284 2964628898 Bacteria 7083044
1294 2964639876 2964636051 Bacteria 7091832
1295 2964645832 2964643177 Bacteria 6820887
1296 2964654123 2964649959 Bacteria 6675118
1297 2964657403 2964656573 Bacteria 7100150
1298 2964664470 2964663802 Bacteria 7019362
1299 2964674247 2964670856 Bacteria 6851364
1300 2964683084 2964678106 Bacteria 6792020
1301 2964685543 2964685014 Bacteria 6839111
1302 2964694619 2964691889 Bacteria 6802758
1303 2964700770 2964698721 Bacteria 6765331
1304 2964707907 2964705432 Bacteria 7114648
1305 2964712886 2964712639 Bacteria 6695970
1306 2964725042 2964719344 Bacteria 7286602
1307 2965023335 2965018300 Bacteria 6883036
1308 2965031026 2965025482 Bacteria 6532201
1309 2965032183 2965032056 Bacteria 6887443
1310 2965045829 2965040258 Bacteria 6855979
1311 2965050784 2965047637 Bacteria 6623551
1312 2965065706 2965062239 Bacteria 7412989
1313 2965095267 2965089291 Bacteria 6866420
1314 2965103395 2965102966 Bacteria 6800987
1315 2965111373 2965110997 Bacteria 6693150
1316 2965121122 2965119406 Bacteria 6956431
1317 2967667800 2967664464 Bacteria 6948836
1318 2967673514 2967671571 Bacteria 7021409
1319 2967680876 2967678726 Bacteria 7264382
1320 2967687599 2967686174 Bacteria 6678622
1321 2967695373 2967693043 Bacteria 6804451
1322 2967700444 2967699805 Bacteria 6854538
1323 2967711411 2967706974 Bacteria 7186053
1324 2967718867 2967714385 Bacteria 7000047
1325 2967722582 2967721400 Bacteria 7073753
1326 2967733678 2967728569 Bacteria 6641507
1327 2967739023 2967735183 Bacteria 6827012
1328 2967742588 2967742019 Bacteria 6794534
1329 2967749873 2967748971 Bacteria 6733771
1330 2967756311 2967755722 Bacteria 6814706
1331 2967768121 2967762386 Bacteria 6923502
1332 2967775310 2967769361 Bacteria 6587838
1333 2967777522 2967775926 Bacteria 6738189
1334 2968002386 2967996073 Bacteria 6787468
1335 2968009617 2968003550 Bacteria 6929263
1336 2968023537 2968016561 Bacteria 7022047
1337 2968093137 2968091066 Bacteria 6052692
1338 2968102440 2968097103 Bacteria 6107094
1339 2968117288 2968110612 Bacteria 6814636
1340 2968122286 2968117919 Bacteria 6536078
1341 2968132043 2968128360 Bacteria 6270294
1342 2968141743 2968138860 Bacteria 6605449
1343 2968176923 2968171901 Bacteria 6894245
1344 2970020970 2970019648 Bacteria 7072033
1345 2970029847 2970026789 Bacteria 6785236
1346 2970034253 2970033650 Bacteria 7118744
1347 2970047654 2970040964 Bacteria 6731123
1348 2970048435 2970047711 Bacteria 7088379
1349 2970059429 2970054988 Bacteria 6611507
1350 2970062356 2970061556 Bacteria 7099761
1351 2970075562 2970068827 Bacteria 7123112
1352 2970078757 2970076120 Bacteria 6697332
1353 2970086370 2970082768 Bacteria 6183754
1354 2970093647 2970088815 Bacteria 6933825
1355 2970096491 2970095765 Bacteria 6936963
1356 2970108979 2970102677 Bacteria 6812532
1357 2970114130 2970109326 Bacteria 6863976
1358 2970122352 2970116247 Bacteria 6501857
1359 2970123842 2970122695 Bacteria 6625855
1360 2970133728 2970129317 Bacteria 6806560
1361 2970138160 2970136068 Bacteria 7207982
1362 2970143716 2970143518 Bacteria 6446480
1363 2970153343 2970149975 Bacteria 6779706
1364 2970163697 2970156795 Bacteria 7168044
1365 2970167212 2970164137 Bacteria 6861252
1366 2970175014 2970170962 Bacteria 6876229
1367 2970178821 2970177841 Bacteria 6768001
1368 2970186911 2970184632 Bacteria 7054431
1369 2970196564 2970191845 Bacteria 7032787
1370 2970476119 2970469710 Bacteria 6969209
1371 2970490765 2970489779 Bacteria 6517260
1372 2970509957 2970503327 Bacteria 7099517
1373 2970511858 2970510686 Bacteria 7006402
1374 2970537234 2970532167 Bacteria 6553173
1375 2970552129 2970547951 Bacteria 6931819
1376 2970559817 2970554993 Bacteria 6814252
1377 2970594139 2970593180 Bacteria 7073582
1378 2970623945 2970619444 Bacteria 6986144
1379 2970630142 2970627176 Bacteria 6680862
1380 2977517323 2977516862 Bacteria 6940108
1381 2977525426 2977523885 Bacteria 6960446
1382 2977535196 2977530762 Bacteria 6951399
1383 2977540278 2977537788 Bacteria 6929320
1384 2977550410 2977544691 Bacteria 6875412
1385 2977558972 2977551784 Bacteria 7125765
1386 2977559692 2977558990 Bacteria 6863948
1387 2977570308 2977565890 Bacteria 6901543
1388 2977577461 2977572785 Bacteria 6763888
1389 2977585492 2977579622 Bacteria 6772100
1390 2977828534 2977821940 Bacteria 6906439
1391 2977829662 2977828996 Bacteria 7007971
1392 2977844238 2977843712 Bacteria 6753583
1393 2977855444 2977851361 Bacteria 6694324
1394 2977859643 2977858184 Bacteria 6215359
1395 2977865541 2977864932 Bacteria 7534097
1396 2977879469 2977872689 Bacteria 7270173
1397 2977898831 2977898635 Bacteria 6675551
1398 2977908451 2977907340 Bacteria 6577984
1399 2977917611 2977915119 Bacteria 6829656
1400 2977929465 2977922695 Bacteria 6956781
1401 2977935803 2977935797 Bacteria 6252826
1402 2977942360 2977942078 Bacteria 7570577
1403 2977954590 2977950692 Bacteria 6893264
1404 2977960966 2977957713 Bacteria 6877875
1405 2977988069 2977986579 Bacteria 6581278
1406 2978972550 2978969890 Bacteria 5400756
