F494304

General Info

Members Datasets Scaffolds Average Seq Length
1485 791 1140 457

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0000191|Ga0500556_0000191_1002_2573
Length 523
Sequence MLARGDEPERRSFASLRVLWQRLRRFPLARLHWRHWRWPRRSDFYIPAPVRSAWQALPPAPRPLRVFGTWFANTHTRNMQIIXXXLADVLPKGLYARALIIIIAPIVVLEGVVAFVFMERHWQAVTRRLSEATARDIAAVIDIYEEYPRQDQYTQLIEMARDRLNLSMQVLPPGDLPAPRPKPFFALLDRALSDEIRRQVQRPFWIDTVGQSRHVEIRVKLQNAILRFVATRSQTYASNSHIFLLWMIGSSVILLTVAILFLRNQIRPILRLAEAADAFGKGRRVPDDFRPRGAREVRQAATAFLEMRDRITTHVEQRTTMLAGVSHDLRTILTRFKLELALLGDTPEAMSLQADVREMQDMLEDYLAFAKGDGGEESAPTNLRELLQEVYDEGQYFGTPIELKLRKRREELVLPLKRQAFKRAITNLVSNAARFGDQIIIRGAVEGQWVRIEVDDNGPGIPEAERANVFKPFYRLDHARNQDEGNTGLGLAIARDIAKSHGGDITLGESSMGGLRAIISVPL

