F494225

General Info

Members Datasets Scaffolds Average Seq Length
1473 284 1472 201

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0055351|Ga0496125_0055351_533_1144
Length 203
Sequence MFTGIITDIGTIRSAEQRGDLRLTIACGFPLGDVAIGASIACSGACMTVVAKGNDSFTVDISAESIACTAPGLWTVGSRLNLERALKVGDELGGHIVTGHVDGVGTVLGVCAEGDSHRVGFEVPAALAPLIAPKGSITIDGVSLTVNDVTDEDGSTHFSVNIIPHTWNVTTLGTLEPGRKVNLEIDTLARYLARMQTYANNVH

Samples

Sample ID Description Type Environment
1 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
254 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
255 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
256 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
257 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
258 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
259 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
260 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
261 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
262 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
263 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
264 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
276 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
282 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.2
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 4.48
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1042470 3300001904 Bacteria 698
2 JGI24741J21665_1011469 3300001915 Bacteria 1549
3 JGI24741J21665_1019648 3300001915 Bacteria 1069
4 JGI24752J21851_1010035 3300001976 Bacteria 1235
5 JGI24740J21852_10000554 3300001979 Bacteria 16027
6 JGI24740J21852_10013366 3300001979 Bacteria 3064
7 JGI24739J22299_10000237 3300001989 Bacteria 18648
8 JGI24739J22299_10049217 3300001989 Bacteria 1367
9 JGI24737J22298_10000061 3300001990 Bacteria 32526
10 JGI24737J22298_10002804 3300001990 Bacteria 6171
11 JGI24737J22298_10003327 3300001990 Bacteria 5687
12 JGI24737J22298_10003796 3300001990 Bacteria 5314
13 JGI24737J22298_10062968 3300001990 Bacteria 1114
14 JGI24737J22298_10070255 3300001990 Bacteria 1046
15 JGI24737J22298_10131123 3300001990 Bacteria 740
16 JGI24743J22301_10020642 3300001991 Bacteria 1255
17 JGI24735J21928_10030339 3300002067 Bacteria 1607
18 JGI24735J21928_10087326 3300002067 Bacteria 894
19 JGI24735J21928_10111022 3300002067 Bacteria 789
20 JGI24738J21930_10000146 3300002075 Bacteria 17468
21 JGI24738J21930_10018700 3300002075 Bacteria 1447
22 Ga0065712_10034447 3300005290 Bacteria 973
23 Ga0065712_10145831 3300005290 Bacteria 1410
24 Ga0065715_10020566 3300005293 Bacteria 2010
25 Ga0070658_10017589 3300005327 Bacteria 5718
26 Ga0070658_10021897 3300005327 Bacteria 5125
27 Ga0070658_10023865 3300005327 Bacteria 4906
28 Ga0070658_10039281 3300005327 Bacteria 3817
29 Ga0070658_10053296 3300005327 Bacteria 3283
30 Ga0070658_10067751 3300005327 Bacteria 2917
31 Ga0070658_10117370 3300005327 Bacteria 2209
32 Ga0070658_10156140 3300005327 Bacteria 1913
33 Ga0070658_10181586 3300005327 Bacteria 1770
34 Ga0070658_10188578 3300005327 Bacteria 1737
35 Ga0070658_10384534 3300005327 Bacteria 1204
36 Ga0070658_10444987 3300005327 Bacteria 1116
37 Ga0070658_10595028 3300005327 Bacteria 958
38 Ga0070658_10627048 3300005327 Bacteria 932
39 Ga0070658_10685197 3300005327 Bacteria 889
40 Ga0070658_11065821 3300005327 Bacteria 703
41 Ga0070676_10002544 3300005328 Bacteria 9375
42 Ga0070676_10023349 3300005328 Bacteria 3476
43 Ga0070676_10039319 3300005328 Bacteria 2735
44 Ga0070676_10044553 3300005328 Bacteria 2582
45 Ga0070676_10045623 3300005328 Bacteria 2553
46 Ga0070676_10155888 3300005328 Bacteria 1465
47 Ga0070676_10525139 3300005328 Bacteria 844
48 Ga0070683_100001658 3300005329 Bacteria 17258
49 Ga0070683_100001823 3300005329 Bacteria 16621
50 Ga0070683_100028420 3300005329 Bacteria 5053
51 Ga0070683_100065110 3300005329 Bacteria 3393
52 Ga0070683_100217714 3300005329 Bacteria 1815
53 Ga0070690_100003412 3300005330 Bacteria 8690
54 Ga0070690_100055943 3300005330 Bacteria 2528
55 Ga0070690_100920702 3300005330 Bacteria 685
56 Ga0070670_100009473 3300005331 Bacteria 8315
57 Ga0070670_100035510 3300005331 Bacteria 4291
58 Ga0070670_100038046 3300005331 Bacteria 4137
59 Ga0070670_100041176 3300005331 Bacteria 3970
60 Ga0070670_100186706 3300005331 Bacteria 1800
61 Ga0070670_100396545 3300005331 Bacteria 1218
62 Ga0070670_100444298 3300005331 Bacteria 1148
63 Ga0070677_10024881 3300005333 Bacteria 2231
64 Ga0070677_10100182 3300005333 Bacteria 1276
65 Ga0068869_100000493 3300005334 Bacteria 21956
66 Ga0068869_100152153 3300005334 Bacteria 1795
67 Ga0068869_100511894 3300005334 Bacteria 1003
68 Ga0070666_10000310 3300005335 Bacteria 31154
69 Ga0070666_10021897 3300005335 Bacteria 4145
70 Ga0070666_10032872 3300005335 Bacteria 3429
71 Ga0070666_10134434 3300005335 Bacteria 1720
72 Ga0070680_100000958 3300005336 Bacteria 20442
73 Ga0070680_100001306 3300005336 Bacteria 18035
74 Ga0070680_100021826 3300005336 Bacteria 5092
75 Ga0070680_100024024 3300005336 Bacteria 4865
76 Ga0070680_100626488 3300005336 Bacteria 924
77 Ga0070680_100642075 3300005336 Bacteria 912
78 Ga0070682_100082315 3300005337 Bacteria 2086
79 Ga0070682_100735759 3300005337 Bacteria 795
80 Ga0068868_100009873 3300005338 Bacteria 6893
81 Ga0068868_100033902 3300005338 Bacteria 3939
82 Ga0068868_100100287 3300005338 Bacteria 2343
83 Ga0068868_100141466 3300005338 Bacteria 1975
84 Ga0068868_100248740 3300005338 Bacteria 1496
85 Ga0068868_100279854 3300005338 Bacteria 1412
86 Ga0068868_100423599 3300005338 Bacteria 1153
87 Ga0068868_100437620 3300005338 Bacteria 1135
88 Ga0068868_100495680 3300005338 Bacteria 1069
89 Ga0070660_100000393 3300005339 Bacteria 29017
90 Ga0070660_100002280 3300005339 Bacteria 13171
91 Ga0070660_100003937 3300005339 Bacteria 10262
92 Ga0070660_100005463 3300005339 Bacteria 8800
93 Ga0070660_100023648 3300005339 Bacteria 4553
94 Ga0070660_100028115 3300005339 Bacteria 4204
95 Ga0070660_100038834 3300005339 Bacteria 3616
96 Ga0070660_100089592 3300005339 Bacteria 2424
97 Ga0070660_100098760 3300005339 Bacteria 2311
98 Ga0070660_100121986 3300005339 Bacteria 2080
99 Ga0070660_100127923 3300005339 Bacteria 2031
100 Ga0070660_100273793 3300005339 Bacteria 1380
101 Ga0070660_100318123 3300005339 Bacteria 1278
102 Ga0070660_100343726 3300005339 Bacteria 1228
103 Ga0070660_100351772 3300005339 Bacteria 1213
104 Ga0070660_100628948 3300005339 Unclassified 898
105 Ga0070660_100798484 3300005339 Bacteria 794
106 Ga0070660_100820966 3300005339 Bacteria 782
107 Ga0070660_100937614 3300005339 Bacteria 731
108 Ga0070689_100186292 3300005340 Bacteria 1688
109 Ga0070687_100111864 3300005343 Bacteria 1547
110 Ga0070661_100019646 3300005344 Bacteria 4814
111 Ga0070661_100029190 3300005344 Bacteria 3980
112 Ga0070661_100032544 3300005344 Bacteria 3775
113 Ga0070661_100044151 3300005344 Bacteria 3256
114 Ga0070661_100048864 3300005344 Bacteria 3097
115 Ga0070661_100052164 3300005344 Bacteria 2993
116 Ga0070661_100078263 3300005344 Bacteria 2439
117 Ga0070661_100111625 3300005344 Bacteria 2042
118 Ga0070661_100232404 3300005344 Bacteria 1417
119 Ga0070661_100238067 3300005344 Bacteria 1401
120 Ga0070661_100252692 3300005344 Bacteria 1361
121 Ga0070661_100306370 3300005344 Bacteria 1237
122 Ga0070661_100442730 3300005344 Bacteria 1033
123 Ga0070661_100588603 3300005344 Bacteria 898
124 Ga0070692_10005785 3300005345 Bacteria 5316
125 Ga0070692_10141282 3300005345 Bacteria 1363
126 Ga0070692_10475130 3300005345 Bacteria 805
127 Ga0070668_100001945 3300005347 Bacteria 15069
128 Ga0070668_100006904 3300005347 Bacteria 8414