1407 2979092480 2979089926 Bacteria 5670289
1408 2979100129 2979095461 Bacteria 5669583
1409 2979104451 2979100975 Bacteria 5423623
1410 2979711578 2979710463 Bacteria 6785254
1411 2979751870 2979742915 Bacteria 7301278
1412 2979769346 2979764755 Bacteria 6610066
1413 2979776589 2979772303 Bacteria 6618277
1414 2979781371 2979779861 Bacteria 6219781
1415 2979800560 2979793036 Bacteria 6808957
1416 2979814833 2979808191 Bacteria 7179355
1417 2984513753 2984509177 Bacteria 5274802
1418 2984522669 2984518228 Bacteria 5277463
1419 2984541975 2984537506 Bacteria 5277481
1420 2984590803 2984587000 Bacteria 5263363
1421 2984601405 2984601300 Bacteria 5455244
1422 2987641899 2987636660 Bacteria 8088555
1423 2987648588 2987645492 Bacteria 6117018
1424 2987653451 2987652177 Bacteria 6969023
1425 2987664538 2987659509 Bacteria 6966464
1426 2987678118 2987673487 Bacteria 6884027
1427 2989354837 2989349275 Bacteria 6349068
1428 2989771505 2989771324 Bacteria 5605128
1429 2989780022 2989776772 Bacteria 4843317
1430 2995394778 2995392953 Bacteria 4539380
1431 2996354699 2996348954 Bacteria 7239054
1432 2996389895 2996386984 Bacteria 6978667
1433 2996890177 2996887358 Bacteria 5795980
1434 2996895219 2996893221 Bacteria 5823108
1435 3000137758 3000135777 Bacteria 6891109
1436 3003930919 3003930520 Bacteria 5667563
1437 3004173697 3004167301 Bacteria 8330599
1438 3004193592 3004188549 Bacteria 6952365
1439 3004202174 3004195979 Bacteria 6776956
1440 3004209290 3004203850 Bacteria 7307914
1441 3004236608 3004232784 Bacteria 6662140
1442 3004244379 3004239961 Bacteria 6892290
1443 3004249476 3004248173 Bacteria 6563236
1444 3004275373 3004268573 Bacteria 7043476
1445 3004281347 3004275668 Bacteria 7114440
1446 3004290429 3004289098 Bacteria 6135450
1447 3004336839 3004334049 Bacteria 8449246
1448 3005415734 3005409236 Bacteria 7188837
1449 3005421681 3005416602 Bacteria 7064308
1450 639650370 639633055 Bacteria 7751309
1451 643827402 643692032 Bacteria 6891900
1452 648737105 648276728 Bacteria 6968865
1453 649870914 649633066 Bacteria 6690028
1454 650741112 650716007 Bacteria 5573770
1455 8003573829 8003570095 Bacteria 5747666
1456 8003995247 8003992118 Bacteria 7266902
1457 8004002965 8003999396 Bacteria 7063185
1458 8004306798 8004300914 Bacteria 6132239
1459 8004315209 8004312739 Bacteria 7444653
1460 8004367049 8004361976 Bacteria 6858373
1461 8004381511 8004374579 Bacteria 6898112
1462 8004388560 8004387939 Bacteria 7049250
1463 8004447660 8004445564 Bacteria 6322258
1464 8004646448 8004640170 Bacteria 6723001
1465 8004700703 8004695233 Bacteria 6731676
1466 8004706381 8004703790 Bacteria 8006957
1467 8004715182 8004714634 Bacteria 6776161
1468 8004731309 8004727605 Bacteria 6643904
1469 8005249165 8005246636 Bacteria 4933972
1470 8005262361 8005258706 Bacteria 6184835
1471 8005313636 8005307578 Bacteria 7395396
1472 8005319615 8005314921 Bacteria 7072929
1473 8005324704 8005321885 Bacteria 5795980
1474 8005381632 8005376324 Bacteria 6590079
1475 8005465031 8005460587 Bacteria 7157962
1476 8005490237 8005484373 Bacteria 6297373
1477 8005546605 8005542996 Bacteria 7077758
1478 8005561104 8005556819 Bacteria 6908598
1479 8005565730 8005563573 Bacteria 7153261
1480 8005571782 8005570704 Bacteria 6957481
1481 8005646894 8005645114 Bacteria 6950293
1482 8005660753 8005658619 Bacteria 4500593
1483 8018128849 8018127388 Bacteria 7351159
1484 8018155120 8018150411 Bacteria 5549903
1485 8018165160 8018163183 Bacteria 7277977
1486 8023686474 8023680758 Bacteria 7729763
1487 8024484302 8024479707 Bacteria 6954785
1488 8024490793 8024486573 Bacteria 6540512
1489 8046768088 8046767195 Bacteria 7547379
1490 8049296166 8049293176 Bacteria 6128433
1491 8054560173 8054558443 Bacteria 5204801
1492 8055435633 8055431914 Bacteria 4551896
1493 8056878182 8056875544 Bacteria 4355797
1494 8057581553 8057575449 Bacteria 7367519
1495 8057879222 8057874678 Bacteria 7494653
1496 Ga0395905_0001126
1497 RicEn_FSXC42840_b1
1498 JGI24740J21852_10000013
1499 JGI24740J21852_10003324
1500 JGI24737J22298_10257894
1501 JGI25155J39150_1000010
1502 JGI25156J39149_1000102
1503 JGI25156J39149_1008662
1504 JGI25162J39368_1000879
1505 JGI25154J39366_1000184
1506 JGI25158J39367_1000526
1507 JGI25158J39367_1020635
1508 JGI25157J39369_1000009
1509 JGI25157J39369_1000842
1510 JGI25152J39213_1002498
1511 JGI25152J39213_1003827
1512 JGI25152J39213_1016049
1513 JGI25150J39212_1012970
1514 JGI25159J45721_1000053
1515 JGI25159J45721_1009500
1516 JGI25151J46595_10001525
1517 JGI25151J46595_10005265
1518 JGI25151J46595_10010648
1519 JGI25151J46595_10014524
1520 JGI25165J46597_1000273
1521 JGI25165J46597_1001977
1522 JGI25153J46596_10070568
1523 JGI25153J46596_10075202
1524 rootH2_10104045
1525 rootL2_10029472
1526 rootH1_10215066
1527 JGI25160J50197_1000168
1528 JGI25160J50197_1000235
1529 JGI25160J50197_1018219
1530 JGI25161J50226_1000175
1531 JGI25161J50226_1001177
1532 Ga0055539_1014238
1533 Ga0055526_1002546
1534 Ga0055526_1002690
1535 Ga0055526_1010815
1536 Ga0055526_1017168