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
14 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
20 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
32 2519899620 Rhizobium sp. Pop5 Isolate Nodule
33 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
34 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
35 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
36 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
37 2534681786 Brucella suis 92/29 Isolate Unclassified
38 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
39 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
40 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
41 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
42 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
43 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
44 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
45 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
46 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
47 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
48 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
49 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
50 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
51 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
52 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
53 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
54 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
55 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
56 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
57 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
58 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
59 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
60 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
61 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
62 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
63 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
64 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
65 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
66 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
67 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
68 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
69 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
70 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
71 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
72 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
73 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
74 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
75 2643221558 Rhizobium sp. Root149 Isolate Unclassified
76 2643221568 Rhizobium sp. Root564 Isolate Unclassified
77 2643221582 Rhizobium sp. Root651 Isolate Unclassified
78 2643221599 Rhizobium sp. Root708 Isolate Unclassified
79 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
80 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
81 2643221693 Rhizobium sp. Root491 Isolate Unclassified
82 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
83 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
84 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
85 2718217882 Rhizobium sp. N741 Isolate Nodule
86 2718217927 Rhizobium sp. N324 Isolate Nodule
87 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
88 2718218009 Rhizobium sp. N561 Isolate Nodule
89 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
90 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
91 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
92 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
93 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
94 2718218363 Rhizobium sp. N113 Isolate Nodule
95 2718218365 Rhizobium sp. N731 Isolate Nodule
96 2718218366 Rhizobium sp. N621 Isolate Nodule
97 2718218423 Rhizobium sp. N941 Isolate Nodule
98 2721755514 Rhizobium sp. N6212 Isolate Nodule
99 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
100 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
101 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
102 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
103 2721755809 Rhizobium sp. N541 Isolate Nodule
104 2721755810 Rhizobium sp. N871 Isolate Nodule
105 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
106 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
107 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
108 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
109 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
110 2728369365 Rhizobium sp. N1341 Isolate Nodule
111 2728369397 Rhizobium sp. N1314 Isolate Nodule
112 2738541293 Rhizobium sp. GV031 Isolate Unclassified
113 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
114 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
115 2751185800 Brucella pituitosa AA2 Isolate Unclassified
116 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
117 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
118 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
119 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
120 2791355199
121 2791355256 Rhizobium sp. M10 Isolate Nodule
122 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
123 2791355260 Rhizobium sp. L9 Isolate Nodule
124 2791355261 Rhizobium sp. J15 Isolate Nodule
125 2791355262 Rhizobium sp. M1 Isolate Nodule
126 2791355263 Rhizobium chutanense C5 Isolate Nodule
127 2791355264 Rhizobium sp. S9 Isolate Nodule
128 2791355265 Rhizobium sp. H4 Isolate Nodule
129 2791355266 Rhizobium sp. L43 Isolate Nodule
130 2791355267 Rhizobium sp. L18 Isolate Nodule
131 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
132 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
133 2802429633 Rhizobium anhuiense J3 Isolate Nodule
134 2802429634 Rhizobium anhuiense S10 Isolate Nodule
135 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
136 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
137 2802429637 Rhizobium anhuiense C15 Isolate Nodule
138 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
139 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
140 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
141 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
142 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
143 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
144 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
145 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
146 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
147 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
148 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
149 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
150 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
151 2838048938 Rhizobium pisi 27/80 Isolate Nodule
152 2838061910 Rhizobium phaseoli L15 Isolate Nodule
153 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
154 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
155 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
156 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
157 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
158 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
159 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
160 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
161 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
162 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
163 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
164 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
165 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
166 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
167 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
168 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
169 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
170 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
171 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
172 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
173 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
174 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
175 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
176 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
177 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
178 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
179 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
180 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
181 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
182 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
183 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
184 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
185 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
186 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
187 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
188 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
189 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
190 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
191 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
192 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
193 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
194 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
195 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
196 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
197 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
198 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
199 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
200 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
201 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
202 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
203 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
204 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
205 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
206 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
207 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
208 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
209 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
210 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
211 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
212 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
213 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
214 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
215 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
216 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
217 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
218 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
219 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
220 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
221 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
222 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
223 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
224 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
225 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
226 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
227 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
228 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
229 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
230 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
231 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
232 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
233 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
234 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
235 2854911287 Brucella lupini LUP21 Isolate Unclassified
236 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
237 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
238 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
239 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
240 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
241 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
242 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
243 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
244 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
245 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
246 2904699407
247 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
248 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
249 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
250 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
251 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
252 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
253 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
254 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
255 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
256 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
257 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
258 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
259 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
260 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
261 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
262 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
263 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
264 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
265 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
266 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
267 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
268 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
269 2933599457 Rhizobium phaseoli M3 Isolate Nodule
270 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
271 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
272 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
273 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
274 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
275 2936381700 Rhizobium chutanense C16 Isolate Unclassified
276 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
277 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
278 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
279 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
280 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
281 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
282 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
283 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
284 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
285 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
286 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
287 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
288 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
289 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
290 2996887358 Rhizobium sp. R711 Isolate Nodule
291 2996893221 Rhizobium sp. R635 Isolate Nodule
292 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
293 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
294 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
295 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
296 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
297 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
298 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
299 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
300 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
301 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
302 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
303 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
304 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
305 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
306 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
307 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
308 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
309 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
310 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
311 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
312 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
313 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
314 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
315 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
316 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
317 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
318 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
319 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
320 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
321 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
322 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
323 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
324 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
325 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
326 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
327 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
328 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
329 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
330 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
331 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
332 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
333 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
334 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
335 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
336 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
337 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
338 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
339 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
340 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
341 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
342 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
343 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
344 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
345 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
346 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
347 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
348 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
349 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
350 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
351 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
352 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
353 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
354 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
355 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
356 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
357 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
358 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
359 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
360 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
361 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
362 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
363 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
364 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
365 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
366 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
367 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
368 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
369 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
370 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
371 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
372 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
373 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
374 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
375 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
376 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
377 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
378 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
379 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
380 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
381 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
382 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
383 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
384 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
385 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
386 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
387 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
388 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
389 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
390 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
391 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
392 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
393 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
394 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
395 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
396 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
397 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
398 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
399 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
400 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
401 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
402 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
403 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
404 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
405 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
406 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
407 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
408 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
409 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
410 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
411 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
412 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
413 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
414 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
415 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
416 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
417 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
418 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
419 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
420 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
421 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
422 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
423 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
424 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
425 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
426 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
427 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
428 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
429 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
430 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
431 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
432 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
433 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
434 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
435 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
436 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
437 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
438 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
439 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
440 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
441 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
442 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
443 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
444 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
445 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
446 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
447 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
448 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
449 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
450 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
451 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
452 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
453 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
454 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
455 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
456 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
457 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
458 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
459 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
461 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
462 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
463 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
465 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
466 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
468 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
469 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
470 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
472 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
473 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
474 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
475 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
519 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
522 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
529 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
530 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
531 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
532 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
533 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
535 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
537 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
538 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
539 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
540 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
541 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
542 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
543 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