129 Ga0070668_100190030 3300005347 Bacteria 1682
130 Ga0070668_100199082 3300005347 Bacteria 1644
131 Ga0070668_100463232 3300005347 Bacteria 1092
132 Ga0070668_100501718 3300005347 Bacteria 1051
133 Ga0070669_100000532 3300005353 Bacteria 28333
134 Ga0070669_100027300 3300005353 Bacteria 4108
135 Ga0070669_100062653 3300005353 Bacteria 2735
136 Ga0070669_100071452 3300005353 Bacteria 2567
137 Ga0070669_100134791 3300005353 Bacteria 1898
138 Ga0070669_100212886 3300005353 Bacteria 1525
139 Ga0070675_100020764 3300005354 Bacteria 5242
140 Ga0070675_100112106 3300005354 Bacteria 2309
141 Ga0070675_100190175 3300005354 Bacteria 1778
142 Ga0070675_100531338 3300005354 Bacteria 1062
143 Ga0070675_100668336 3300005354 Bacteria 945
144 Ga0070675_100940898 3300005354 Bacteria 792
145 Ga0070675_100946478 3300005354 Bacteria 790
146 Ga0070671_100000539 3300005355 Bacteria 26673
147 Ga0070671_100002550 3300005355 Bacteria 14119
148 Ga0070671_100003074 3300005355 Bacteria 12977
149 Ga0070671_100016185 3300005355 Bacteria 6031
150 Ga0070671_100026869 3300005355 Bacteria 4735
151 Ga0070671_100032270 3300005355 Bacteria 4331
152 Ga0070671_100042117 3300005355 Bacteria 3796
153 Ga0070671_100050903 3300005355 Bacteria 3445
154 Ga0070671_100053548 3300005355 Bacteria 3355
155 Ga0070671_100062437 3300005355 Bacteria 3102
156 Ga0070671_100115568 3300005355 Bacteria 2256
157 Ga0070671_100180199 3300005355 Bacteria 1788
158 Ga0070671_100201057 3300005355 Bacteria 1689
159 Ga0070671_100214073 3300005355 Bacteria 1634
160 Ga0070671_100359329 3300005355 Bacteria 1243
161 Ga0070674_100003566 3300005356 Bacteria 8748
162 Ga0070674_100119087 3300005356 Bacteria 1952
163 Ga0070674_100681879 3300005356 Bacteria 877
164 Ga0070673_100000058 3300005364 Bacteria 45772
165 Ga0070673_100012087 3300005364 Bacteria 5916
166 Ga0070673_100046028 3300005364 Bacteria 3387
167 Ga0070673_100060327 3300005364 Bacteria 3005
168 Ga0070673_100074397 3300005364 Bacteria 2738
169 Ga0070673_100113693 3300005364 Bacteria 2248
170 Ga0070673_100280687 3300005364 Bacteria 1461
171 Ga0070673_100323919 3300005364 Bacteria 1362
172 Ga0070673_100725899 3300005364 Bacteria 914
173 Ga0070659_100000564 3300005366 Bacteria 27103
174 Ga0070659_100002195 3300005366 Bacteria 13892
175 Ga0070659_100004781 3300005366 Bacteria 9681
176 Ga0070659_100010127 3300005366 Bacteria 6940
177 Ga0070659_100011224 3300005366 Bacteria 6620
178 Ga0070659_100025802 3300005366 Bacteria 4519
179 Ga0070659_100028544 3300005366 Bacteria 4310
180 Ga0070659_100033959 3300005366 Bacteria 3966
181 Ga0070659_100035593 3300005366 Bacteria 3877
182 Ga0070659_100104608 3300005366 Bacteria 2281
183 Ga0070659_100115699 3300005366 Bacteria 2167
184 Ga0070659_100131281 3300005366 Bacteria 2035
185 Ga0070659_100134481 3300005366 Bacteria 2010
186 Ga0070659_100174552 3300005366 Bacteria 1762
187 Ga0070659_100277579 3300005366 Bacteria 1393
188 Ga0070659_100398942 3300005366 Bacteria 1161
189 Ga0070659_100413615 3300005366 Bacteria 1140
190 Ga0070659_100681747 3300005366 Bacteria 888
191 Ga0070659_100684772 3300005366 Bacteria 886
192 Ga0070667_100003138 3300005367 Bacteria 14187
193 Ga0070667_100004233 3300005367 Bacteria 12118
194 Ga0070667_100005598 3300005367 Bacteria 10490
195 Ga0070667_100010390 3300005367 Bacteria 7685
196 Ga0070667_100018968 3300005367 Bacteria 5703
197 Ga0070667_100031834 3300005367 Bacteria 4396
198 Ga0070667_100033987 3300005367 Bacteria 4265
199 Ga0070667_100064440 3300005367 Bacteria 3109
200 Ga0070667_100120142 3300005367 Bacteria 2285
201 Ga0070667_100167494 3300005367 Bacteria 1938
202 Ga0070667_101358638 3300005367 Bacteria 666
203 Ga0070714_100058647 3300005435 Bacteria 3299
204 Ga0070714_100064364 3300005435 Bacteria 3156
205 Ga0070714_100074579 3300005435 Bacteria 2941
206 Ga0070714_100158117 3300005435 Bacteria 2048
207 Ga0070713_100003292 3300005436 Bacteria 10645
208 Ga0070694_100006264 3300005444 Bacteria 7223
209 Ga0070663_100012256 3300005455 Bacteria 5414
210 Ga0070663_100016552 3300005455 Bacteria 4793
211 Ga0070663_100122000 3300005455 Bacteria 1970
212 Ga0070663_100201660 3300005455 Bacteria 1553
213 Ga0070663_100254250 3300005455 Bacteria 1391
214 Ga0070663_100514515 3300005455 Bacteria 996
215 Ga0070663_100586929 3300005455 Bacteria 935
216 Ga0070678_100007681 3300005456 Bacteria 6411
217 Ga0070678_100043488 3300005456 Bacteria 3200
218 Ga0070678_100062075 3300005456 Bacteria 2757
219 Ga0070678_100105276 3300005456 Bacteria 2196
220 Ga0070678_100261294 3300005456 Bacteria 1456
221 Ga0070678_100362589 3300005456 Bacteria 1249
222 Ga0070662_100000280 3300005457 Bacteria 30084
223 Ga0070662_100001326 3300005457 Bacteria 15206
224 Ga0070662_100020245 3300005457 Bacteria 4528
225 Ga0070662_100027057 3300005457 Bacteria 3978
226 Ga0070662_100027986 3300005457 Bacteria 3919
227 Ga0070662_100033379 3300005457 Bacteria 3623
228 Ga0070662_100063706 3300005457 Bacteria 2697
229 Ga0070662_100069225 3300005457 Bacteria 2596
230 Ga0070662_100079152 3300005457 Bacteria 2443
231 Ga0070662_100111698 3300005457 Bacteria 2083
232 Ga0070662_100179597 3300005457 Bacteria 1668
233 Ga0070662_100206771 3300005457 Bacteria 1560
234 Ga0070662_100443490 3300005457 Bacteria 1076
235 Ga0070662_100473881 3300005457 Bacteria 1041
236 Ga0070662_100510131 3300005457 Bacteria 1004
237 Ga0070681_10042653 3300005458 Bacteria 4546
238 Ga0070681_10066769 3300005458 Bacteria 3566
239 Ga0070681_10167647 3300005458 Bacteria 2118
240 Ga0070681_10210803 3300005458 Bacteria 1859
241 Ga0070681_10437079 3300005458 Bacteria 1220
242 Ga0068867_100001818 3300005459 Bacteria 14861
243 Ga0068867_100006658 3300005459 Bacteria 8168
244 Ga0068867_100015265 3300005459 Bacteria 5445
245 Ga0068867_100171287 3300005459 Bacteria 1720
246 Ga0068867_100448633 3300005459 Bacteria 1098
247 Ga0068867_100520497 3300005459 Bacteria 1026
248 Ga0070685_10031058 3300005466 Bacteria 2981
249 Ga0070685_10067028 3300005466 Bacteria 2117
250 Ga0070685_10288612 3300005466 Bacteria 1101
251 Ga0070679_100000001 3300005530 Bacteria 764811
252 Ga0070679_100000346 3300005530 Bacteria 39334
253 Ga0070679_100039289 3300005530 Bacteria 4703
254 Ga0070679_100061768 3300005530 Bacteria 3735
255 Ga0070679_100083269 3300005530 Bacteria 3187
256 Ga0070679_100114370 3300005530 Bacteria 2684
257 Ga0070679_100188060 3300005530 Bacteria 2035
258 Ga0070679_100278865 3300005530 Bacteria 1624
259 Ga0070679_100327932 3300005530 Bacteria 1479
260 Ga0070679_100844813 3300005530 Bacteria 859
261 Ga0070684_100030606 3300005535 Bacteria 4574
262 Ga0070684_100040434 3300005535 Bacteria 4015
263 Ga0070684_100272786 3300005535 Bacteria 1549
264 Ga0070684_100582407 3300005535 Bacteria 1040
265 Ga0068853_100000783 3300005539 Bacteria 22097
266 Ga0068853_100024992 3300005539 Bacteria 5012
267 Ga0068853_100026040 3300005539 Bacteria 4910
268 Ga0068853_100369126 3300005539 Bacteria 1338
269 Ga0068853_100399054 3300005539 Bacteria 1287
270 Ga0068853_100595251 3300005539 Bacteria 1050
271 Ga0068853_100621606 3300005539 Bacteria 1027
272 Ga0068853_100779199 3300005539 Bacteria 915
273 Ga0068853_100810836 3300005539 Bacteria 897
274 Ga0070672_100016934 3300005543 Bacteria 5231
275 Ga0070672_100019222 3300005543 Bacteria 4956
276 Ga0070672_100027432 3300005543 Bacteria 4247
277 Ga0070672_100193914 3300005543 Bacteria 1697
278 Ga0070672_100205070 3300005543 Bacteria 1649
279 Ga0070672_100252346 3300005543 Bacteria 1486
280 Ga0070672_100300040 3300005543 Bacteria 1361
281 Ga0070672_100430338 3300005543 Bacteria 1135
282 Ga0070686_100012997 3300005544 Bacteria 4753