1537 Ga0055526_1018522
1538 Ga0055524_1002053
1539 Ga0055524_1003375
1540 Ga0055524_1007952
1541 Ga0055524_1009037
1542 Ga0055524_1017569
1543 Ga0055524_1018474
1544 Ga0055524_1037117
1545 Ga0055536_1002743
1546 Ga0055528_1000369
1547 Ga0055528_1001991
1548 Ga0055528_1005279
1549 Ga0055528_1017003
1550 Ga0055528_1035258
1551 Ga0055530_10015001
1552 Ga0055540_1013494
1553 Ga0055540_1015856
1554 Ga0055531_10003576
1555 Ga0055531_10064627
1556 Ga0058692_1002172
1557 Ga0058692_1006673
1558 Ga0058692_1007029
1559 Ga0058692_1028227
1560 Ga0055543_1000226
1561 Ga0055543_1000412
1562 Ga0065165_1000133
1563 Ga0065165_1002250
1564 Ga0065165_1005266
1565 Ga0065165_1052669
1566 Ga0065704_10763127
1567 Ga0065715_10853871
1568 Ga0070658_10344666
1569 Ga0070658_10386302
1570 Ga0070670_100000183
1571 Ga0068869_100309951
1572 Ga0070680_100027990
1573 Ga0070682_100000791
1574 Ga0070660_100045414
1575 Ga0070660_100153690
1576 Ga0070691_10016489
1577 Ga0070661_100705424
1578 Ga0070692_10111921
1579 Ga0070668_100334991
1580 Ga0070668_100449344
1581 Ga0070668_100517355
1582 Ga0070668_101286691
1583 Ga0070668_101341896
1584 Ga0070669_100374603
1585 Ga0070671_100173508
1586 Ga0070674_100768454
1587 Ga0070659_100081160
1588 Ga0070659_100892153
1589 Ga0070705_100009688
1590 Ga0070700_100087920
1591 Ga0070694_100052405
1592 Ga0070663_100003763
1593 Ga0070678_100090978
1594 Ga0070662_100372795
1595 Ga0070662_101054725
1596 Ga0070681_10008287
1597 Ga0068867_101612271
1598 Ga0070679_100199832
1599 Ga0070684_100716527
1600 Ga0068853_100040844
1601 Ga0068853_100702550
1602 Ga0068853_101443730
1603 Ga0070665_100083379
1604 Ga0070665_100389179
1605 Ga0070665_100668223
1606 Ga0068855_100476119
1607 Ga0068855_101313924
1608 Ga0070664_100039603
1609 Ga0070664_100585780
1610 Ga0068857_100035472
1611 Ga0068854_100335999
1612 Ga0068856_100014117
1613 Ga0068856_100081792
1614 Ga0068856_100188981
1615 Ga0068852_100059446
1616 Ga0068852_100261305
1617 Ga0068852_100815066
1618 Ga0068860_101068060
1619 Ga0068860_102236096
1620 Ga0068862_100519182
1621 Ga0081455_10441046
1622 Ga0075365_10001999
1623 Ga0075365_10011804
1624 Ga0075365_10022037
1625 Ga0075365_10036005
1626 Ga0075365_10080809
1627 Ga0075365_10324910
1628 Ga0075365_10453340
1629 Ga0075368_10000370
1630 Ga0075368_10006472
1631 Ga0075368_10060920
1632 Ga0075363_100097483
1633 Ga0075363_100249788
1634 Ga0075364_10000195
1635 Ga0075364_10064288
1636 Ga0075364_10107044
1637 Ga0075364_10614010
1638 Ga0075362_10005758
1639 Ga0075362_10041266
1640 Ga0075367_10003513
1641 Ga0075367_10010829
1642 Ga0075367_10037942
1643 Ga0075367_10088137
1644 Ga0075367_10143891
1645 Ga0075367_10209748
1646 Ga0075369_10007006
1647 Ga0075369_10009506
1648 Ga0075369_10009744
1649 Ga0075369_10039071
1650 Ga0075369_10186025
1651 Ga0075366_10015737
1652 Ga0075366_10153478
1653 Ga0097621_100872739
1654 Ga0075370_10000923
1655 Ga0075370_10046667
1656 Ga0075370_10256009
1657 Ga0079104_1000195
1658 Ga0079104_1007315
1659 Ga0079104_1019653
1660 Ga0099826_10002340
1661 Ga0099826_10030104
1662 Ga0105251_10032824
1663 Ga0105240_10000013
1664 Ga0105245_10676194
1665 Ga0105247_10038391
1666 Ga0105243_10018422
1667 Ga0105243_10031359
1668 Ga0105243_11181347
1669 Ga0105243_11206633
1670 Ga0105241_10005600
1671 Ga0105241_10130804
1672 Ga0105241_11153113
1673 Ga0105237_10012742
1674 Ga0105237_10017470
1675 Ga0105237_10083583
1676 Ga0105237_10314042
1677 Ga0105238_10010328
1678 Ga0105238_10021086
1679 Ga0105238_10201007
1680 Ga0105238_10258207
1681 Ga0105238_11427143
1682 Ga0105249_10603127
1683 Ga0105249_11159140
1684 Ga0105249_11771134
1685 Ga0123342_1015184
1686 Ga0105239_10158935
1687 Ga0105239_10184102
1688 Ga0105239_10239809
1689 Ga0105239_10389948
1690 Ga0105239_10480594
1691 Ga0105246_10103527
1692 Ga0105246_10299020
1693 Ga0157373_10007612
1694 Ga0157373_10262877
1695 Ga0157371_10000108
1696 Ga0157371_10020668
1697 Ga0157370_10000720
1698 Ga0157370_10003357
1699 Ga0157370_10193891
1700 Ga0157370_10318199
1701 Ga0157370_10831338
1702 Ga0157369_10023136
1703 Ga0157369_10082749
1704 Ga0157369_10537836
1705 Ga0157369_10853251
1706 Ga0171463_1004
1707 Ga0157374_11327888
1708 Ga0157378_10357062
1709 Ga0157378_10579366
1710 Ga0157378_11604741
1711 Ga0163162_10286000
1712 Ga0163162_10461997
1713 Ga0157372_11395879
1714 Ga0157375_10182934
1715 Ga0157375_11764529
1716 Ga0163163_11715603
1717 Ga0182008_10066410
1718 Ga0157379_12244190
1719 Ga0157376_11436206
1720 Ga0182006_1051320
1721 Ga0182007_10001661
1722 Ga0182007_10079999
1723 Ga0182005_1001607
1724 Ga0183365_11151
1725 Ga0183363_1208
1726 Ga0214544_1000024
1727 Ga0214542_1000008
1728 Ga0214543_1000031
1729 Ga0214543_1000053
1730 Ga0228711_1000050
1731 Ga0228710_1000063
1732 Ga0209435_100009
1733 Ga0209436_101476
1734 Ga0209436_122632
1735 Ga0209672_104990
1736 Ga0209437_100057
1737 Ga0207425_1004647
1738 Ga0207425_1016579
1739 Ga0207425_1023523
1740 Ga0209646_1000018
1741 Ga0209646_1010312
1742 Ga0209026_1000032
1743 Ga0209026_1000068
1744 Ga0209677_100199
1745 Ga0209759_1000007
1746 Ga0209759_1000142