544 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
545 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
546 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
547 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
548 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
549 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
550 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
551 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
552 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
553 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
554 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
555 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
556 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
557 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
558 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
559 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
560 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
561 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
562 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
563 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
564 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
565 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
566 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
567 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
568 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
569 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
570 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
571 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
572 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
573 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
574 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
575 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
576 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
577 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
578 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
579 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
580 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
581 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
582 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
583 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
584 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
585 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
586 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
587 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
588 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
589 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
590 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
591 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
592 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
593 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
594 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
595 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
596 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
597 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
598 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
599 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
600 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
601 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
602 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
603 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
604 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
605 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
606 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
607 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
608 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
609 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
610 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
611 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
612 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
613 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
614 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
615 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
616 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
617 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
618 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
619 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
620 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
621 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
622 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
623 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
624 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
625 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
626 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
627 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
628 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
629 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
630 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
631 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
632 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
633 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
634 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
635 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
636 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
637 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
638 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
639 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
640 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
641 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
642 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
643 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
644 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
645 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
646 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
647 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
648 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
649 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
650 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
651 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
652 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
653 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
654 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
655 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
656 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
657 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
658 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
659 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
660 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
661 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
662 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
663 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
664 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
665 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
666 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
668 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
669 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
670 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
673 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
674 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
676 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
678 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
679 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
680 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
681 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
682 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
683 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
684 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
685 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
686 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
687 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
688 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
689 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
690 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
691 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
692 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
693 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
694 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
695 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
696 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
697 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
698 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
699 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
700 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
701 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
702 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
703 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
704 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
705 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
706 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
707 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
708 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
709 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
710 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
711 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
712 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
713 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
714 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
715 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
716 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
717 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
718 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
719 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
720 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
721 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
722 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
723 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
724 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
725 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
726 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
727 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
728 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
729 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
730 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
731 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
732 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
733 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
734 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
735 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
736 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
737 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
738 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
739 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
740 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
741 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
742 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
743 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
744 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
745 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
746 8005258706 Rhizobium sp. R693 Isolate Nodule
747 8005275841 Rhizobium sp. N4311 Isolate Nodule
748 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
749 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
750 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
751 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
752 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
753 8005321885 Rhizobium sp. R72 Isolate Nodule
754 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
755 8005382845 Rhizobium sp. R634 Isolate Nodule
756 8005395548 Rhizobium sp. R339 Isolate Nodule
757 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
758 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
759 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
760 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
761 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
762 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
763 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
764 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
765 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
766 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
767 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
768 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
769 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
770 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
771 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
772 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
773 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
774 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
775 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
776 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
777 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
778 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
779 8018176218 Rhizobium sp. N122 Isolate Nodule
780 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
781 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
782 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
783 8024501048 Rhizobium sp. H4 Isolate Nodule
784 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
785 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
786 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
787 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
788 8056382006 Rhizobium croatiense 13T Isolate Nodule
789 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
790 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
791 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.87
Metatranscriptomes 0
Isolates 23.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 14.55
Nodule 15.49
Rhizoplane 5.59
Rhizosphere 52.79
Stem 0
Stem Tuber 0
Unclassified 11.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000423 3300001979 Bacteria 18058
2 JGI25155J39150_1000014 3300002704 Bacteria 196159
3 JGI25156J39149_1000037 3300002705 Bacteria 109690
4 JGI25162J39368_1000812 3300002737 Bacteria 20615
5 JGI25154J39366_1000876 3300002738 Bacteria 13004
6 JGI25158J39367_1000019 3300002739 Bacteria 41617
7 JGI25157J39369_1000040 3300002741 Bacteria 126165
8 JGI25152J39213_1000503 3300002773 Bacteria 21792
9 JGI25152J39213_1000625 3300002773 Bacteria 18778
10 JGI25152J39213_1001100 3300002773 Bacteria 12675
11 JGI25152J39213_1003940 3300002773 Bacteria 4858
12 JGI25152J39213_1012362 3300002773 Bacteria 1838
13 JGI25152J39213_1015307 3300002773 Bacteria 1517
14 JGI25150J39212_1000065 3300002774 Bacteria 63825
15 JGI25159J45721_1000877 3300002987 Bacteria 13071
16 JGI25159J45721_1014248 3300002987 Bacteria 1802
17 JGI25151J46595_10000367 3300003187 Bacteria 47332
18 JGI25151J46595_10000921 3300003187 Bacteria 22894
19 JGI25151J46595_10003025 3300003187 Bacteria 9543
20 JGI25151J46595_10014979 3300003187 Bacteria 3440
21 JGI25151J46595_10016279 3300003187 Bacteria 3256
22 JGI25151J46595_10036533 3300003187 Bacteria 1852
23 JGI25406J46586_10000043 3300003203 Bacteria 55866
24 JGI25165J46597_1000903 3300003214 Bacteria 20623
25 JGI25165J46597_1001166 3300003214 Bacteria 16164
26 JGI25153J46596_10000584 3300003215 Bacteria 22421
27 JGI25153J46596_10002664 3300003215 Bacteria 10200
28 JGI25153J46596_10012117 3300003215 Bacteria 3753
29 JGI25153J46596_10013173 3300003215 Bacteria 3514
30 JGI25153J46596_10025022 3300003215 Bacteria 2141
31 JGI25153J46596_10030729 3300003215 Bacteria 1822
32 JGI25153J46596_10037582 3300003215 Bacteria 1537
33 rootL2_10000510 3300003322 Bacteria 5722
34 JGI25160J50197_1000001 3300003354 Bacteria 782301
35 JGI25160J50197_1005650 3300003354 Bacteria 5174
36 JGI25160J50197_1014031 3300003354 Bacteria 2699
37 JGI25161J50226_1000001 3300003374 Bacteria 655036
38 JGI25161J50226_1000068 3300003374 Bacteria 90522
39 JGI25161J50226_1002399 3300003374 Bacteria 4825
40 Ga0055526_1002736 3300003771 Bacteria 11710
41 Ga0055526_1002871 3300003771 Bacteria 11351
42 Ga0055526_1006392 3300003771 Bacteria 6403
43 Ga0055526_1013626 3300003771 Bacteria 3421
44 Ga0055524_1000844 3300003775 Bacteria 20102
45 Ga0055524_1001783 3300003775 Bacteria 11818
46 Ga0055524_1008042 3300003775 Bacteria 4415
47 Ga0055524_1008939 3300003775 Bacteria 4120
48 Ga0055528_1000256 3300003790 Bacteria 45159
49 Ga0055528_1001239 3300003790 Bacteria 16230
50 Ga0055528_1005673 3300003790 Bacteria 5757
51 Ga0055528_1008996 3300003790 Bacteria 4216
52 Ga0055540_1001197 3300003792 Bacteria 16000
53 Ga0055540_1001577 3300003792 Bacteria 13292
54 Ga0058692_1003742 3300003856 Bacteria 4642
55 Ga0058692_1012637 3300003856 Bacteria 1993
56 Ga0055543_1000003 3300004625 Bacteria 358656
57 Ga0055543_1000189 3300004625 Bacteria 50188
58 Ga0055543_1000421 3300004625 Bacteria 26753
59 Ga0065165_1000335 3300005262 Bacteria 77037
60 Ga0065165_1004192 3300005262 Bacteria 9187
61 Ga0065165_1014635 3300005262 Bacteria 3036
62 Ga0065165_1035029 3300005262 Bacteria 1545
63 Ga0070658_10028370 3300005327 Bacteria 4493
64 Ga0070658_10041410 3300005327 Bacteria 3716
65 Ga0070676_10018800 3300005328 Bacteria 3835
66 Ga0070690_100007090 3300005330 Bacteria 6402
67 Ga0070690_100021605 3300005330 Bacteria 3931
68 Ga0070670_100015142 3300005331 Bacteria 6618
69 Ga0068869_100008016 3300005334 Bacteria 6785
70 Ga0068869_100187055 3300005334 Bacteria 1626
71 Ga0070680_100009063 3300005336 Bacteria 7630
72 Ga0070680_100017028 3300005336 Bacteria 5725
73 Ga0070680_100024074 3300005336 Bacteria 4860
74 Ga0070680_100039172 3300005336 Bacteria 3836
75 Ga0070680_100055551 3300005336 Bacteria 3236
76 Ga0070682_100006798 3300005337 Bacteria 6419
77 Ga0068868_100011527 3300005338 Bacteria 6439
78 Ga0068868_100037777 3300005338 Bacteria 3745
79 Ga0070660_100020869 3300005339 Bacteria 4822
80 Ga0070660_100208762 3300005339 Bacteria 1585
81 Ga0070689_100002488 3300005340 Bacteria 12048
82 Ga0070689_100129908 3300005340 Bacteria 2019
83 Ga0070691_10003165 3300005341 Bacteria 7367
84 Ga0070691_10006024 3300005341 Bacteria 5535
85 Ga0070687_100017051 3300005343 Bacteria 3331
86 Ga0070661_100006175 3300005344 Bacteria 8258
87 Ga0070668_100000234 3300005347 Bacteria 36207
88 Ga0070668_100028088 3300005347 Bacteria 4270
89 Ga0070669_100013989 3300005353 Bacteria 5706
90 Ga0070675_100076779 3300005354 Bacteria 2779
91 Ga0070671_100073641 3300005355 Bacteria 2853
92 Ga0070671_100121087 3300005355 Bacteria 2202
93 Ga0070674_100001018 3300005356 Bacteria 14617
94 Ga0070674_100100868 3300005356 Bacteria 2103
95 Ga0070674_100123582 3300005356 Bacteria 1919
96 Ga0070673_100000403 3300005364 Bacteria 22935
97 Ga0070659_100007757 3300005366 Bacteria 7806
98 Ga0070667_100008949 3300005367 Bacteria 8290
99 Ga0070667_100014739 3300005367 Bacteria 6459
100 Ga0070703_10000529 3300005406 Bacteria 14371
101 Ga0070703_10019591 3300005406 Bacteria 1962
102 Ga0070709_10031127 3300005434 Bacteria 3208
103 Ga0070709_10042094 3300005434 Bacteria 2819
104 Ga0070714_100014994 3300005435 Bacteria 6229
105 Ga0070714_100022160 3300005435 Bacteria 5206
106 Ga0070714_100035924 3300005435 Bacteria 4154
107 Ga0070713_100013219 3300005436 Bacteria 6086
108 Ga0070713_100103755 3300005436 Bacteria 2468
109 Ga0070710_10080913 3300005437 Bacteria 1896
110 Ga0070701_10051668 3300005438 Bacteria 2133
111 Ga0070711_100038095 3300005439 Bacteria 3230
112 Ga0070705_100002587 3300005440 Bacteria 9071
113 Ga0070705_100017036 3300005440 Bacteria 3785
114 Ga0070705_100066043 3300005440 Bacteria 2168
115 Ga0070700_100000966 3300005441 Bacteria 14202
116 Ga0070700_100002386 3300005441 Bacteria 9574
117 Ga0070694_100000337 3300005444 Bacteria 25194
118 Ga0070694_100009764 3300005444 Bacteria 5894
119 Ga0070708_100044042 3300005445 Bacteria 3923
120 Ga0070663_100015445 3300005455 Bacteria 4930
121 Ga0070678_100004169 3300005456 Bacteria 8155
122 Ga0070678_100009294 3300005456 Bacteria 5946
123 Ga0070678_100037609 3300005456 Bacteria 3400
124 Ga0070662_100011648 3300005457 Bacteria 5806
125 Ga0070681_10007604 3300005458 Bacteria 10593
126 Ga0070681_10027924 3300005458 Bacteria 5673
127 Ga0070681_10052599 3300005458 Bacteria 4062
128 Ga0068867_100076738 3300005459 Bacteria 2509
129 Ga0068867_100080436 3300005459 Bacteria 2454
130 Ga0068867_100101674 3300005459 Bacteria 2196
131 Ga0068867_100150560 3300005459 Bacteria 1827
132 Ga0070685_10075629 3300005466 Bacteria 2006
133 Ga0070706_100183764 3300005467 Bacteria 1953
134 Ga0070707_100109867 3300005468 Bacteria 2674
135 Ga0070698_100032559 3300005471 Bacteria 5399
136 Ga0070699_100000211 3300005518 Bacteria 57596
137 Ga0070679_100007751 3300005530 Bacteria 10056
138 Ga0070684_100015146 3300005535 Bacteria 6270
139 Ga0070697_100003566 3300005536 Bacteria 11961
140 Ga0070697_100008374 3300005536 Bacteria 8070
141 Ga0070672_100111227 3300005543 Bacteria 2233
142 Ga0070686_100003976 3300005544 Bacteria 8130
143 Ga0070686_100094090 3300005544 Bacteria 2011
144 Ga0070695_100000528 3300005545 Bacteria 20195
145 Ga0070695_100007260 3300005545 Bacteria 6570
146 Ga0070695_100053987 3300005545 Bacteria 2585
147 Ga0070695_100082458 3300005545 Bacteria 2129
148 Ga0070696_100000025 3300005546 Bacteria 68455
149 Ga0070696_100021726 3300005546 Bacteria 4353
150 Ga0070693_100026560 3300005547 Bacteria 3127
151 Ga0070693_100060064 3300005547 Bacteria 2206
152 Ga0070665_100004062 3300005548 Bacteria 15397
153 Ga0070665_100014688 3300005548 Bacteria 7857
154 Ga0070665_100035974 3300005548 Bacteria 4982
155 Ga0070665_100095758 3300005548 Bacteria 2973
156 Ga0070665_100172326 3300005548 Bacteria 2165
157 Ga0070665_100183478 3300005548 Bacteria 2093
158 Ga0070704_100000088 3300005549 Bacteria 31829
159 Ga0070704_100023343 3300005549 Bacteria 4038
160 Ga0068855_100181107 3300005563 Bacteria 2382
161 Ga0070664_100002217 3300005564 Bacteria 15619
162 Ga0068857_100000858 3300005577 Bacteria 22797
163 Ga0068857_100015135 3300005577 Bacteria 6733
164 Ga0068854_100109640 3300005578 Bacteria 2080
165 Ga0068854_100144178 3300005578 Bacteria 1831
166 Ga0068856_100007771 3300005614 Bacteria 10474
167 Ga0068856_100098838 3300005614 Bacteria 2909
168 Ga0068856_100126841 3300005614 Bacteria 2555
169 Ga0068856_100139066 3300005614 Bacteria 2435
170 Ga0070702_100013195 3300005615 Bacteria 4165
171 Ga0068852_100015530 3300005616 Bacteria 5911
172 Ga0068852_100018831 3300005616 Bacteria 5448
173 Ga0068859_100004630 3300005617 Bacteria 14009
174 Ga0068859_100156635 3300005617 Bacteria 2355
175 Ga0068859_100185676 3300005617 Bacteria 2163
176 Ga0068864_100052482 3300005618 Bacteria 3514
177 Ga0068866_10029980 3300005718 Bacteria 2606
178 Ga0068861_100001266 3300005719 Bacteria 15769
179 Ga0068861_100018065 3300005719 Bacteria 5015
180 Ga0068861_100029518 3300005719 Bacteria 4012
181 Ga0068870_10080199 3300005840 Bacteria 1802
182 Ga0068863_100212109 3300005841 Bacteria 1865
183 Ga0068863_100226485 3300005841 Bacteria 1802
184 Ga0068858_100022612 3300005842 Bacteria 5864
185 Ga0068858_100024334 3300005842 Bacteria 5642
186 Ga0068858_100095408 3300005842 Bacteria 2771
187 Ga0068860_100000866 3300005843 Bacteria 33672
188 Ga0068860_100074117 3300005843 Bacteria 3236
189 Ga0068862_100003544 3300005844 Bacteria 13382
190 Ga0068862_100003947 3300005844 Bacteria 12611
191 Ga0068862_100010822 3300005844 Bacteria 7535
192 Ga0068862_100148874 3300005844 Bacteria 2082
193 Ga0081455_10000028 3300005937 Bacteria 155778
194 Ga0081455_10005953 3300005937 Bacteria 13229
195 Ga0081455_10010832 3300005937 Bacteria 9207
196 Ga0081455_10014732 3300005937 Bacteria 7633
197 Ga0081455_10028468 3300005937 Bacteria 5105
198 Ga0081455_10031097 3300005937 Bacteria 4835
199 Ga0081455_10032844 3300005937 Bacteria 4670
200 Ga0081538_10001580 3300005981 Bacteria 23375
201 Ga0081540_1000060 3300005983 Bacteria 119707
202 Ga0081540_1001329 3300005983 Bacteria 21570
203 Ga0081540_1002655 3300005983 Bacteria 14544
204 Ga0081540_1006504 3300005983 Bacteria 8494
205 Ga0081540_1010381 3300005983 Bacteria 6314
206 Ga0081540_1022796 3300005983 Bacteria 3688
207 Ga0081539_10000324 3300005985 Bacteria 106549
208 Ga0070717_10002247 3300006028 Bacteria 13537
209 Ga0075365_10000668 3300006038 Bacteria 13715
210 Ga0075365_10000714 3300006038 Bacteria 13415
211 Ga0075365_10003031 3300006038 Bacteria 8519
212 Ga0075365_10006740 3300006038 Bacteria 6353
213 Ga0075365_10010597 3300006038 Bacteria 5378
214 Ga0075365_10026619 3300006038 Bacteria 3673
215 Ga0075368_10006727 3300006042 Bacteria 4035
216 Ga0075368_10007363 3300006042 Bacteria 3881
217 Ga0075363_100006948 3300006048 Bacteria 5174
218 Ga0075363_100016324 3300006048 Bacteria 3667
219 Ga0075363_100055676 3300006048 Bacteria 2119
220 Ga0075364_10016329 3300006051 Bacteria 4616
221 Ga0075364_10023681 3300006051 Bacteria 3890
222 Ga0075364_10048395 3300006051 Bacteria 2770
223 Ga0070715_10004334 3300006163 Bacteria 4640
224 Ga0070715_10051545 3300006163 Bacteria 1771
225 Ga0070716_100002741 3300006173 Bacteria 8175
226 Ga0070716_100027145 3300006173 Bacteria 3072
227 Ga0070712_100018715 3300006175 Bacteria 4504
228 Ga0075362_10002069 3300006177 Bacteria 6623
229 Ga0075367_10000307 3300006178 Bacteria 17312
230 Ga0075367_10006662 3300006178 Bacteria 5857
231 Ga0075367_10007788 3300006178 Bacteria 5509
232 Ga0075367_10039569 3300006178 Bacteria 2749
233 Ga0075367_10041292 3300006178 Bacteria 2696
234 Ga0075367_10042342 3300006178 Bacteria 2664
235 Ga0075369_10002993 3300006186 Bacteria 6107
236 Ga0075369_10017136 3300006186 Bacteria 2932
237 Ga0075366_10001623 3300006195 Bacteria 11269
238 Ga0075366_10035707 3300006195 Bacteria 2931
239 Ga0075366_10097697 3300006195 Bacteria 1761
240 Ga0097621_100034300 3300006237 Bacteria 4048
241 Ga0075370_10027615 3300006353 Bacteria 3150
242 Ga0075370_10032675 3300006353 Bacteria 2910
243 Ga0075428_100004552 3300006844 Bacteria 15331