283 Ga0070686_100076545 3300005544 Bacteria 2204
284 Ga0070693_100006149 3300005547 Bacteria 5818
285 Ga0070693_100018195 3300005547 Bacteria 3666
286 Ga0070693_100913005 3300005547 Bacteria 659
287 Ga0070665_100001540 3300005548 Bacteria 26631
288 Ga0070665_100003665 3300005548 Bacteria 16274
289 Ga0070665_100004875 3300005548 Bacteria 13935
290 Ga0070665_100024758 3300005548 Bacteria 6047
291 Ga0070665_100025156 3300005548 Bacteria 5999
292 Ga0070665_100025496 3300005548 Bacteria 5956
293 Ga0070665_100111470 3300005548 Bacteria 2738
294 Ga0070665_100144084 3300005548 Bacteria 2386
295 Ga0070665_100412631 3300005548 Bacteria 1359
296 Ga0070665_101064141 3300005548 Bacteria 821
297 Ga0068855_100001416 3300005563 Bacteria 29777
298 Ga0068855_100001751 3300005563 Bacteria 27092
299 Ga0068855_100009125 3300005563 Bacteria 11978
300 Ga0068855_100084213 3300005563 Bacteria 3682
301 Ga0068855_100160217 3300005563 Bacteria 2555
302 Ga0068855_100339635 3300005563 Bacteria 1656
303 Ga0068855_100701767 3300005563 Bacteria 1083
304 Ga0070664_100003451 3300005564 Bacteria 12768
305 Ga0070664_100006576 3300005564 Bacteria 9375
306 Ga0070664_100011906 3300005564 Bacteria 7060
307 Ga0070664_100015311 3300005564 Bacteria 6271
308 Ga0070664_100019922 3300005564 Bacteria 5522
309 Ga0070664_100021506 3300005564 Bacteria 5318
310 Ga0070664_100027924 3300005564 Bacteria 4693
311 Ga0070664_100035891 3300005564 Bacteria 4163
312 Ga0070664_100049763 3300005564 Bacteria 3544
313 Ga0070664_100068793 3300005564 Bacteria 3028
314 Ga0070664_100241687 3300005564 Bacteria 1621
315 Ga0070664_100289564 3300005564 Bacteria 1478
316 Ga0070664_100333645 3300005564 Bacteria 1376
317 Ga0070664_100824534 3300005564 Bacteria 868
318 Ga0068857_100008327 3300005577 Bacteria 8959
319 Ga0068857_100011289 3300005577 Bacteria 7770
320 Ga0068857_100021196 3300005577 Bacteria 5718
321 Ga0068857_100021706 3300005577 Bacteria 5649
322 Ga0068857_100086971 3300005577 Bacteria 2795
323 Ga0068857_100096793 3300005577 Bacteria 2645
324 Ga0068857_100260968 3300005577 Bacteria 1590
325 Ga0068857_100261684 3300005577 Bacteria 1588
326 Ga0068857_100327933 3300005577 Bacteria 1414
327 Ga0068854_100008111 3300005578 Bacteria 6738
328 Ga0068854_100024402 3300005578 Bacteria 4140
329 Ga0068854_100045803 3300005578 Bacteria 3111
330 Ga0068854_100103511 3300005578 Bacteria 2137
331 Ga0068854_100215394 3300005578 Bacteria 1517
332 Ga0068854_100521394 3300005578 Bacteria 1004
333 Ga0068854_100653974 3300005578 Bacteria 903
334 Ga0068854_100795549 3300005578 Bacteria 824
335 Ga0068854_100880566 3300005578 Bacteria 786
336 Ga0068856_100000977 3300005614 Bacteria 30513
337 Ga0068856_100091821 3300005614 Bacteria 3020
338 Ga0068856_100126282 3300005614 Bacteria 2561
339 Ga0068856_100141328 3300005614 Bacteria 2415
340 Ga0068856_100314168 3300005614 Bacteria 1584
341 Ga0068856_100564362 3300005614 Bacteria 1159
342 Ga0068852_100002885 3300005616 Bacteria 11927
343 Ga0068852_100003205 3300005616 Bacteria 11426
344 Ga0068852_100020958 3300005616 Bacteria 5205
345 Ga0068852_100025534 3300005616 Bacteria 4789
346 Ga0068852_100073242 3300005616 Bacteria 3013
347 Ga0068852_100089769 3300005616 Bacteria 2747
348 Ga0068852_100112384 3300005616 Bacteria 2479
349 Ga0068852_100139205 3300005616 Bacteria 2244
350 Ga0068852_100431326 3300005616 Bacteria 1302
351 Ga0068852_100489834 3300005616 Bacteria 1223
352 Ga0068852_100509456 3300005616 Bacteria 1199
353 Ga0068852_101083848 3300005616 Bacteria 821
354 Ga0068859_100000136 3300005617 Bacteria 68907
355 Ga0068859_100001019 3300005617 Bacteria 28705
356 Ga0068859_100038073 3300005617 Bacteria 4826
357 Ga0068859_100137838 3300005617 Bacteria 2514
358 Ga0068859_100457198 3300005617 Bacteria 1373
359 Ga0068864_100000235 3300005618 Bacteria 49611
360 Ga0068864_100000540 3300005618 Bacteria 32248
361 Ga0068864_100000711 3300005618 Bacteria 27933
362 Ga0068864_100002756 3300005618 Bacteria 14495
363 Ga0068864_100018916 3300005618 Bacteria 5759
364 Ga0068864_100034386 3300005618 Bacteria 4310
365 Ga0068864_100138617 3300005618 Bacteria 2192
366 Ga0068864_100216013 3300005618 Bacteria 1767
367 Ga0068864_100635313 3300005618 Bacteria 1038
368 Ga0068864_101369687 3300005618 Bacteria 709
369 Ga0068866_10052875 3300005718 Bacteria 2074
370 Ga0068866_10053658 3300005718 Bacteria 2062
371 Ga0068866_10068670 3300005718 Bacteria 1864
372 Ga0068861_100063756 3300005719 Bacteria 2833
373 Ga0068851_10042367 3300005834 Bacteria 2291
374 Ga0068851_10047340 3300005834 Bacteria 2178
375 Ga0068851_10242794 3300005834 Bacteria 1019
376 Ga0068851_10291676 3300005834 Bacteria 935
377 Ga0068851_10461840 3300005834 Bacteria 756
378 Ga0068870_10239037 3300005840 Bacteria 1120
379 Ga0068870_10274292 3300005840 Bacteria 1055
380 Ga0068863_100000140 3300005841 Bacteria 76175
381 Ga0068863_100000607 3300005841 Bacteria 36378
382 Ga0068863_100000823 3300005841 Bacteria 31100
383 Ga0068863_100010426 3300005841 Bacteria 9032
384 Ga0068863_100014473 3300005841 Bacteria 7596
385 Ga0068863_100076272 3300005841 Bacteria 3172
386 Ga0068863_100112544 3300005841 Bacteria 2592
387 Ga0068863_100542283 3300005841 Bacteria 1148
388 Ga0068863_101090698 3300005841 Bacteria 803
389 Ga0068858_100000514 3300005842 Bacteria 40588
390 Ga0068858_100002498 3300005842 Bacteria 18554
391 Ga0068858_100004922 3300005842 Bacteria 13083
392 Ga0068858_100010521 3300005842 Bacteria 8761
393 Ga0068858_100063754 3300005842 Bacteria 3410
394 Ga0068858_100186695 3300005842 Bacteria 1958
395 Ga0068858_101159738 3300005842 Bacteria 759
396 Ga0068860_100010118 3300005843 Bacteria 9347
397 Ga0068860_100023633 3300005843 Bacteria 5940
398 Ga0068860_100026574 3300005843 Bacteria 5579
399 Ga0068860_100041001 3300005843 Bacteria 4423
400 Ga0068860_100055225 3300005843 Bacteria 3775
401 Ga0068860_100064802 3300005843 Bacteria 3470
402 Ga0068860_100512191 3300005843 Bacteria 1199
403 Ga0068860_100902708 3300005843 Unclassified 900
404 Ga0068860_101189332 3300005843 Bacteria 782
405 Ga0068860_101242153 3300005843 Bacteria 765
406 Ga0068862_100002905 3300005844 Bacteria 14978
407 Ga0068862_100015049 3300005844 Bacteria 6425
408 Ga0068862_100031153 3300005844 Bacteria 4499
409 Ga0068862_100101125 3300005844 Bacteria 2521
410 Ga0068862_100180275 3300005844 Bacteria 1895
411 Ga0068862_100229728 3300005844 Bacteria 1683
412 Ga0070717_10003557 3300006028 Bacteria 11166
413 Ga0070712_100014929 3300006175 Bacteria 4994
414 Ga0097621_100010815 3300006237 Bacteria 6695
415 Ga0097621_100013664 3300006237 Bacteria 6061
416 Ga0097621_100057276 3300006237 Bacteria 3186
417 Ga0097621_100113096 3300006237 Bacteria 2296
418 Ga0097621_100159051 3300006237 Bacteria 1941
419 Ga0068871_100004382 3300006358 Bacteria 9811
420 Ga0068871_100025554 3300006358 Bacteria 4597
421 Ga0068871_100160884 3300006358 Bacteria 1920
422 Ga0068871_100440275 3300006358 Bacteria 1167
423 Ga0068871_100880847 3300006358 Bacteria 829
424 Ga0075433_10103395 3300006852 Bacteria 2523
425 Ga0075433_10484422 3300006852 Bacteria 1089
426 Ga0068865_100000697 3300006881 Bacteria 18907
427 Ga0068865_100118352 3300006881 Bacteria 1965
428 Ga0068865_100144685 3300006881 Bacteria 1796
429 Ga0068865_100202395 3300006881 Bacteria 1542
430 Ga0068865_100374859 3300006881 Bacteria 1159
431 Ga0068865_100393772 3300006881 Bacteria 1133
432 Ga0097620_100000136 3300006931 Bacteria 68907
433 Ga0097620_100001019 3300006931 Bacteria 28705
434 Ga0097620_100038074 3300006931 Bacteria 4826
435 Ga0097620_100044294 3300006931 Bacteria 4471
436 Ga0097620_100068363 3300006931 Bacteria 3587