1747 Ga0209129_1000118
1748 Ga0209129_1001411
1749 Ga0209129_1003993
1750 Ga0209129_1044623
1751 Ga0209233_1000030
1752 Ga0209233_1000134
1753 Ga0209233_1000331
1754 Ga0209233_1030002
1755 Ga0209455_1019748
1756 Ga0209673_1000033
1757 Ga0209673_1000052
1758 Ga0209673_1000459
1759 Ga0209673_1007582
1760 Ga0209130_1000027
1761 Ga0209130_1000132
1762 Ga0209130_1008806
1763 Ga0209130_1054352
1764 Ga0209675_1041449
1765 Ga0209676_1001384
1766 Ga0209025_1000042
1767 Ga0209025_1000241
1768 Ga0209025_1000487
1769 Ga0209025_1001035
1770 Ga0209025_1004694
1771 Ga0209025_1004706
1772 Ga0209025_1014160
1773 Ga0209025_1027594
1774 Ga0209025_1056548
1775 Ga0209564_1000111
1776 Ga0209564_1000569
1777 Ga0209564_1002864
1778 Ga0209564_1012163
1779 Ga0209564_1054347
1780 Ga0209564_1077488
1781 Ga0209758_1002002
1782 Ga0209758_1010141
1783 Ga0209758_1015446
1784 Ga0209758_1027554
1785 Ga0209758_1028483
1786 Ga0209050_1008253
1787 Ga0209256_1000132
1788 Ga0209256_1000361
1789 Ga0209256_1000510
1790 Ga0209256_1002711
1791 Ga0209256_1011367
1792 Ga0209256_1019551
1793 Ga0209256_1019624
1794 Ga0209256_1047493
1795 Ga0209256_1063069
1796 Ga0207426_1000072
1797 Ga0207426_1000246
1798 Ga0207426_1000595
1799 Ga0209051_1003461
1800 Ga0209051_1003573
1801 Ga0209051_1014030
1802 Ga0209051_1018700
1803 Ga0209051_1050455
1804 Ga0209051_1075244
1805 Ga0209051_1085637
1806 Ga0209257_1001613
1807 Ga0209257_1031551
1808 Ga0207656_10174216
1809 Ga0207642_10925415
1810 Ga0207710_10440012
1811 Ga0207680_10556528
1812 Ga0207647_10017328
1813 Ga0207647_10035238
1814 Ga0207647_10173910
1815 Ga0207647_10206596
1816 Ga0207645_10457795
1817 Ga0207705_10535669
1818 Ga0207654_10068696
1819 Ga0207654_10198014
1820 Ga0207707_10250306
1821 Ga0207695_10000044
1822 Ga0207695_10705120
1823 Ga0207671_10000226
1824 Ga0207671_10129928
1825 Ga0207671_10262382
1826 Ga0207671_10738293
1827 Ga0207660_10260913
1828 Ga0207657_10027233
1829 Ga0207649_10315154
1830 Ga0207681_10557000
1831 Ga0207694_10065714
1832 Ga0207694_10470302
1833 Ga0207694_10618405
1834 Ga0207694_11146171
1835 Ga0207694_11147228
1836 Ga0207650_10000151
1837 Ga0207687_11300403
1838 Ga0207644_10430036
1839 Ga0207690_10813937
1840 Ga0207706_10361814
1841 Ga0207706_10984542
1842 Ga0207709_10183972
1843 Ga0207704_11093092
1844 Ga0207711_10248707
1845 Ga0207711_11046888
1846 Ga0207689_10033428
1847 Ga0207661_11592418
1848 Ga0207679_10124140
1849 Ga0207679_10734119
1850 Ga0207667_10792086
1851 Ga0207667_11161698
1852 Ga0207712_10455288
1853 Ga0207712_10561879
1854 Ga0207668_10065742
1855 Ga0207668_10465533
1856 Ga0207640_10222974
1857 Ga0207640_11667508
1858 Ga0207703_10110024
1859 Ga0207639_10090669
1860 Ga0207639_10818469
1861 Ga0207678_10001387
1862 Ga0207678_10178111
1863 Ga0207678_10333886
1864 Ga0207678_10449195
1865 Ga0207678_11725499
1866 Ga0207708_10653067
1867 Ga0207702_10014459
1868 Ga0207702_10081120
1869 Ga0207702_10099208
1870 Ga0207674_10052895
1871 Ga0207674_10628241
1872 Ga0207675_100826292
1873 Ga0207683_10190699
1874 Ga0207683_10312408
1875 Ga0207683_10585914
1876 Ga0207698_10186223
1877 Ga0207698_10468803
1878 Ga0207698_10529533
1879 Ga0207698_10676570
1880 Ga0209281_1000028
1881 Ga0209281_1000030
1882 Ga0209281_1000840
1883 Ga0209371_1000037
1884 Ga0209371_1001857
1885 Ga0209371_1008497
1886 Ga0209371_1046644
1887 Ga0209282_1000004
1888 Ga0209282_1000283
1889 Ga0209282_1039116
1890 Ga0209813_10000828
1891 Ga0209813_10109991
1892 Ga0209813_10213878
1893 Ga0209974_10386636
1894 Ga0268266_10012307
1895 Ga0268266_10241317
1896 Ga0268266_10275690
1897 Ga0268266_10516927
1898 Ga0268266_11889092
1899 Ga0268265_10359867
1900 Ga0268264_11166233
1901 Ga0307517_10327943
1902 Ga0307515_10000377
1903 Ga0307515_10000434
1904 Ga0307515_10016274
1905 Ga0307515_10033701
1906 Ga0307515_10394488
1907 Ga0268256_1000039
1908 Ga0268256_1002298
1909 Ga0268256_1008786
1910 Ga0268256_1052564
1911 Ga0316176_1072425
1912 Ga0316181_1261403
1913 Ga0307513_10001888
1914 Ga0307513_10192741
1915 Ga0307513_10442346
1916 Ga0307513_10529354
1917 Ga0307408_100052252
1918 Ga0307408_100187346
1919 Ga0307408_101006931
1920 Ga0307516_10315998
1921 Ga0307405_10512740
1922 Ga0307413_11156467
1923 Ga0307410_10188008
1924 Ga0307410_10834157
1925 Ga0307412_10351845
1926 Ga0307412_10582268
1927 Ga0315914_1000001
1928 Ga0307409_100489820
1929 Ga0307409_101096909
1930 Ga0315913_1000024
1931 Ga0315915_1000002
1932 Ga0373941_0368889
1933 Ga0316574_0054367
1934 Ga0316584_0407069
1935 Ga0395900_0536357
1936 Ga0395898_0164394
1937 Ga0395905_0004591
1938 Ga0395905_0073479
1939 Ga0395905_0136682
1940 Ga0395905_0159911
1941 Ga0395905_0166954
1942 Ga0395905_0420019
1943 Ga0395905_0916404
1944 Ga0395905_1457642
1945 Ga0395901_0108029
1946 Ga0395901_0192399
1947 Ga0395901_0320823
1948 Ga0395901_0363975
1949 Ga0439436_0013306
1950 Ga0439465_0007940
1951 Ga0439465_0258020
1952 Ga0451787_328280
1953 Ga0451791_1874397
1954 Ga0451798_0190316
1955 Ga0451804_0509084
1956 Ga0451833_0656247
1957 Ga0451839_0797687
1958 Ga0451840_02813
1959 Ga0451841_0317996