244 Ga0075428_100020096 3300006844 Bacteria 7395
245 Ga0075428_100172714 3300006844 Bacteria 2342
246 Ga0075428_100224414 3300006844 Bacteria 2028
247 Ga0075431_100001225 3300006847 Bacteria 23251
248 Ga0075431_100003740 3300006847 Bacteria 14780
249 Ga0075431_100094794 3300006847 Bacteria 3080
250 Ga0075433_10101808 3300006852 Bacteria 2543
251 Ga0075434_100004034 3300006871 Bacteria 13165
252 Ga0075434_100143512 3300006871 Bacteria 2408
253 Ga0075429_100031033 3300006880 Bacteria 4644
254 Ga0075429_100067427 3300006880 Bacteria 3114
255 Ga0075429_100120398 3300006880 Bacteria 2294
256 Ga0075436_100082943 3300006914 Bacteria 2224
257 Ga0097620_100004630 3300006931 Bacteria 14009
258 Ga0097620_100156641 3300006931 Bacteria 2355
259 Ga0097620_100185673 3300006931 Bacteria 2163
260 Ga0079104_1000045 3300006946 Bacteria 183705
261 Ga0099826_10001757 3300006948 Bacteria 13397
262 Ga0075435_100043602 3300007076 Bacteria 3591
263 Ga0105250_10037129 3300009092 Bacteria 1955
264 Ga0105240_10000014 3300009093 Bacteria 482033
265 Ga0105240_10079458 3300009093 Bacteria 4036
266 Ga0111539_10002206 3300009094 Bacteria 26008
267 Ga0111539_10029699 3300009094 Bacteria 6654
268 Ga0111539_10033166 3300009094 Bacteria 6270
269 Ga0111539_10084829 3300009094 Bacteria 3723
270 Ga0111539_10092241 3300009094 Bacteria 3559
271 Ga0111539_10093995 3300009094 Bacteria 3522
272 Ga0105245_10031108 3300009098 Bacteria 4721
273 Ga0105245_10076125 3300009098 Bacteria 3056
274 Ga0105245_10101671 3300009098 Bacteria 2661
275 Ga0105247_10031473 3300009101 Bacteria 3220
276 Ga0105247_10084212 3300009101 Bacteria 2009
277 Ga0105247_10122288 3300009101 Bacteria 1688
278 Ga0114129_10066061 3300009147 Bacteria 5045
279 Ga0114129_10069645 3300009147 Bacteria 4903
280 Ga0114129_10136655 3300009147 Bacteria 3363
281 Ga0105243_10005218 3300009148 Bacteria 10164
282 Ga0105243_10084484 3300009148 Bacteria 2600
283 Ga0105241_10017412 3300009174 Bacteria 5281
284 Ga0105241_10086268 3300009174 Bacteria 2469
285 Ga0105242_10043466 3300009176 Bacteria 3635
286 Ga0105248_10002357 3300009177 Bacteria 20976
287 Ga0105248_10017355 3300009177 Bacteria 7934
288 Ga0105248_10084418 3300009177 Bacteria 3573
289 Ga0105248_10143827 3300009177 Bacteria 2691
290 Ga0105237_10001173 3300009545 Bacteria 35022
291 Ga0105237_10012548 3300009545 Bacteria 8926
292 Ga0105237_10109882 3300009545 Bacteria 2749
293 Ga0105237_10141696 3300009545 Bacteria 2398
294 Ga0105249_10006404 3300009553 Bacteria 10238
295 Ga0105249_10039488 3300009553 Bacteria 4286
296 Ga0105249_10090229 3300009553 Bacteria 2865
297 Ga0123341_1000028 3300009765 Bacteria 69145
298 Ga0123342_1025236 3300009766 Bacteria 3608
299 Ga0099796_10001582 3300010159 Bacteria 4665
300 Ga0105239_10007720 3300010375 Bacteria 12311
301 Ga0105239_10163227 3300010375 Bacteria 2490
302 Ga0105246_10012175 3300011119 Bacteria 5359
303 Ga0105246_10071014 3300011119 Bacteria 2451
304 Ga0105246_10179360 3300011119 Bacteria 1629
305 Ga0157373_10045009 3300013100 Bacteria 3151
306 Ga0157371_10000017 3300013102 Bacteria 320830
307 Ga0157371_10096069 3300013102 Bacteria 2100
308 Ga0157370_10000248 3300013104 Bacteria 68580
309 Ga0157370_10000453 3300013104 Bacteria 51332
310 Ga0157370_10121914 3300013104 Bacteria 2435
311 Ga0157369_10122429 3300013105 Bacteria 2759
312 Ga0157374_10025891 3300013296 Bacteria 5273
313 Ga0157378_10012829 3300013297 Bacteria 7335
314 Ga0157378_10071157 3300013297 Bacteria 3123
315 Ga0157378_10184630 3300013297 Bacteria 1963
316 Ga0163162_10011477 3300013306 Bacteria 8639
317 Ga0163162_10085798 3300013306 Bacteria 3226
318 Ga0157372_10003755 3300013307 Bacteria 16310
319 Ga0157372_10004863 3300013307 Bacteria 14274
320 Ga0157372_10018463 3300013307 Bacteria 7497
321 Ga0157375_10003490 3300013308 Bacteria 13634
322 Ga0157375_10015580 3300013308 Bacteria 6809
323 Ga0157375_10020906 3300013308 Bacteria 5990
324 Ga0163163_10009818 3300014325 Bacteria 8576
325 Ga0163163_10091687 3300014325 Bacteria 3053
326 Ga0163163_10129463 3300014325 Bacteria 2564
327 Ga0157380_10008850 3300014326 Bacteria 7193
328 Ga0157380_10011116 3300014326 Bacteria 6494
329 Ga0157380_10048783 3300014326 Bacteria 3337
330 Ga0157377_10011638 3300014745 Bacteria 4397
331 Ga0157379_10019678 3300014968 Bacteria 5963
332 Ga0157379_10045595 3300014968 Bacteria 3913
333 Ga0157379_10082728 3300014968 Bacteria 2876
334 Ga0157376_10001343 3300014969 Bacteria 16214
335 Ga0157376_10007833 3300014969 Bacteria 7658
336 Ga0157376_10044782 3300014969 Bacteria 3639
337 Ga0157376_10240090 3300014969 Bacteria 1688
338 Ga0182007_10002275 3300015262 Bacteria 9674
339 Ga0182005_1003222 3300015265 Bacteria 5583
340 Ga0163161_10019891 3300017792 Bacteria 4709
341 Ga0213876_10000521 3300021384 Bacteria 29455
342 Ga0213875_10000142 3300021388 Bacteria 77423
343 Ga0209435_100027 3300025206 Bacteria 196217
344 Ga0209436_100070 3300025208 Bacteria 51558
345 Ga0209437_100051 3300025233 Bacteria 392523
346 Ga0209437_100098 3300025233 Bacteria 229766
347 Ga0207425_1000055 3300025245 Bacteria 152820
348 Ga0207425_1002623 3300025245 Bacteria 6214
349 Ga0207425_1010050 3300025245 Bacteria 2319
350 Ga0209646_1000086 3300025246 Bacteria 196217
351 Ga0209646_1001543 3300025246 Bacteria 6077
352 Ga0209026_1000082 3300025250 Bacteria 196315
353 Ga0209677_103714 3300025253 Bacteria 4778
354 Ga0209759_1000063 3300025256 Bacteria 196315
355 Ga0209129_1000029 3300025258 Bacteria 401149
356 Ga0209129_1000252 3300025258 Bacteria 55710
357 Ga0209129_1002284 3300025258 Bacteria 9548
358 Ga0209129_1004169 3300025258 Bacteria 5830
359 Ga0209129_1004487 3300025258 Bacteria 5423
360 Ga0209129_1004800 3300025258 Bacteria 5101
361 Ga0209129_1006109 3300025258 Bacteria 4016
362 Ga0209233_1000095 3300025261 Bacteria 303783
363 Ga0209233_1000113 3300025261 Bacteria 253455
364 Ga0209233_1000499 3300025261 Bacteria 23606
365 Ga0209233_1004488 3300025261 Bacteria 4736
366 Ga0209455_1013848 3300025272 Bacteria 1854
367 Ga0209673_1000010 3300025273 Bacteria 596656
368 Ga0209673_1000025 3300025273 Bacteria 404572
369 Ga0209673_1001302 3300025273 Bacteria 25365
370 Ga0209673_1003050 3300025273 Bacteria 10354
371 Ga0209673_1003553 3300025273 Bacteria 9091
372 Ga0209673_1006293 3300025273 Bacteria 5772
373 Ga0209673_1013055 3300025273 Bacteria 3305
374 Ga0209130_1000003 3300025284 Bacteria 677988
375 Ga0209130_1000020 3300025284 Bacteria 379297
376 Ga0209676_1003911 3300025292 Bacteria 8654
377 Ga0209025_1000070 3300025294 Bacteria 287776
378 Ga0209025_1000091 3300025294 Bacteria 250401
379 Ga0209025_1000171 3300025294 Bacteria 160478
380 Ga0209025_1000213 3300025294 Bacteria 139002
381 Ga0209025_1002872 3300025294 Bacteria 17275
382 Ga0209025_1003464 3300025294 Bacteria 14898
383 Ga0209025_1004176 3300025294 Bacteria 12766
384 Ga0209025_1005254 3300025294 Bacteria 10663
385 Ga0209025_1009226 3300025294 Bacteria 6917
386 Ga0209025_1045523 3300025294 Bacteria 1818
387 Ga0209564_1000588 3300025295 Bacteria 57321
388 Ga0209564_1000644 3300025295 Bacteria 52727
389 Ga0209564_1002026 3300025295 Bacteria 17574
390 Ga0209564_1004176 3300025295 Bacteria 9021
391 Ga0209564_1019688 3300025295 Bacteria 2510
392 Ga0209758_1000094 3300025297 Bacteria 241068
393 Ga0209758_1001343 3300025297 Bacteria 29681
394 Ga0209758_1001396 3300025297 Bacteria 28704
395 Ga0209758_1003105 3300025297 Bacteria 15708
396 Ga0209758_1003829 3300025297 Bacteria 13210
397 Ga0209758_1004170 3300025297 Bacteria 12290
398 Ga0209758_1004893 3300025297 Bacteria 10773
399 Ga0209758_1005268 3300025297 Bacteria 10116
400 Ga0209758_1005691 3300025297 Bacteria 9416
401 Ga0209050_1003085 3300025298 Bacteria 12800
402 Ga0209256_1000924 3300025299 Bacteria 35882
403 Ga0209256_1001336 3300025299 Bacteria 26297
404 Ga0209256_1001864 3300025299 Bacteria 19479
405 Ga0209256_1003148 3300025299 Bacteria 12008
406 Ga0209256_1013150 3300025299 Bacteria 3094
407 Ga0207426_1000008 3300025302 Bacteria 848730
408 Ga0207426_1000011 3300025302 Bacteria 791203
409 Ga0207426_1000218 3300025302 Bacteria 135865
410 Ga0207426_1001028 3300025302 Bacteria 26709
411 Ga0209051_1000393 3300025303 Bacteria 60776
412 Ga0209051_1000645 3300025303 Bacteria 39647
413 Ga0209051_1002788 3300025303 Bacteria 12055
414 Ga0209051_1003537 3300025303 Bacteria 10186
415 Ga0209051_1044163 3300025303 Bacteria 1555
416 Ga0209257_1001083 3300025304 Bacteria 35747
417 Ga0209257_1001180 3300025304 Bacteria 33048
418 Ga0207653_10000563 3300025885 Bacteria 13454
419 Ga0207653_10006390 3300025885 Bacteria 3676
420 Ga0207682_10003335 3300025893 Bacteria 7001
421 Ga0207692_10019608 3300025898 Bacteria 3060
422 Ga0207688_10002165 3300025901 Bacteria 10566
423 Ga0207647_10002823 3300025904 Bacteria 13108
424 Ga0207699_10025065 3300025906 Bacteria 3271
425 Ga0207643_10070492 3300025908 Bacteria 2010
426 Ga0207684_10181512 3300025910 Bacteria 1815
427 Ga0207654_10054155 3300025911 Bacteria 2318
428 Ga0207654_10057170 3300025911 Bacteria 2266
429 Ga0207707_10020676 3300025912 Bacteria 5748
430 Ga0207707_10177401 3300025912 Bacteria 1861
431 Ga0207695_10000037 3300025913 Bacteria 476303
432 Ga0207671_10005059 3300025914 Bacteria 12314
433 Ga0207671_10023035 3300025914 Bacteria 4700
434 Ga0207671_10149864 3300025914 Bacteria 1802
435 Ga0207693_10028254 3300025915 Bacteria 4432
436 Ga0207663_10008963 3300025916 Bacteria 5264
437 Ga0207660_10027905 3300025917 Bacteria 3858
438 Ga0207662_10024185 3300025918 Bacteria 3495
439 Ga0207657_10000793 3300025919 Bacteria 33507
440 Ga0207657_10018024 3300025919 Bacteria 6754
441 Ga0207657_10109973 3300025919 Bacteria 2277
442 Ga0207649_10024229 3300025920 Bacteria 3525
443 Ga0207681_10008095 3300025923 Bacteria 6432
444 Ga0207694_10128085 3300025924 Bacteria 2033
445 Ga0207650_10024193 3300025925 Bacteria 4314
446 Ga0207650_10068179 3300025925 Bacteria 2671
447 Ga0207659_10067361 3300025926 Bacteria 2600
448 Ga0207659_10125754 3300025926 Bacteria 1971
449 Ga0207700_10003685 3300025928 Bacteria 8938
450 Ga0207700_10062861 3300025928 Bacteria 2821
451 Ga0207664_10021260 3300025929 Bacteria 4821
452 Ga0207664_10108706 3300025929 Bacteria 2303
453 Ga0207664_10160590 3300025929 Bacteria 1917
454 Ga0207644_10189785 3300025931 Bacteria 1615
455 Ga0207690_10047721 3300025932 Bacteria 2843
456 Ga0207690_10065726 3300025932 Bacteria 2481
457 Ga0207706_10000771 3300025933 Bacteria 33246
458 Ga0207706_10043108 3300025933 Bacteria 3999
459 Ga0207686_10071238 3300025934 Bacteria 2236
460 Ga0207709_10036879 3300025935 Bacteria 2901
461 Ga0207709_10039590 3300025935 Bacteria 2816
462 Ga0207709_10055490 3300025935 Bacteria 2448
463 Ga0207670_10037361 3300025936 Bacteria 3164
464 Ga0207670_10123193 3300025936 Bacteria 1888
465 Ga0207669_10001419 3300025937 Bacteria 10207
466 Ga0207669_10077770 3300025937 Bacteria 2111
467 Ga0207669_10095630 3300025937 Bacteria 1948
468 Ga0207704_10005472 3300025938 Bacteria 5855
469 Ga0207704_10007858 3300025938 Bacteria 5062
470 Ga0207665_10006767 3300025939 Bacteria 7594
471 Ga0207691_10036074 3300025940 Bacteria 4583
472 Ga0207691_10038271 3300025940 Bacteria 4438
473 Ga0207691_10059792 3300025940 Bacteria 3464
474 Ga0207689_10012615 3300025942 Bacteria 7218
475 Ga0207689_10069328 3300025942 Bacteria 2897
476 Ga0207689_10121753 3300025942 Bacteria 2146
477 Ga0207689_10142013 3300025942 Bacteria 1978
478 Ga0207661_10000597 3300025944 Bacteria 23061
479 Ga0207667_10090709 3300025949 Bacteria 3158
480 Ga0207651_10099624 3300025960 Bacteria 2152
481 Ga0207712_10005896 3300025961 Bacteria 7723
482 Ga0207712_10139080 3300025961 Bacteria 1861
483 Ga0207668_10047803 3300025972 Bacteria 2932
484 Ga0207640_10132968 3300025981 Bacteria 1801
485 Ga0207658_10017328 3300025986 Bacteria 4962
486 Ga0207658_10088849 3300025986 Bacteria 2390
487 Ga0207658_10198316 3300025986 Bacteria 1674
488 Ga0207677_10022070 3300026023 Bacteria 3904
489 Ga0207703_10037399 3300026035 Bacteria 3866
490 Ga0207678_10001022 3300026067 Bacteria 25519
491 Ga0207678_10005903 3300026067 Bacteria 10911
492 Ga0207678_10027856 3300026067 Bacteria 4933
493 Ga0207678_10051786 3300026067 Bacteria 3543
494 Ga0207708_10008989 3300026075 Bacteria 7394
495 Ga0207708_10017744 3300026075 Bacteria 5358
496 Ga0207708_10026614 3300026075 Bacteria 4380
497 Ga0207702_10032087 3300026078 Bacteria 4382
498 Ga0207702_10197203 3300026078 Bacteria 1864
499 Ga0207702_10263736 3300026078 Bacteria 1623
500 Ga0207641_10186921 3300026088 Bacteria 1901
501 Ga0207641_10249858 3300026088 Bacteria 1656
502 Ga0207648_10009097 3300026089 Bacteria 9549
503 Ga0207648_10019785 3300026089 Bacteria 6074
504 Ga0207648_10086932 3300026089 Bacteria 2728
505 Ga0207676_10038454 3300026095 Bacteria 3652
506 Ga0207674_10002080 3300026116 Bacteria 25369
507 Ga0207674_10004073 3300026116 Bacteria 17710
508 Ga0207674_10018036 3300026116 Bacteria 7688
509 Ga0207675_100000706 3300026118 Bacteria 33090
510 Ga0207675_100026125 3300026118 Bacteria 5435
511 Ga0207675_100040082 3300026118 Bacteria 4371
512 Ga0207683_10005141 3300026121 Bacteria 11234
513 Ga0207683_10013991 3300026121 Bacteria 6842
514 Ga0207683_10018157 3300026121 Bacteria 5999
515 Ga0207698_10014910 3300026142 Bacteria 5186
516 Ga0209281_1000034 3300027111 Bacteria 382562
517 Ga0209371_1000022 3300027312 Bacteria 536342
518 Ga0209371_1002636 3300027312 Bacteria 9805
519 Ga0209813_10000942 3300027866 Bacteria 6546
520 Ga0209813_10001527 3300027866 Bacteria 5192
521 Ga0209813_10011255 3300027866 Bacteria 2334
522 Ga0207428_10112701 3300027907 Bacteria 2092
523 Ga0207428_10121934 3300027907 Bacteria 1999
524 Ga0268266_10002343 3300028379 Bacteria 20488
525 Ga0268266_10006350 3300028379 Bacteria 10834
526 Ga0268266_10062684 3300028379 Bacteria 3209
527 Ga0268266_10159375 3300028379 Bacteria 2040
528 Ga0268265_10003697 3300028380 Bacteria 10899
529 Ga0268265_10011309 3300028380 Bacteria 6035
530 Ga0268265_10028782 3300028380 Bacteria 3982
531 Ga0268265_10039667 3300028380 Bacteria 3472
532 Ga0268265_10056528 3300028380 Bacteria 2986
533 Ga0268265_10251197 3300028380 Bacteria 1566
534 Ga0268264_10002123 3300028381 Bacteria 17683
535 Ga0307517_10007290 3300028786 Bacteria 16162
536 Ga0307515_10024602 3300028794 Bacteria 10484
537 Ga0307515_10037579 3300028794 Bacteria 7781
538 Ga0268256_1000019 3300030500 Bacteria 587949
539 Ga0268256_1009737 3300030500 Bacteria 3155
540 Ga0265330_10022020 3300031235 Bacteria 2903
541 Ga0265332_10003124 3300031238 Bacteria 8068
542 Ga0265332_10015403 3300031238 Bacteria 3374
543 Ga0265328_10000013 3300031239 Bacteria 156079
544 Ga0265328_10006035 3300031239 Bacteria 5158
545 Ga0265320_10005625 3300031240 Bacteria 8006
546 Ga0265325_10066241 3300031241 Bacteria 1822
547 Ga0265329_10004853 3300031242 Bacteria 5512
548 Ga0265340_10004018 3300031247 Bacteria 8265
549 Ga0265339_10003260 3300031249 Bacteria 11369
550 Ga0265339_10009125 3300031249 Bacteria 6263
551 Ga0265339_10037528 3300031249 Bacteria 2707
552 Ga0265339_10054451 3300031249 Bacteria 2173
553 Ga0265316_10014590 3300031344 Bacteria 6908
554 Ga0265316_10115821 3300031344 Bacteria 2026
555 Ga0307513_10093541 3300031456 Bacteria 3055
556 Ga0307408_100145506 3300031548 Bacteria 1865
557 Ga0265313_10011740 3300031595 Bacteria 5422
558 Ga0265342_10000281 3300031712 Bacteria 57398
559 Ga0265342_10006089 3300031712 Bacteria 9051
560 Ga0316578_10043757 3300031728 Bacteria 2602
561 Ga0307405_10076695 3300031731 Bacteria 2169
562 Ga0307413_10054839 3300031824 Bacteria 2421
563 Ga0307412_10005488 3300031911 Bacteria 7122
564 Ga0307510_10015785 3300033180 Bacteria 8928
565 Ga0315911_1000012 3300033442 Bacteria 248988
566 Ga0373936_0012798 3300035113 Bacteria 3198
567 Ga0373939_0008986 3300035114 Bacteria 2464
568 Ga0373960_0008663 3300035121 Bacteria 2444
569 Ga0373960_0013296 3300035121 Bacteria 2063
570 Ga0373942_0008134 3300035207 Bacteria 2440
571 Ga0373961_0012093 3300035241 Bacteria 2154
572 Ga0373962_0002198 3300035242 Bacteria 4654
573 Ga0316574_0083679 3300035398 Bacteria 2028
574 Ga0373931_0000542 3300035691 Bacteria 15487
575 Ga0373931_0013329 3300035691 Bacteria 4001
576 Ga0373931_0015868 3300035691 Bacteria 3699
577 Ga0373931_0035062 3300035691 Bacteria 2606
578 Ga0373927_0037711 3300035695 Bacteria 3140
579 Ga0373927_0104814 3300035695 Bacteria 1841
580 Ga0316582_0017083 3300036647 Bacteria 4189
581 Ga0316584_0010059 3300036712 Bacteria 6593
582 Ga0316584_0024612 3300036712 Bacteria 4407
583 Ga0395899_0016833 3300037312 Bacteria 5574
584 Ga0395899_0062406 3300037312 Bacteria 2744
585 Ga0395900_0005676 3300037418 Bacteria 13049
586 Ga0395900_0142224 3300037418 Bacteria 2456
587 Ga0395898_0024654 3300037466 Bacteria 6068
588 Ga0395898_0178160 3300037466 Bacteria 2031
589 Ga0395905_0002783 3300037471 Bacteria 19151
590 Ga0436364_0634277 3300037853 Bacteria 5458
591 Ga0436364_1294173 3300037853 Bacteria 2484
592 Ga0436364_1465979 3300037853 Bacteria 23307
593 Ga0436365_1935268 3300039437 Bacteria 135877
594 Ga0439453_0000474 3300041408 Bacteria 4393
595 Ga0439465_0003165 3300041413 Bacteria 5369
596 Ga0451839_1004641 3300041496 Bacteria 2346
597 Ga0451841_0076277 3300041498 Bacteria 2008
598 Ga0451853_2995973 3300041512 Bacteria 1974
599 Ga0439435_0011362 3300042436 Bacteria 2136
600 Ga0439435_0014143 3300042436 Bacteria 1968
601 Ga0439460_0019128 3300042461 Bacteria 1851
602 Ga0466966_0044254 3300044684 Bacteria 2851
603 Ga0466966_0095551 3300044684 Bacteria 1841
604 Ga0466959_0025947 3300045049 Bacteria 4345
605 Ga0495592_0043717 3300046454 Bacteria 3350
606 Ga0495603_0007974 3300046455 Bacteria 6391
607 Ga0495629_0001711 3300046459 Bacteria 17228
608 Ga0495638_0000679 3300046460 Bacteria 36986
609 Ga0495638_0020829 3300046460 Bacteria 4330
610 Ga0495638_0099384 3300046460 Bacteria 1742
611 Ga0495641_0029859 3300046461 Bacteria 2621
612 Ga0495651_0044401 3300046462 Bacteria 3445
613 Ga0495651_0113317 3300046462 Bacteria 2002
614 Ga0495650_0063003 3300046471 Bacteria 1480
615 Ga0495580_0000341 3300046472 Bacteria 38098
616 Ga0495582_0000352 3300046473 Bacteria 25196
617 Ga0495605_0001576 3300046474 Bacteria 14807
618 Ga0495662_0005789 3300046476 Bacteria 6185
619 Ga0495584_0010636 3300046491 Bacteria 4726
620 Ga0495584_0019729 3300046491 Bacteria 3425
621 Ga0495584_0033859 3300046491 Bacteria 2585
622 Ga0495585_0011315 3300046492 Bacteria 5284
623 Ga0495585_0098445 3300046492 Bacteria 1567
624 Ga0495594_0000049 3300046499 Bacteria 52677
625 Ga0495594_0036768 3300046499 Bacteria 2671
626 Ga0495607_0026885 3300046501 Bacteria 3566
627 Ga0495583_0001761 3300046506 Bacteria 20650
628 Ga0495583_0015906 3300046506 Bacteria 4070
629 Ga0495606_0001738 3300046507 Bacteria 27981
630 Ga0495610_0001284 3300046512 Bacteria 22438
631 Ga0495620_0014239 3300046515 Bacteria 4049
632 Ga0495631_0000730 3300046518 Bacteria 21123
633 Ga0495632_0003008 3300046519 Bacteria 12304
634 Ga0495632_0037343 3300046519 Bacteria 2465
635 Ga0495643_0013305 3300046522 Bacteria 4929
636 Ga0495643_0017611 3300046522 Bacteria 4172
637 Ga0495643_0026246 3300046522 Bacteria 3288
638 Ga0495644_0039694 3300046523 Bacteria 1775
639 Ga0495648_0029417 3300046524 Bacteria 3647
640 Ga0495654_0000340 3300046530 Bacteria 40748
641 Ga0495640_0028235 3300046533 Bacteria 4041
642 Ga0495609_0011033 3300046538 Bacteria 4315
643 Ga0495597_0016698 3300046542 Bacteria 3465
644 Ga0495645_0154668 3300046543 Bacteria 1590
645 Ga0495622_0003452 3300046557 Bacteria 7449
646 Ga0495622_0004709 3300046557 Bacteria 6325
647 Ga0495622_0012739 3300046557 Bacteria 3900
648 Ga0495633_0011174 3300046558 Bacteria 4860
649 Ga0495633_0029770 3300046558 Bacteria 2655
650 Ga0495633_0047117 3300046558 Bacteria 2037
651 Ga0495668_0073452 3300046616 Bacteria 1878
652 Ga0495611_0006826 3300046648 Bacteria 4850
653 Ga0495625_0002939 3300046660 Bacteria 17768
654 Ga0495588_0003299 3300046674 Bacteria 7009
655 Ga0495588_0032571 3300046674 Bacteria 2627
656 Ga0495647_0001152 3300046681 Bacteria 8119
657 Ga0495658_0002888 3300046683 Bacteria 8631
658 Ga0495669_0025273 3300046684 Bacteria 2589
659 Ga0495613_0000244 3300046689 Bacteria 51563
660 Ga0495670_0029574 3300046691 Bacteria 2719
661 Ga0495649_0031997 3300046694 Bacteria 2900
662 Ga0495649_0067809 3300046694 Bacteria 1914
663 Ga0495600_0134447 3300046809 Bacteria 1606
664 Ga0495660_0026020 3300046810 Bacteria 3319
665 Ga0495581_0047371 3300047315 Bacteria 2485
666 Ga0495604_0009407 3300047317 Bacteria 7728
667 Ga0495672_0018870 3300047320 Bacteria 4568
668 Ga0495672_0065538 3300047320 Bacteria 2076
669 Ga0495687_052686 3300047443 Bacteria 1719
670 Ga0495684_0034547 3300047471 Bacteria 3879
671 Ga0495686_0002387 3300047472 Bacteria 17834
672 Ga0495686_0039171 3300047472 Bacteria 3028
673 Ga0495686_0050992 3300047472 Bacteria 2599
674 Ga0495593_0000405 3300047673 Bacteria 23980
675 Ga0495602_0212260 3300048088 Bacteria 1468
676 Ga0495615_0009524 3300048090 Bacteria 1914
677 Ga0495626_0047851 3300048091 Bacteria 1987
678 Ga0496100_0012485 3300048903 Bacteria 4872
679 Ga0496100_0118672 3300048903 Bacteria 1848
680 Ga0496101_0001116 3300048904 Bacteria 15986
681 Ga0496101_0021312 3300048904 Bacteria 4452
682 Ga0496101_0061075 3300048904 Bacteria 2736
683 Ga0496101_0118441 3300048904 Bacteria 2000
684 Ga0496102_0001225 3300048905 Bacteria 23244
685 Ga0496102_0011055 3300048905 Bacteria 7775
686 Ga0496102_0011710 3300048905 Bacteria 7570
687 Ga0496102_0062715 3300048905 Bacteria 3404
688 Ga0496102_0095774 3300048905 Bacteria 2752
689 Ga0496102_0170830 3300048905 Bacteria 2047
690 Ga0496102_0202443 3300048905 Bacteria 1871
691 Ga0496102_0253212 3300048905 Bacteria 1660
692 Ga0496103_0002998 3300048906 Bacteria 10436
693 Ga0496103_0009621 3300048906 Bacteria 5722
694 Ga0496103_0042490 3300048906 Bacteria 2797
695 Ga0496103_0075829 3300048906 Bacteria 2110
696 Ga0496103_0112505 3300048906 Bacteria 1730
697 Ga0496104_0000686 3300048907 Bacteria 29123
698 Ga0496104_0003421 3300048907 Bacteria 13687
699 Ga0496104_0005572 3300048907 Bacteria 11024
700 Ga0496104_0062113 3300048907 Bacteria 3542
701 Ga0496104_0100510 3300048907 Bacteria 2768
702 Ga0496104_0108079 3300048907 Bacteria 2665
703 Ga0496104_0129915 3300048907 Bacteria 2420
704 Ga0496105_0003211 3300048908 Bacteria 12037
705 Ga0496105_0028196 3300048908 Bacteria 4591
706 Ga0496105_0031869 3300048908 Bacteria 4323
707 Ga0496105_0050577 3300048908 Bacteria 3432
708 Ga0496106_0001187 3300048909 Bacteria 19427
709 Ga0496106_0002573 3300048909 Bacteria 13505
710 Ga0496106_0002685 3300048909 Bacteria 13218
711 Ga0496106_0016484 3300048909 Bacteria 5467
712 Ga0496106_0025754 3300048909 Bacteria 4378
713 Ga0496106_0069765 3300048909 Bacteria 2683
714 Ga0496106_0079715 3300048909 Bacteria 2514
715 Ga0496106_0169920 3300048909 Bacteria 1728
716 Ga0496107_0004740 3300048910 Bacteria 9238
717 Ga0496107_0010037 3300048910 Bacteria 6567
718 Ga0496107_0011502 3300048910 Bacteria 6165
719 Ga0496107_0063579 3300048910 Bacteria 2675
720 Ga0496107_0091706 3300048910 Bacteria 2221
721 Ga0496107_0112526 3300048910 Bacteria 2001
722 Ga0496108_0002263 3300048911 Bacteria 15423
723 Ga0496108_0022456 3300048911 Bacteria 5186
724 Ga0496108_0027900 3300048911 Bacteria 4667
725 Ga0496109_0015885 3300048912 Bacteria 6573
726 Ga0496109_0036545 3300048912 Bacteria 4434
727 Ga0496109_0143606 3300048912 Bacteria 2232
728 Ga0496110_0000284 3300048913 Bacteria 33124
729 Ga0496110_0007574 3300048913 Bacteria 8675
730 Ga0496110_0017988 3300048913 Bacteria 5919
731 Ga0496110_0024274 3300048913 Bacteria 5165
732 Ga0496110_0051547 3300048913 Bacteria 3616
733 Ga0496110_0128416 3300048913 Bacteria 2288
734 Ga0496111_0000384 3300048914 Bacteria 22053
735 Ga0496111_0068120 3300048914 Bacteria 2586
736 Ga0496111_0070731 3300048914 Bacteria 2538
737 Ga0496112_0082059 3300048915 Bacteria 3189
738 Ga0496112_0102778 3300048915 Bacteria 2827
739 Ga0496113_0045793 3300048916 Bacteria 3246
740 Ga0496113_0067092 3300048916 Bacteria 2719
741 Ga0496113_0170064 3300048916 Bacteria 1726
742 Ga0496114_0003394 3300048917 Bacteria 12233
743 Ga0496114_0016526 3300048917 Bacteria 5947
744 Ga0496114_0034331 3300048917 Bacteria 4184
745 Ga0496114_0062369 3300048917 Bacteria 3120
746 Ga0496114_0179112 3300048917 Bacteria 1850
747 Ga0496115_0001457 3300048918 Bacteria 16992
748 Ga0496115_0015523 3300048918 Bacteria 5779
749 Ga0496115_0025228 3300048918 Bacteria 4627
750 Ga0496115_0041568 3300048918 Bacteria 3659
751 Ga0496115_0075681 3300048918 Bacteria 2735
752 Ga0496116_0004327 3300048919 Bacteria 13584
753 Ga0496116_0008694 3300048919 Bacteria 8775
754 Ga0496116_0028841 3300048919 Bacteria 4012
755 Ga0496116_0075957 3300048919 Bacteria 2106
756 Ga0496117_0000002 3300048920 Bacteria 2483758
757 Ga0496117_0001837 3300048920 Bacteria 28723
758 Ga0496117_0002461 3300048920 Bacteria 23306
759 Ga0496117_0005543 3300048920 Bacteria 13212
760 Ga0496117_0029084 3300048920 Bacteria 4266
761 Ga0496117_0051521 3300048920 Bacteria 2909
762 Ga0496117_0108756 3300048920 Bacteria 1733
763 Ga0496118_0000504 3300048921 Bacteria 64695
764 Ga0496118_0001992 3300048921 Bacteria 28962
765 Ga0496118_0006810 3300048921 Bacteria 12405
766 Ga0496118_0010841 3300048921 Bacteria 8976
767 Ga0496118_0042282 3300048921 Bacteria 3597
768 Ga0496118_0098291 3300048921 Bacteria 1988
769 Ga0496118_0109008 3300048921 Bacteria 1844
770 Ga0496119_0017979 3300048922 Bacteria 5288
771 Ga0496119_0024804 3300048922 Bacteria 4206
772 Ga0496119_0073263 3300048922 Bacteria 1997
773 Ga0496120_0000248 3300048923 Bacteria 90783
774 Ga0496120_0022579 3300048923 Bacteria 3956
775 Ga0496120_0029651 3300048923 Bacteria 3338
776 Ga0496120_0045353 3300048923 Bacteria 2547
777 Ga0496121_0000003 3300048924 Bacteria 1191431
778 Ga0496121_0002066 3300048924 Bacteria 31785
779 Ga0496121_0002081 3300048924 Bacteria 31581
780 Ga0496121_0014899 3300048924 Bacteria 8196
781 Ga0496121_0024137 3300048924 Bacteria 5825
782 Ga0496121_0026318 3300048924 Bacteria 5485
783 Ga0496121_0031226 3300048924 Bacteria 4870
784 Ga0496121_0051303 3300048924 Bacteria 3475
785 Ga0496121_0060589 3300048924 Bacteria 3112
786 Ga0496121_0068006 3300048924 Bacteria 2884
787 Ga0496121_0070766 3300048924 Bacteria 2808
788 Ga0496122_0000004 3300048925 Bacteria 645283
789 Ga0496122_0000157 3300048925 Bacteria 159733