437 Ga0097620_100137833 3300006931 Bacteria 2514
438 Ga0097620_100457183 3300006931 Bacteria 1373
439 Ga0105251_10113015 3300009011 Bacteria 1236
440 Ga0105240_10046035 3300009093 Bacteria 5530
441 Ga0105240_10133084 3300009093 Bacteria 2980
442 Ga0105240_10266040 3300009093 Bacteria 1976
443 Ga0105240_10328118 3300009093 Bacteria 1742
444 Ga0105240_10366055 3300009093 Bacteria 1632
445 Ga0105240_10378002 3300009093 Bacteria 1600
446 Ga0105240_10440717 3300009093 Bacteria 1460
447 Ga0105240_10924809 3300009093 Bacteria 937
448 Ga0105245_10000170 3300009098 Bacteria 61721
449 Ga0105245_10179041 3300009098 Bacteria 2024
450 Ga0105245_10336415 3300009098 Bacteria 1492
451 Ga0105247_10123506 3300009101 Bacteria 1680
452 Ga0105247_10139882 3300009101 Bacteria 1585
453 Ga0105243_10061789 3300009148 Bacteria 2997
454 Ga0105243_10275539 3300009148 Bacteria 1513
455 Ga0105243_10384871 3300009148 Bacteria 1298
456 Ga0105241_10248246 3300009174 Bacteria 1508
457 Ga0105241_10273175 3300009174 Bacteria 1441
458 Ga0105241_10337261 3300009174 Bacteria 1305
459 Ga0105241_10595251 3300009174 Bacteria 998
460 Ga0105242_10032902 3300009176 Bacteria 4149
461 Ga0105242_10069659 3300009176 Bacteria 2914
462 Ga0105248_10000184 3300009177 Bacteria 72728
463 Ga0105248_10001269 3300009177 Bacteria 28212
464 Ga0105248_10002216 3300009177 Bacteria 21499
465 Ga0105248_10003825 3300009177 Bacteria 16686
466 Ga0105248_10004489 3300009177 Bacteria 15445
467 Ga0105248_10004542 3300009177 Bacteria 15358
468 Ga0105248_10006079 3300009177 Bacteria 13251
469 Ga0105248_10038619 3300009177 Bacteria 5344
470 Ga0105248_10051265 3300009177 Bacteria 4631
471 Ga0105248_10060789 3300009177 Bacteria 4242
472 Ga0105248_10077298 3300009177 Bacteria 3742
473 Ga0105248_10160406 3300009177 Bacteria 2537
474 Ga0105248_10170769 3300009177 Bacteria 2451
475 Ga0105248_10316338 3300009177 Bacteria 1758
476 Ga0105248_10362628 3300009177 Bacteria 1631
477 Ga0105248_10483120 3300009177 Bacteria 1396
478 Ga0105248_10754812 3300009177 Bacteria 1098
479 Ga0105237_10026407 3300009545 Bacteria 5935
480 Ga0105237_10154612 3300009545 Bacteria 2290
481 Ga0105238_10035751 3300009551 Bacteria 5050
482 Ga0105238_10312184 3300009551 Bacteria 1557
483 Ga0105238_10470858 3300009551 Bacteria 1255
484 Ga0105249_10148990 3300009553 Bacteria 2251
485 Ga0105239_10054221 3300010375 Bacteria 4397
486 Ga0105239_10166849 3300010375 Bacteria 2462
487 Ga0105239_10630895 3300010375 Bacteria 1223
488 Ga0105239_10681708 3300010375 Bacteria 1175
489 Ga0105246_10013975 3300011119 Bacteria 5041
490 Ga0105246_10021263 3300011119 Bacteria 4173
491 Ga0105246_10152456 3300011119 Bacteria 1751
492 Ga0105246_10173877 3300011119 Bacteria 1652
493 Ga0105246_10481792 3300011119 Bacteria 1050
494 Ga0157373_10008290 3300013100 Bacteria 7721
495 Ga0157373_10018941 3300013100 Bacteria 5011
496 Ga0157373_10059724 3300013100 Bacteria 2702
497 Ga0157373_10123172 3300013100 Bacteria 1823
498 Ga0157373_10213065 3300013100 Bacteria 1362
499 Ga0157373_10236318 3300013100 Bacteria 1291
500 Ga0157373_10239212 3300013100 Bacteria 1283
501 Ga0157373_10276281 3300013100 Bacteria 1190
502 Ga0157373_10395855 3300013100 Bacteria 989
503 Ga0157371_10000443 3300013102 Bacteria 50736
504 Ga0157371_10001298 3300013102 Bacteria 26285
505 Ga0157371_10011268 3300013102 Bacteria 6903
506 Ga0157371_10014444 3300013102 Bacteria 5958
507 Ga0157371_10053663 3300013102 Bacteria 2862
508 Ga0157371_10191084 3300013102 Bacteria 1466
509 Ga0157371_10630271 3300013102 Bacteria 799
510 Ga0157371_10701206 3300013102 Bacteria 758
511 Ga0157370_10009490 3300013104 Bacteria 10384
512 Ga0157370_10017776 3300013104 Bacteria 7166
513 Ga0157370_10027786 3300013104 Bacteria 5577
514 Ga0157370_10059021 3300013104 Bacteria 3647
515 Ga0157370_10117052 3300013104 Bacteria 2489
516 Ga0157370_10166058 3300013104 Bacteria 2053
517 Ga0157370_10328859 3300013104 Bacteria 1409
518 Ga0157370_10439202 3300013104 Bacteria 1200
519 Ga0157370_10712949 3300013104 Bacteria 915
520 Ga0157369_10003984 3300013105 Bacteria 17513
521 Ga0157369_10012031 3300013105 Bacteria 9827
522 Ga0157369_10040140 3300013105 Bacteria 5111
523 Ga0157369_10048252 3300013105 Bacteria 4621
524 Ga0157369_10141638 3300013105 Bacteria 2544
525 Ga0157369_10169637 3300013105 Bacteria 2300
526 Ga0157369_10330244 3300013105 Bacteria 1584
527 Ga0157369_10330245 3300013105 Bacteria 1584
528 Ga0157369_10574609 3300013105 Bacteria 1164
529 Ga0157369_10606074 3300013105 Bacteria 1130
530 Ga0157369_10771331 3300013105 Bacteria 989
531 Ga0157374_10001338 3300013296 Bacteria 20964
532 Ga0157374_10062443 3300013296 Bacteria 3492
533 Ga0157374_10303596 3300013296 Bacteria 1579
534 Ga0157374_10423366 3300013296 Bacteria 1330
535 Ga0157378_10000312 3300013297 Bacteria 47527
536 Ga0157378_10039006 3300013297 Bacteria 4212
537 Ga0157378_10136098 3300013297 Bacteria 2278
538 Ga0157378_10692289 3300013297 Bacteria 1038
539 Ga0163162_10006506 3300013306 Bacteria 11316
540 Ga0163162_10013507 3300013306 Bacteria 7973
541 Ga0163162_10031200 3300013306 Bacteria 5285
542 Ga0163162_10159178 3300013306 Bacteria 2379
543 Ga0163162_10279680 3300013306 Bacteria 1801
544 Ga0163162_10502271 3300013306 Bacteria 1343
545 Ga0163162_11602884 3300013306 Bacteria 742
546 Ga0157372_10033724 3300013307 Bacteria 5626
547 Ga0157372_10106044 3300013307 Bacteria 3214
548 Ga0157372_10325153 3300013307 Bacteria 1791
549 Ga0157372_10364542 3300013307 Bacteria 1684
550 Ga0157372_10395211 3300013307 Bacteria 1611
551 Ga0157372_10484191 3300013307 Bacteria 1442
552 Ga0157372_10953470 3300013307 Bacteria 994
553 Ga0157372_11093934 3300013307 Bacteria 922
554 Ga0157372_11150057 3300013307 Bacteria 897
555 Ga0157372_11192994 3300013307 Bacteria 880
556 Ga0157375_10005251 3300013308 Bacteria 11245
557 Ga0157375_10020027 3300013308 Bacteria 6102
558 Ga0157375_10063193 3300013308 Bacteria 3682
559 Ga0157375_10089094 3300013308 Bacteria 3141
560 Ga0157375_10271190 3300013308 Bacteria 1859
561 Ga0157375_10328983 3300013308 Bacteria 1693
562 Ga0157375_10580725 3300013308 Bacteria 1281
563 Ga0163163_10000131 3300014325 Bacteria 76809
564 Ga0163163_10037220 3300014325 Bacteria 4733
565 Ga0163163_10096601 3300014325 Bacteria 2975
566 Ga0163163_10539024 3300014325 Bacteria 1229
567 Ga0157380_10545974 3300014326 Bacteria 1136
568 Ga0157379_10001982 3300014968 Bacteria 16935
569 Ga0157379_10083728 3300014968 Bacteria 2859
570 Ga0157379_10143504 3300014968 Bacteria 2153
571 Ga0157379_10244883 3300014968 Bacteria 1626
572 Ga0157376_10069220 3300014969 Bacteria 2991
573 Ga0163161_10804823 3300017792 Bacteria 790
574 Ga0197907_10024488 3300020069 Bacteria 2642
575 Ga0206353_10478740 3300020082 Bacteria 4816
576 Ga0206353_11034454 3300020082 Bacteria 4286
577 Ga0213876_10013376 3300021384 Bacteria 4361
578 Ga0213875_10001406 3300021388 Bacteria 15672
579 Ga0207697_10000063 3300025315 Bacteria 45019
580 Ga0207697_10009852 3300025315 Bacteria 4108
581 Ga0207697_10043989 3300025315 Bacteria 1836
582 Ga0207697_10046735 3300025315 Bacteria 1783
583 Ga0207656_10001771 3300025321 Bacteria 7186
584 Ga0207656_10052489 3300025321 Bacteria 1766
585 Ga0207656_10079603 3300025321 Bacteria 1470
586 Ga0207656_10089308 3300025321 Bacteria 1396
587 Ga0207682_10041349 3300025893 Bacteria 1881
588 Ga0207682_10059860 3300025893 Bacteria 1592
589 Ga0207682_10189538 3300025893 Bacteria 942
590 Ga0207642_10014356 3300025899 Bacteria 2921
591 Ga0207642_10017422 3300025899 Bacteria 2732
592 Ga0207642_10343867 3300025899 Bacteria 878
593 Ga0207710_10092037 3300025900 Bacteria 1420
594 Ga0207688_10000106 3300025901 Bacteria 33178