1960 Ga0451845_0142149
1961 Ga0451846_33483
1962 Ga0451847_0149356
1963 Ga0451849_1233240
1964 Ga0451851_0041039
1965 Ga0451843_0950520
1966 Ga0451853_1752544
1967 Ga0439445_0255893
1968 Ga0439449_0023273
1969 Ga0439449_0386849
1970 Ga0439455_0199105
1971 Ga0439462_0224245
1972 Ga0450920_023890
1973 Ga0466972_0083314
1974 Ga0466965_0041976
1975 Ga0466965_0540303
1976 Ga0466960_0156005
1977 Ga0466967_1292166
1978 Ga0495617_045322
1979 Ga0495627_039264
1980 Ga0495627_083163
1981 Ga0495592_0325386
1982 Ga0495590_0008145
1983 Ga0495629_0239147
1984 Ga0495638_0001266
1985 Ga0495638_0061845
1986 Ga0495638_0188006
1987 Ga0495638_0200521
1988 Ga0495650_0022011
1989 Ga0495605_0001289
1990 Ga0495605_0201863
1991 Ga0495662_0051558
1992 Ga0495584_0111263
1993 Ga0495585_0003047
1994 Ga0495585_0014299
1995 Ga0495585_0044472
1996 Ga0495585_0355542
1997 Ga0495607_0070406
1998 Ga0495607_0223498
1999 Ga0495583_0003099
2000 Ga0495583_0129631
2001 Ga0495583_0275303
2002 Ga0495606_0011138
2003 Ga0495606_0055573
2004 Ga0495606_0066095
2005 Ga0495606_0077128
2006 Ga0495610_0002597
2007 Ga0495610_0019307
2008 Ga0495610_0023092
2009 Ga0495610_0026275
2010 Ga0495616_0002338
2011 Ga0495616_0103543
2012 Ga0495616_0114020
2013 Ga0495620_0016883
2014 Ga0495620_0017309
2015 Ga0495620_0018102
2016 Ga0495620_0170758
2017 Ga0495631_0001859
2018 Ga0495632_0012884
2019 Ga0495632_0015553
2020 Ga0495632_0026520
2021 Ga0495632_0303681
2022 Ga0495632_0484135
2023 Ga0495643_0011972
2024 Ga0495643_0030466
2025 Ga0495643_0097990
2026 Ga0495644_0019675
2027 Ga0495648_0122865
2028 Ga0495648_0164547
2029 Ga0495652_0060749
2030 Ga0495654_0000308
2031 Ga0495654_0078466
2032 Ga0495654_0119438
2033 Ga0495654_0147827
2034 Ga0495609_0012502
2035 Ga0495609_0070523
2036 Ga0495597_0024478
2037 Ga0495622_0029699
2038 Ga0495633_0019083
2039 Ga0495633_0038782
2040 Ga0495633_0053812
2041 Ga0495633_0242892
2042 Ga0495656_0014722
2043 Ga0495656_0071441
2044 Ga0495668_0022717
2045 Ga0495668_0025481
2046 Ga0495668_0046473
2047 Ga0495668_0066618
2048 Ga0495668_0393198
2049 Ga0495625_0014610
2050 Ga0495625_0029614
2051 Ga0495625_0052613
2052 Ga0495625_0136309
2053 Ga0495625_0261524
2054 Ga0495625_0477356
2055 Ga0495661_0251451
2056 Ga0495661_0488210
2057 Ga0495588_0000643
2058 Ga0495588_0011541
2059 Ga0495670_0013208
2060 Ga0495671_0061710
2061 Ga0495671_0131517
2062 Ga0495649_0013866
2063 Ga0495649_0034639
2064 Ga0495649_0191142
2065 Ga0495649_0372293
2066 Ga0495660_0015869
2067 Ga0495660_0055768
2068 Ga0495604_0016659
2069 Ga0495636_0015190
2070 Ga0495636_0029106
2071 Ga0495672_0024621
2072 Ga0495683_0042349
2073 Ga0495687_130338
2074 Ga0495677_0184821
2075 Ga0495673_0084463
2076 Ga0495681_0126581
2077 Ga0495686_0002454
2078 Ga0495686_0045229
2079 Ga0495686_0267362
2080 Ga0495626_0136317
2081 Ga0496100_0663184
2082 Ga0496102_0147383
2083 Ga0496102_0246818
2084 Ga0496102_0641635
2085 Ga0496103_0149178
2086 Ga0496103_0501194
2087 Ga0496103_0702337
2088 Ga0496104_0989843
2089 Ga0496105_0119676
2090 Ga0496105_0476381
2091 Ga0496105_0634908
2092 Ga0496106_0089525
2093 Ga0496107_0003241
2094 Ga0496107_0694442
2095 Ga0496109_1225340
2096 Ga0496110_0088309
2097 Ga0496110_0527091
2098 Ga0496110_1136013
2099 Ga0496111_0003486
2100 Ga0496111_0649468
2101 Ga0496112_0321351
2102 Ga0496113_0346349
2103 Ga0496113_0480525
2104 Ga0496114_0411267
2105 Ga0496115_0002734
2106 Ga0496115_0212934
2107 Ga0496116_0000057
2108 Ga0496116_0016742
2109 Ga0496116_0020118
2110 Ga0496116_0134513
2111 Ga0496116_0401047
2112 Ga0496116_0425930
2113 Ga0496117_0000031
2114 Ga0496117_0004678
2115 Ga0496117_0017870
2116 Ga0496117_0022715
2117 Ga0496117_0194704
2118 Ga0496117_0519429
2119 Ga0496118_0001884
2120 Ga0496118_0004259
2121 Ga0496118_0013516
2122 Ga0496118_0017624
2123 Ga0496118_0165226
2124 Ga0496118_0368325
2125 Ga0496119_0032290
2126 Ga0496119_0036562
2127 Ga0496119_0049122
2128 Ga0496119_0053854
2129 Ga0496119_0081628
2130 Ga0496119_0091575
2131 Ga0496119_0278767
2132 Ga0496120_0001817
2133 Ga0496120_0003907
2134 Ga0496120_0014950
2135 Ga0496120_0021746
2136 Ga0496120_0043423
2137 Ga0496120_0056595
2138 Ga0496121_0000034
2139 Ga0496121_0005856
2140 Ga0496121_0008693
2141 Ga0496121_0020154
2142 Ga0496121_0030144
2143 Ga0496121_0048825
2144 Ga0496121_0072725
2145 Ga0496121_0102152
2146 Ga0496121_0319092
2147 Ga0496121_0490596
2148 Ga0496122_0000023
2149 Ga0496122_0000074
2150 Ga0496122_0002284
2151 Ga0496122_0020124
2152 Ga0496122_0032494
2153 Ga0496122_0061360
2154 Ga0496123_0000027
2155 Ga0496123_0000062
2156 Ga0496123_0000290
2157 Ga0496123_0017802
2158 Ga0496123_0031088
2159 Ga0496123_0044983
2160 Ga0496123_0053721
2161 Ga0496123_0073264
2162 Ga0496123_0096986
2163 Ga0496124_0008017
2164 Ga0496124_0009644
2165 Ga0496124_0013702
2166 Ga0496124_0026371
2167 Ga0496124_0039353
2168 Ga0496124_0041824
2169 Ga0496124_0083621
2170 Ga0496124_0106942
2171 Ga0496124_0215472
2172 Ga0496124_0406245
2173 Ga0496125_0000030
2174 Ga0496125_0003346
2175 Ga0496125_0014218
2176 Ga0496125_0044581
2177 Ga0496125_0047815