790 Ga0496122_0000464 3300048925 Bacteria 84473
791 Ga0496122_0002548 3300048925 Bacteria 25610
792 Ga0496122_0002992 3300048925 Bacteria 23005
793 Ga0496122_0008594 3300048925 Bacteria 10970
794 Ga0496122_0012347 3300048925 Bacteria 8523
795 Ga0496122_0017363 3300048925 Bacteria 6734
796 Ga0496122_0042048 3300048925 Bacteria 3601
797 Ga0496122_0067283 3300048925 Bacteria 2581
798 Ga0496122_0099410 3300048925 Bacteria 1950
799 Ga0496123_0000007 3300048926 Bacteria 645283
800 Ga0496123_0000048 3300048926 Bacteria 244152
801 Ga0496123_0000147 3300048926 Bacteria 143834
802 Ga0496123_0008732 3300048926 Bacteria 9251
803 Ga0496123_0024846 3300048926 Bacteria 4536
804 Ga0496123_0049001 3300048926 Bacteria 2836
805 Ga0496123_0058792 3300048926 Bacteria 2490
806 Ga0496123_0062745 3300048926 Bacteria 2378
807 Ga0496124_0000252 3300048927 Bacteria 103596
808 Ga0496124_0001975 3300048927 Bacteria 27965
809 Ga0496124_0006419 3300048927 Bacteria 12818
810 Ga0496124_0009611 3300048927 Bacteria 9911
811 Ga0496124_0030203 3300048927 Bacteria 4813
812 Ga0496124_0044775 3300048927 Bacteria 3795
813 Ga0496124_0045079 3300048927 Bacteria 3781
814 Ga0496124_0052642 3300048927 Bacteria 3457
815 Ga0496124_0052659 3300048927 Bacteria 3457
816 Ga0496124_0066889 3300048927 Bacteria 2991
817 Ga0496124_0106607 3300048927 Bacteria 2262
818 Ga0496124_0161723 3300048927 Bacteria 1744
819 Ga0496125_0000039 3300048928 Bacteria 318665
820 Ga0496125_0000158 3300048928 Bacteria 151273
821 Ga0496125_0003285 3300048928 Bacteria 19855
822 Ga0496125_0003542 3300048928 Bacteria 18812
823 Ga0496125_0011876 3300048928 Bacteria 8676
824 Ga0496125_0048283 3300048928 Bacteria 3551
825 Ga0496125_0069046 3300048928 Bacteria 2775
826 Ga0496126_0000601 3300048929 Bacteria 67983
827 Ga0496126_0031494 3300048929 Bacteria 5010
828 Ga0496126_0043789 3300048929 Bacteria 4126
829 Ga0496126_0044550 3300048929 Bacteria 4084
830 Ga0495678_038248 3300049459 Bacteria 1943
831 Ga0501031_0000946 3300049568 Bacteria 17557
832 Ga0501031_0001971 3300049568 Bacteria 12963
833 Ga0501031_0007375 3300049568 Bacteria 7169
834 Ga0501031_0016379 3300049568 Bacteria 4814
835 Ga0501032_0000024 3300049569 Bacteria 143876
836 Ga0501032_0000045 3300049569 Bacteria 110632
837 Ga0501032_0000503 3300049569 Bacteria 31656
838 Ga0501032_0003274 3300049569 Bacteria 12461
839 Ga0501032_0003745 3300049569 Bacteria 11530
840 Ga0501032_0088721 3300049569 Bacteria 2053
841 Ga0501033_0000140 3300049570 Bacteria 70162
842 Ga0501033_0000391 3300049570 Bacteria 42136
843 Ga0501033_0001234 3300049570 Bacteria 22939
844 Ga0501033_0005696 3300049570 Bacteria 9821
845 Ga0501033_0019665 3300049570 Bacteria 5103
846 Ga0501033_0059447 3300049570 Bacteria 2822
847 Ga0501033_0060542 3300049570 Bacteria 2793
848 Ga0501033_0062142 3300049570 Bacteria 2751
849 Ga0501033_0155037 3300049570 Bacteria 1651
850 Ga0501033_0175882 3300049570 Bacteria 1536
851 Ga0501034_0000001 3300049571 Bacteria 2184493
852 Ga0501034_0000031 3300049571 Bacteria 244022
853 Ga0501034_0000072 3300049571 Bacteria 179824
854 Ga0501034_0000140 3300049571 Bacteria 134996
855 Ga0501034_0001662 3300049571 Bacteria 28665
856 Ga0501034_0016783 3300049571 Bacteria 7507
857 Ga0501034_0029807 3300049571 Bacteria 5547
858 Ga0501034_0032089 3300049571 Bacteria 5336
859 Ga0501034_0068842 3300049571 Bacteria 3550
860 Ga0501034_0132990 3300049571 Bacteria 2470
861 Ga0501034_0155559 3300049571 Bacteria 2260
862 Ga0501034_0165952 3300049571 Bacteria 2177
863 Ga0501034_0218372 3300049571 Bacteria 1859
864 Ga0501036_0000050 3300049572 Bacteria 75340
865 Ga0501036_0000443 3300049572 Bacteria 29542
866 Ga0501036_0003158 3300049572 Bacteria 13145
867 Ga0501036_0005542 3300049572 Bacteria 10238
868 Ga0501036_0093539 3300049572 Bacteria 2540
869 Ga0501036_0155848 3300049572 Bacteria 1926
870 Ga0501036_0165509 3300049572 Bacteria 1864
871 Ga0501036_0214633 3300049572 Bacteria 1616
872 Ga0501036_0255041 3300049572 Bacteria 1470
873 Ga0501037_0000024 3300049573 Bacteria 146046
874 Ga0501037_0000030 3300049573 Bacteria 136148
875 Ga0501037_0000580 3300049573 Bacteria 28773
876 Ga0501037_0002101 3300049573 Bacteria 14430
877 Ga0501037_0003738 3300049573 Bacteria 11051
878 Ga0501037_0010112 3300049573 Bacteria 6923
879 Ga0501037_0012101 3300049573 Bacteria 6355
880 Ga0501037_0030562 3300049573 Bacteria 3980
881 Ga0501037_0066770 3300049573 Bacteria 2620
882 Ga0501037_0146260 3300049573 Bacteria 1690
883 Ga0501038_0000039 3300049574 Bacteria 122904
884 Ga0501038_0000064 3300049574 Bacteria 87975
885 Ga0501038_0002080 3300049574 Bacteria 18546
886 Ga0501038_0007178 3300049574 Bacteria 10298
887 Ga0501038_0045779 3300049574 Bacteria 3796
888 Ga0501038_0138390 3300049574 Bacteria 1993
889 Ga0501038_0160841 3300049574 Bacteria 1825
890 Ga0501039_0000017 3300049575 Bacteria 189412
891 Ga0501039_0000041 3300049575 Bacteria 113488
892 Ga0501039_0000060 3300049575 Bacteria 85528
893 Ga0501039_0003603 3300049575 Bacteria 11608
894 Ga0501039_0005181 3300049575 Bacteria 9871
895 Ga0501039_0015335 3300049575 Bacteria 5865
896 Ga0501039_0015440 3300049575 Bacteria 5845
897 Ga0501039_0082829 3300049575 Bacteria 2498
898 Ga0501039_0202698 3300049575 Bacteria 1560
899 Ga0501040_0019352 3300049576 Bacteria 4528
900 Ga0501040_0036176 3300049576 Bacteria 3349
901 Ga0501040_0044516 3300049576 Bacteria 3025
902 Ga0501040_0123449 3300049576 Bacteria 1818
903 Ga0501041_0122100 3300049577 Bacteria 1619
904 Ga0501042_0008737 3300049578 Bacteria 6719
905 Ga0501042_0055727 3300049578 Bacteria 2821
906 Ga0501042_0096875 3300049578 Bacteria 2120
907 Ga0501042_0100192 3300049578 Bacteria 2083
908 Ga0501042_0119367 3300049578 Bacteria 1898
909 Ga0501043_0000050 3300049579 Bacteria 107465
910 Ga0501043_0002562 3300049579 Bacteria 15362
911 Ga0501043_0004818 3300049579 Bacteria 10917
912 Ga0501043_0007493 3300049579 Bacteria 8665
913 Ga0501043_0034144 3300049579 Bacteria 4001
914 Ga0501043_0038382 3300049579 Bacteria 3766
915 Ga0501043_0055905 3300049579 Bacteria 3100
916 Ga0501043_0069616 3300049579 Bacteria 2764
917 Ga0501046_0000011 3300049580 Bacteria 326457
918 Ga0501046_0000522 3300049580 Bacteria 38028
919 Ga0501046_0002369 3300049580 Bacteria 17725
920 Ga0501046_0002813 3300049580 Bacteria 16205
921 Ga0501046_0015763 3300049580 Bacteria 6344
922 Ga0501046_0017969 3300049580 Bacteria 5894
923 Ga0501046_0020020 3300049580 Bacteria 5540
924 Ga0501046_0024813 3300049580 Bacteria 4913
925 Ga0501046_0027495 3300049580 Bacteria 4639
926 Ga0501046_0043873 3300049580 Bacteria 3558
927 Ga0501046_0075292 3300049580 Bacteria 2617
928 Ga0501046_0080224 3300049580 Bacteria 2522
929 Ga0501046_0090190 3300049580 Bacteria 2359
930 Ga0501046_0109971 3300049580 Bacteria 2106
931 Ga0501047_0000174 3300049581 Bacteria 79021
932 Ga0501047_0001332 3300049581 Bacteria 24241
933 Ga0501047_0003631 3300049581 Bacteria 14539
934 Ga0501047_0030448 3300049581 Bacteria 5203
935 Ga0501047_0065883 3300049581 Bacteria 3491
936 Ga0501047_0188128 3300049581 Bacteria 1929
937 Ga0501048_0000043 3300049582 Bacteria 61640
938 Ga0501048_0000704 3300049582 Bacteria 24375
939 Ga0501048_0005516 3300049582 Bacteria 9627
940 Ga0501048_0037310 3300049582 Bacteria 3490
941 Ga0501048_0125730 3300049582 Bacteria 1813
942 Ga0501067_0000239 3300049583 Bacteria 30445
943 Ga0501067_0001523 3300049583 Bacteria 12619
944 Ga0501067_0002890 3300049583 Bacteria 9451
945 Ga0501067_0016088 3300049583 Bacteria 4136
946 Ga0501067_0032572 3300049583 Bacteria 2893
947 Ga0501068_0000227 3300049584 Bacteria 27306
948 Ga0501068_0005242 3300049584 Bacteria 7076
949 Ga0501069_0011635 3300049585 Bacteria 4665
950 Ga0501069_0015333 3300049585 Bacteria 4106
951 Ga0501070_0003314 3300049586 Bacteria 13986
952 Ga0501070_0006076 3300049586 Bacteria 10289
953 Ga0501070_0062539 3300049586 Bacteria 3083
954 Ga0501071_0004977 3300049587 Bacteria 8488
955 Ga0501071_0024865 3300049587 Bacteria 4191
956 Ga0501071_0028880 3300049587 Bacteria 3910
957 Ga0501071_0057760 3300049587 Bacteria 2804
958 Ga0501072_0001189 3300049588 Bacteria 19405
959 Ga0501072_0033867 3300049588 Bacteria 4002
960 Ga0501072_0048079 3300049588 Bacteria 3359
961 Ga0501072_0113278 3300049588 Bacteria 2159
962 Ga0501073_0000009 3300049589 Bacteria 195649
963 Ga0501073_0001927 3300049589 Bacteria 15444
964 Ga0501073_0014036 3300049589 Bacteria 5820
965 Ga0501073_0014176 3300049589 Bacteria 5788
966 Ga0501073_0049560 3300049589 Bacteria 2945
967 Ga0501073_0081549 3300049589 Bacteria 2250
968 Ga0501073_0122318 3300049589 Bacteria 1803
969 Ga0501074_0000049 3300049590 Bacteria 56854
970 Ga0501074_0000831 3300049590 Bacteria 19586
971 Ga0501074_0039961 3300049590 Bacteria 3397
972 Ga0501074_0149346 3300049590 Bacteria 1671
973 Ga0501075_0017073 3300049591 Bacteria 5237
974 Ga0501075_0021072 3300049591 Bacteria 4750
975 Ga0501075_0041245 3300049591 Bacteria 3458
976 Ga0501076_0018243 3300049592 Bacteria 5346
977 Ga0501076_0044409 3300049592 Bacteria 3504
978 Ga0501076_0065154 3300049592 Bacteria 2905
979 Ga0501076_0178007 3300049592 Bacteria 1733
980 Ga0501077_0004072 3300049593 Bacteria 8824
981 Ga0501077_0006974 3300049593 Bacteria 6959
982 Ga0501077_0016812 3300049593 Bacteria 4614
983 Ga0501079_0007729 3300049741 Bacteria 8139
984 Ga0501079_0008443 3300049741 Bacteria 7808
985 Ga0501079_0014652 3300049741 Bacteria 5979
986 Ga0501079_0020240 3300049741 Bacteria 5086
987 Ga0501079_0023425 3300049741 Bacteria 4738
988 Ga0501079_0048999 3300049741 Bacteria 3260
989 Ga0501079_0053058 3300049741 Bacteria 3128
990 Ga0501080_0000483 3300049742 Bacteria 30977
991 Ga0501080_0005392 3300049742 Bacteria 11401
992 Ga0501080_0005405 3300049742 Bacteria 11390
993 Ga0501080_0026539 3300049742 Bacteria 5382
994 Ga0501080_0058540 3300049742 Bacteria 3586
995 Ga0501080_0164799 3300049742 Bacteria 2046
996 Ga0501080_0195485 3300049742 Bacteria 1858
997 Ga0501080_0204562 3300049742 Bacteria 1811
998 Ga0501081_0000925 3300049743 Bacteria 17405
999 Ga0501081_0007863 3300049743 Bacteria 6918
1000 Ga0501081_0124898 3300049743 Bacteria 1835
1001 Ga0501081_0174278 3300049743 Bacteria 1554
1002 Ga0501083_0000251 3300049744 Bacteria 34183
1003 Ga0501083_0003402 3300049744 Bacteria 11133
1004 Ga0501083_0024070 3300049744 Bacteria 4221
1005 Ga0501083_0040696 3300049744 Bacteria 3154
1006 Ga0501083_0083294 3300049744 Bacteria 2119
1007 Ga0501083_0110689 3300049744 Bacteria 1806
1008 Ga0501035_0000021 3300049822 Bacteria 209085
1009 Ga0501035_0000067 3300049822 Bacteria 129204
1010 Ga0501035_0001140 3300049822 Bacteria 27786
1011 Ga0501035_0012866 3300049822 Bacteria 7725
1012 Ga0501035_0013199 3300049822 Bacteria 7624
1013 Ga0501035_0149284 3300049822 Bacteria 2029
1014 Ga0501044_0000013 3300049823 Bacteria 248795
1015 Ga0501044_0000255 3300049823 Bacteria 67530
1016 Ga0501044_0000258 3300049823 Bacteria 67161
1017 Ga0501044_0006574 3300049823 Bacteria 12830
1018 Ga0501044_0031056 3300049823 Bacteria 5625
1019 Ga0501044_0043076 3300049823 Bacteria 4691
1020 Ga0501044_0076351 3300049823 Bacteria 3401
1021 Ga0501044_0079746 3300049823 Bacteria 3317
1022 Ga0501044_0133712 3300049823 Bacteria 2473
1023 Ga0501045_0005432 3300049824 Bacteria 8825
1024 Ga0501045_0013152 3300049824 Bacteria 5837
1025 Ga0501045_0033049 3300049824 Bacteria 3751
1026 Ga0501045_0067828 3300049824 Bacteria 2620
1027 Ga0501045_0073430 3300049824 Bacteria 2519
1028 Ga0501045_0094675 3300049824 Bacteria 2209
1029 Ga0501045_0101009 3300049824 Bacteria 2135
1030 nmdc:mga03683_28078_c1 3300050489 Bacteria 2235
1031 nmdc:mga03683_31252_c1 3300050489 Bacteria 2135
1032 nmdc:mga03683_4167_c1 3300050489 Bacteria 4759
1033 nmdc:mga03n38_1208_c1 3300050490 Bacteria 6657
1034 nmdc:mga03n38_36547_c1 3300050490 Bacteria 2113
1035 nmdc:mga00v17_119667_c1 3300050491 Bacteria 1676
1036 nmdc:mga00v17_44102_c1 3300050491 Bacteria 2688
1037 nmdc:mga00v17_465_c1 3300050491 Bacteria 22680
1038 nmdc:mga00v17_6336_c1 3300050491 Bacteria 4487
1039 nmdc:mga00v17_69449_c1 3300050491 Bacteria 2180
1040 nmdc:mga0yw44_10820_c1 3300050492 Bacteria 4676
1041 nmdc:mga0yw44_11229_c1 3300050492 Bacteria 4612
1042 nmdc:mga0yw44_13015_c1 3300050492 Bacteria 4362
1043 nmdc:mga0yw44_133_c1 3300050492 Bacteria 25520
1044 nmdc:mga0yw44_2265_c1 3300050492 Bacteria 8111
1045 nmdc:mga0yw44_480_c1 3300050492 Bacteria 14184
1046 nmdc:mga0yw44_65601_c1 3300050492 Bacteria 2238
1047 nmdc:mga0yw44_80612_c1 3300050492 Bacteria 2039
1048 nmdc:mga0k408_25157_c1 3300050493 Bacteria 3370
1049 nmdc:mga06z11_515_c1 3300050494 Bacteria 14263
1050 nmdc:mga06z11_65479_c1 3300050494 Bacteria 1907
1051 nmdc:mga04h51_1183_c2 3300050495 Bacteria 4620
1052 nmdc:mga07m45_25828_c1 3300050496 Bacteria 3225
1053 nmdc:mga07m45_53313_c1 3300050496 Bacteria 2285
1054 nmdc:mga05p37_27738_c2 3300050507 Bacteria 5346
1055 nmdc:mga05p37_38858_c1 3300050507 Bacteria 5838
1056 nmdc:mga05p37_99963_c1 3300050507 Bacteria 3572
1057 nmdc:mga09592_30760_c1 3300050508 Bacteria 4469
1058 nmdc:mga0qj67_10579_c1 3300050509 Bacteria 6891
1059 nmdc:mga0qj67_92724_c1 3300050509 Bacteria 2428
1060 nmdc:mga06r32_1139_c1 3300050510 Bacteria 23882
1061 nmdc:mga06r32_24317_c1 3300050510 Bacteria 5621
1062 nmdc:mga06r32_24468_c1 3300050510 Bacteria 5605
1063 nmdc:mga08y16_55983_c1 3300050511 Bacteria 4122
1064 nmdc:mga08y16_62263_c1 3300050511 Bacteria 3896
1065 nmdc:mga08y16_81104_c1 3300050511 Bacteria 3382
1066 nmdc:mga0n895_142612_c1 3300050512 Bacteria 2425
1067 nmdc:mga0n895_193860_c1 3300050512 Bacteria 2063
1068 nmdc:mga0n895_19449_c1 3300050512 Bacteria 6313
1069 nmdc:mga08x19_42312_c1 3300050514 Bacteria 2904
1070 nmdc:mga08x19_65058_c1 3300050514 Bacteria 2367
1071 nmdc:mga0a205_33429_c1 3300050515 Bacteria 4931
1072 nmdc:mga0a205_84949_c1 3300050515 Bacteria 3057
1073 nmdc:mga0sz30_1524_c1 3300050516 Bacteria 8253
1074 Ga0495612_0056722 3300053078 Bacteria 1617
1075 Ga0495612_0062130 3300053078 Bacteria 1548
1076 Ga0495655_0001076 3300053083 Bacteria 4220
1077 Ga0495595_0014352 3300053084 Bacteria 3360
1078 Ga0495595_0030168 3300053084 Bacteria 2431
1079 Ga0495619_0061857 3300053085 Bacteria 2492
1080 Ga0500578_0017813 3300053086 Bacteria 4564
1081 Ga0500578_0047862 3300053086 Bacteria 2743
1082 Ga0500644_0015369 3300053088 Bacteria 2181
1083 Ga0500651_0001062 3300053093 Bacteria 13560
1084 Ga0500651_0025973 3300053093 Bacteria 3677
1085 Ga0500651_0041252 3300053093 Bacteria 2909
1086 Ga0500651_0090264 3300053093 Bacteria 1887
1087 Ga0500566_0005320 3300053094 Bacteria 7656
1088 Ga0500641_0001796 3300053096 Bacteria 7605
1089 Ga0500556_0000191 3300053104 Bacteria 50112
1090 Ga0500560_000794 3300053107 Bacteria 4835
1091 Ga0500569_002351 3300053109 Bacteria 3713
1092 Ga0500595_000068 3300053119 Bacteria 73931
1093 Ga0500595_002456 3300053119 Bacteria 9189
1094 Ga0500618_000143 3300053125 Bacteria 59383
1095 Ga0500618_005083 3300053125 Bacteria 4055
1096 Ga0500618_010537 3300053125 Bacteria 2478
1097 Ga0500618_015726 3300053125 Bacteria 1906
1098 Ga0500642_0020557 3300053130 Bacteria 2597
1099 Ga0500658_0007207 3300053134 Bacteria 4107
1100 Ga0500658_0025104 3300053134 Bacteria 2289
1101 Ga0500561_0000087 3300053137 Bacteria 18523
1102 Ga0500568_0000963 3300053139 Bacteria 19793
1103 Ga0500590_006431 3300053148 Bacteria 5727
1104 Ga0500616_0000577 3300053153 Bacteria 44621
1105 Ga0500616_0000682 3300053153 Bacteria 39794
1106 Ga0500616_0004378 3300053153 Bacteria 10098
1107 Ga0500616_0036613 3300053153 Bacteria 2662
1108 Ga0500622_0000429 3300053156 Bacteria 39925
1109 Ga0500633_0003101 3300053160 Bacteria 3563
1110 Ga0500634_0003778 3300053161 Bacteria 6842
1111 Ga0500634_0033035 3300053161 Bacteria 2820
1112 Ga0500634_0058791 3300053161 Bacteria 2047
1113 Ga0500636_0042426 3300053177 Bacteria 2689
1114 Ga0500636_0072384 3300053177 Bacteria 1997
1115 Ga0500637_0002593 3300053178 Bacteria 8079
1116 Ga0500637_0002928 3300053178 Bacteria 7720
1117 Ga0501084_0001539 3300054114 Bacteria 18342
1118 Ga0501084_0002907 3300054114 Bacteria 13869
1119 Ga0501084_0019594 3300054114 Bacteria 5637
1120 Ga0501084_0020027 3300054114 Bacteria 5578
1121 Ga0501084_0094744 3300054114 Bacteria 2507
1122 Ga0501084_0103219 3300054114 Bacteria 2394
1123 Ga0501084_0151035 3300054114 Bacteria 1958
1124 Ga0501084_0154551 3300054114 Bacteria 1934
1125 Ga0501082_0000285 3300060353 Bacteria 44550
1126 Ga0501082_0009569 3300060353 Bacteria 8340
1127 Ga0501082_0010462 3300060353 Bacteria 7983
1128 Ga0501082_0020426 3300060353 Bacteria 5710
1129 Ga0501082_0043277 3300060353 Bacteria 3882
1130 Ga0501082_0055376 3300060353 Bacteria 3417
1131 Ga0501082_0063705 3300060353 Bacteria 3174
1132 Ga0501082_0068042 3300060353 Bacteria 3067
1133 Ga0501082_0068963 3300060353 Bacteria 3044
1134 Ga0501082_0234645 3300060353 Bacteria 1596
1135 Ga0530510_0007874 3300061734 Bacteria 7432
1136 Ga0530510_0015103 3300061734 Bacteria 5454
1137 Ga0530510_0016317 3300061734 Bacteria 5254
1138 Ga0530510_0018519 3300061734 Bacteria 4937
1139 Ga0530510_0052044 3300061734 Bacteria 2959
1140 Ga0530510_0139555 3300061734 Bacteria 1785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0001796 Ga0500641_0001796_6428_7591 386
2 3300053125 Ga0500618_010537 Ga0500618_010537_19_1182 386
3 3300003856 Ga0058692_1003742 Ga0058692_10037422 387
4 3300048923 Ga0496120_0045353 Ga0496120_0045353_1267_2511 392
5 3300046543 Ga0495645_0154668 Ga0495645_0154668_366_1571 400
6 3300050492 nmdc:mga0yw44_65601_c1 nmdc:mga0yw44_65601_c1_15_1223 402
7 3300053086 Ga0500578_0047862 Ga0500578_0047862_19_1227 402
8 3300049581 Ga0501047_0188128 Ga0501047_0188128_10_1233 406
9 3300053161 Ga0500634_0058791 Ga0500634_0058791_705_2015 409
10 3300013307 Ga0157372_10003755 Ga0157372_1000375514 412
11 3300027866 Ga0209813_10011255 Ga0209813_100112553 414
12 3300053078 Ga0495612_0056722 Ga0495612_0056722_39_1337 417
13 3300031239 Ga0265328_10006035 Ga0265328_100060351 419
14 3300031344 Ga0265316_10014590 Ga0265316_100145905 419
15 3300049742 Ga0501080_0164799 Ga0501080_0164799_254_1660 423
16 3300049571 Ga0501034_0032089 Ga0501034_0032089_3510_4904 424
17 3300005334 Ga0068869_100187055 Ga0068869_1001870551 425
18 3300005338 Ga0068868_100037777 Ga0068868_1000377774 425
19 3300005456 Ga0070678_100009294 Ga0070678_1000092944 425
20 3300005547 Ga0070693_100060064 Ga0070693_1000600642 425
21 3300005548 Ga0070665_100172326 Ga0070665_1001723262 425
22 3300005840 Ga0068870_10080199 Ga0068870_100801992 425
23 3300013296 Ga0157374_10025891 Ga0157374_100258914 425
24 3300013306 Ga0163162_10011477 Ga0163162_100114779 425
25 3300014325 Ga0163163_10009818 Ga0163163_100098187 425
26 3300014969 Ga0157376_10007833 Ga0157376_100078336 425
27 3300025908 Ga0207643_10070492 Ga0207643_100704922 425
28 3300025925 Ga0207650_10068179 Ga0207650_100681792 425
29 3300025936 Ga0207670_10123193 Ga0207670_101231932 425
30 3300025940 Ga0207691_10059792 Ga0207691_100597923 425
31 3300026023 Ga0207677_10022070 Ga0207677_100220704 425
32 3300026078 Ga0207702_10263736 Ga0207702_102637362 425
33 3300026121 Ga0207683_10018157 Ga0207683_100181577 425
34 3300028379 Ga0268266_10159375 Ga0268266_101593752 425
35 3300028380 Ga0268265_10251197 Ga0268265_102511971 425
36 3300033442 Ga0315911_1000012 Ga0315911_1000012101 425
37 3300048904 Ga0496101_0001116 Ga0496101_0001116_8170_9555 425
38 3300048905 Ga0496102_0011710 Ga0496102_0011710_4005_5390 425
39 3300048907 Ga0496104_0108079 Ga0496104_0108079_189_1574 425
40 3300048908 Ga0496105_0028196 Ga0496105_0028196_744_2129 425
41 3300048911 Ga0496108_0022456 Ga0496108_0022456_3080_4465 425
42 3300048912 Ga0496109_0015885 Ga0496109_0015885_722_2107 425
43 3300048913 Ga0496110_0024274 Ga0496110_0024274_1324_2709 425
44 3300048917 Ga0496114_0034331 Ga0496114_0034331_1001_2386 425
45 3300048918 Ga0496115_0001457 Ga0496115_0001457_5080_6465 425
46 3300048924 Ga0496121_0068006 Ga0496121_0068006_482_1867 425
47 3300048928 Ga0496125_0069046 Ga0496125_0069046_1128_2513 425
48 3300049591 Ga0501075_0021072 Ga0501075_0021072_1125_2435 425
49 3300049593 Ga0501077_0004072 Ga0501077_0004072_5213_6523 425
50 3300049741 Ga0501079_0020240 Ga0501079_0020240_2691_4001 425
51 3300049743 Ga0501081_0000925 Ga0501081_0000925_8586_9896 425
52 3300049744 Ga0501083_0110689 Ga0501083_0110689_451_1761 425
53 3300054114 Ga0501084_0019594 Ga0501084_0019594_581_1891 425
54 3300060353 Ga0501082_0020426 Ga0501082_0020426_260_1570 425
55 3300061734 Ga0530510_0018519 Ga0530510_0018519_1905_3215 425
56 3300005544 Ga0070686_100094090 Ga0070686_1000940901 426
57 3300005937 Ga0081455_10032844 Ga0081455_100328441 426
58 3300006178 Ga0075367_10042342 Ga0075367_100423422 426
59 3300006353 Ga0075370_10027615 Ga0075370_100276152 426
60 3300025938 Ga0207704_10005472 Ga0207704_100054726 426
61 3300046492 Ga0495585_0098445 Ga0495585_0098445_150_1535 426
62 3300048924 Ga0496121_0024137 Ga0496121_0024137_1183_2568 426
63 3300048927 Ga0496124_0161723 Ga0496124_0161723_147_1532 426
64 3300049583 Ga0501067_0032572 Ga0501067_0032572_239_1627 426
65 iso_pu_bacteria 2854911287 2854912516 426
66 3300006186 Ga0075369_10002993 Ga0075369_100029932 427
67 3300009766 Ga0123342_1025236 Ga0123342_10252363 427
68 3300047320 Ga0495672_0065538 Ga0495672_0065538_412_1797 427
69 3300048924 Ga0496121_0002081 Ga0496121_0002081_2601_3989 427
70 3300048929 Ga0496126_0031494 Ga0496126_0031494_619_2007 427
71 3300053093 Ga0500651_0001062 Ga0500651_0001062_8717_10105 427
72 3300053119 Ga0500595_002456 Ga0500595_002456_403_1791 427
73 3300053130 Ga0500642_0020557 Ga0500642_0020557_457_1845 427
74 3300009101 Ga0105247_10122288 Ga0105247_101222881 428
75 3300009553 Ga0105249_10039488 Ga0105249_100394884 428
76 3300011119 Ga0105246_10179360 Ga0105246_101793602 428
77 3300013297 Ga0157378_10184630 Ga0157378_101846302 428
78 3300014968 Ga0157379_10045595 Ga0157379_100455953 428
79 3300035691 Ga0373931_0015868 Ga0373931_0015868_482_1777 428
80 3300044684 Ga0466966_0095551 Ga0466966_0095551_419_1801 428
81 3300046460 Ga0495638_0099384 Ga0495638_0099384_429_1718 428
82 3300046471 Ga0495650_0063003 Ga0495650_0063003_11_1300 428
83 3300048905 Ga0496102_0095774 Ga0496102_0095774_43_1338 428
84 3300048910 Ga0496107_0063579 Ga0496107_0063579_1191_2486 428
85 3300013307 Ga0157372_10018463 Ga0157372_100184634 429
86 3300046533 Ga0495640_0028235 Ga0495640_0028235_17_1309 429
87 3300053078 Ga0495612_0062130 Ga0495612_0062130_239_1531 429
88 3300025261 Ga0209233_1004488 Ga0209233_10044882 430
89 3300046557 Ga0495622_0012739 Ga0495622_0012739_2350_3678 430
90 3300048922 Ga0496119_0024804 Ga0496119_0024804_1008_2306 430
91 3300048925 Ga0496122_0099410 Ga0496122_0099410_248_1546 430
92 3300046491 Ga0495584_0010636 Ga0495584_0010636_3197_4525 431
93 3300060353 Ga0501082_0068042 Ga0501082_0068042_1741_3048 431
94 3300021384 Ga0213876_10000521 Ga0213876_1000052125 432
95 3300039437 Ga0436365_1935268 Ga0436365_1935268_44663_45979 432
96 3300005937 Ga0081455_10005953 Ga0081455_100059535 433
97 3300009098 Ga0105245_10076125 Ga0105245_100761253 433
98 3300049824 Ga0501045_0094675 Ga0501045_0094675_856_2172 433
99 3300053177 Ga0500636_0072384 Ga0500636_0072384_189_1568 433
100 3300054114 Ga0501084_0151035 Ga0501084_0151035_29_1345 433
101 3300049569 Ga0501032_0000045 Ga0501032_0000045_9157_10485 434
102 3300049570 Ga0501033_0060542 Ga0501033_0060542_336_1664 434
103 3300049571 Ga0501034_0000001 Ga0501034_0000001_1867228_1868556 434
104 3300049572 Ga0501036_0003158 Ga0501036_0003158_972_2300 434
105 3300049575 Ga0501039_0000041 Ga0501039_0000041_54173_55501 434
106 3300049575 Ga0501039_0202698 Ga0501039_0202698_181_1503 434
107 3300049576 Ga0501040_0123449 Ga0501040_0123449_472_1794 434
108 3300049578 Ga0501042_0100192 Ga0501042_0100192_733_2055 434
109 3300049582 Ga0501048_0037310 Ga0501048_0037310_2153_3469 434
110 iso_pu_bacteria 2510917028 2511182551 434
111 iso_pu_bacteria 2582581294 2585202065 434
112 3300054114 Ga0501084_0094744 Ga0501084_0094744_678_2087 435
113 3300005841 Ga0068863_100226485 Ga0068863_1002264852 436
114 3300005842 Ga0068858_100095408 Ga0068858_1000954082 436
115 3300009098 Ga0105245_10031108 Ga0105245_100311085 436
116 3300009177 Ga0105248_10017355 Ga0105248_100173555 436
117 3300009545 Ga0105237_10141696 Ga0105237_101416962 436
118 3300025914 Ga0207671_10023035 Ga0207671_100230353 436
119 3300025926 Ga0207659_10067361 Ga0207659_100673612 436
120 3300025942 Ga0207689_10069328 Ga0207689_100693282 436
121 3300026035 Ga0207703_10037399 Ga0207703_100373993 436
122 3300028379 Ga0268266_10062684 Ga0268266_100626843 436
123 3300031241 Ga0265325_10066241 Ga0265325_100662412 436
124 3300048905 Ga0496102_0253212 Ga0496102_0253212_202_1587 436
125 3300050496 nmdc:mga07m45_53313_c1 nmdc:mga07m45_53313_c1_39_1352 436
126 3300006051 Ga0075364_10048395 Ga0075364_100483952 437
127 3300048919 Ga0496116_0075957 Ga0496116_0075957_692_2080 437
128 3300048920 Ga0496117_0029084 Ga0496117_0029084_2521_3909 437
129 3300048921 Ga0496118_0098291 Ga0496118_0098291_314_1702 437
130 3300048924 Ga0496121_0000003 Ga0496121_0000003_497698_499086 437
131 3300048925 Ga0496122_0067283 Ga0496122_0067283_864_2252 437
132 3300048926 Ga0496123_0058792 Ga0496123_0058792_901_2289 437
133 3300048927 Ga0496124_0044775 Ga0496124_0044775_330_1718 437
134 3300048928 Ga0496125_0000039 Ga0496125_0000039_275939_277327 437
135 3300049571 Ga0501034_0218372 Ga0501034_0218372_12_1328 437
136 3300050491 nmdc:mga00v17_6336_c1 nmdc:mga00v17_6336_c1_188_1576 437
137 3300053177 Ga0500636_0042426 Ga0500636_0042426_222_1637 437
138 3300005983 Ga0081540_1010381 Ga0081540_10103814 438
139 3300006038 Ga0075365_10006740 Ga0075365_100067407 438
140 3300006844 Ga0075428_100004552 Ga0075428_1000045528 438
141 3300009147 Ga0114129_10066061 Ga0114129_100660615 438
142 3300048088 Ga0495602_0212260 Ga0495602_0212260_16_1419 438
143 3300048927 Ga0496124_0106607 Ga0496124_0106607_888_2207 438
144 3300050492 nmdc:mga0yw44_11229_c1 nmdc:mga0yw44_11229_c1_1017_2480 438
145 3300050507 nmdc:mga05p37_99963_c1 nmdc:mga05p37_99963_c1_1503_2966 438
146 3300053161 Ga0500634_0033035 Ga0500634_0033035_395_1786 438
147 3300025986 Ga0207658_10198316 Ga0207658_101983161 439
148 3300035398 Ga0316574_0083679 Ga0316574_0083679_133_1566 439
149 3300036712 Ga0316584_0024612 Ga0316584_0024612_519_1952 439
150 3300061734 Ga0530510_0015103 Ga0530510_0015103_1114_2487 439