595 Ga0207688_10012958 3300025901 Bacteria 4533
596 Ga0207688_10117116 3300025901 Bacteria 1552
597 Ga0207688_10138871 3300025901 Bacteria 1429
598 Ga0207688_10543354 3300025901 Bacteria 730
599 Ga0207680_10000858 3300025903 Bacteria 14331
600 Ga0207680_10005013 3300025903 Bacteria 6307
601 Ga0207680_10024301 3300025903 Bacteria 3324
602 Ga0207680_10184985 3300025903 Bacteria 1411
603 Ga0207680_10201679 3300025903 Bacteria 1356
604 Ga0207680_10264281 3300025903 Bacteria 1192
605 Ga0207647_10000246 3300025904 Bacteria 44259
606 Ga0207647_10000844 3300025904 Bacteria 23765
607 Ga0207647_10004004 3300025904 Bacteria 10990
608 Ga0207647_10008871 3300025904 Bacteria 7172
609 Ga0207647_10028642 3300025904 Bacteria 3615
610 Ga0207647_10029689 3300025904 Bacteria 3534
611 Ga0207647_10068178 3300025904 Bacteria 2154
612 Ga0207647_10072817 3300025904 Bacteria 2071
613 Ga0207647_10329220 3300025904 Bacteria 867
614 Ga0207645_10002473 3300025907 Bacteria 14517
615 Ga0207645_10005404 3300025907 Bacteria 9266
616 Ga0207645_10005761 3300025907 Bacteria 8937
617 Ga0207645_10055410 3300025907 Bacteria 2531
618 Ga0207645_10086631 3300025907 Bacteria 2012
619 Ga0207645_10113185 3300025907 Bacteria 1758
620 Ga0207643_10289546 3300025908 Bacteria 1017
621 Ga0207643_10325012 3300025908 Bacteria 961
622 Ga0207705_10000270 3300025909 Bacteria 49639
623 Ga0207705_10000654 3300025909 Bacteria 28865
624 Ga0207705_10001164 3300025909 Bacteria 21416
625 Ga0207705_10003976 3300025909 Bacteria 11241
626 Ga0207705_10017246 3300025909 Bacteria 5171
627 Ga0207705_10041115 3300025909 Bacteria 3316
628 Ga0207705_10041136 3300025909 Bacteria 3315
629 Ga0207705_10045686 3300025909 Bacteria 3147
630 Ga0207705_10051569 3300025909 Bacteria 2961
631 Ga0207705_10080278 3300025909 Bacteria 2377
632 Ga0207705_10087171 3300025909 Bacteria 2282
633 Ga0207705_10154995 3300025909 Bacteria 1718
634 Ga0207705_10205694 3300025909 Bacteria 1492
635 Ga0207705_10254737 3300025909 Bacteria 1339
636 Ga0207705_10281638 3300025909 Bacteria 1273
637 Ga0207705_10380892 3300025909 Bacteria 1090
638 Ga0207654_10139524 3300025911 Bacteria 1544
639 Ga0207654_10232285 3300025911 Bacteria 1229
640 Ga0207654_10252406 3300025911 Bacteria 1183
641 Ga0207707_10124542 3300025912 Bacteria 2254
642 Ga0207707_10155670 3300025912 Bacteria 1999
643 Ga0207695_10282837 3300025913 Bacteria 1552
644 Ga0207671_10013747 3300025914 Bacteria 6426
645 Ga0207671_10093411 3300025914 Bacteria 2269
646 Ga0207693_10012089 3300025915 Bacteria 6979
647 Ga0207660_10002965 3300025917 Bacteria 11098
648 Ga0207660_10313906 3300025917 Bacteria 1250
649 Ga0207660_10379394 3300025917 Bacteria 1136
650 Ga0207662_10158594 3300025918 Bacteria 1444
651 Ga0207662_10231953 3300025918 Bacteria 1206
652 Ga0207662_10443558 3300025918 Bacteria 886
653 Ga0207657_10000120 3300025919 Bacteria 78496
654 Ga0207657_10000165 3300025919 Bacteria 67173
655 Ga0207657_10001091 3300025919 Bacteria 28769
656 Ga0207657_10001609 3300025919 Bacteria 24281
657 Ga0207657_10002106 3300025919 Bacteria 21522
658 Ga0207657_10003456 3300025919 Bacteria 16857
659 Ga0207657_10004437 3300025919 Bacteria 14844
660 Ga0207657_10005819 3300025919 Bacteria 12841
661 Ga0207657_10005832 3300025919 Bacteria 12831
662 Ga0207657_10011038 3300025919 Bacteria 8978
663 Ga0207657_10017485 3300025919 Bacteria 6872
664 Ga0207657_10017706 3300025919 Bacteria 6823
665 Ga0207657_10032178 3300025919 Bacteria 4742
666 Ga0207657_10089600 3300025919 Bacteria 2569
667 Ga0207657_10102080 3300025919 Bacteria 2379
668 Ga0207657_10139823 3300025919 Bacteria 1979
669 Ga0207657_10161483 3300025919 Bacteria 1820
670 Ga0207657_10194432 3300025919 Bacteria 1635
671 Ga0207657_10775900 3300025919 Bacteria 742
672 Ga0207657_10802812 3300025919 Bacteria 727
673 Ga0207649_10010318 3300025920 Bacteria 5129
674 Ga0207649_10011924 3300025920 Bacteria 4807
675 Ga0207649_10013268 3300025920 Bacteria 4594
676 Ga0207649_10062182 3300025920 Bacteria 2353
677 Ga0207649_10077716 3300025920 Bacteria 2139
678 Ga0207649_10141485 3300025920 Bacteria 1647
679 Ga0207649_10235614 3300025920 Bacteria 1311
680 Ga0207649_10318919 3300025920 Bacteria 1141
681 Ga0207649_10340436 3300025920 Bacteria 1107
682 Ga0207652_10000058 3300025921 Bacteria 113620
683 Ga0207652_10089469 3300025921 Bacteria 2703
684 Ga0207652_10108877 3300025921 Bacteria 2455
685 Ga0207652_10110899 3300025921 Bacteria 2433
686 Ga0207652_10189828 3300025921 Bacteria 1848
687 Ga0207652_10570331 3300025921 Bacteria 1016
688 Ga0207652_11003670 3300025921 Bacteria 733
689 Ga0207681_10000712 3300025923 Bacteria 21864
690 Ga0207681_10014345 3300025923 Bacteria 4923
691 Ga0207681_10022820 3300025923 Bacteria 3995
692 Ga0207681_10027653 3300025923 Bacteria 3669
693 Ga0207681_10070809 3300025923 Bacteria 2430
694 Ga0207681_10206218 3300025923 Bacteria 1512
695 Ga0207681_10649515 3300025923 Bacteria 874
696 Ga0207681_10677981 3300025923 Bacteria 856
697 Ga0207694_10456197 3300025924 Bacteria 1067
698 Ga0207694_10470875 3300025924 Bacteria 1050
699 Ga0207650_10008503 3300025925 Bacteria 7007
700 Ga0207650_10026694 3300025925 Bacteria 4123
701 Ga0207650_10031526 3300025925 Bacteria 3829
702 Ga0207650_10233082 3300025925 Bacteria 1485
703 Ga0207659_10080229 3300025926 Bacteria 2410
704 Ga0207659_10103816 3300025926 Bacteria 2148
705 Ga0207659_10113627 3300025926 Bacteria 2063
706 Ga0207659_10116773 3300025926 Bacteria 2038
707 Ga0207659_10124791 3300025926 Bacteria 1978
708 Ga0207659_10456971 3300025926 Bacteria 1076
709 Ga0207687_10006289 3300025927 Bacteria 7853
710 Ga0207687_10080248 3300025927 Bacteria 2355
711 Ga0207687_10328309 3300025927 Bacteria 1240
712 Ga0207687_10387260 3300025927 Bacteria 1147
713 Ga0207700_10035226 3300025928 Bacteria 3603
714 Ga0207700_10090811 3300025928 Bacteria 2411
715 Ga0207700_10339899 3300025928 Bacteria 1305
716 Ga0207664_10033370 3300025929 Bacteria 3954
717 Ga0207664_10039005 3300025929 Bacteria 3685
718 Ga0207664_10078218 3300025929 Bacteria 2682
719 Ga0207664_10147318 3300025929 Bacteria 1997
720 Ga0207664_10196556 3300025929 Bacteria 1739
721 Ga0207664_10482032 3300025929 Bacteria 1109
722 Ga0207664_10652066 3300025929 Bacteria 946
723 Ga0207644_10000202 3300025931 Bacteria 41988
724 Ga0207644_10000240 3300025931 Bacteria 37642
725 Ga0207644_10006364 3300025931 Bacteria 7688
726 Ga0207644_10008507 3300025931 Bacteria 6715
727 Ga0207644_10014968 3300025931 Bacteria 5201
728 Ga0207644_10018147 3300025931 Bacteria 4757
729 Ga0207644_10023425 3300025931 Bacteria 4229
730 Ga0207644_10046836 3300025931 Bacteria 3082
731 Ga0207644_10064724 3300025931 Bacteria 2657
732 Ga0207644_10083602 3300025931 Bacteria 2364
733 Ga0207644_10091658 3300025931 Bacteria 2266
734 Ga0207644_10231304 3300025931 Bacteria 1469
735 Ga0207644_10333026 3300025931 Bacteria 1229
736 Ga0207690_10002306 3300025932 Bacteria 11636
737 Ga0207690_10002510 3300025932 Bacteria 11089
738 Ga0207690_10019265 3300025932 Bacteria 4198
739 Ga0207690_10079755 3300025932 Bacteria 2282
740 Ga0207690_10102134 3300025932 Bacteria 2050
741 Ga0207690_10112637 3300025932 Bacteria 1962
742 Ga0207690_10120709 3300025932 Bacteria 1903
743 Ga0207690_10136888 3300025932 Bacteria 1799
744 Ga0207690_10157910 3300025932 Bacteria 1688
745 Ga0207690_10294697 3300025932 Bacteria 1267
746 Ga0207690_10385811 3300025932 Bacteria 1114
747 Ga0207690_10394873 3300025932 Bacteria 1102
748 Ga0207690_10411044 3300025932 Bacteria 1081
749 Ga0207690_10521684 3300025932 Bacteria 963
750 Ga0207690_10578457 3300025932 Bacteria 915
751 Ga0207690_10627384 3300025932 Bacteria 879