2178 Ga0496125_0097190
2179 Ga0496125_0133085
2180 Ga0496125_0337932
2181 Ga0496125_0415778
2182 Ga0496126_0002222
2183 Ga0496126_0004878
2184 Ga0496126_0009461
2185 Ga0496126_0034327
2186 Ga0496126_0081220
2187 Ga0496126_0091895
2188 Ga0496126_0192147
2189 Ga0496126_0251933
2190 Ga0496126_0253787
2191 Ga0496126_1240570
2192 Ga0495678_016040
2193 Ga0495678_016669
2194 Ga0495678_018645
2195 Ga0495682_0007963
2196 Ga0501034_1010067
2197 Ga0501036_0075608
2198 Ga0501038_0035627
2199 Ga0501039_0058415
2200 Ga0501040_0440760
2201 Ga0501043_0161588
2202 Ga0501046_0139157
2203 Ga0501047_0174214
2204 Ga0501048_0047427
2205 Ga0501067_0330681
2206 Ga0501067_0512461
2207 Ga0501073_0255407
2208 Ga0501074_1003793
2209 Ga0501080_0226294
2210 Ga0501083_0089443
2211 Ga0501280_001760
2212 Ga0501035_0213079
2213 nmdc:mga03683_10202_c1
2214 nmdc:mga03n38_136758_c1
2215 nmdc:mga03n38_74528_c1
2216 nmdc:mga00v17_211955_c1
2217 nmdc:mga00v17_285428_c1
2218 nmdc:mga00v17_330716_c1
2219 nmdc:mga00v17_360_c1
2220 nmdc:mga00v17_378440_c1
2221 nmdc:mga00v17_4292_c1
2222 nmdc:mga00v17_439014_c1
2223 nmdc:mga00v17_75888_c2
2224 nmdc:mga0yw44_13168_c1
2225 nmdc:mga0yw44_180104_c1
2226 nmdc:mga0yw44_456761_c1
2227 nmdc:mga0yw44_6773_c1
2228 nmdc:mga0k408_176025_c1
2229 nmdc:mga0k408_437589_c1
2230 nmdc:mga0k408_68217_c1
2231 nmdc:mga0k408_794579_c1
2232 nmdc:mga06z11_137765_c1
2233 nmdc:mga06z11_174112_c1
2234 nmdc:mga06z11_372201_c1
2235 nmdc:mga06z11_423545_c1
2236 nmdc:mga04h51_85095_c1
2237 nmdc:mga04h51_99504_c1
2238 nmdc:mga07m45_2146_c1
2239 nmdc:mga07m45_698220_c1
2240 nmdc:mga0sz30_1057_c1
2241 nmdc:mga0sz30_14896_c1
2242 nmdc:mga0sz30_273541_c1
2243 nmdc:mga0sz30_33473_c1
2244 nmdc:mga0sz30_40559_c1
2245 Ga0500610_0036361
2246 Ga0500610_0070121
2247 Ga0495655_0015995
2248 Ga0495619_0082511
2249 Ga0500644_0004951
2250 Ga0500560_000732
2251 Ga0500569_021327
2252 Ga0500594_0001734
2253 Ga0500594_0135948
2254 Ga0500594_0151021
2255 Ga0500607_258895
2256 Ga0500608_034722
2257 Ga0500618_000862
2258 Ga0500618_003034
2259 Ga0500618_009427
2260 Ga0500658_0000112
2261 Ga0500559_0002392
2262 Ga0500561_0000170
2263 Ga0500568_0001609
2264 Ga0500568_0116614
2265 Ga0500568_0145161
2266 Ga0500573_0001302
2267 Ga0500573_0237604
2268 Ga0500577_0467478
2269 Ga0500590_024567
2270 Ga0500604_0010862
2271 Ga0500616_0002690
2272 Ga0500616_0048868
2273 Ga0500616_0136208
2274 Ga0500622_0001156
2275 Ga0500622_0001966
2276 Ga0500622_0036863
2277 Ga0500624_000401
2278 Ga0500627_0115000
2279 Ga0500634_0001225
2280 Ga0500634_0004081
2281 Ga0587091_099795
2282 Ga0587072_015315
2283 Ga0501082_0055900
2284 2503199089
2285 2509109489
2286 2509116619
2287 2509370067
2288 2509378201
2289 2509394039
2290 2510135185
2291 2510305358
2292 2510318290
2293 2510843661
2294 2510896636
2295 2511132093
2296 2511183936
2297 2511503226
2298 2512534497
2299 2512973692
2300 2513571562
2301 2513578602
2302 2513586098
2303 2513598141
2304 2513601790
2305 2513613313
2306 2513615616
2307 2513630215
2308 2513711287
2309 2513869177
2310 2513884191
2311 2513903520
2312 2513912321
2313 2513928494
2314 2513984065
2315 2513998547
2316 2514003626
2317 2514019332
2318 2514035669
2319 2514418073
2320 2515114340
2321 2515610964
2322 2515636259
2323 2515643247
2324 2515657714
2325 2515741528
2326 2516205494
2327 2516894657
2328 2517037983
2329 2517078251
2330 2517097016
2331 2517408599
2332 2517571305
2333 2524450551
2334 2524458404
2335 2535518955
2336 2537876645
2337 2551675886
2338 2551689614
2339 2551693319
2340 2551703302
2341 2551709409
2342 2551723759
2343 2551727295
2344 2551734705
2345 2551741023
2346 2554248810
2347 2559295898
2348 2561467054
2349 2585166784
2350 2585201802
2351 2585228802
2352 2585266868
2353 2585271605
2354 2585280668
2355 2585326453
2356 2585334209
2357 2585387911
2358 2585396006
2359 2585399687
2360 2585526106
2361 2585531602
2362 2585540719
2363 2585551451
2364 2585563155
2365 2585820774
2366 2585838988
2367 2585902793
2368 2585907374
2369 2587982632
2370 2588519586
2371 2599335031
2372 2599420206
2373 2599603310
2374 2599720273
2375 2599937021
2376 2600193462
2377 2600373292
2378 2601610784
2379 2601747558
2380 2616306787
2381 2616557639
2382 2617383307
2383 2643808153
2384 2643813697
2385 2643855026
2386 2643921423
2387 2643988465
2388 2644002408
2389 2644051981
2390 2644068658
2391 2644110063
2392 2644150339
2393 2644154618
2394 2644194884
2395 2644201463
2396 2644209414
2397 2644240565
2398 2644299937
2399 2644312943
2400 2644336491
2401 2644379587
2402 2644419727
2403 2644453084
2404 2644484433
2405 2644492444
2406 2644499836
2407 2644521476
2408 2644546137
2409 2644618673
2410 2644652942
2411 2644658164
2412 2644677181
2413 2644688887
2414 2657682512
2415 2671113533
2416 2688596363
2417 2692319971
2418 2694630166
2419 2723028562
2420 2723573483
2421 2725947473
2422 2730109498
2423 2738947575
2424 2739037215
2425 2753463724
2426 2756673752
2427 2766064336
2428 2776915420
2429 2778173694
2430 2792582137
2431 2792622002
2432 2792628741
2433 2792641331
2434 2792747611