151 3300025912 Ga0207707_10177401 Ga0207707_101774012 440
152 3300049572 Ga0501036_0165509 Ga0501036_0165509_433_1809 440
153 3300049824 Ga0501045_0033049 Ga0501045_0033049_2215_3591 440
154 3300002739 JGI25158J39367_1000019 JGI25158J39367_100001925 441
155 3300002773 JGI25152J39213_1001100 JGI25152J39213_10011003 441
156 3300002987 JGI25159J45721_1014248 JGI25159J45721_10142482 441
157 3300003215 JGI25153J46596_10013173 JGI25153J46596_100131733 441
158 3300003354 JGI25160J50197_1014031 JGI25160J50197_10140311 441
159 3300003374 JGI25161J50226_1000068 JGI25161J50226_100006850 441
160 3300003771 Ga0055526_1002736 Ga0055526_10027363 441
161 3300003775 Ga0055524_1001783 Ga0055524_10017833 441
162 3300004625 Ga0055543_1000189 Ga0055543_10001893 441
163 3300005262 Ga0065165_1014635 Ga0065165_10146354 441
164 3300005842 Ga0068858_100024334 Ga0068858_1000243347 441
165 3300025208 Ga0209436_100070 Ga0209436_10007030 441
166 3300025258 Ga0209129_1002284 Ga0209129_100228410 441
167 3300025273 Ga0209673_1003050 Ga0209673_100305013 441
168 3300025284 Ga0209130_1000020 Ga0209130_1000020102 441
169 3300025295 Ga0209564_1000588 Ga0209564_100058840 441
170 3300025297 Ga0209758_1005691 Ga0209758_100569110 441
171 3300025299 Ga0209256_1003148 Ga0209256_10031487 441
172 3300025302 Ga0207426_1000008 Ga0207426_1000008171 441
173 3300025303 Ga0209051_1002788 Ga0209051_100278812 441
174 3300026067 Ga0207678_10005903 Ga0207678_100059036 441
175 3300026116 Ga0207674_10018036 Ga0207674_100180362 441
176 3300046507 Ga0495606_0001738 Ga0495606_0001738_2510_3835 441
177 3300048924 Ga0496121_0014899 Ga0496121_0014899_5695_7020 441
178 3300048924 Ga0496121_0070766 Ga0496121_0070766_247_1632 441
179 iso_pu_bacteria 2534681786 2535485210 441
180 iso_pu_bacteria 2751185800 2753359858 441
181 iso_pu_bacteria 2758568016 2758642180 441
182 3300005347 Ga0070668_100028088 Ga0070668_1000280885 442
183 3300005435 Ga0070714_100014994 Ga0070714_1000149943 442
184 3300005436 Ga0070713_100013219 Ga0070713_1000132194 442
185 3300005617 Ga0068859_100185676 Ga0068859_1001856762 442
186 3300005719 Ga0068861_100018065 Ga0068861_1000180654 442
187 3300005844 Ga0068862_100010822 Ga0068862_1000108224 442
188 3300005937 Ga0081455_10010832 Ga0081455_100108322 442
189 3300006038 Ga0075365_10026619 Ga0075365_100266192 442
190 3300006042 Ga0075368_10006727 Ga0075368_100067273 442
191 3300006178 Ga0075367_10006662 Ga0075367_100066626 442
192 3300006931 Ga0097620_100185673 Ga0097620_1001856732 442
193 3300025928 Ga0207700_10003685 Ga0207700_100036856 442
194 3300025929 Ga0207664_10021260 Ga0207664_100212602 442
195 3300027866 Ga0209813_10000942 Ga0209813_100009426 442
196 3300028380 Ga0268265_10011309 Ga0268265_100113094 442
197 3300046557 Ga0495622_0004709 Ga0495622_0004709_2308_3672 442
198 3300047320 Ga0495672_0018870 Ga0495672_0018870_715_2079 442
199 3300050490 nmdc:mga03n38_1208_c1 nmdc:mga03n38_1208_c1_2829_4307 442
200 3300050491 nmdc:mga00v17_119667_c1 nmdc:mga00v17_119667_c1_31_1494 442
201 3300050494 nmdc:mga06z11_515_c1 nmdc:mga06z11_515_c1_2567_4045 442
202 3300050495 nmdc:mga04h51_1183_c2 nmdc:mga04h51_1183_c2_150_1628 442
203 3300053178 Ga0500637_0002928 Ga0500637_0002928_3115_4479 442
204 3300005545 Ga0070695_100082458 Ga0070695_1000824581 443
205 3300009174 Ga0105241_10017412 Ga0105241_100174122 443
206 3300014969 Ga0157376_10240090 Ga0157376_102400902 443
207 3300025911 Ga0207654_10057170 Ga0207654_100571701 443
208 3300025932 Ga0207690_10065726 Ga0207690_100657262 443
209 3300048903 Ga0496100_0118672 Ga0496100_0118672_147_1601 443
210 3300048904 Ga0496101_0118441 Ga0496101_0118441_507_1961 443
211 3300048905 Ga0496102_0062715 Ga0496102_0062715_1881_3302 443
212 3300048906 Ga0496103_0009621 Ga0496103_0009621_196_1650 443
213 3300048906 Ga0496103_0075829 Ga0496103_0075829_36_1457 443
214 3300048909 Ga0496106_0069765 Ga0496106_0069765_1093_2547 443
215 3300048910 Ga0496107_0004740 Ga0496107_0004740_1919_3373 443
216 3300048918 Ga0496115_0041568 Ga0496115_0041568_333_1787 443
217 3300049568 Ga0501031_0007375 Ga0501031_0007375_1481_2815 443
218 3300049570 Ga0501033_0001234 Ga0501033_0001234_18233_19567 443
219 3300049573 Ga0501037_0000580 Ga0501037_0000580_1678_3012 443
220 3300049580 Ga0501046_0000011 Ga0501046_0000011_191320_192741 443
221 3300049580 Ga0501046_0020020 Ga0501046_0020020_2138_3472 443
222 3300049582 Ga0501048_0000043 Ga0501048_0000043_20811_22223 443
223 3300049822 Ga0501035_0013199 Ga0501035_0013199_2397_3731 443
224 3300005545 Ga0070695_100053987 Ga0070695_1000539872 444
225 3300005937 Ga0081455_10000028 Ga0081455_1000002892 444
226 3300005983 Ga0081540_1000060 Ga0081540_100006085 444
227 3300006871 Ga0075434_100004034 Ga0075434_1000040343 444
228 3300009094 Ga0111539_10084829 Ga0111539_100848294 444
229 3300009094 Ga0111539_10092241 Ga0111539_100922414 444
230 3300009545 Ga0105237_10012548 Ga0105237_100125484 444
231 3300025914 Ga0207671_10149864 Ga0207671_101498641 444
232 3300026075 Ga0207708_10026614 Ga0207708_100266143 444
233 3300027907 Ga0207428_10121934 Ga0207428_101219342 444
234 3300031249 Ga0265339_10037528 Ga0265339_100375282 444
235 3300031249 Ga0265339_10054451 Ga0265339_100544511 444
236 3300035114 Ga0373939_0008986 Ga0373939_0008986_29_1438 444
237 3300035121 Ga0373960_0008663 Ga0373960_0008663_358_1767 444
238 3300035207 Ga0373942_0008134 Ga0373942_0008134_141_1550 444
239 3300035241 Ga0373961_0012093 Ga0373961_0012093_129_1538 444
240 3300035691 Ga0373931_0000542 Ga0373931_0000542_12145_13554 444
241 3300035691 Ga0373931_0035062 Ga0373931_0035062_611_2020 444
242 3300037418 Ga0395900_0142224 Ga0395900_0142224_92_1507 444
243 3300046491 Ga0495584_0033859 Ga0495584_0033859_1073_2482 444
244 3300049569 Ga0501032_0003274 Ga0501032_0003274_9742_11157 444
245 3300049571 Ga0501034_0000031 Ga0501034_0000031_8004_9419 444
246 3300049571 Ga0501034_0132990 Ga0501034_0132990_420_1835 444
247 3300049572 Ga0501036_0093539 Ga0501036_0093539_889_2304 444
248 3300049573 Ga0501037_0002101 Ga0501037_0002101_5666_7081 444
249 3300049574 Ga0501038_0007178 Ga0501038_0007178_990_2405 444
250 3300049575 Ga0501039_0005181 Ga0501039_0005181_2801_4216 444
251 3300049579 Ga0501043_0038382 Ga0501043_0038382_216_1631 444
252 3300049580 Ga0501046_0002369 Ga0501046_0002369_4471_5886 444
253 3300049580 Ga0501046_0015763 Ga0501046_0015763_2276_3691 444
254 3300049581 Ga0501047_0001332 Ga0501047_0001332_4619_6034 444
255 3300049581 Ga0501047_0030448 Ga0501047_0030448_1142_2557 444
256 3300049583 Ga0501067_0001523 Ga0501067_0001523_8237_9652 444
257 3300049586 Ga0501070_0062539 Ga0501070_0062539_998_2413 444
258 3300049589 Ga0501073_0014176 Ga0501073_0014176_1433_2848 444
259 3300049589 Ga0501073_0049560 Ga0501073_0049560_62_1465 444
260 3300049589 Ga0501073_0081549 Ga0501073_0081549_369_1778 444
261 3300049742 Ga0501080_0000483 Ga0501080_0000483_18219_19634 444
262 3300049822 Ga0501035_0001140 Ga0501035_0001140_18211_19626 444
263 3300049823 Ga0501044_0000013 Ga0501044_0000013_11911_13326 444
264 3300049823 Ga0501044_0043076 Ga0501044_0043076_2673_4088 444
265 3300049823 Ga0501044_0133712 Ga0501044_0133712_302_1717 444
266 3300050511 nmdc:mga08y16_81104_c1 nmdc:mga08y16_81104_c1_1860_3269 444
267 3300050512 nmdc:mga0n895_19449_c1 nmdc:mga0n895_19449_c1_1876_3285 444
268 3300050515 nmdc:mga0a205_33429_c1 nmdc:mga0a205_33429_c1_1415_2824 444
269 3300060353 Ga0501082_0043277 Ga0501082_0043277_1115_2530 444
270 3300005981 Ga0081538_10001580 Ga0081538_100015809 445
271 3300006048 Ga0075363_100006948 Ga0075363_1000069484 445
272 3300006051 Ga0075364_10023681 Ga0075364_100236813 445
273 3300006178 Ga0075367_10007788 Ga0075367_100077887 445
274 3300006195 Ga0075366_10001623 Ga0075366_100016232 445
275 3300013297 Ga0157378_10071157 Ga0157378_100711574 445
276 3300025937 Ga0207669_10095630 Ga0207669_100956302 445
277 3300049571 Ga0501034_0029807 Ga0501034_0029807_1037_2401 445
278 3300049573 Ga0501037_0010112 Ga0501037_0010112_2668_4032 445
279 3300049823 Ga0501044_0031056 Ga0501044_0031056_435_1799 445
280 3300050493 nmdc:mga0k408_25157_c1 nmdc:mga0k408_25157_c1_540_1928 445
281 iso_pu_bacteria 2643221558 2643811387 445
282 3300006844 Ga0075428_100172714 Ga0075428_1001727142 446
283 3300006847 Ga0075431_100001225 Ga0075431_10000122516 446
284 3300006880 Ga0075429_100031033 Ga0075429_1000310333 446
285 3300031239 Ga0265328_10000013 Ga0265328_1000001314 446
286 3300049591 Ga0501075_0017073 Ga0501075_0017073_2434_3834 446
287 3300049741 Ga0501079_0053058 Ga0501079_0053058_1606_3006 446
288 3300050508 nmdc:mga09592_30760_c1 nmdc:mga09592_30760_c1_1899_3299 446
289 3300050509 nmdc:mga0qj67_92724_c1 nmdc:mga0qj67_92724_c1_938_2338 446
290 3300050510 nmdc:mga06r32_1139_c1 nmdc:mga06r32_1139_c1_14049_15449 446
291 3300053153 Ga0500616_0036613 Ga0500616_0036613_318_1703 446
292 3300061734 Ga0530510_0007874 Ga0530510_0007874_1336_2736 446
293 3300005336 Ga0070680_100039172 Ga0070680_1000391723 447
294 3300005341 Ga0070691_10006024 Ga0070691_100060246 447
295 3300005406 Ga0070703_10000529 Ga0070703_100005295 447
296 3300005438 Ga0070701_10051668 Ga0070701_100516682 447
297 3300005440 Ga0070705_100002587 Ga0070705_1000025871 447
298 3300005441 Ga0070700_100002386 Ga0070700_1000023867 447
299 3300005444 Ga0070694_100000337 Ga0070694_10000033723 447
300 3300005445 Ga0070708_100044042 Ga0070708_1000440424 447
301 3300005455 Ga0070663_100015445 Ga0070663_1000154456 447
302 3300005458 Ga0070681_10027924 Ga0070681_100279246 447
303 3300005467 Ga0070706_100183764 Ga0070706_1001837641 447
304 3300005468 Ga0070707_100109867 Ga0070707_1001098671 447
305 3300005471 Ga0070698_100032559 Ga0070698_1000325596 447
306 3300005518 Ga0070699_100000211 Ga0070699_10000021127 447
307 3300005536 Ga0070697_100008374 Ga0070697_1000083742 447
308 3300005545 Ga0070695_100000528 Ga0070695_10000052819 447
309 3300005546 Ga0070696_100000025 Ga0070696_10000002528 447
310 3300005549 Ga0070704_100000088 Ga0070704_10000008831 447
311 3300005577 Ga0068857_100000858 Ga0068857_1000008588 447
312 3300005617 Ga0068859_100004630 Ga0068859_1000046307 447
313 3300005843 Ga0068860_100000866 Ga0068860_10000086628 447
314 3300005844 Ga0068862_100003544 Ga0068862_10000354413 447
315 3300005937 Ga0081455_10028468 Ga0081455_100284682 447
316 3300006038 Ga0075365_10000714 Ga0075365_1000071415 447
317 3300006847 Ga0075431_100003740 Ga0075431_1000037407 447
318 3300006914 Ga0075436_100082943 Ga0075436_1000829432 447
319 3300006931 Ga0097620_100004630 Ga0097620_1000046307 447
320 3300007076 Ga0075435_100043602 Ga0075435_1000436024 447
321 3300009094 Ga0111539_10002206 Ga0111539_100022068 447
322 3300009553 Ga0105249_10006404 Ga0105249_100064046 447
323 3300011119 Ga0105246_10071014 Ga0105246_100710143 447
324 3300013308 Ga0157375_10020906 Ga0157375_100209065 447
325 3300014325 Ga0163163_10091687 Ga0163163_100916872 447
326 3300014326 Ga0157380_10008850 Ga0157380_100088507 447
327 3300025885 Ga0207653_10000563 Ga0207653_100005634 447
328 3300025910 Ga0207684_10181512 Ga0207684_101815121 447
329 3300025912 Ga0207707_10020676 Ga0207707_100206763 447
330 3300025917 Ga0207660_10027905 Ga0207660_100279053 447
331 3300025933 Ga0207706_10043108 Ga0207706_100431084 447
332 3300025942 Ga0207689_10121753 Ga0207689_101217532 447
333 3300025961 Ga0207712_10005896 Ga0207712_100058968 447
334 3300026067 Ga0207678_10027856 Ga0207678_100278562 447
335 3300026075 Ga0207708_10008989 Ga0207708_100089896 447
336 3300026116 Ga0207674_10002080 Ga0207674_1000208013 447
337 3300028380 Ga0268265_10003697 Ga0268265_100036978 447
338 3300028381 Ga0268264_10002123 Ga0268264_1000212318 447
339 3300035695 Ga0373927_0104814 Ga0373927_0104814_63_1466 447
340 3300048905 Ga0496102_0011055 Ga0496102_0011055_696_2102 447
341 3300048907 Ga0496104_0000686 Ga0496104_0000686_24572_26065 447
342 3300048907 Ga0496104_0003421 Ga0496104_0003421_441_1844 447
343 3300048907 Ga0496104_0129915 Ga0496104_0129915_361_1767 447
344 3300048909 Ga0496106_0002573 Ga0496106_0002573_1261_2667 447
345 3300048909 Ga0496106_0169920 Ga0496106_0169920_290_1693 447
346 3300048910 Ga0496107_0011502 Ga0496107_0011502_636_2042 447
347 3300048911 Ga0496108_0002263 Ga0496108_0002263_10777_12270 447
348 3300048912 Ga0496109_0036545 Ga0496109_0036545_1505_2908 447
349 3300048913 Ga0496110_0000284 Ga0496110_0000284_7552_9045 447
350 3300048913 Ga0496110_0007574 Ga0496110_0007574_3057_4460 447
351 3300048913 Ga0496110_0051547 Ga0496110_0051547_302_1705 447
352 3300048914 Ga0496111_0068120 Ga0496111_0068120_65_1468 447
353 3300048916 Ga0496113_0067092 Ga0496113_0067092_1181_2584 447
354 3300048918 Ga0496115_0075681 Ga0496115_0075681_847_2253 447
355 3300049575 Ga0501039_0082829 Ga0501039_0082829_1066_2475 447
356 3300049576 Ga0501040_0019352 Ga0501040_0019352_1104_2510 447
357 3300049578 Ga0501042_0096875 Ga0501042_0096875_176_1582 447
358 3300049580 Ga0501046_0043873 Ga0501046_0043873_1535_2932 447
359 3300049580 Ga0501046_0080224 Ga0501046_0080224_854_2260 447
360 3300049580 Ga0501046_0109971 Ga0501046_0109971_544_1950 447
361 3300049590 Ga0501074_0149346 Ga0501074_0149346_121_1527 447
362 3300049592 Ga0501076_0018243 Ga0501076_0018243_946_2343 447
363 3300049593 Ga0501077_0016812 Ga0501077_0016812_382_1779 447
364 3300049741 Ga0501079_0007729 Ga0501079_0007729_5953_7350 447
365 3300049742 Ga0501080_0026539 Ga0501080_0026539_1387_2784 447
366 3300049743 Ga0501081_0007863 Ga0501081_0007863_1203_2609 447
367 3300049743 Ga0501081_0124898 Ga0501081_0124898_43_1452 447
368 3300049743 Ga0501081_0174278 Ga0501081_0174278_135_1541 447
369 3300049824 Ga0501045_0067828 Ga0501045_0067828_1069_2475 447
370 3300049824 Ga0501045_0073430 Ga0501045_0073430_859_2265 447
371 3300049824 Ga0501045_0101009 Ga0501045_0101009_55_1464 447
372 3300050509 nmdc:mga0qj67_10579_c1 nmdc:mga0qj67_10579_c1_1603_3012 447
373 3300050510 nmdc:mga06r32_24317_c1 nmdc:mga06r32_24317_c1_505_1914 447
374 3300050511 nmdc:mga08y16_55983_c1 nmdc:mga08y16_55983_c1_2075_3478 447
375 3300050514 nmdc:mga08x19_65058_c1 nmdc:mga08x19_65058_c1_237_1640 447
376 3300054114 Ga0501084_0001539 Ga0501084_0001539_207_1604 447
377 3300060353 Ga0501082_0009569 Ga0501082_0009569_2658_4055 447
378 3300060353 Ga0501082_0063705 Ga0501082_0063705_154_1560 447
379 3300061734 Ga0530510_0139555 Ga0530510_0139555_271_1680 447
380 3300003203 JGI25406J46586_10000043 JGI25406J46586_1000004336 448
381 3300005985 Ga0081539_10000324 Ga0081539_1000032484 448
382 3300006844 Ga0075428_100224414 Ga0075428_1002244142 448
383 3300006852 Ga0075433_10101808 Ga0075433_101018082 448
384 3300009094 Ga0111539_10093995 Ga0111539_100939953 448
385 3300031728 Ga0316578_10043757 Ga0316578_100437572 448
386 3300036712 Ga0316584_0010059 Ga0316584_0010059_1322_2743 448
387 3300046558 Ga0495633_0011174 Ga0495633_0011174_3355_4731 448
388 3300049568 Ga0501031_0016379 Ga0501031_0016379_777_2189 448
389 3300049569 Ga0501032_0000024 Ga0501032_0000024_83028_84440 448
390 3300049570 Ga0501033_0000391 Ga0501033_0000391_37034_38446 448
391 3300049571 Ga0501034_0000140 Ga0501034_0000140_32886_34298 448
392 3300049572 Ga0501036_0000443 Ga0501036_0000443_24478_25890 448
393 3300049572 Ga0501036_0155848 Ga0501036_0155848_24_1403 448
394 3300049572 Ga0501036_0214633 Ga0501036_0214633_224_1603 448
395 3300049573 Ga0501037_0000024 Ga0501037_0000024_120165_121577 448
396 3300049574 Ga0501038_0000064 Ga0501038_0000064_82937_84349 448
397 3300049575 Ga0501039_0000017 Ga0501039_0000017_82843_84255 448
398 3300049576 Ga0501040_0036176 Ga0501040_0036176_222_1601 448
399 3300049577 Ga0501041_0122100 Ga0501041_0122100_19_1398 448
400 3300049578 Ga0501042_0055727 Ga0501042_0055727_18_1397 448
401 3300049579 Ga0501043_0000050 Ga0501043_0000050_82937_84349 448
402 3300049579 Ga0501043_0069616 Ga0501043_0069616_1107_2483 448
403 3300049580 Ga0501046_0075292 Ga0501046_0075292_1100_2473 448
404 3300049580 Ga0501046_0090190 Ga0501046_0090190_31_1410 448
405 3300049582 Ga0501048_0125730 Ga0501048_0125730_181_1554 448
406 3300049587 Ga0501071_0028880 Ga0501071_0028880_712_2091 448
407 3300049587 Ga0501071_0057760 Ga0501071_0057760_195_1574 448
408 3300049588 Ga0501072_0033867 Ga0501072_0033867_379_1758 448
409 3300049741 Ga0501079_0023425 Ga0501079_0023425_3277_4650 448
410 3300049822 Ga0501035_0000021 Ga0501035_0000021_124843_126255 448
411 3300049822 Ga0501035_0149284 Ga0501035_0149284_487_1866 448
412 3300049823 Ga0501044_0006574 Ga0501044_0006574_3597_5009 448
413 3300049824 Ga0501045_0013152 Ga0501045_0013152_3011_4384 448
414 3300050515 nmdc:mga0a205_84949_c1 nmdc:mga0a205_84949_c1_543_1958 448
415 3300054114 Ga0501084_0020027 Ga0501084_0020027_3806_5185 448
416 3300060353 Ga0501082_0055376 Ga0501082_0055376_279_1658 448
417 3300005328 Ga0070676_10018800 Ga0070676_100188002 449
418 3300005330 Ga0070690_100007090 Ga0070690_1000070902 449
419 3300005331 Ga0070670_100015142 Ga0070670_1000151423 449
420 3300005334 Ga0068869_100008016 Ga0068869_1000080167 449
421 3300005336 Ga0070680_100017028 Ga0070680_1000170282 449
422 3300005337 Ga0070682_100006798 Ga0070682_1000067987 449
423 3300005338 Ga0068868_100011527 Ga0068868_1000115276 449
424 3300005339 Ga0070660_100020869 Ga0070660_1000208693 449
425 3300005340 Ga0070689_100002488 Ga0070689_1000024883 449
426 3300005341 Ga0070691_10003165 Ga0070691_100031655 449
427 3300005343 Ga0070687_100017051 Ga0070687_1000170513 449
428 3300005344 Ga0070661_100006175 Ga0070661_1000061753 449
429 3300005347 Ga0070668_100000234 Ga0070668_1000002349 449
430 3300005353 Ga0070669_100013989 Ga0070669_1000139892 449
431 3300005354 Ga0070675_100076779 Ga0070675_1000767793 449
432 3300005355 Ga0070671_100121087 Ga0070671_1001210872 449
433 3300005356 Ga0070674_100001018 Ga0070674_10000101818 449
434 3300005356 Ga0070674_100123582 Ga0070674_1001235822 449
435 3300005364 Ga0070673_100000403 Ga0070673_1000004032 449
436 3300005366 Ga0070659_100007757 Ga0070659_1000077576 449
437 3300005367 Ga0070667_100008949 Ga0070667_1000089498 449
438 3300005406 Ga0070703_10019591 Ga0070703_100195912 449
439 3300005434 Ga0070709_10031127 Ga0070709_100311273 449
440 3300005435 Ga0070714_100022160 Ga0070714_1000221602 449
441 3300005437 Ga0070710_10080913 Ga0070710_100809131 449
442 3300005439 Ga0070711_100038095 Ga0070711_1000380953 449
443 3300005440 Ga0070705_100017036 Ga0070705_1000170363 449
444 3300005441 Ga0070700_100000966 Ga0070700_1000009661 449
445 3300005444 Ga0070694_100009764 Ga0070694_1000097645 449
446 3300005456 Ga0070678_100004169 Ga0070678_1000041698 449
447 3300005457 Ga0070662_100011648 Ga0070662_1000116482 449
448 3300005459 Ga0068867_100080436 Ga0068867_1000804361 449
449 3300005459 Ga0068867_100150560 Ga0068867_1001505602 449
450 3300005543 Ga0070672_100111227 Ga0070672_1001112272 449
451 3300005544 Ga0070686_100003976 Ga0070686_1000039763 449
452 3300005545 Ga0070695_100007260 Ga0070695_1000072602 449
453 3300005546 Ga0070696_100021726 Ga0070696_1000217261 449
454 3300005547 Ga0070693_100026560 Ga0070693_1000265603 449
455 3300005548 Ga0070665_100095758 Ga0070665_1000957583 449
456 3300005549 Ga0070704_100023343 Ga0070704_1000233432 449
457 3300005564 Ga0070664_100002217 Ga0070664_1000022172 449
458 3300005577 Ga0068857_100015135 Ga0068857_1000151358 449
459 3300005578 Ga0068854_100109640 Ga0068854_1001096402 449
460 3300005614 Ga0068856_100007771 Ga0068856_10000777113 449
461 3300005615 Ga0070702_100013195 Ga0070702_1000131952 449
462 3300005616 Ga0068852_100015530 Ga0068852_1000155306 449
463 3300005617 Ga0068859_100156635 Ga0068859_1001566352 449
464 3300005618 Ga0068864_100052482 Ga0068864_1000524821 449
465 3300005719 Ga0068861_100001266 Ga0068861_10000126619 449
466 3300005841 Ga0068863_100212109 Ga0068863_1002121092 449
467 3300005842 Ga0068858_100022612 Ga0068858_1000226126 449
468 3300005843 Ga0068860_100074117 Ga0068860_1000741172 449
469 3300005844 Ga0068862_100003947 Ga0068862_10000394713 449
470 3300005937 Ga0081455_10031097 Ga0081455_100310972 449
471 3300006163 Ga0070715_10004334 Ga0070715_100043344 449
472 3300006173 Ga0070716_100002741 Ga0070716_1000027419 449
473 3300006175 Ga0070712_100018715 Ga0070712_1000187152 449
474 3300006237 Ga0097621_100034300 Ga0097621_1000343003 449
475 3300006880 Ga0075429_100067427 Ga0075429_1000674272 449
476 3300006931 Ga0097620_100156641 Ga0097620_1001566412 449
477 3300009093 Ga0105240_10079458 Ga0105240_100794583 449
478 3300009098 Ga0105245_10101671 Ga0105245_101016712 449
479 3300009101 Ga0105247_10031473 Ga0105247_100314732 449
480 3300009148 Ga0105243_10005218 Ga0105243_1000521812 449
481 3300009174 Ga0105241_10086268 Ga0105241_100862683 449
482 3300009176 Ga0105242_10043466 Ga0105242_100434664 449
483 3300009177 Ga0105248_10002357 Ga0105248_100023572 449
484 3300009545 Ga0105237_10109882 Ga0105237_101098822 449
485 3300009553 Ga0105249_10090229 Ga0105249_100902292 449
486 3300011119 Ga0105246_10012175 Ga0105246_100121753 449
487 3300013102 Ga0157371_10096069 Ga0157371_100960692 449
488 3300013105 Ga0157369_10122429 Ga0157369_101224292 449
489 3300013297 Ga0157378_10012829 Ga0157378_100128295 449
490 3300013306 Ga0163162_10085798 Ga0163162_100857982 449
491 3300013307 Ga0157372_10004863 Ga0157372_100048632 449
492 3300013308 Ga0157375_10015580 Ga0157375_100155803 449
493 3300014326 Ga0157380_10011116 Ga0157380_100111167 449
494 3300014745 Ga0157377_10011638 Ga0157377_100116383 449
495 3300014968 Ga0157379_10082728 Ga0157379_100827282 449
496 3300014969 Ga0157376_10001343 Ga0157376_1000134320 449
497 3300014969 Ga0157376_10044782 Ga0157376_100447824 449
498 3300017792 Ga0163161_10019891 Ga0163161_100198915 449
499 3300025885 Ga0207653_10006390 Ga0207653_100063904 449
500 3300025898 Ga0207692_10019608 Ga0207692_100196081 449
501 3300025901 Ga0207688_10002165 Ga0207688_1000216513 449
502 3300025904 Ga0207647_10002823 Ga0207647_100028232 449
503 3300025911 Ga0207654_10054155 Ga0207654_100541552 449
504 3300025915 Ga0207693_10028254 Ga0207693_100282542 449
505 3300025916 Ga0207663_10008963 Ga0207663_100089632 449
506 3300025918 Ga0207662_10024185 Ga0207662_100241853 449
507 3300025919 Ga0207657_10000793 Ga0207657_100007931 449
508 3300025920 Ga0207649_10024229 Ga0207649_100242294 449
509 3300025923 Ga0207681_10008095 Ga0207681_100080957 449
510 3300025925 Ga0207650_10024193 Ga0207650_100241933 449
511 3300025926 Ga0207659_10125754 Ga0207659_101257542 449
512 3300025932 Ga0207690_10047721 Ga0207690_100477211 449
513 3300025933 Ga0207706_10000771 Ga0207706_1000077141 449
514 3300025934 Ga0207686_10071238 Ga0207686_100712382 449
515 3300025935 Ga0207709_10039590 Ga0207709_100395903 449
516 3300025936 Ga0207670_10037361 Ga0207670_100373613 449
517 3300025937 Ga0207669_10077770 Ga0207669_100777703 449
518 3300025938 Ga0207704_10007858 Ga0207704_100078586 449
519 3300025939 Ga0207665_10006767 Ga0207665_100067672 449
520 3300025940 Ga0207691_10036074 Ga0207691_100360742 449
521 3300025942 Ga0207689_10012615 Ga0207689_100126157 449
522 3300025961 Ga0207712_10139080 Ga0207712_101390801 449
523 3300025981 Ga0207640_10132968 Ga0207640_101329683 449
524 3300025986 Ga0207658_10088849 Ga0207658_100888492 449
525 3300026067 Ga0207678_10001022 Ga0207678_1000102226 449
526 3300026075 Ga0207708_10017744 Ga0207708_100177441 449
527 3300026078 Ga0207702_10197203 Ga0207702_101972032 449
528 3300026088 Ga0207641_10186921 Ga0207641_101869212 449
529 3300026089 Ga0207648_10019785 Ga0207648_100197856 449
530 3300026089 Ga0207648_10086932 Ga0207648_100869324 449
531 3300026095 Ga0207676_10038454 Ga0207676_100384544 449
532 3300026116 Ga0207674_10004073 Ga0207674_1000407322 449
533 3300026118 Ga0207675_100000706 Ga0207675_10000070638 449
534 3300026121 Ga0207683_10005141 Ga0207683_1000514113 449
535 3300026142 Ga0207698_10014910 Ga0207698_100149102 449
536 3300027907 Ga0207428_10112701 Ga0207428_101127012 449
537 3300028380 Ga0268265_10028782 Ga0268265_100287822 449
538 3300035121 Ga0373960_0013296 Ga0373960_0013296_327_1709 449
539 3300035691 Ga0373931_0013329 Ga0373931_0013329_1198_2580 449
540 3300035695 Ga0373927_0037711 Ga0373927_0037711_961_2340 449
541 3300046455 Ga0495603_0007974 Ga0495603_0007974_4224_5603 449
542 3300046459 Ga0495629_0001711 Ga0495629_0001711_4396_5775 449
543 3300046461 Ga0495641_0029859 Ga0495641_0029859_309_1688 449
544 3300046472 Ga0495580_0000341 Ga0495580_0000341_20185_21564 449
545 3300046473 Ga0495582_0000352 Ga0495582_0000352_13968_15347 449
546 3300046499 Ga0495594_0000049 Ga0495594_0000049_32572_33951 449
547 3300046557 Ga0495622_0003452 Ga0495622_0003452_3838_5217 449
548 3300046681 Ga0495647_0001152 Ga0495647_0001152_1235_2614 449
549 3300046683 Ga0495658_0002888 Ga0495658_0002888_4220_5599 449
550 3300046689 Ga0495613_0000244 Ga0495613_0000244_18738_20117 449
551 3300047673 Ga0495593_0000405 Ga0495593_0000405_3884_5263 449
552 3300048903 Ga0496100_0012485 Ga0496100_0012485_1195_2577 449
553 3300048905 Ga0496102_0202443 Ga0496102_0202443_91_1470 449
554 3300048906 Ga0496103_0042490 Ga0496103_0042490_1289_2671 449
555 3300048907 Ga0496104_0100510 Ga0496104_0100510_1067_2449 449
556 3300048908 Ga0496105_0050577 Ga0496105_0050577_1873_3255 449
557 3300048909 Ga0496106_0016484 Ga0496106_0016484_3652_5034 449
558 3300048909 Ga0496106_0079715 Ga0496106_0079715_1104_2483 449
559 3300048910 Ga0496107_0091706 Ga0496107_0091706_777_2156 449
560 3300048911 Ga0496108_0027900 Ga0496108_0027900_1286_2668 449
561 3300048913 Ga0496110_0017988 Ga0496110_0017988_4411_5793 449
562 3300048914 Ga0496111_0070731 Ga0496111_0070731_864_2246 449
563 3300048915 Ga0496112_0082059 Ga0496112_0082059_183_1562 449
564 3300048915 Ga0496112_0102778 Ga0496112_0102778_1289_2671 449
565 3300048916 Ga0496113_0045793 Ga0496113_0045793_187_1566 449
566 3300048917 Ga0496114_0016526 Ga0496114_0016526_4273_5655 449
567 3300048917 Ga0496114_0062369 Ga0496114_0062369_996_2378 449
568 3300048918 Ga0496115_0015523 Ga0496115_0015523_434_1816 449
569 3300049590 Ga0501074_0039961 Ga0501074_0039961_1841_3253 449
570 3300050492 nmdc:mga0yw44_80612_c1 nmdc:mga0yw44_80612_c1_305_1876 449
571 3300050514 nmdc:mga08x19_42312_c1 nmdc:mga08x19_42312_c1_682_2064 449
572 3300053085 Ga0495619_0061857 Ga0495619_0061857_1090_2469 449
573 3300053153 Ga0500616_0004378 Ga0500616_0004378_62_1609 449