752 Ga0207690_10736471 3300025932 Bacteria 812
753 Ga0207690_10758356 3300025932 Bacteria 800
754 Ga0207706_10000224 3300025933 Bacteria 62043
755 Ga0207706_10004274 3300025933 Bacteria 13436
756 Ga0207706_10028329 3300025933 Bacteria 5003
757 Ga0207706_10028595 3300025933 Bacteria 4978
758 Ga0207706_10030051 3300025933 Bacteria 4849
759 Ga0207706_10030442 3300025933 Bacteria 4814
760 Ga0207706_10031271 3300025933 Bacteria 4742
761 Ga0207706_10033742 3300025933 Bacteria 4554
762 Ga0207706_10045603 3300025933 Bacteria 3883
763 Ga0207706_10061628 3300025933 Bacteria 3303
764 Ga0207706_10068017 3300025933 Bacteria 3135
765 Ga0207706_10098317 3300025933 Bacteria 2574
766 Ga0207706_10167671 3300025933 Bacteria 1930
767 Ga0207706_10198709 3300025933 Bacteria 1759
768 Ga0207706_10241487 3300025933 Bacteria 1579
769 Ga0207706_10549615 3300025933 Bacteria 994
770 Ga0207686_10050884 3300025934 Bacteria 2578
771 Ga0207686_10071490 3300025934 Bacteria 2233
772 Ga0207709_10181495 3300025935 Bacteria 1487
773 Ga0207709_10364671 3300025935 Bacteria 1095
774 Ga0207709_10569512 3300025935 Bacteria 893
775 Ga0207670_10118305 3300025936 Bacteria 1921
776 Ga0207670_10366802 3300025936 Bacteria 1144
777 Ga0207670_10444732 3300025936 Bacteria 1044
778 Ga0207669_10026389 3300025937 Bacteria 3159
779 Ga0207669_10041168 3300025937 Bacteria 2687
780 Ga0207669_10060717 3300025937 Bacteria 2319
781 Ga0207704_10192122 3300025938 Bacteria 1486
782 Ga0207704_10238290 3300025938 Bacteria 1357
783 Ga0207704_10309929 3300025938 Bacteria 1213
784 Ga0207704_10451038 3300025938 Bacteria 1026
785 Ga0207704_10659217 3300025938 Bacteria 863
786 Ga0207691_10000750 3300025940 Bacteria 32085
787 Ga0207691_10005051 3300025940 Bacteria 12732
788 Ga0207691_10041076 3300025940 Bacteria 4273
789 Ga0207691_10064962 3300025940 Bacteria 3305
790 Ga0207691_10068974 3300025940 Bacteria 3194
791 Ga0207691_10136077 3300025940 Bacteria 2167
792 Ga0207691_10139727 3300025940 Bacteria 2135
793 Ga0207691_10205367 3300025940 Bacteria 1713
794 Ga0207691_10456349 3300025940 Bacteria 1087
795 Ga0207711_10000105 3300025941 Bacteria 90036
796 Ga0207711_10000190 3300025941 Bacteria 65723
797 Ga0207711_10000908 3300025941 Bacteria 28478
798 Ga0207711_10001131 3300025941 Bacteria 25459
799 Ga0207711_10005280 3300025941 Bacteria 10951
800 Ga0207711_10013254 3300025941 Bacteria 6849
801 Ga0207711_10015748 3300025941 Bacteria 6271
802 Ga0207711_10043714 3300025941 Bacteria 3823
803 Ga0207711_10076879 3300025941 Bacteria 2909
804 Ga0207711_10080732 3300025941 Bacteria 2841
805 Ga0207711_10218526 3300025941 Bacteria 1742
806 Ga0207711_10292154 3300025941 Bacteria 1502
807 Ga0207711_10342601 3300025941 Bacteria 1383
808 Ga0207711_10379902 3300025941 Bacteria 1311
809 Ga0207711_10489546 3300025941 Bacteria 1146
810 Ga0207689_10000051 3300025942 Bacteria 88480
811 Ga0207689_10015875 3300025942 Bacteria 6379
812 Ga0207689_10052167 3300025942 Bacteria 3371
813 Ga0207689_10075601 3300025942 Bacteria 2769
814 Ga0207689_10581574 3300025942 Bacteria 941
815 Ga0207689_10627362 3300025942 Bacteria 905
816 Ga0207661_10051216 3300025944 Bacteria 3293
817 Ga0207661_10064717 3300025944 Bacteria 2965
818 Ga0207661_10179652 3300025944 Bacteria 1848
819 Ga0207661_10299069 3300025944 Bacteria 1442
820 Ga0207661_10301220 3300025944 Bacteria 1437
821 Ga0207679_10004233 3300025945 Bacteria 8918
822 Ga0207679_10007760 3300025945 Bacteria 6819
823 Ga0207679_10007961 3300025945 Bacteria 6738
824 Ga0207679_10019294 3300025945 Bacteria 4577
825 Ga0207679_10020675 3300025945 Bacteria 4446
826 Ga0207679_10021485 3300025945 Bacteria 4377
827 Ga0207679_10054860 3300025945 Bacteria 2936
828 Ga0207679_10055729 3300025945 Bacteria 2915
829 Ga0207679_10068998 3300025945 Bacteria 2658
830 Ga0207679_10128916 3300025945 Bacteria 2026
831 Ga0207679_10200893 3300025945 Bacteria 1665
832 Ga0207679_10243639 3300025945 Bacteria 1525
833 Ga0207679_10333453 3300025945 Bacteria 1317
834 Ga0207679_10447361 3300025945 Bacteria 1145
835 Ga0207667_10000579 3300025949 Bacteria 47716
836 Ga0207667_10006485 3300025949 Bacteria 14155
837 Ga0207667_10012465 3300025949 Bacteria 9792
838 Ga0207667_10077499 3300025949 Bacteria 3447
839 Ga0207667_10093640 3300025949 Bacteria 3102
840 Ga0207667_10106520 3300025949 Bacteria 2892
841 Ga0207667_10144043 3300025949 Bacteria 2453
842 Ga0207667_10185753 3300025949 Bacteria 2134
843 Ga0207667_10278147 3300025949 Bacteria 1711
844 Ga0207667_10355773 3300025949 Bacteria 1493
845 Ga0207667_10493976 3300025949 Bacteria 1242
846 Ga0207667_11358254 3300025949 Bacteria 685
847 Ga0207651_10002058 3300025960 Bacteria 9470
848 Ga0207651_10012659 3300025960 Bacteria 4785
849 Ga0207651_10040444 3300025960 Bacteria 3084
850 Ga0207651_10042262 3300025960 Bacteria 3032
851 Ga0207651_10043007 3300025960 Bacteria 3012
852 Ga0207651_10044775 3300025960 Bacteria 2964
853 Ga0207651_10045728 3300025960 Bacteria 2938
854 Ga0207651_10064604 3300025960 Bacteria 2562
855 Ga0207651_10069526 3300025960 Bacteria 2486
856 Ga0207651_10131441 3300025960 Bacteria 1917
857 Ga0207651_10633758 3300025960 Bacteria 937
858 Ga0207651_10637626 3300025960 Bacteria 934
859 Ga0207651_10759023 3300025960 Bacteria 858
860 Ga0207651_10937429 3300025960 Bacteria 772
861 Ga0207712_10001657 3300025961 Bacteria 14950
862 Ga0207668_10000086 3300025972 Bacteria 69871
863 Ga0207668_10007893 3300025972 Bacteria 6326
864 Ga0207668_10093274 3300025972 Bacteria 2218
865 Ga0207668_10329190 3300025972 Bacteria 1270
866 Ga0207640_10000428 3300025981 Bacteria 25901
867 Ga0207640_10003885 3300025981 Bacteria 8066
868 Ga0207640_10013224 3300025981 Bacteria 4725
869 Ga0207640_10019431 3300025981 Bacteria 4014
870 Ga0207640_10060515 3300025981 Bacteria 2503
871 Ga0207640_10124261 3300025981 Bacteria 1855
872 Ga0207640_10515705 3300025981 Bacteria 998
873 Ga0207640_10731013 3300025981 Bacteria 851
874 Ga0207658_10002031 3300025986 Bacteria 15107
875 Ga0207658_10002254 3300025986 Bacteria 14276
876 Ga0207658_10004381 3300025986 Bacteria 9817
877 Ga0207658_10006625 3300025986 Bacteria 7887
878 Ga0207658_10008246 3300025986 Bacteria 7097
879 Ga0207658_10008914 3300025986 Bacteria 6803
880 Ga0207658_10013911 3300025986 Bacteria 5507
881 Ga0207658_10087867 3300025986 Bacteria 2401
882 Ga0207658_10139172 3300025986 Bacteria 1962
883 Ga0207658_10157544 3300025986 Bacteria 1857
884 Ga0207658_10288021 3300025986 Bacteria 1410
885 Ga0207658_10359128 3300025986 Bacteria 1270
886 Ga0207658_10730913 3300025986 Bacteria 896
887 Ga0207677_10007697 3300026023 Bacteria 5980
888 Ga0207677_10049998 3300026023 Bacteria 2825
889 Ga0207677_10052858 3300026023 Bacteria 2762
890 Ga0207677_10156406 3300026023 Bacteria 1766
891 Ga0207677_10161055 3300026023 Bacteria 1743
892 Ga0207677_10205187 3300026023 Bacteria 1570
893 Ga0207677_10239355 3300026023 Bacteria 1467
894 Ga0207677_10727067 3300026023 Bacteria 883
895 Ga0207703_10006394 3300026035 Bacteria 9419
896 Ga0207703_10007523 3300026035 Bacteria 8644
897 Ga0207703_10010010 3300026035 Bacteria 7433
898 Ga0207703_10013542 3300026035 Bacteria 6353
899 Ga0207703_10030430 3300026035 Bacteria 4267
900 Ga0207703_10101815 3300026035 Bacteria 2436
901 Ga0207639_10001075 3300026041 Bacteria 18521
902 Ga0207639_10002776 3300026041 Bacteria 11763
903 Ga0207639_10035974 3300026041 Bacteria 3666
904 Ga0207639_10088157 3300026041 Bacteria 2475
905 Ga0207639_10218731 3300026041 Bacteria 1644
906 Ga0207639_10299963 3300026041 Bacteria 1420
907 Ga0207639_10319150 3300026041 Bacteria 1379
908 Ga0207639_10376492 3300026041 Bacteria 1274