2435 2793281109
2436 2793359457
2437 2802717328
2438 2802724683
2439 2802729435
2440 2802736780
2441 2802743186
2442 2802749688
2443 2804753597
2444 2806047306
2445 2806054161
2446 2806060255
2447 2806068866
2448 2806077191
2449 2808988278
2450 2819244720
2451 2819560908
2452 2819611184
2453 2819638881
2454 2821128661
2455 2837651320
2456 2838030877
2457 2838040412
2458 2838048409
2459 2838078266
2460 2838667826
2461 2838678729
2462 2838683955
2463 2838690215
2464 2838698484
2465 2838711599
2466 2838718182
2467 2838723026
2468 2838728249
2469 2838731990
2470 2838741678
2471 2838744886
2472 2839993311
2473 2841845488
2474 2841850582
2475 2841855943
2476 2841863165
2477 2842081400
2478 2842116924
2479 2842121823
2480 2842128908
2481 2842133621
2482 2842145191
2483 2842155467
2484 2842161113
2485 2842166631
2486 2842174576
2487 2842179235
2488 2842184729
2489 2842190606
2490 2842215070
2491 2842223301
2492 2842227791
2493 2842232312
2494 2842240838
2495 2842246727
2496 2842261171
2497 2842274235
2498 2842295057
2499 2842300340
2500 2842305918
2501 2842361143
2502 2842374925
2503 2842381456
2504 2842388526
2505 2842477609
2506 2842487952
2507 2842504518
2508 2842511768
2509 2842520097
2510 2842524422
2511 2842926220
2512 2844003069
2513 2844011188
2514 2844164262
2515 2844457087
2516 2847420806
2517 2847673807
2518 2847690288
2519 2848995631
2520 2850082549
2521 2852391637
2522 2855827283
2523 2855842665
2524 2855878169
2525 2856320542
2526 2856328493
2527 2856341453
2528 2856353542
2529 2856363509
2530 2856365015
2531 2857353306
2532 2857371909
2533 2857519503
2534 2857534186
2535 2858803476
2536 2869169006
2537 2869174583
2538 2869236895
2539 2869246793
2540 2869253457
2541 2869258172
2542 2869268020
2543 2869276173
2544 2869279539
2545 2869286360
2546 2871430329
2547 2871442333
2548 2871454263
2549 2871465365
2550 2871472318
2551 2871486923
2552 2871494887
2553 2871500922
2554 2874104738
2555 2874115852
2556 2874118239
2557 2874137997
2558 2874139471
2559 2874146747
2560 2874155820
2561 2874166461
2562 2874176796
2563 2876370599
2564 2876385308
2565 2876388607
2566 2876399268
2567 2876402294
2568 2876409448
2569 2876414149
2570 2876427306
2571 2878038957
2572 2878742065
2573 2878746525
2574 2878760012
2575 2878764969
2576 2878772113
2577 2878778878
2578 2878786505
2579 2881148583
2580 2881159674
2581 2881165368
2582 2881852883
2583 2881858572
2584 2881867186
2585 2882640317
2586 2882916817
2587 2885307226
2588 2885313766
2589 2885324479
2590 2885332409
2591 2885337564
2592 2885344914
2593 2885357741
2594 2888337052
2595 2888353578
2596 2889015294
2597 2889019628
2598 2891051150
2599 2891373845
2600 2896390295
2601 2899795264
2602 2899808095
2603 2899849245
2604 2903494246
2605 2903499715
2606 2903517621
2607 2903545737
2608 2904665795
2609 2906308926
2610 2906322207
2611 2906333851
2612 2906362035
2613 2906364421
2614 2906371869
2615 2906393202
2616 2906395619
2617 2906405462
2618 2906410059
2619 2906421321
2620 2906434899
2621 2913300075
2622 2913312484
2623 2915982543
2624 2915988260
2625 2915994496
2626 2916007067
2627 2916008750
2628 2916015254
2629 2916024398
2630 2916031237
2631 2916037663
2632 2916047503
2633 2916051728
2634 2916058427
2635 2916066205
2636 2916075307
2637 2916082046
2638 2919105326
2639 2919118560
2640 2919170640
2641 2919411009
2642 2920760447
2643 2920825844
2644 2921205897
2645 2921209521
2646 2921239596
2647 2921245434
2648 2921254554
2649 2921257703
2650 2921267019
2651 2921285571
2652 2921293166
2653 2921298760
2654 2922132573
2655 2922157290
2656 2922177056
2657 2922183237
2658 2922191487
2659 2923559554
2660 2924150567
2661 2924155482
2662 2924161154
2663 2924169927
2664 2924173346
2665 2924180676
2666 2924186925
2667 2924193692
2668 2924206569
2669 2924209342
2670 2924214475
2671 2924226170
2672 2924231761
2673 2924710341
2674 2924722913
2675 2924737575
2676 2924748186
2677 2924751617
2678 2924779749
2679 2924790816
2680 2926755090
2681 2926762250
2682 2929141808
2683 2933010683
2684 2933015643
2685 2933021914
2686 2933572423
2687 2933593072
2688 2933597616
2689 2935897867
2690 2935903697
2691 2936369823
2692 2936379010
2693 2936382013
2694 2936997558
2695 2937009422
2696 2937013675
2697 2937019107
2698 2937024783
2699 2937034873
2700 2937036098
2701 2937044064
2702 2937051126
2703 2937062096
2704 2937064802
2705 2937074353
2706 2937081933
2707 2937086140
2708 2937097720
2709 2937101348
2710 2937106701
2711 2937119581
2712 2937123160
2713 2937132664
2714 2937822266
2715 2937823934
2716 2937848640
2717 2937864836
2718 2937877053
2719 2937880107
2720 2937895206
2721 2937988140
2722 2937999587
2723 2938018655
2724 2941501259
2725 2957381944
2726 2957384595
2727 2957391365
2728 2957400516
2729 2957404335
2730 2957413729
2731 2957416602
2732 2957425730
2733 2957434577
2734 2957442201
2735 2957447904
2736 2957455047
2737 2957463744
2738 2957470679
2739 2957473282
2740 2957483962
2741 2957485693
2742 2957494132
2743 2957502981
2744 2957510130
2745 2958035117
2746 2958044148
2747 2958046616