574 iso_pu_bacteria 2765235802 2765466562 449
575 iso_pu_bacteria 2839993093 2839997460 449
576 iso_pu_bacteria 2904578770 2904582041 449
577 iso_pu_bacteria 2919119836 2919123181 449
578 3300005330 Ga0070690_100021605 Ga0070690_1000216053 450
579 3300005356 Ga0070674_100100868 Ga0070674_1001008682 450
580 3300009101 Ga0105247_10084212 Ga0105247_100842123 450
581 3300009177 Ga0105248_10143827 Ga0105248_101438273 450
582 3300010375 Ga0105239_10163227 Ga0105239_101632272 450
583 3300013308 Ga0157375_10003490 Ga0157375_100034907 450
584 3300014325 Ga0163163_10129463 Ga0163163_101294633 450
585 3300014326 Ga0157380_10048783 Ga0157380_100487833 450
586 3300014968 Ga0157379_10019678 Ga0157379_100196785 450
587 3300026088 Ga0207641_10249858 Ga0207641_102498581 450
588 3300026118 Ga0207675_100026125 Ga0207675_1000261254 450
589 3300028380 Ga0268265_10056528 Ga0268265_100565284 450
590 3300031548 Ga0307408_100145506 Ga0307408_1001455061 450
591 3300036647 Ga0316582_0017083 Ga0316582_0017083_997_2400 450
592 3300048904 Ga0496101_0021312 Ga0496101_0021312_1734_3113 450
593 3300048907 Ga0496104_0005572 Ga0496104_0005572_2675_4054 450
594 3300048908 Ga0496105_0003211 Ga0496105_0003211_1878_3257 450
595 3300048908 Ga0496105_0031869 Ga0496105_0031869_2644_4023 450
596 3300048909 Ga0496106_0002685 Ga0496106_0002685_1221_2600 450
597 3300048910 Ga0496107_0010037 Ga0496107_0010037_1552_2931 450
598 3300048910 Ga0496107_0112526 Ga0496107_0112526_154_1533 450
599 3300048917 Ga0496114_0003394 Ga0496114_0003394_1543_2922 450
600 3300048917 Ga0496114_0179112 Ga0496114_0179112_27_1406 450
601 3300048918 Ga0496115_0025228 Ga0496115_0025228_1728_3107 450
602 iso_pu_bacteria 2671180139 2671692318 450
603 3300005367 Ga0070667_100014739 Ga0070667_1000147397 451
604 3300005440 Ga0070705_100066043 Ga0070705_1000660432 451
605 3300006871 Ga0075434_100143512 Ga0075434_1001435122 451
606 3300025972 Ga0207668_10047803 Ga0207668_100478031 451
607 3300025986 Ga0207658_10017328 Ga0207658_100173284 451
608 3300026118 Ga0207675_100040082 Ga0207675_1000400823 451
609 3300048909 Ga0496106_0025754 Ga0496106_0025754_2582_3964 451
610 3300048916 Ga0496113_0170064 Ga0496113_0170064_293_1675 451
611 3300049571 Ga0501034_0165952 Ga0501034_0165952_385_1788 451
612 3300049573 Ga0501037_0066770 Ga0501037_0066770_410_1792 451
613 3300049575 Ga0501039_0015335 Ga0501039_0015335_1287_2669 451
614 3300049578 Ga0501042_0119367 Ga0501042_0119367_22_1404 451
615 3300049580 Ga0501046_0024813 Ga0501046_0024813_2500_3882 451
616 3300049580 Ga0501046_0027495 Ga0501046_0027495_624_2009 451
617 3300049588 Ga0501072_0113278 Ga0501072_0113278_254_1636 451
618 3300049591 Ga0501075_0041245 Ga0501075_0041245_866_2248 451
619 3300049592 Ga0501076_0044409 Ga0501076_0044409_652_2037 451
620 3300049592 Ga0501076_0178007 Ga0501076_0178007_119_1501 451
621 3300049593 Ga0501077_0006974 Ga0501077_0006974_1201_2583 451
622 3300049742 Ga0501080_0058540 Ga0501080_0058540_1063_2448 451
623 3300049823 Ga0501044_0076351 Ga0501044_0076351_1852_3237 451
624 3300050507 nmdc:mga05p37_27738_c2 nmdc:mga05p37_27738_c2_3754_5136 451
625 3300050512 nmdc:mga0n895_193860_c1 nmdc:mga0n895_193860_c1_616_1998 451
626 3300053083 Ga0495655_0001076 Ga0495655_0001076_2561_3949 451
627 3300054114 Ga0501084_0103219 Ga0501084_0103219_330_1712 451
628 3300060353 Ga0501082_0234645 Ga0501082_0234645_123_1508 451
629 3300061734 Ga0530510_0016317 Ga0530510_0016317_63_1445 451
630 3300061734 Ga0530510_0052044 Ga0530510_0052044_1508_2890 451
631 iso_pu_bacteria 2513237096 2513655651 451
632 iso_pu_bacteria 2513237101 2513697873 451
633 iso_pu_bacteria 2513237137 2513859664 451
634 iso_pu_bacteria 2513237145 2513916271 451
635 iso_pu_bacteria 2517572143 2517890115 451
636 iso_pu_bacteria 2524023210 2524467577 451
637 iso_pu_bacteria 2524023228 2524538226 451
638 iso_pu_bacteria 2643221547 2643754954 451
639 iso_pu_bacteria 2667528175 2671124352 451
640 iso_pu_bacteria 2721755755 2723842744 451
641 iso_pu_bacteria 2791355199 2793080375 451
642 iso_pu_bacteria 2838022645 2838023702 451
643 iso_pu_bacteria 2842198810 2842199216 451
644 iso_pu_bacteria 2874604998 2874606588 451
645 iso_pu_bacteria 2889033259 2889033960 451
646 iso_pu_bacteria 2903748898 2903757405 451
647 iso_pu_bacteria 2904699407 2904706739 451
648 iso_pu_bacteria 2906635258 2906642585 451
649 iso_pu_bacteria 2906660503 2906661586 451
650 iso_pu_bacteria 2908739725 2908740341 451
651 iso_pu_bacteria 2922361189 2922367365 451
652 iso_pu_bacteria 2922386360 2922389936 451
653 iso_pu_bacteria 2935630451 2935633327 451
654 iso_pu_bacteria 2941507105 2941509371 451
655 iso_pu_bacteria 2941515067 2941517200 451
656 iso_pu_bacteria 2941523033 2941529945 451
657 iso_pu_bacteria 3005474847 3005476351 451
658 iso_pu_bacteria 8006933436 8006937689 451
659 iso_pu_bacteria 8006964411 8006966047 451
660 iso_pu_bacteria 8006973647 8006977721 451
661 iso_pu_bacteria 8006984368 8006989808 451
662 iso_pu_bacteria 8006994254 8006998178 451
663 iso_pu_bacteria 8056673599 8056675194 451
664 3300003187 JGI25151J46595_10016279 JGI25151J46595_100162792 452
665 3300006038 Ga0075365_10003031 Ga0075365_100030316 452
666 3300006178 Ga0075367_10039569 Ga0075367_100395692 452
667 3300006844 Ga0075428_100020096 Ga0075428_10002009610 452
668 3300006847 Ga0075431_100094794 Ga0075431_1000947943 452
669 3300010159 Ga0099796_10001582 Ga0099796_100015825 452
670 3300025294 Ga0209025_1000171 Ga0209025_1000171115 452
671 3300028379 Ga0268266_10006350 Ga0268266_100063503 452
672 3300037466 Ga0395898_0024654 Ga0395898_0024654_1656_3098 452
673 3300037471 Ga0395905_0002783 Ga0395905_0002783_4235_5677 452
674 3300046499 Ga0495594_0036768 Ga0495594_0036768_95_1477 452
675 3300048912 Ga0496109_0143606 Ga0496109_0143606_604_1986 452
676 3300048920 Ga0496117_0001837 Ga0496117_0001837_16181_17563 452
677 3300048923 Ga0496120_0029651 Ga0496120_0029651_1769_3151 452
678 3300048925 Ga0496122_0000157 Ga0496122_0000157_62272_63651 452
679 3300048925 Ga0496122_0000464 Ga0496122_0000464_18358_19740 452
680 3300048926 Ga0496123_0000048 Ga0496123_0000048_180502_181881 452
681 3300048926 Ga0496123_0000147 Ga0496123_0000147_10282_11664 452
682 3300048927 Ga0496124_0001975 Ga0496124_0001975_16570_17952 452
683 3300048927 Ga0496124_0045079 Ga0496124_0045079_1912_3291 452
684 3300048928 Ga0496125_0003542 Ga0496125_0003542_8362_9744 452
685 3300048929 Ga0496126_0000601 Ga0496126_0000601_9858_11240 452
686 3300049571 Ga0501034_0155559 Ga0501034_0155559_146_1528 452
687 3300049574 Ga0501038_0160841 Ga0501038_0160841_372_1754 452
688 3300049579 Ga0501043_0007493 Ga0501043_0007493_143_1525 452
689 3300050489 nmdc:mga03683_4167_c1 nmdc:mga03683_4167_c1_1247_2629 452
690 3300050492 nmdc:mga0yw44_480_c1 nmdc:mga0yw44_480_c1_4073_5455 452
691 3300050510 nmdc:mga06r32_24468_c1 nmdc:mga06r32_24468_c1_521_1963 452
692 3300050512 nmdc:mga0n895_142612_c1 nmdc:mga0n895_142612_c1_202_1644 452
693 3300053088 Ga0500644_0015369 Ga0500644_0015369_666_2072 452
694 iso_pu_bacteria 2828305725 2828308189 452
695 3300002773 JGI25152J39213_1012362 JGI25152J39213_10123622 453
696 3300002773 JGI25152J39213_1015307 JGI25152J39213_10153071 453
697 3300003187 JGI25151J46595_10036533 JGI25151J46595_100365332 453
698 3300003215 JGI25153J46596_10000584 JGI25153J46596_1000058420 453
699 3300003215 JGI25153J46596_10030729 JGI25153J46596_100307292 453
700 3300003215 JGI25153J46596_10037582 JGI25153J46596_100375821 453
701 3300005336 Ga0070680_100024074 Ga0070680_1000240743 453
702 3300005336 Ga0070680_100055551 Ga0070680_1000555513 453
703 3300005459 Ga0068867_100101674 Ga0068867_1001016741 453
704 3300005548 Ga0070665_100014688 Ga0070665_1000146886 453
705 3300005578 Ga0068854_100144178 Ga0068854_1001441782 453
706 3300005614 Ga0068856_100126841 Ga0068856_1001268411 453
707 3300005718 Ga0068866_10029980 Ga0068866_100299802 453
708 3300005719 Ga0068861_100029518 Ga0068861_1000295183 453
709 3300005937 Ga0081455_10014732 Ga0081455_1001473210 453
710 3300005983 Ga0081540_1002655 Ga0081540_100265513 453
711 3300005983 Ga0081540_1006504 Ga0081540_10065043 453
712 3300005983 Ga0081540_1022796 Ga0081540_10227965 453
713 3300006038 Ga0075365_10010597 Ga0075365_100105973 453
714 3300006048 Ga0075363_100016324 Ga0075363_1000163241 453
715 3300006051 Ga0075364_10016329 Ga0075364_100163292 453
716 3300006186 Ga0075369_10017136 Ga0075369_100171362 453
717 3300006195 Ga0075366_10097697 Ga0075366_100976972 453
718 3300006353 Ga0075370_10032675 Ga0075370_100326753 453
719 3300006880 Ga0075429_100120398 Ga0075429_1001203983 453
720 3300009092 Ga0105250_10037129 Ga0105250_100371292 453
721 3300009094 Ga0111539_10029699 Ga0111539_100296996 453
722 3300009094 Ga0111539_10033166 Ga0111539_100331663 453
723 3300009147 Ga0114129_10069645 Ga0114129_100696454 453
724 3300009147 Ga0114129_10136655 Ga0114129_101366552 453
725 3300025245 Ga0207425_1002623 Ga0207425_10026233 453
726 3300025258 Ga0209129_1004169 Ga0209129_10041693 453
727 3300025258 Ga0209129_1004800 Ga0209129_10048006 453
728 3300025294 Ga0209025_1003464 Ga0209025_100346414 453
729 3300025297 Ga0209758_1003829 Ga0209758_10038299 453
730 3300025297 Ga0209758_1004170 Ga0209758_10041709 453
731 3300025297 Ga0209758_1004893 Ga0209758_100489310 453
732 3300025928 Ga0207700_10062861 Ga0207700_100628611 453
733 3300025935 Ga0207709_10036879 Ga0207709_100368791 453
734 3300025937 Ga0207669_10001419 Ga0207669_100014199 453
735 3300026067 Ga0207678_10051786 Ga0207678_100517863 453
736 3300028379 Ga0268266_10002343 Ga0268266_100023435 453
737 3300028380 Ga0268265_10039667 Ga0268265_100396674 453
738 3300028786 Ga0307517_10007290 Ga0307517_1000729011 453
739 3300028794 Ga0307515_10037579 Ga0307515_100375796 453
740 3300031824 Ga0307413_10054839 Ga0307413_100548392 453
741 3300033180 Ga0307510_10015785 Ga0307510_100157857 453
742 3300035113 Ga0373936_0012798 Ga0373936_0012798_433_1830 453
743 3300035242 Ga0373962_0002198 Ga0373962_0002198_1815_3206 453
744 3300046460 Ga0495638_0020829 Ga0495638_0020829_2159_3664 453
745 3300046491 Ga0495584_0019729 Ga0495584_0019729_1870_3255 453
746 3300046519 Ga0495632_0037343 Ga0495632_0037343_955_2340 453
747 3300046522 Ga0495643_0017611 Ga0495643_0017611_1822_3198 453
748 3300046523 Ga0495644_0039694 Ga0495644_0039694_259_1644 453
749 3300046538 Ga0495609_0011033 Ga0495609_0011033_1146_2531 453
750 3300046558 Ga0495633_0047117 Ga0495633_0047117_296_1681 453
751 3300046674 Ga0495588_0032571 Ga0495588_0032571_236_1621 453
752 3300046684 Ga0495669_0025273 Ga0495669_0025273_855_2240 453
753 3300046691 Ga0495670_0029574 Ga0495670_0029574_1277_2662 453
754 3300046694 Ga0495649_0031997 Ga0495649_0031997_243_1619 453
755 3300047315 Ga0495581_0047371 Ga0495581_0047371_404_1789 453
756 3300048090 Ga0495615_0009524 Ga0495615_0009524_244_1629 453
757 3300048905 Ga0496102_0170830 Ga0496102_0170830_44_1429 453
758 3300048906 Ga0496103_0112505 Ga0496103_0112505_16_1401 453
759 3300048909 Ga0496106_0001187 Ga0496106_0001187_11143_12519 453
760 3300048920 Ga0496117_0051521 Ga0496117_0051521_366_1742 453
761 3300048921 Ga0496118_0010841 Ga0496118_0010841_647_2023 453
762 3300048924 Ga0496121_0026318 Ga0496121_0026318_349_1725 453
763 3300048925 Ga0496122_0002548 Ga0496122_0002548_5316_6692 453
764 3300048927 Ga0496124_0066889 Ga0496124_0066889_1497_2873 453
765 3300049579 Ga0501043_0055905 Ga0501043_0055905_148_1524 453
766 3300049580 Ga0501046_0017969 Ga0501046_0017969_4206_5582 453
767 3300049581 Ga0501047_0065883 Ga0501047_0065883_1739_3115 453
768 3300049589 Ga0501073_0122318 Ga0501073_0122318_385_1761 453
769 3300049744 Ga0501083_0024070 Ga0501083_0024070_39_1415 453
770 3300050491 nmdc:mga00v17_44102_c1 nmdc:mga00v17_44102_c1_374_1759 453
771 3300050491 nmdc:mga00v17_69449_c1 nmdc:mga00v17_69449_c1_119_1504 453
772 3300050492 nmdc:mga0yw44_10820_c1 nmdc:mga0yw44_10820_c1_2296_3681 453
773 3300050492 nmdc:mga0yw44_13015_c1 nmdc:mga0yw44_13015_c1_263_1648 453
774 3300050507 nmdc:mga05p37_38858_c1 nmdc:mga05p37_38858_c1_3105_4511 453
775 3300050511 nmdc:mga08y16_62263_c1 nmdc:mga08y16_62263_c1_93_1478 453
776 3300053084 Ga0495595_0014352 Ga0495595_0014352_1881_3266 453
777 3300053084 Ga0495595_0030168 Ga0495595_0030168_825_2357 453
778 3300053093 Ga0500651_0090264 Ga0500651_0090264_402_1778 453
779 3300053094 Ga0500566_0005320 Ga0500566_0005320_5188_6573 453
780 3300053119 Ga0500595_000068 Ga0500595_000068_17402_18787 453
781 3300053134 Ga0500658_0025104 Ga0500658_0025104_344_1720 453
782 3300053156 Ga0500622_0000429 Ga0500622_0000429_31147_32523 453
783 3300053160 Ga0500633_0003101 Ga0500633_0003101_1891_3267 453
784 3300053178 Ga0500637_0002593 Ga0500637_0002593_3479_4864 453
785 iso_pu_bacteria 2558860983 2561468668 453
786 iso_pu_bacteria 2937843397 2937844350 453
787 3300005262 Ga0065165_1035029 Ga0065165_10350291 454
788 3300005327 Ga0070658_10028370 Ga0070658_100283704 454
789 3300005327 Ga0070658_10041410 Ga0070658_100414102 454
790 3300005336 Ga0070680_100009063 Ga0070680_1000090638 454
791 3300005339 Ga0070660_100208762 Ga0070660_1002087621 454
792 3300005340 Ga0070689_100129908 Ga0070689_1001299081 454
793 3300005434 Ga0070709_10042094 Ga0070709_100420942 454
794 3300005435 Ga0070714_100035924 Ga0070714_1000359242 454
795 3300005436 Ga0070713_100103755 Ga0070713_1001037552 454
796 3300005456 Ga0070678_100037609 Ga0070678_1000376092 454
797 3300005458 Ga0070681_10007604 Ga0070681_1000760410 454
798 3300005458 Ga0070681_10052599 Ga0070681_100525994 454
799 3300005459 Ga0068867_100076738 Ga0068867_1000767382 454
800 3300005466 Ga0070685_10075629 Ga0070685_100756292 454
801 3300005530 Ga0070679_100007751 Ga0070679_10000775110 454
802 3300005535 Ga0070684_100015146 Ga0070684_1000151462 454
803 3300005536 Ga0070697_100003566 Ga0070697_1000035668 454
804 3300005844 Ga0068862_100148874 Ga0068862_1001488742 454
805 3300006028 Ga0070717_10002247 Ga0070717_1000224714 454
806 3300006163 Ga0070715_10051545 Ga0070715_100515451 454
807 3300006173 Ga0070716_100027145 Ga0070716_1000271452 454
808 3300013104 Ga0157370_10121914 Ga0157370_101219143 454
809 3300021388 Ga0213875_10000142 Ga0213875_1000014245 454
810 3300025893 Ga0207682_10003335 Ga0207682_100033352 454
811 3300025906 Ga0207699_10025065 Ga0207699_100250653 454
812 3300025919 Ga0207657_10018024 Ga0207657_100180245 454
813 3300025919 Ga0207657_10109973 Ga0207657_101099732 454
814 3300025924 Ga0207694_10128085 Ga0207694_101280851 454
815 3300025929 Ga0207664_10108706 Ga0207664_101087062 454
816 3300025929 Ga0207664_10160590 Ga0207664_101605902 454
817 3300025931 Ga0207644_10189785 Ga0207644_101897852 454
818 3300025940 Ga0207691_10038271 Ga0207691_100382712 454
819 3300025942 Ga0207689_10142013 Ga0207689_101420132 454
820 3300025944 Ga0207661_10000597 Ga0207661_100005976 454
821 3300025960 Ga0207651_10099624 Ga0207651_100996241 454
822 3300026089 Ga0207648_10009097 Ga0207648_100090974 454
823 3300026121 Ga0207683_10013991 Ga0207683_100139914 454
824 3300031235 Ga0265330_10022020 Ga0265330_100220203 454
825 3300031238 Ga0265332_10003124 Ga0265332_100031243 454
826 3300031238 Ga0265332_10015403 Ga0265332_100154032 454
827 3300031240 Ga0265320_10005625 Ga0265320_100056254 454
828 3300031242 Ga0265329_10004853 Ga0265329_100048533 454
829 3300031247 Ga0265340_10004018 Ga0265340_100040187 454
830 3300031249 Ga0265339_10003260 Ga0265339_100032609 454
831 3300031249 Ga0265339_10009125 Ga0265339_100091258 454
832 3300031344 Ga0265316_10115821 Ga0265316_101158212 454
833 3300031595 Ga0265313_10011740 Ga0265313_100117405 454
834 3300031712 Ga0265342_10000281 Ga0265342_1000028122 454
835 3300031712 Ga0265342_10006089 Ga0265342_100060894 454
836 3300037312 Ga0395899_0016833 Ga0395899_0016833_703_2091 454
837 3300037312 Ga0395899_0062406 Ga0395899_0062406_812_2200 454
838 3300037418 Ga0395900_0005676 Ga0395900_0005676_993_2381 454
839 3300037466 Ga0395898_0178160 Ga0395898_0178160_426_1814 454
840 3300037853 Ga0436364_0634277 Ga0436364_0634277_409_1797 454
841 3300037853 Ga0436364_1294173 Ga0436364_1294173_891_2279 454
842 3300037853 Ga0436364_1465979 Ga0436364_1465979_8111_9499 454
843 3300041408 Ga0439453_0000474 Ga0439453_0000474_2674_4062 454
844 3300042436 Ga0439435_0011362 Ga0439435_0011362_517_1905 454
845 3300042461 Ga0439460_0019128 Ga0439460_0019128_89_1477 454
846 3300044684 Ga0466966_0044254 Ga0466966_0044254_527_1915 454
847 3300045049 Ga0466959_0025947 Ga0466959_0025947_948_2336 454
848 3300046462 Ga0495651_0113317 Ga0495651_0113317_561_1949 454
849 3300047471 Ga0495684_0034547 Ga0495684_0034547_303_1691 454
850 3300048928 Ga0496125_0000158 Ga0496125_0000158_39805_41193 454
851 3300048929 Ga0496126_0043789 Ga0496126_0043789_2658_4046 454
852 3300049568 Ga0501031_0000946 Ga0501031_0000946_14945_16333 454
853 3300049568 Ga0501031_0001971 Ga0501031_0001971_5537_6925 454
854 3300049569 Ga0501032_0000503 Ga0501032_0000503_27499_28887 454
855 3300049569 Ga0501032_0003745 Ga0501032_0003745_3006_4394 454
856 3300049570 Ga0501033_0000140 Ga0501033_0000140_41213_42601 454
857 3300049570 Ga0501033_0005696 Ga0501033_0005696_7137_8525 454
858 3300049570 Ga0501033_0019665 Ga0501033_0019665_1502_2890 454
859 3300049570 Ga0501033_0062142 Ga0501033_0062142_967_2355 454
860 3300049570 Ga0501033_0155037 Ga0501033_0155037_114_1502 454
861 3300049571 Ga0501034_0000072 Ga0501034_0000072_11658_13046 454
862 3300049571 Ga0501034_0001662 Ga0501034_0001662_11958_13361 454
863 3300049571 Ga0501034_0016783 Ga0501034_0016783_3702_5090 454
864 3300049572 Ga0501036_0000050 Ga0501036_0000050_46414_47802 454
865 3300049572 Ga0501036_0005542 Ga0501036_0005542_5021_6409 454
866 3300049572 Ga0501036_0255041 Ga0501036_0255041_48_1451 454
867 3300049573 Ga0501037_0000030 Ga0501037_0000030_17141_18529 454
868 3300049573 Ga0501037_0003738 Ga0501037_0003738_5962_7350 454
869 3300049573 Ga0501037_0012101 Ga0501037_0012101_341_1756 454
870 3300049573 Ga0501037_0030562 Ga0501037_0030562_1994_3382 454
871 3300049573 Ga0501037_0146260 Ga0501037_0146260_187_1578 454
872 3300049574 Ga0501038_0000039 Ga0501038_0000039_68689_70077 454
873 3300049574 Ga0501038_0002080 Ga0501038_0002080_3451_4839 454
874 3300049574 Ga0501038_0138390 Ga0501038_0138390_11_1402 454
875 3300049575 Ga0501039_0000060 Ga0501039_0000060_56628_58016 454
876 3300049575 Ga0501039_0003603 Ga0501039_0003603_2684_4072 454
877 3300049575 Ga0501039_0015440 Ga0501039_0015440_2642_4033 454
878 3300049576 Ga0501040_0044516 Ga0501040_0044516_1475_2866 454
879 3300049578 Ga0501042_0008737 Ga0501042_0008737_4116_5507 454
880 3300049579 Ga0501043_0002562 Ga0501043_0002562_13196_14584 454
881 3300049579 Ga0501043_0004818 Ga0501043_0004818_3702_5090 454
882 3300049579 Ga0501043_0034144 Ga0501043_0034144_2538_3926 454
883 3300049580 Ga0501046_0000522 Ga0501046_0000522_9082_10470 454
884 3300049580 Ga0501046_0002813 Ga0501046_0002813_2883_4271 454
885 3300049581 Ga0501047_0000174 Ga0501047_0000174_4353_5741 454
886 3300049581 Ga0501047_0003631 Ga0501047_0003631_9773_11161 454
887 3300049582 Ga0501048_0000704 Ga0501048_0000704_20599_21987 454
888 3300049582 Ga0501048_0005516 Ga0501048_0005516_6227_7615 454
889 3300049583 Ga0501067_0000239 Ga0501067_0000239_14984_16372 454
890 3300049583 Ga0501067_0002890 Ga0501067_0002890_2154_3545 454
891 3300049583 Ga0501067_0016088 Ga0501067_0016088_1613_3001 454
892 3300049584 Ga0501068_0000227 Ga0501068_0000227_10331_11719 454
893 3300049584 Ga0501068_0005242 Ga0501068_0005242_3830_5218 454
894 3300049585 Ga0501069_0011635 Ga0501069_0011635_2547_3938 454
895 3300049585 Ga0501069_0015333 Ga0501069_0015333_1934_3322 454
896 3300049586 Ga0501070_0003314 Ga0501070_0003314_3517_4905 454
897 3300049586 Ga0501070_0006076 Ga0501070_0006076_2048_3436 454
898 3300049587 Ga0501071_0004977 Ga0501071_0004977_5893_7281 454
899 3300049587 Ga0501071_0024865 Ga0501071_0024865_1329_2720 454
900 3300049588 Ga0501072_0001189 Ga0501072_0001189_8860_10248 454
901 3300049588 Ga0501072_0048079 Ga0501072_0048079_431_1822 454
902 3300049589 Ga0501073_0000009 Ga0501073_0000009_27483_28871 454
903 3300049589 Ga0501073_0001927 Ga0501073_0001927_6986_8374 454
904 3300049589 Ga0501073_0014036 Ga0501073_0014036_4015_5406 454
905 3300049590 Ga0501074_0000049 Ga0501074_0000049_40687_42075 454
906 3300049590 Ga0501074_0000831 Ga0501074_0000831_12941_14329 454
907 3300049592 Ga0501076_0065154 Ga0501076_0065154_121_1509 454
908 3300049741 Ga0501079_0008443 Ga0501079_0008443_1711_3099 454
909 3300049741 Ga0501079_0014652 Ga0501079_0014652_3009_4397 454
910 3300049741 Ga0501079_0048999 Ga0501079_0048999_1413_2804 454
911 3300049742 Ga0501080_0005392 Ga0501080_0005392_6635_8023 454
912 3300049742 Ga0501080_0005405 Ga0501080_0005405_6272_7660 454
913 3300049742 Ga0501080_0204562 Ga0501080_0204562_218_1609 454
914 3300049744 Ga0501083_0000251 Ga0501083_0000251_12098_13486 454
915 3300049744 Ga0501083_0003402 Ga0501083_0003402_6985_8373 454
916 3300049744 Ga0501083_0040696 Ga0501083_0040696_1600_2991 454
917 3300049822 Ga0501035_0000067 Ga0501035_0000067_100277_101665 454
918 3300049822 Ga0501035_0012866 Ga0501035_0012866_2508_3896 454
919 3300049823 Ga0501044_0000255 Ga0501044_0000255_34569_35957 454
920 3300049823 Ga0501044_0000258 Ga0501044_0000258_18073_19461 454
921 3300049823 Ga0501044_0079746 Ga0501044_0079746_1781_3172 454
922 3300049824 Ga0501045_0005432 Ga0501045_0005432_2046_3434 454
923 3300050489 nmdc:mga03683_31252_c1 nmdc:mga03683_31252_c1_505_1893 454
924 3300050496 nmdc:mga07m45_25828_c1 nmdc:mga07m45_25828_c1_108_1496 454
925 3300053093 Ga0500651_0025973 Ga0500651_0025973_2198_3655 454
926 3300053104 Ga0500556_0000191 Ga0500556_0000191_1002_2573 454
927 3300054114 Ga0501084_0002907 Ga0501084_0002907_11288_12676 454
928 3300054114 Ga0501084_0154551 Ga0501084_0154551_378_1766 454
929 3300060353 Ga0501082_0000285 Ga0501082_0000285_12944_14332 454
930 3300060353 Ga0501082_0010462 Ga0501082_0010462_2530_3918 454
931 3300060353 Ga0501082_0068963 Ga0501082_0068963_697_2088 454
932 iso_pu_bacteria 2509276021 2509391878 454
933 iso_pu_bacteria 2509276033 2509447266 454
934 iso_pu_bacteria 2510065019 2510134104 454
935 iso_pu_bacteria 2510461076 2510895532 454
936 iso_pu_bacteria 2510917030 2511199175 454
937 iso_pu_bacteria 2513237084 2513567823 454
938 iso_pu_bacteria 2513237085 2513577101 454
939 iso_pu_bacteria 2513237088 2513599923 454
940 iso_pu_bacteria 2513237093 2513633230 454
941 iso_pu_bacteria 2513237103 2513707764 454
942 iso_pu_bacteria 2513237138 2513865846 454
943 iso_pu_bacteria 2513237144 2513908666 454
944 iso_pu_bacteria 2513237162 2514018155 454
945 iso_pu_bacteria 2515075009 2515113209 454
946 iso_pu_bacteria 2515154113 2515636848 454
947 iso_pu_bacteria 2515154114 2515645814 454
948 iso_pu_bacteria 2515154116 2515655196 454
949 iso_pu_bacteria 2515154134 2515739635 454
950 iso_pu_bacteria 2516653077 2517036869 454
951 iso_pu_bacteria 2516653085 2517077231 454
952 iso_pu_bacteria 2517093000 2517095988 454
953 iso_pu_bacteria 2517287029 2517407605 454
954 iso_pu_bacteria 2519899620 2520380415 454
955 iso_pu_bacteria 2529292951 2530646648 454
956 iso_pu_bacteria 2534681796 2535517031 454
957 iso_pu_bacteria 2582581298 2585223005 454
958 iso_pu_bacteria 2582581299 2585228445 454
959 iso_pu_bacteria 2582581304 2585258348 454
960 iso_pu_bacteria 2582581867 2585400879 454
961 iso_pu_bacteria 2585427526 2585524658 454
962 iso_pu_bacteria 2585427528 2585538347 454
963 iso_pu_bacteria 2585427529 2585545588 454
964 iso_pu_bacteria 2585427590 2585822219 454
965 iso_pu_bacteria 2585427593 2585836300 454
966 iso_pu_bacteria 2585427594 2585843387 454
967 iso_pu_bacteria 2615840624 2616293209 454
968 iso_pu_bacteria 2643221599 2644007111 454
969 iso_pu_bacteria 2643221634 2644193673 454
970 iso_pu_bacteria 2643221643 2644242491 454
971 iso_pu_bacteria 2718217882 2719181947 454
972 iso_pu_bacteria 2718217927 2719386559 454
973 iso_pu_bacteria 2718217997 2719666306 454
974 iso_pu_bacteria 2718218009 2719732664 454
975 iso_pu_bacteria 2718218199 2720492726 454
976 iso_pu_bacteria 2718218232 2720614195 454
977 iso_pu_bacteria 2718218233 2720620963 454
978 iso_pu_bacteria 2718218235 2720632287 454
979 iso_pu_bacteria 2718218269 2720776015 454
980 iso_pu_bacteria 2718218363 2721148038 454
981 iso_pu_bacteria 2718218365 2721159489 454
982 iso_pu_bacteria 2718218366 2721164874 454
983 iso_pu_bacteria 2718218423 2721400263 454
984 iso_pu_bacteria 2721755514 2722841044 454
985 iso_pu_bacteria 2721755556 2723027614 454
986 iso_pu_bacteria 2721755684 2723561242 454
987 iso_pu_bacteria 2721755685 2723567865 454
988 iso_pu_bacteria 2721755809 2724039076 454
989 iso_pu_bacteria 2721755810 2724045420 454
990 iso_pu_bacteria 2721755819 2724090622 454
991 iso_pu_bacteria 2721755822 2724105130 454
992 iso_pu_bacteria 2721755823 2724110957 454
993 iso_pu_bacteria 2724679232 2725951452 454
994 iso_pu_bacteria 2728369352 2730108550 454
995 iso_pu_bacteria 2728369365 2730165182 454
996 iso_pu_bacteria 2728369397 2730299121 454
997 iso_pu_bacteria 2738541293 2738800242 454
998 iso_pu_bacteria 2738541333 2739032988 454
999 iso_pu_bacteria 2765235942 2766066025 454
1000 iso_pu_bacteria 2791355256 2793294287 454
1001 iso_pu_bacteria 2791355259 2793315939 454
1002 iso_pu_bacteria 2791355260 2793319328 454
1003 iso_pu_bacteria 2791355261 2793328413 454
1004 iso_pu_bacteria 2791355262 2793335369 454
1005 iso_pu_bacteria 2791355263 2793339422 454
1006 iso_pu_bacteria 2791355264 2793347100 454
1007 iso_pu_bacteria 2791355265 2793351691 454
1008 iso_pu_bacteria 2791355266 2793361989 454
1009 iso_pu_bacteria 2791355267 2793367744 454
1010 iso_pu_bacteria 2802429605 2805926921 454
1011 iso_pu_bacteria 2802429606 2805932835 454
1012 iso_pu_bacteria 2802429633 2806045127 454
1013 iso_pu_bacteria 2802429634 2806050079 454
1014 iso_pu_bacteria 2802429635 2806056917 454
1015 iso_pu_bacteria 2802429636 2806064298 454
1016 iso_pu_bacteria 2802429637 2806071565 454
1017 iso_pu_bacteria 2838016132 2838021603 454
1018 iso_pu_bacteria 2838035591 2838038634 454
1019 iso_pu_bacteria 2838042994 2838045117 454
1020 iso_pu_bacteria 2838048938 2838053402 454
1021 iso_pu_bacteria 2838061910 2838065522 454
1022 iso_pu_bacteria 2838068647 2838070001 454