909 Ga0207639_10380550 3300026041 Bacteria 1267
910 Ga0207678_10000217 3300026067 Bacteria 51179
911 Ga0207678_10000315 3300026067 Bacteria 43614
912 Ga0207678_10002797 3300026067 Bacteria 15835
913 Ga0207678_10007956 3300026067 Bacteria 9349
914 Ga0207678_10013114 3300026067 Bacteria 7272
915 Ga0207678_10027502 3300026067 Bacteria 4963
916 Ga0207678_10039959 3300026067 Bacteria 4069
917 Ga0207678_10049040 3300026067 Bacteria 3648
918 Ga0207678_10153210 3300026067 Bacteria 1968
919 Ga0207678_10288488 3300026067 Bacteria 1409
920 Ga0207702_10005472 3300026078 Bacteria 11105
921 Ga0207702_10017620 3300026078 Bacteria 5911
922 Ga0207702_10093897 3300026078 Bacteria 2632
923 Ga0207702_10153594 3300026078 Bacteria 2096
924 Ga0207702_10154406 3300026078 Bacteria 2091
925 Ga0207702_10235661 3300026078 Bacteria 1712
926 Ga0207702_10346474 3300026078 Bacteria 1420
927 Ga0207641_10000172 3300026088 Bacteria 90549
928 Ga0207641_10005515 3300026088 Bacteria 10793
929 Ga0207641_10015982 3300026088 Bacteria 6144
930 Ga0207641_10032293 3300026088 Bacteria 4346
931 Ga0207641_10040796 3300026088 Bacteria 3888
932 Ga0207641_10126929 3300026088 Bacteria 2285
933 Ga0207641_10673407 3300026088 Bacteria 1017
934 Ga0207648_10000221 3300026089 Bacteria 61280
935 Ga0207648_10001535 3300026089 Bacteria 25421
936 Ga0207648_10006756 3300026089 Bacteria 11374
937 Ga0207648_10022543 3300026089 Bacteria 5652
938 Ga0207648_10259227 3300026089 Bacteria 1551
939 Ga0207676_10000300 3300026095 Bacteria 42535
940 Ga0207676_10002706 3300026095 Bacteria 12613
941 Ga0207676_10003558 3300026095 Bacteria 11011
942 Ga0207676_10016196 3300026095 Bacteria 5396
943 Ga0207676_10024594 3300026095 Bacteria 4458
944 Ga0207676_10048814 3300026095 Bacteria 3288
945 Ga0207676_10167667 3300026095 Bacteria 1910
946 Ga0207676_10173408 3300026095 Bacteria 1881
947 Ga0207676_10361405 3300026095 Bacteria 1345
948 Ga0207674_10001184 3300026116 Bacteria 33891
949 Ga0207674_10003022 3300026116 Bacteria 20854
950 Ga0207674_10005356 3300026116 Bacteria 15258
951 Ga0207674_10008550 3300026116 Bacteria 11807
952 Ga0207674_10017887 3300026116 Bacteria 7725
953 Ga0207674_10020272 3300026116 Bacteria 7187
954 Ga0207674_10052864 3300026116 Bacteria 4142
955 Ga0207674_10079796 3300026116 Bacteria 3276
956 Ga0207674_10081806 3300026116 Bacteria 3231
957 Ga0207674_10085026 3300026116 Bacteria 3160
958 Ga0207674_10192441 3300026116 Bacteria 1990
959 Ga0207674_10296315 3300026116 Bacteria 1566
960 Ga0207674_10318448 3300026116 Bacteria 1505
961 Ga0207674_10469513 3300026116 Bacteria 1216
962 Ga0207675_100020392 3300026118 Bacteria 6179
963 Ga0207675_100404301 3300026118 Bacteria 1346
964 Ga0207683_10000541 3300026121 Bacteria 34994
965 Ga0207683_10005768 3300026121 Bacteria 10613
966 Ga0207683_10074642 3300026121 Bacteria 3000
967 Ga0207683_10089891 3300026121 Bacteria 2734
968 Ga0207683_10100173 3300026121 Bacteria 2586
969 Ga0207683_10939727 3300026121 Bacteria 803
970 Ga0207698_10012230 3300026142 Bacteria 5607
971 Ga0207698_10020271 3300026142 Bacteria 4573
972 Ga0207698_10037606 3300026142 Bacteria 3567
973 Ga0207698_10056518 3300026142 Bacteria 3031
974 Ga0207698_10110105 3300026142 Bacteria 2306
975 Ga0207698_10133638 3300026142 Bacteria 2125
976 Ga0207698_10220099 3300026142 Bacteria 1715
977 Ga0207698_10309331 3300026142 Bacteria 1475
978 Ga0207698_10310483 3300026142 Bacteria 1472
979 Ga0207698_10728093 3300026142 Bacteria 989
980 Ga0207698_10975298 3300026142 Bacteria 857
981 Ga0209974_10228584 3300027876 Bacteria 694
982 Ga0268266_10000200 3300028379 Bacteria 104456
983 Ga0268266_10015404 3300028379 Bacteria 6561
984 Ga0268266_10020187 3300028379 Bacteria 5679
985 Ga0268266_10054140 3300028379 Bacteria 3448
986 Ga0268266_10140599 3300028379 Bacteria 2166
987 Ga0268266_10262485 3300028379 Bacteria 1601
988 Ga0268266_10616948 3300028379 Bacteria 1042
989 Ga0268266_10689863 3300028379 Bacteria 984
990 Ga0268265_10002225 3300028380 Bacteria 14916
991 Ga0268265_10002511 3300028380 Bacteria 13738
992 Ga0268265_10006624 3300028380 Bacteria 7841
993 Ga0268265_10011030 3300028380 Bacteria 6103
994 Ga0268265_10103327 3300028380 Bacteria 2307
995 Ga0268265_10183742 3300028380 Bacteria 1799
996 Ga0268265_10426725 3300028380 Bacteria 1232
997 Ga0268264_10002073 3300028381 Bacteria 17893
998 Ga0268264_10002535 3300028381 Bacteria 16046
999 Ga0268264_10010431 3300028381 Bacteria 7680
1000 Ga0268264_10079039 3300028381 Bacteria 2805
1001 Ga0268264_10141908 3300028381 Bacteria 2143
1002 Ga0268264_10150632 3300028381 Bacteria 2085
1003 Ga0268264_10427383 3300028381 Bacteria 1279
1004 Ga0268264_10450474 3300028381 Bacteria 1247
1005 Ga0268264_11028374 3300028381 Bacteria 831
1006 Ga0307515_10204124 3300028794 Bacteria 1843
1007 Ga0307515_10385968 3300028794 Bacteria 1031
1008 Ga0307408_100003312 3300031548 Bacteria 11077
1009 Ga0307408_100036299 3300031548 Bacteria 3464
1010 Ga0307408_100038158 3300031548 Bacteria 3388
1011 Ga0307408_100324419 3300031548 Bacteria 1298
1012 Ga0307408_100392479 3300031548 Bacteria 1189
1013 Ga0307408_100403964 3300031548 Bacteria 1174
1014 Ga0307405_10017102 3300031731 Bacteria 3972
1015 Ga0307405_10080849 3300031731 Bacteria 2122
1016 Ga0307405_10141497 3300031731 Bacteria 1678
1017 Ga0307405_10550678 3300031731 Bacteria 933
1018 Ga0307413_10060861 3300031824 Bacteria 2326
1019 Ga0307413_10090824 3300031824 Bacteria 1988
1020 Ga0307413_10115193 3300031824 Bacteria 1808
1021 Ga0307413_10121479 3300031824 Bacteria 1770
1022 Ga0307413_10150850 3300031824 Bacteria 1619
1023 Ga0307410_10024252 3300031852 Bacteria 3787
1024 Ga0307410_10025577 3300031852 Bacteria 3706
1025 Ga0307410_10035920 3300031852 Bacteria 3223
1026 Ga0307410_10036295 3300031852 Bacteria 3208
1027 Ga0307410_10065499 3300031852 Bacteria 2499
1028 Ga0307410_10074793 3300031852 Bacteria 2360
1029 Ga0307410_10079510 3300031852 Bacteria 2298
1030 Ga0307410_10344031 3300031852 Bacteria 1189
1031 Ga0307410_10399993 3300031852 Bacteria 1109
1032 Ga0307410_10457109 3300031852 Bacteria 1043
1033 Ga0307410_10692178 3300031852 Bacteria 858
1034 Ga0307406_10011830 3300031901 Bacteria 4958
1035 Ga0307406_10014646 3300031901 Bacteria 4515
1036 Ga0307406_10171798 3300031901 Bacteria 1569
1037 Ga0307406_10173390 3300031901 Bacteria 1563
1038 Ga0307406_10215456 3300031901 Bacteria 1423
1039 Ga0307406_10220984 3300031901 Bacteria 1408
1040 Ga0307406_10371745 3300031901 Bacteria 1124
1041 Ga0307407_10012647 3300031903 Bacteria 4064
1042 Ga0307407_10020835 3300031903 Bacteria 3368
1043 Ga0307407_10198917 3300031903 Bacteria 1341
1044 Ga0307412_10045061 3300031911 Bacteria 2881
1045 Ga0307412_10121129 3300031911 Bacteria 1883
1046 Ga0307412_10128072 3300031911 Bacteria 1839
1047 Ga0307412_10181540 3300031911 Bacteria 1583
1048 Ga0307412_10291990 3300031911 Bacteria 1284
1049 Ga0307412_10749395 3300031911 Bacteria 843
1050 Ga0307409_100010549 3300031995 Bacteria 5755
1051 Ga0307409_100021707 3300031995 Bacteria 4408
1052 Ga0307409_100028355 3300031995 Bacteria 3987
1053 Ga0307409_100076692 3300031995 Bacteria 2681
1054 Ga0307409_100095169 3300031995 Bacteria 2453
1055 Ga0307409_100159292 3300031995 Bacteria 1971
1056 Ga0307409_100173582 3300031995 Bacteria 1900
1057 Ga0307409_100196560 3300031995 Bacteria 1800
1058 Ga0307409_100814970 3300031995 Bacteria 942
1059 Ga0307409_101076345 3300031995 Bacteria 824
1060 Ga0307416_100004550 3300032002 Bacteria 8379
1061 Ga0307416_100024627 3300032002 Bacteria 4397
1062 Ga0307416_100062436 3300032002 Bacteria 3046
1063 Ga0307416_100398969 3300032002 Bacteria 1412