2748 2958065755
2749 2958087160
2750 2958094196
2751 2958104339
2752 2958108402
2753 2958120461
2754 2958124893
2755 2958130760
2756 2958145600
2757 2958161404
2758 2958170061
2759 2958176778
2760 2958180098
2761 2960587001
2762 2960592121
2763 2960599305
2764 2960609671
2765 2960616199
2766 2960623557
2767 2960624929
2768 2960633517
2769 2960642465
2770 2960650304
2771 2960654219
2772 2960664287
2773 2960671914
2774 2960676766
2775 2960687348
2776 2960693233
2777 2960698988
2778 2961077925
2779 2961121138
2780 2961134371
2781 2961141605
2782 2961168515
2783 2961177283
2784 2961188928
2785 2964609625
2786 2964616275
2787 2964622586
2788 2964633284
2789 2964639876
2790 2964645832
2791 2964654123
2792 2964657403
2793 2964664470
2794 2964674247
2795 2964683084
2796 2964685543
2797 2964694619
2798 2964700770
2799 2964707907
2800 2964712886
2801 2964725042
2802 2965023335
2803 2965031026
2804 2965032183
2805 2965045829
2806 2965050784
2807 2965065706
2808 2965095267
2809 2965103395
2810 2965111373
2811 2965121122
2812 2967667800
2813 2967673514
2814 2967680876
2815 2967687599
2816 2967695373
2817 2967700444
2818 2967711411
2819 2967718867
2820 2967722582
2821 2967733678
2822 2967739023
2823 2967742588
2824 2967749873
2825 2967756311
2826 2967768121
2827 2967775310
2828 2967777522
2829 2968002386
2830 2968009617
2831 2968023537
2832 2968093137
2833 2968102440
2834 2968117288
2835 2968122286
2836 2968132043
2837 2968141743
2838 2968176923
2839 2970020970
2840 2970029847
2841 2970034253
2842 2970047654
2843 2970048435
2844 2970059429
2845 2970062356
2846 2970075562
2847 2970078757
2848 2970086370
2849 2970093647
2850 2970096491
2851 2970108979
2852 2970114130
2853 2970122352
2854 2970123842
2855 2970133728
2856 2970138160
2857 2970143716
2858 2970153343
2859 2970163697
2860 2970167212
2861 2970175014
2862 2970178821
2863 2970186911
2864 2970196564
2865 2970476119
2866 2970490765
2867 2970509957
2868 2970511858
2869 2970537234
2870 2970552129
2871 2970559817
2872 2970594139
2873 2970623945
2874 2970630142
2875 2977517323
2876 2977525426
2877 2977535196
2878 2977540278
2879 2977550410
2880 2977558972
2881 2977559692
2882 2977570308
2883 2977577461
2884 2977585492
2885 2977828534
2886 2977829662
2887 2977844238
2888 2977855444
2889 2977859643
2890 2977865541
2891 2977879469
2892 2977898831
2893 2977908451
2894 2977917611
2895 2977929465
2896 2977935803
2897 2977942360
2898 2977954590
2899 2977960966
2900 2977988069
2901 2978972550
2902 2979092480
2903 2979100129
2904 2979104451
2905 2979711578
2906 2979751870
2907 2979769346
2908 2979776589
2909 2979781371
2910 2979800560
2911 2979814833
2912 2984513753
2913 2984522669
2914 2984541975
2915 2984590803
2916 2984601405
2917 2987641899
2918 2987648588
2919 2987653451
2920 2987664538
2921 2987678118
2922 2989354837
2923 2989771505
2924 2989780022
2925 2995394778
2926 2996354699
2927 2996389895
2928 2996890177
2929 2996895219
2930 3000137758
2931 3003930919
2932 3004173697
2933 3004193592
2934 3004202174
2935 3004209290
2936 3004236608
2937 3004244379
2938 3004249476
2939 3004275373
2940 3004281347
2941 3004290429
2942 3004336839
2943 3005415734
2944 3005421681
2945 639650370
2946 643827402
2947 648737105
2948 649870914
2949 650741112
2950 8003573829
2951 8003995247
2952 8004002965
2953 8004306798
2954 8004315209
2955 8004367049
2956 8004381511
2957 8004388560
2958 8004447660
2959 8004646448
2960 8004700703
2961 8004706381
2962 8004715182
2963 8004731309
2964 8005249165
2965 8005262361
2966 8005313636
2967 8005319615
2968 8005324704
2969 8005381632
2970 8005465031
2971 8005490237
2972 8005546605
2973 8005561104
2974 8005565730
2975 8005571782
2976 8005646894
2977 8005660753
2978 8018128849
2979 8018155120
2980 8018165160
2981 8023686474
2982 8024484302
2983 8024490793
2984 8046768088
2985 8049296166
2986 8054560173
2987 8055435633
2988 8056878182
2989 8057581553
2990 8057879222

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

16

148

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9384 3 107
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.8868 2 105
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.8865 3 105
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.8652 1 107
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.8613 2 105
ID Description Score Start End Superfamily
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9266 3 107 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9135 2 73 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8919 3 105 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8656 3 107 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8651 2 105 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A3S1ZEQ7-F1-model_v4 EVE domain-containing protein 0.9802 1 85
AF-A0A6A9UMG2-F1-model_v4 deleted 0.9802 1 73
AF-A0A530GD66-F1-model_v4 EVE domain-containing protein 0.9796 1 72
AF-A0A444ME55-F1-model_v4 EVE domain-containing protein 0.9793 1 100
AF-A0A316KAS7-F1-model_v4 EVE domain-containing protein 0.9768 1 63

Map