1023 iso_pu_bacteria 2838661181 2838661446 454
1024 iso_pu_bacteria 2838668709 2838670512 454
1025 iso_pu_bacteria 2838680041 2838683304 454
1026 iso_pu_bacteria 2838686498 2838686896 454
1027 iso_pu_bacteria 2838694306 2838697752 454
1028 iso_pu_bacteria 2838701080 2838702883 454
1029 iso_pu_bacteria 2838707686 2838710868 454
1030 iso_pu_bacteria 2838729681 2838730146 454
1031 iso_pu_bacteria 2838742623 2838742839 454
1032 iso_pu_bacteria 2841851746 2841852342 454
1033 iso_pu_bacteria 2841864319 2841867105 454
1034 iso_pu_bacteria 2842077413 2842079041 454
1035 iso_pu_bacteria 2842110456 2842113114 454
1036 iso_pu_bacteria 2842118031 2842118449 454
1037 iso_pu_bacteria 2842146304 2842147859 454
1038 iso_pu_bacteria 2842156927 2842158200 454
1039 iso_pu_bacteria 2842163707 2842168641 454
1040 iso_pu_bacteria 2842180545 2842181820 454
1041 iso_pu_bacteria 2842192696 2842198736 454
1042 iso_pu_bacteria 2842205361 2842209666 454
1043 iso_pu_bacteria 2842217011 2842218094 454
1044 iso_pu_bacteria 2842229732 2842230129 454
1045 iso_pu_bacteria 2842237096 2842240360 454
1046 iso_pu_bacteria 2842243621 2842244018 454
1047 iso_pu_bacteria 2842250916 2842252925 454
1048 iso_pu_bacteria 2842257432 2842257897 454
1049 iso_pu_bacteria 2842264693 2842269434 454
1050 iso_pu_bacteria 2842271015 2842271566 454
1051 iso_pu_bacteria 2842278818 2842283120 454
1052 iso_pu_bacteria 2842285085 2842285456 454
1053 iso_pu_bacteria 2842291075 2842292703 454
1054 iso_pu_bacteria 2842304105 2842305197 454
1055 iso_pu_bacteria 2842311132 2842314072 454
1056 iso_pu_bacteria 2842317721 2842320864 454
1057 iso_pu_bacteria 2842341865 2842347370 454
1058 iso_pu_bacteria 2842363717 2842370178 454
1059 iso_pu_bacteria 2842370503 2842373935 454
1060 iso_pu_bacteria 2842377471 2842379101 454
1061 iso_pu_bacteria 2842384541 2842384959 454
1062 iso_pu_bacteria 2842395702 2842400197 454
1063 iso_pu_bacteria 2842402390 2842402816 454
1064 iso_pu_bacteria 2842409023 2842409813 454
1065 iso_pu_bacteria 2842415677 2842416462 454
1066 iso_pu_bacteria 2842422224 2842423615 454
1067 iso_pu_bacteria 2842428310 2842430564 454
1068 iso_pu_bacteria 2842434925 2842436624 454
1069 iso_pu_bacteria 2842441272 2842443534 454
1070 iso_pu_bacteria 2842447887 2842449404 454
1071 iso_pu_bacteria 2842462802 2842466818 454
1072 iso_pu_bacteria 2842469257 2842471506 454
1073 iso_pu_bacteria 2842489311 2842492220 454
1074 iso_pu_bacteria 2842495871 2842496600 454
1075 iso_pu_bacteria 2844454524 2844458193 454
1076 iso_pu_bacteria 2857516855 2857517274 454
1077 iso_pu_bacteria 2919100787 2919106311 454
1078 iso_pu_bacteria 2923556063 2923559254 454
1079 iso_pu_bacteria 2933570622 2933571004 454
1080 iso_pu_bacteria 2933586486 2933588829 454
1081 iso_pu_bacteria 2933599457 2933600807 454
1082 iso_pu_bacteria 2935894831 2935896862 454
1083 iso_pu_bacteria 2935901341 2935901803 454
1084 iso_pu_bacteria 2936367885 2936371886 454
1085 iso_pu_bacteria 2936375103 2936379721 454
1086 iso_pu_bacteria 2936381700 2936387468 454
1087 iso_pu_bacteria 2996887358 2996892890 454
1088 iso_pu_bacteria 2996893221 2996894995 454
1089 iso_pu_bacteria 3005445848 3005448600 454
1090 iso_pu_bacteria 3005452660 3005454838 454
1091 iso_pu_bacteria 639633055 639649328 454
1092 iso_pu_bacteria 8005258706 8005259343 454
1093 iso_pu_bacteria 8005275841 8005281364 454
1094 iso_pu_bacteria 8005282627 8005284666 454
1095 iso_pu_bacteria 8005289223 8005295668 454
1096 iso_pu_bacteria 8005301065 8005303279 454
1097 iso_pu_bacteria 8005307578 8005309544 454
1098 iso_pu_bacteria 8005321885 8005327417 454
1099 iso_pu_bacteria 8005376324 8005381081 454
1100 iso_pu_bacteria 8005382845 8005388971 454
1101 iso_pu_bacteria 8005395548 8005395954 454
1102 iso_pu_bacteria 8005430974 8005437432 454
1103 iso_pu_bacteria 8005460587 8005463892 454
1104 iso_pu_bacteria 8005497431 8005501046 454
1105 iso_pu_bacteria 8005542996 8005545844 454
1106 iso_pu_bacteria 8005556819 8005556869 454
1107 iso_pu_bacteria 8005563573 8005568149 454
1108 iso_pu_bacteria 8005570704 8005573310 454
1109 iso_pu_bacteria 8005619151 8005622413 454
1110 iso_pu_bacteria 8005626139 8005629913 454
1111 iso_pu_bacteria 8005668836 8005672463 454
1112 iso_pu_bacteria 8005688590 8005691949 454
1113 iso_pu_bacteria 8005695170 8005697558 454
1114 iso_pu_bacteria 8018127388 8018128051 454
1115 iso_pu_bacteria 8018163183 8018164421 454
1116 iso_pu_bacteria 8018176218 8018176901 454
1117 iso_pu_bacteria 8023680758 8023683016 454
1118 iso_pu_bacteria 8024479707 8024482714 454
1119 iso_pu_bacteria 8024501048 8024504587 454
1120 iso_pu_bacteria 8056375014 8056378290 454
1121 iso_pu_bacteria 8056382006 8056384268 454
1122 iso_pu_bacteria 8057874678 8057878469 454
1123 3300042436 Ga0439435_0014143 Ga0439435_0014143_112_1554 455
1124 3300048921 Ga0496118_0109008 Ga0496118_0109008_280_1713 455
1125 3300049570 Ga0501033_0059447 Ga0501033_0059447_1398_2795 455
1126 3300049574 Ga0501038_0045779 Ga0501038_0045779_1726_3123 455
1127 iso_pu_bacteria 2510917022 2511136737 455
1128 iso_pu_bacteria 2510917026 2511170702 455
1129 iso_pu_bacteria 2513237146 2513925252 455
1130 iso_pu_bacteria 2524023209 2524458777 455
1131 iso_pu_bacteria 2537561587 2537876104 455
1132 iso_pu_bacteria 2554235003 2554248326 455
1133 iso_pu_bacteria 2558860242 2559295442 455
1134 iso_pu_bacteria 2582581307 2585271273 455
1135 iso_pu_bacteria 2585427531 2585559018 455
1136 iso_pu_bacteria 2585427608 2585898397 455
1137 iso_pu_bacteria 2585427609 2585904035 455
1138 iso_pu_bacteria 2585428125 2587980847 455
1139 iso_pu_bacteria 2599185170 2599417162 455
1140 iso_pu_bacteria 2599185210 2599601757 455
1141 iso_pu_bacteria 2599185236 2599721519 455
1142 iso_pu_bacteria 2600254933 2600374183 455
1143 iso_pu_bacteria 2600255279 2601609983 455
1144 iso_pu_bacteria 2600255308 2601746758 455
1145 iso_pu_bacteria 2643221568 2643856651 455
1146 iso_pu_bacteria 2643221582 2643920244 455
1147 iso_pu_bacteria 2643221693 2644521863 455
1148 iso_pu_bacteria 2738541317 2738947939 455
1149 iso_pu_bacteria 2808606387 2808987823 455
1150 iso_pu_bacteria 2818991439 2819559156 455
1151 iso_pu_bacteria 2818991461 2819685075 455
1152 iso_pu_bacteria 2821123053 2821127372 455
1153 iso_pu_bacteria 2837651117 2837654596 455
1154 iso_pu_bacteria 2838675328 2838675673 455
1155 iso_pu_bacteria 2838714209 2838714555 455
1156 iso_pu_bacteria 2838719591 2838721644 455
1157 iso_pu_bacteria 2838724970 2838725315 455
1158 iso_pu_bacteria 2838736955 2838737897 455
1159 iso_pu_bacteria 2841840854 2841841734 455
1160 iso_pu_bacteria 2841846520 2841848626 455
1161 iso_pu_bacteria 2841859092 2841862225 455
1162 iso_pu_bacteria 2842124991 2842125343 455
1163 iso_pu_bacteria 2842130223 2842130568 455
1164 iso_pu_bacteria 2842140634 2842141512 455
1165 iso_pu_bacteria 2842152218 2842154262 455
1166 iso_pu_bacteria 2842170452 2842170799 455
1167 iso_pu_bacteria 2842175837 2842177882 455
1168 iso_pu_bacteria 2842187318 2842187664 455
1169 iso_pu_bacteria 2842211629 2842211975 455
1170 iso_pu_bacteria 2842224351 2842226406 455
1171 iso_pu_bacteria 2842298080 2842298125 455
1172 iso_pu_bacteria 2842357229 2842360275 455
1173 iso_pu_bacteria 2842509118 2842510955 455
1174 iso_pu_bacteria 2842515876 2842519009 455
1175 iso_pu_bacteria 2852387548 2852390401 455
1176 iso_pu_bacteria 2854896431 2854901260 455
1177 iso_pu_bacteria 2854916844 2854918641 455
1178 iso_pu_bacteria 2857531043 2857532212 455
1179 iso_pu_bacteria 2891373044 2891373509 455
1180 iso_pu_bacteria 2899792073 2899795954 455
1181 iso_pu_bacteria 2899845264 2899847814 455
1182 iso_pu_bacteria 2913308742 2913312852 455
1183 iso_pu_bacteria 2919114240 2919114591 455
1184 iso_pu_bacteria 2919166419 2919169427 455
1185 iso_pu_bacteria 2919171160 2919172879 455
1186 iso_pu_bacteria 2926754445 2926755608 455
1187 iso_pu_bacteria 2926760298 2926762732 455
1188 iso_pu_bacteria 2933006813 2933008907 455
1189 iso_pu_bacteria 2933011516 2933014818 455
1190 iso_pu_bacteria 2933016740 2933023235 455
1191 iso_pu_bacteria 2933594066 2933596495 455
1192 iso_pu_bacteria 2978969890 2978971833 455
1193 iso_pu_bacteria 2979089926 2979094777 455
1194 iso_pu_bacteria 2979095461 2979100657 455
1195 iso_pu_bacteria 2984587000 2984590117 455
1196 iso_pu_bacteria 2989349275 2989349981 455
1197 iso_pu_bacteria 3005409236 3005414416 455
1198 iso_pu_bacteria 650716007 650740652 455
1199 iso_pu_bacteria 8003570095 8003571723 455
1200 iso_pu_bacteria 8024486573 8024488174 455
1201 iso_pu_bacteria 8046767195 8046771797 455
1202 iso_pu_bacteria 8054460903 8054463081 455
1203 iso_pu_bacteria 8054558443 8054561071 455
1204 iso_pu_bacteria 8057575449 8057575555 455
1205 3300005983 Ga0081540_1001329 Ga0081540_100132917 456
1206 3300031456 Ga0307513_10093541 Ga0307513_100935412 456
1207 3300053093 Ga0500651_0041252 Ga0500651_0041252_392_1789 456
1208 iso_pu_bacteria 2582581308 2585279212 456
1209 iso_pu_bacteria 2582581315 2585323183 456
1210 iso_pu_bacteria 2582581316 2585331291 456
1211 iso_pu_bacteria 2585427527 2585531303 456
1212 iso_pu_bacteria 2585427530 2585552774 456
1213 iso_pu_bacteria 2615840626 2616311379 456
1214 iso_pu_bacteria 2615840698 2616554394 456
1215 iso_pu_bacteria 2617270742 2617386240 456
1216 iso_pu_bacteria 2667528174 2671111284 456
1217 iso_pu_bacteria 2775507266 2778175575 456
1218 iso_pu_bacteria 2818991448 2819609283 456
1219 iso_pu_bacteria 2818991453 2819641408 456
1220 iso_pu_bacteria 2838029111 2838033695 456
1221 iso_pu_bacteria 2842475841 2842480442 456
1222 iso_pu_bacteria 2842482326 2842483926 456
1223 iso_pu_bacteria 2842502639 2842505337 456
1224 iso_pu_bacteria 2919408235 2919410147 456
1225 iso_pu_bacteria 3005416602 3005417511 456
1226 iso_pu_bacteria 8005314921 8005315700 456
1227 iso_pu_bacteria 8005484373 8005489051 456
1228 iso_pu_bacteria 8005645114 8005646131 456
1229 iso_pu_bacteria 8005682033 8005682744 456
1230 3300002773 JGI25152J39213_1000503 JGI25152J39213_100050311 458
1231 3300002773 JGI25152J39213_1000625 JGI25152J39213_100062513 458
1232 3300002773 JGI25152J39213_1003940 JGI25152J39213_10039404 458
1233 3300002774 JGI25150J39212_1000065 JGI25150J39212_100006513 458
1234 3300003187 JGI25151J46595_10000367 JGI25151J46595_1000036715 458
1235 3300003187 JGI25151J46595_10000921 JGI25151J46595_100009219 458
1236 3300003187 JGI25151J46595_10003025 JGI25151J46595_1000302510 458
1237 3300003187 JGI25151J46595_10014979 JGI25151J46595_100149794 458
1238 3300003215 JGI25153J46596_10002664 JGI25153J46596_1000266411 458
1239 3300003215 JGI25153J46596_10012117 JGI25153J46596_100121171 458
1240 3300003215 JGI25153J46596_10025022 JGI25153J46596_100250221 458
1241 3300003354 JGI25160J50197_1005650 JGI25160J50197_10056506 458
1242 3300003374 JGI25161J50226_1002399 JGI25161J50226_10023993 458
1243 3300003771 Ga0055526_1002871 Ga0055526_100287112 458
1244 3300003771 Ga0055526_1006392 Ga0055526_10063925 458
1245 3300003771 Ga0055526_1013626 Ga0055526_10136261 458
1246 3300003775 Ga0055524_1000844 Ga0055524_100084415 458
1247 3300003775 Ga0055524_1008042 Ga0055524_10080425 458
1248 3300003775 Ga0055524_1008939 Ga0055524_10089395 458
1249 3300003790 Ga0055528_1000256 Ga0055528_100025638 458
1250 3300003790 Ga0055528_1001239 Ga0055528_100123910 458
1251 3300003790 Ga0055528_1005673 Ga0055528_10056735 458
1252 3300003790 Ga0055528_1008996 Ga0055528_10089962 458
1253 3300003792 Ga0055540_1001577 Ga0055540_100157716 458
1254 3300004625 Ga0055543_1000421 Ga0055543_100042118 458
1255 3300005355 Ga0070671_100073641 Ga0070671_1000736412 458
1256 3300006178 Ga0075367_10000307 Ga0075367_100003075 458
1257 3300006178 Ga0075367_10041292 Ga0075367_100412922 458
1258 3300009177 Ga0105248_10084418 Ga0105248_100844182 458
1259 3300009765 Ga0123341_1000028 Ga0123341_100002812 458
1260 3300025245 Ga0207425_1000055 Ga0207425_1000055105 458
1261 3300025245 Ga0207425_1010050 Ga0207425_10100502 458
1262 3300025258 Ga0209129_1000029 Ga0209129_1000029306 458
1263 3300025258 Ga0209129_1000252 Ga0209129_100025231 458
1264 3300025258 Ga0209129_1004487 Ga0209129_10044874 458
1265 3300025258 Ga0209129_1006109 Ga0209129_10061093 458
1266 3300025273 Ga0209673_1000010 Ga0209673_1000010397 458
1267 3300025273 Ga0209673_1000025 Ga0209673_1000025285 458
1268 3300025273 Ga0209673_1001302 Ga0209673_100130213 458
1269 3300025273 Ga0209673_1003553 Ga0209673_100355310 458
1270 3300025273 Ga0209673_1006293 Ga0209673_10062934 458
1271 3300025273 Ga0209673_1013055 Ga0209673_10130552 458
1272 3300025294 Ga0209025_1000070 Ga0209025_100007075 458
1273 3300025294 Ga0209025_1000091 Ga0209025_100009151 458
1274 3300025294 Ga0209025_1002872 Ga0209025_100287219 458
1275 3300025294 Ga0209025_1004176 Ga0209025_10041764 458
1276 3300025294 Ga0209025_1005254 Ga0209025_100525411 458
1277 3300025294 Ga0209025_1009226 Ga0209025_10092265 458
1278 3300025294 Ga0209025_1045523 Ga0209025_10455232 458
1279 3300025295 Ga0209564_1000644 Ga0209564_100064438 458
1280 3300025295 Ga0209564_1002026 Ga0209564_100202622 458
1281 3300025295 Ga0209564_1004176 Ga0209564_100417611 458
1282 3300025295 Ga0209564_1019688 Ga0209564_10196882 458
1283 3300025297 Ga0209758_1000094 Ga0209758_1000094159 458
1284 3300025297 Ga0209758_1001343 Ga0209758_100134325 458
1285 3300025297 Ga0209758_1001396 Ga0209758_100139624 458
1286 3300025297 Ga0209758_1003105 Ga0209758_100310510 458
1287 3300025297 Ga0209758_1005268 Ga0209758_100526811 458
1288 3300025298 Ga0209050_1003085 Ga0209050_100308517 458
1289 3300025299 Ga0209256_1000924 Ga0209256_100092432 458
1290 3300025299 Ga0209256_1001336 Ga0209256_100133619 458
1291 3300025299 Ga0209256_1001864 Ga0209256_100186410 458
1292 3300025299 Ga0209256_1013150 Ga0209256_10131504 458
1293 3300025302 Ga0207426_1000218 Ga0207426_100021860 458
1294 3300025302 Ga0207426_1001028 Ga0207426_100102815 458
1295 3300025303 Ga0209051_1000393 Ga0209051_10003935 458
1296 3300025303 Ga0209051_1003537 Ga0209051_100353711 458
1297 3300025303 Ga0209051_1044163 Ga0209051_10441631 458
1298 3300025304 Ga0209257_1001180 Ga0209257_100118030 458
1299 3300028794 Ga0307515_10024602 Ga0307515_100246022 458
1300 3300031731 Ga0307405_10076695 Ga0307405_100766952 458
1301 3300031911 Ga0307412_10005488 Ga0307412_100054887 458
1302 3300041413 Ga0439465_0003165 Ga0439465_0003165_1429_2805 458
1303 3300041496 Ga0451839_1004641 Ga0451839_1004641_284_1660 458
1304 3300041498 Ga0451841_0076277 Ga0451841_0076277_50_1426 458
1305 3300041512 Ga0451853_2995973 Ga0451853_2995973_565_1941 458
1306 3300046460 Ga0495638_0000679 Ga0495638_0000679_22470_23846 458
1307 3300046474 Ga0495605_0001576 Ga0495605_0001576_2702_4078 458
1308 3300046492 Ga0495585_0011315 Ga0495585_0011315_814_2190 458
1309 3300046501 Ga0495607_0026885 Ga0495607_0026885_252_1628 458
1310 3300046506 Ga0495583_0001761 Ga0495583_0001761_8464_9840 458
1311 3300046506 Ga0495583_0015906 Ga0495583_0015906_1389_2765 458
1312 3300046512 Ga0495610_0001284 Ga0495610_0001284_20537_21913 458
1313 3300046515 Ga0495620_0014239 Ga0495620_0014239_1014_2390 458
1314 3300046518 Ga0495631_0000730 Ga0495631_0000730_12928_14304 458
1315 3300046519 Ga0495632_0003008 Ga0495632_0003008_8896_10272 458
1316 3300046522 Ga0495643_0013305 Ga0495643_0013305_2346_3722 458
1317 3300046522 Ga0495643_0026246 Ga0495643_0026246_1042_2418 458
1318 3300046524 Ga0495648_0029417 Ga0495648_0029417_1573_2949 458
1319 3300046542 Ga0495597_0016698 Ga0495597_0016698_454_1830 458
1320 3300046616 Ga0495668_0073452 Ga0495668_0073452_104_1480 458
1321 3300046648 Ga0495611_0006826 Ga0495611_0006826_3137_4513 458
1322 3300046660 Ga0495625_0002939 Ga0495625_0002939_13235_14611 458
1323 3300046694 Ga0495649_0067809 Ga0495649_0067809_43_1419 458
1324 3300046810 Ga0495660_0026020 Ga0495660_0026020_1073_2449 458
1325 3300047443 Ga0495687_052686 Ga0495687_052686_100_1476 458
1326 3300047472 Ga0495686_0039171 Ga0495686_0039171_98_1474 458
1327 3300047472 Ga0495686_0050992 Ga0495686_0050992_463_1839 458
1328 3300048091 Ga0495626_0047851 Ga0495626_0047851_319_1695 458
1329 3300048919 Ga0496116_0004327 Ga0496116_0004327_9883_11259 458
1330 3300048919 Ga0496116_0008694 Ga0496116_0008694_2095_3471 458
1331 3300048919 Ga0496116_0028841 Ga0496116_0028841_454_1830 458
1332 3300048920 Ga0496117_0005543 Ga0496117_0005543_3756_5132 458
1333 3300048921 Ga0496118_0006810 Ga0496118_0006810_8117_9550 458
1334 3300048922 Ga0496119_0073263 Ga0496119_0073263_584_1963 458
1335 3300048924 Ga0496121_0031226 Ga0496121_0031226_3432_4808 458
1336 3300048924 Ga0496121_0051303 Ga0496121_0051303_63_1439 458
1337 3300048925 Ga0496122_0017363 Ga0496122_0017363_3246_4622 458
1338 3300048925 Ga0496122_0042048 Ga0496122_0042048_1231_2607 458
1339 3300048926 Ga0496123_0024846 Ga0496123_0024846_63_1439 458
1340 3300048926 Ga0496123_0049001 Ga0496123_0049001_1231_2607 458
1341 3300048926 Ga0496123_0062745 Ga0496123_0062745_940_2316 458
1342 3300048927 Ga0496124_0009611 Ga0496124_0009611_451_1827 458
1343 3300048927 Ga0496124_0030203 Ga0496124_0030203_2113_3489 458
1344 3300048927 Ga0496124_0052642 Ga0496124_0052642_1316_2692 458
1345 3300048928 Ga0496125_0003285 Ga0496125_0003285_14827_16203 458
1346 3300049459 Ga0495678_038248 Ga0495678_038248_207_1583 458
1347 3300049569 Ga0501032_0088721 Ga0501032_0088721_47_1423 458
1348 3300049570 Ga0501033_0175882 Ga0501033_0175882_48_1424 458
1349 3300049742 Ga0501080_0195485 Ga0501080_0195485_389_1765 458
1350 3300049744 Ga0501083_0083294 Ga0501083_0083294_679_2055 458
1351 3300050492 nmdc:mga0yw44_2265_c1 nmdc:mga0yw44_2265_c1_5472_6848 458
1352 3300050494 nmdc:mga06z11_65479_c1 nmdc:mga06z11_65479_c1_410_1786 458
1353 3300053086 Ga0500578_0017813 Ga0500578_0017813_1996_3372 458
1354 3300053109 Ga0500569_002351 Ga0500569_002351_1621_2997 458
1355 3300053125 Ga0500618_015726 Ga0500618_015726_438_1814 458
1356 3300053134 Ga0500658_0007207 Ga0500658_0007207_69_1445 458
1357 3300053139 Ga0500568_0000963 Ga0500568_0000963_9091_10467 458
1358 3300053153 Ga0500616_0000577 Ga0500616_0000577_30006_31382 458
1359 iso_pu_bacteria 2929138655 2929140965 458
1360 3300002987 JGI25159J45721_1000877 JGI25159J45721_100087711 459
1361 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001473 459
1362 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001284 459
1363 3300003792 Ga0055540_1001197 Ga0055540_100119713 459
1364 3300004625 Ga0055543_1000003 Ga0055543_1000003300 459
1365 3300005262 Ga0065165_1000335 Ga0065165_100033523 459
1366 3300005262 Ga0065165_1004192 Ga0065165_10041929 459
1367 3300005548 Ga0070665_100004062 Ga0070665_1000040629 459
1368 3300005548 Ga0070665_100183478 Ga0070665_1001834781 459
1369 3300006038 Ga0075365_10000668 Ga0075365_1000066812 459
1370 3300006042 Ga0075368_10007363 Ga0075368_100073634 459
1371 3300006048 Ga0075363_100055676 Ga0075363_1000556762 459
1372 3300006177 Ga0075362_10002069 Ga0075362_100020693 459
1373 3300006195 Ga0075366_10035707 Ga0075366_100357073 459
1374 3300006946 Ga0079104_1000045 Ga0079104_1000045114 459
1375 3300006948 Ga0099826_10001757 Ga0099826_1000175711 459
1376 3300009148 Ga0105243_10084484 Ga0105243_100844842 459
1377 3300013100 Ga0157373_10045009 Ga0157373_100450093 459
1378 3300013102 Ga0157371_10000017 Ga0157371_10000017159 459
1379 3300013104 Ga0157370_10000453 Ga0157370_1000045322 459
1380 3300025284 Ga0209130_1000003 Ga0209130_1000003301 459
1381 3300025292 Ga0209676_1003911 Ga0209676_10039119 459
1382 3300025294 Ga0209025_1000213 Ga0209025_100021395 459
1383 3300025302 Ga0207426_1000011 Ga0207426_1000011474 459
1384 3300025303 Ga0209051_1000645 Ga0209051_100064523 459
1385 3300025304 Ga0209257_1001083 Ga0209257_10010839 459
1386 3300025935 Ga0207709_10055490 Ga0207709_100554903 459
1387 3300027111 Ga0209281_1000034 Ga0209281_1000034190 459
1388 3300027312 Ga0209371_1000022 Ga0209371_1000022181 459
1389 3300027866 Ga0209813_10001527 Ga0209813_100015272 459
1390 3300030500 Ga0268256_1000019 Ga0268256_1000019339 459
1391 3300046454 Ga0495592_0043717 Ga0495592_0043717_1375_2754 459
1392 3300046462 Ga0495651_0044401 Ga0495651_0044401_915_2294 459
1393 3300046476 Ga0495662_0005789 Ga0495662_0005789_567_1946 459
1394 3300046530 Ga0495654_0000340 Ga0495654_0000340_10653_12032 459
1395 3300046558 Ga0495633_0029770 Ga0495633_0029770_753_2132 459
1396 3300046674 Ga0495588_0003299 Ga0495588_0003299_1519_2898 459
1397 3300046809 Ga0495600_0134447 Ga0495600_0134447_208_1587 459
1398 3300047317 Ga0495604_0009407 Ga0495604_0009407_4855_6234 459
1399 3300047472 Ga0495686_0002387 Ga0495686_0002387_8590_9969 459
1400 3300048907 Ga0496104_0062113 Ga0496104_0062113_572_1951 459
1401 3300048913 Ga0496110_0128416 Ga0496110_0128416_702_2081 459
1402 3300048914 Ga0496111_0000384 Ga0496111_0000384_17503_18882 459
1403 3300048920 Ga0496117_0000002 Ga0496117_0000002_364095_365474 459
1404 3300048920 Ga0496117_0108756 Ga0496117_0108756_339_1718 459
1405 3300048921 Ga0496118_0000504 Ga0496118_0000504_56158_57537 459
1406 3300048921 Ga0496118_0042282 Ga0496118_0042282_894_2273 459
1407 3300048923 Ga0496120_0000248 Ga0496120_0000248_60144_61523 459
1408 3300048924 Ga0496121_0060589 Ga0496121_0060589_1368_2747 459
1409 3300048925 Ga0496122_0000004 Ga0496122_0000004_280202_281581 459
1410 3300048925 Ga0496122_0008594 Ga0496122_0008594_9203_10582 459
1411 3300048925 Ga0496122_0012347 Ga0496122_0012347_5396_6775 459
1412 3300048926 Ga0496123_0000007 Ga0496123_0000007_280202_281581 459
1413 3300048926 Ga0496123_0008732 Ga0496123_0008732_4240_5619 459
1414 3300048927 Ga0496124_0000252 Ga0496124_0000252_23331_24713 459
1415 3300048927 Ga0496124_0006419 Ga0496124_0006419_1399_2778 459
1416 3300048927 Ga0496124_0052659 Ga0496124_0052659_1779_3158 459
1417 3300048928 Ga0496125_0048283 Ga0496125_0048283_1051_2430 459
1418 3300049571 Ga0501034_0068842 Ga0501034_0068842_1235_2731 459
1419 3300050489 nmdc:mga03683_28078_c1 nmdc:mga03683_28078_c1_468_1847 459
1420 3300050490 nmdc:mga03n38_36547_c1 nmdc:mga03n38_36547_c1_168_1547 459
1421 3300050491 nmdc:mga00v17_465_c1 nmdc:mga00v17_465_c1_13742_15121 459
1422 3300050492 nmdc:mga0yw44_133_c1 nmdc:mga0yw44_133_c1_11589_12968 459
1423 3300050516 nmdc:mga0sz30_1524_c1 nmdc:mga0sz30_1524_c1_3102_4481 459
1424 3300053107 Ga0500560_000794 Ga0500560_000794_1911_3290 459
1425 3300053125 Ga0500618_000143 Ga0500618_000143_46551_47930 459
1426 3300053137 Ga0500561_0000087 Ga0500561_0000087_9970_11349 459
1427 3300053148 Ga0500590_006431 Ga0500590_006431_2291_3670 459
1428 3300053153 Ga0500616_0000682 Ga0500616_0000682_28644_30023 459
1429 3300053161 Ga0500634_0003778 Ga0500634_0003778_3700_5079 459
1430 iso_pu_bacteria 2979100975 2979104010 459
1431 iso_pu_bacteria 2984509177 2984511421 459
1432 iso_pu_bacteria 2984518228 2984522218 459
1433 iso_pu_bacteria 2984537506 2984541519 459
1434 iso_pu_bacteria 2984601300 2984603794 459
1435 3300001979 JGI24740J21852_10000423 JGI24740J21852_1000042311 460
1436 3300002704 JGI25155J39150_1000014 JGI25155J39150_100001414 460
1437 3300002705 JGI25156J39149_1000037 JGI25156J39149_100003798 460
1438 3300002737 JGI25162J39368_1000812 JGI25162J39368_100081216 460
1439 3300002738 JGI25154J39366_1000876 JGI25154J39366_10008765 460
1440 3300002741 JGI25157J39369_1000040 JGI25157J39369_100004012 460
1441 3300003214 JGI25165J46597_1000903 JGI25165J46597_100090316 460
1442 3300003214 JGI25165J46597_1001166 JGI25165J46597_100116615 460
1443 3300003322 rootL2_10000510 rootL2_100005105 460
1444 3300003856 Ga0058692_1012637 Ga0058692_10126371 460
1445 3300005548 Ga0070665_100035974 Ga0070665_1000359743 460
1446 3300005563 Ga0068855_100181107 Ga0068855_1001811072 460
1447 3300005614 Ga0068856_100098838 Ga0068856_1000988382 460
1448 3300005614 Ga0068856_100139066 Ga0068856_1001390662 460
1449 3300005616 Ga0068852_100018831 Ga0068852_1000188316 460
1450 3300009093 Ga0105240_10000014 Ga0105240_10000014372 460
1451 3300009545 Ga0105237_10001173 Ga0105237_100011739 460
1452 3300010375 Ga0105239_10007720 Ga0105239_100077206 460
1453 3300013104 Ga0157370_10000248 Ga0157370_1000024851 460
1454 3300015262 Ga0182007_10002275 Ga0182007_1000227511 460
1455 3300015265 Ga0182005_1003222 Ga0182005_10032222 460
1456 3300025206 Ga0209435_100027 Ga0209435_10002712 460
1457 3300025233 Ga0209437_100051 Ga0209437_100051154 460
1458 3300025233 Ga0209437_100098 Ga0209437_10009823 460
1459 3300025246 Ga0209646_1000086 Ga0209646_100008612 460
1460 3300025246 Ga0209646_1001543 Ga0209646_10015435 460
1461 3300025250 Ga0209026_1000082 Ga0209026_100008212 460
1462 3300025253 Ga0209677_103714 Ga0209677_1037146 460
1463 3300025256 Ga0209759_1000063 Ga0209759_1000063189 460
1464 3300025261 Ga0209233_1000095 Ga0209233_1000095140 460
1465 3300025261 Ga0209233_1000113 Ga0209233_1000113189 460
1466 3300025261 Ga0209233_1000499 Ga0209233_100049916 460
1467 3300025272 Ga0209455_1013848 Ga0209455_10138481 460
1468 3300025913 Ga0207695_10000037 Ga0207695_10000037374 460
1469 3300025914 Ga0207671_10005059 Ga0207671_1000505910 460
1470 3300025949 Ga0207667_10090709 Ga0207667_100907092 460
1471 3300026078 Ga0207702_10032087 Ga0207702_100320873 460
1472 3300027312 Ga0209371_1002636 Ga0209371_100263611 460
1473 3300030500 Ga0268256_1009737 Ga0268256_10097373 460
1474 3300048904 Ga0496101_0061075 Ga0496101_0061075_452_1834 460
1475 3300048905 Ga0496102_0001225 Ga0496102_0001225_3708_5090 460
1476 3300048906 Ga0496103_0002998 Ga0496103_0002998_5474_6856 460
1477 3300048920 Ga0496117_0002461 Ga0496117_0002461_7934_9316 460
1478 3300048921 Ga0496118_0001992 Ga0496118_0001992_20135_21517 460
1479 3300048922 Ga0496119_0017979 Ga0496119_0017979_572_1954 460
1480 3300048923 Ga0496120_0022579 Ga0496120_0022579_1784_3166 460
1481 3300048924 Ga0496121_0002066 Ga0496121_0002066_7935_9317 460
1482 3300048925 Ga0496122_0002992 Ga0496122_0002992_1542_2924 460
1483 3300048928 Ga0496125_0011876 Ga0496125_0011876_6212_7594 460
1484 3300048929 Ga0496126_0044550 Ga0496126_0044550_919_2301 460
1485 3300053125 Ga0500618_005083 Ga0500618_005083_244_1626 460

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00672

HAMP

HAMP domain

260

313

0.94

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

417

523

0.93

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

317

375

0.91

Feature Viewer

pLDDT pTM Quality
76.56 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map