1064 Ga0307416_100401131 3300032002 Bacteria 1409
1065 Ga0307414_10027528 3300032004 Bacteria 3675
1066 Ga0307414_10029219 3300032004 Bacteria 3585
1067 Ga0307414_10034367 3300032004 Bacteria 3360
1068 Ga0307414_10048927 3300032004 Bacteria 2920
1069 Ga0307414_10051407 3300032004 Bacteria 2861
1070 Ga0307414_10073518 3300032004 Bacteria 2473
1071 Ga0307414_10087717 3300032004 Bacteria 2300
1072 Ga0307414_10489437 3300032004 Bacteria 1086
1073 Ga0307414_10500492 3300032004 Bacteria 1075
1074 Ga0307414_10558424 3300032004 Bacteria 1021
1075 Ga0307414_10567912 3300032004 Bacteria 1013
1076 Ga0307414_10582363 3300032004 Bacteria 1001
1077 Ga0307414_10629129 3300032004 Bacteria 965
1078 Ga0307414_11230992 3300032004 Bacteria 693
1079 Ga0307411_10004546 3300032005 Bacteria 6666
1080 Ga0307411_10014761 3300032005 Bacteria 4360
1081 Ga0307411_10050336 3300032005 Bacteria 2712
1082 Ga0307411_10116365 3300032005 Bacteria 1924
1083 Ga0307411_10132255 3300032005 Bacteria 1825
1084 Ga0307411_10202493 3300032005 Bacteria 1526
1085 Ga0307411_10206353 3300032005 Bacteria 1513
1086 Ga0307411_10229282 3300032005 Bacteria 1446
1087 Ga0307415_100021401 3300032126 Bacteria 3974
1088 Ga0307415_100091323 3300032126 Bacteria 2205
1089 Ga0307415_100157309 3300032126 Bacteria 1756
1090 Ga0307415_100172291 3300032126 Bacteria 1689
1091 Ga0307415_100297493 3300032126 Bacteria 1335
1092 Ga0307415_100309318 3300032126 Bacteria 1312
1093 Ga0307415_100433020 3300032126 Bacteria 1132
1094 Ga0307415_100576341 3300032126 Bacteria 997
1095 Ga0307415_100607544 3300032126 Bacteria 974
1096 Ga0307415_100804576 3300032126 Bacteria 858
1097 Ga0373943_0002312 3300035170 Bacteria 8661
1098 Ga0373946_0346531 3300035171 Bacteria 742
1099 Ga0373935_0039935 3300035692 Bacteria 2943
1100 Ga0373935_0043735 3300035692 Bacteria 2820
1101 Ga0373947_0136102 3300035725 Bacteria 1572
1102 Ga0395899_0000270 3300037312 Bacteria 68004
1103 Ga0395899_0000998 3300037312 Bacteria 25996
1104 Ga0395899_0010843 3300037312 Bacteria 6986
1105 Ga0395899_0013488 3300037312 Bacteria 6248
1106 Ga0395899_0019430 3300037312 Bacteria 5162
1107 Ga0395899_0021014 3300037312 Bacteria 4949
1108 Ga0395899_0024186 3300037312 Bacteria 4595
1109 Ga0395899_0025940 3300037312 Bacteria 4423
1110 Ga0395899_0036079 3300037312 Bacteria 3710
1111 Ga0395899_0066901 3300037312 Bacteria 2638
1112 Ga0395899_0081252 3300037312 Bacteria 2358
1113 Ga0395899_0084784 3300037312 Bacteria 2303
1114 Ga0395899_0096924 3300037312 Bacteria 2133
1115 Ga0395899_0104740 3300037312 Bacteria 2038
1116 Ga0395899_0156960 3300037312 Bacteria 1609
1117 Ga0395899_0172348 3300037312 Bacteria 1523
1118 Ga0395899_0200272 3300037312 Bacteria 1393
1119 Ga0395899_0200807 3300037312 Bacteria 1390
1120 Ga0395899_0210709 3300037312 Bacteria 1350
1121 Ga0395899_0273064 3300037312 Bacteria 1152
1122 Ga0395899_0291071 3300037312 Bacteria 1108
1123 Ga0395899_0431101 3300037312 Bacteria 867
1124 Ga0395899_0550280 3300037312 Bacteria 742
1125 Ga0395899_0551644 3300037312 Bacteria 740
1126 Ga0395900_0000290 3300037418 Bacteria 75444
1127 Ga0395900_0004722 3300037418 Bacteria 14370
1128 Ga0395900_0009456 3300037418 Bacteria 9990
1129 Ga0395900_0010539 3300037418 Bacteria 9456
1130 Ga0395900_0016179 3300037418 Bacteria 7598
1131 Ga0395900_0017673 3300037418 Bacteria 7279
1132 Ga0395900_0018333 3300037418 Bacteria 7140
1133 Ga0395900_0048442 3300037418 Bacteria 4377
1134 Ga0395900_0049164 3300037418 Bacteria 4344
1135 Ga0395900_0061099 3300037418 Bacteria 3875
1136 Ga0395900_0088941 3300037418 Bacteria 3175
1137 Ga0395900_0104526 3300037418 Bacteria 2909
1138 Ga0395900_0144501 3300037418 Bacteria 2433
1139 Ga0395900_0146941 3300037418 Bacteria 2410
1140 Ga0395900_0169335 3300037418 Bacteria 2224
1141 Ga0395900_0179984 3300037418 Bacteria 2149
1142 Ga0395900_0194342 3300037418 Bacteria 2056
1143 Ga0395900_0273463 3300037418 Bacteria 1683
1144 Ga0395900_0273957 3300037418 Bacteria 1681
1145 Ga0395900_0288513 3300037418 Bacteria 1630
1146 Ga0395900_0309126 3300037418 Bacteria 1564
1147 Ga0395900_0320797 3300037418 Bacteria 1529
1148 Ga0395900_0324669 3300037418 Bacteria 1518
1149 Ga0395900_0351444 3300037418 Bacteria 1447
1150 Ga0395900_0359551 3300037418 Bacteria 1427
1151 Ga0395900_0377813 3300037418 Bacteria 1386
1152 Ga0395900_0401727 3300037418 Bacteria 1334
1153 Ga0395900_0415919 3300037418 Bacteria 1306
1154 Ga0395900_0566503 3300037418 Bacteria 1079
1155 Ga0395900_0569971 3300037418 Bacteria 1075
1156 Ga0395900_0620172 3300037418 Bacteria 1020
1157 Ga0395900_0658113 3300037418 Bacteria 984
1158 Ga0395900_0762565 3300037418 Bacteria 897
1159 Ga0395900_0923094 3300037418 Bacteria 795
1160 Ga0395898_0000054 3300037466 Bacteria 279561
1161 Ga0395898_0002537 3300037466 Bacteria 21412
1162 Ga0395898_0031011 3300037466 Bacteria 5346
1163 Ga0395898_0041320 3300037466 Bacteria 4555
1164 Ga0395898_0049411 3300037466 Bacteria 4121
1165 Ga0395898_0082820 3300037466 Bacteria 3092
1166 Ga0395898_0097378 3300037466 Bacteria 2825
1167 Ga0395898_0101153 3300037466 Bacteria 2768
1168 Ga0395898_0143643 3300037466 Bacteria 2284
1169 Ga0395898_0193635 3300037466 Bacteria 1942
1170 Ga0395898_0213961 3300037466 Bacteria 1838
1171 Ga0395898_0220426 3300037466 Bacteria 1809
1172 Ga0395898_0257539 3300037466 Bacteria 1664
1173 Ga0395898_0326758 3300037466 Bacteria 1463
1174 Ga0395898_0351126 3300037466 Bacteria 1406
1175 Ga0395898_0446700 3300037466 Bacteria 1232
1176 Ga0395898_0778331 3300037466 Bacteria 898
1177 Ga0395898_1086702 3300037466 Bacteria 734
1178 Ga0395905_0000046 3300037471 Bacteria 240463
1179 Ga0395905_0000464 3300037471 Bacteria 56406
1180 Ga0395905_0001572 3300037471 Bacteria 27278
1181 Ga0395905_0004285 3300037471 Bacteria 14873
1182 Ga0395905_0005705 3300037471 Bacteria 12649
1183 Ga0395905_0007948 3300037471 Bacteria 10491
1184 Ga0395905_0008923 3300037471 Bacteria 9847
1185 Ga0395905_0010834 3300037471 Bacteria 8832
1186 Ga0395905_0011831 3300037471 Bacteria 8424
1187 Ga0395905_0014345 3300037471 Bacteria 7571
1188 Ga0395905_0015579 3300037471 Bacteria 7223
1189 Ga0395905_0040463 3300037471 Bacteria 4373
1190 Ga0395905_0041225 3300037471 Bacteria 4333
1191 Ga0395905_0043230 3300037471 Bacteria 4227
1192 Ga0395905_0054150 3300037471 Bacteria 3754
1193 Ga0395905_0058041 3300037471 Bacteria 3619
1194 Ga0395905_0074110 3300037471 Bacteria 3190
1195 Ga0395905_0075701 3300037471 Bacteria 3154
1196 Ga0395905_0083499 3300037471 Bacteria 2992
1197 Ga0395905_0089835 3300037471 Bacteria 2879
1198 Ga0395905_0100386 3300037471 Bacteria 2717
1199 Ga0395905_0105816 3300037471 Bacteria 2642
1200 Ga0395905_0107970 3300037471 Bacteria 2613
1201 Ga0395905_0123602 3300037471 Bacteria 2433
1202 Ga0395905_0127904 3300037471 Bacteria 2389
1203 Ga0395905_0130666 3300037471 Bacteria 2362
1204 Ga0395905_0135173 3300037471 Bacteria 2319
1205 Ga0395905_0139783 3300037471 Bacteria 2278
1206 Ga0395905_0146126 3300037471 Bacteria 2224
1207 Ga0395905_0153301 3300037471 Bacteria 2167
1208 Ga0395905_0174510 3300037471 Bacteria 2018
1209 Ga0395905_0215712 3300037471 Bacteria 1797
1210 Ga0395905_0232198 3300037471 Bacteria 1725
1211 Ga0395905_0269393 3300037471 Bacteria 1589
1212 Ga0395905_0362324 3300037471 Bacteria 1342
1213 Ga0395905_0370976 3300037471 Bacteria 1324
1214 Ga0395905_0460845 3300037471 Bacteria 1169
1215 Ga0395905_0467786 3300037471 Bacteria 1159
1216 Ga0395905_0488949 3300037471 Bacteria 1130
1217 Ga0395905_0491798 3300037471 Bacteria 1126
1218 Ga0395905_0538859 3300037471 Bacteria 1068
1219 Ga0395905_0596773 3300037471 Bacteria 1006
1220 Ga0395905_0597877 3300037471 Bacteria 1005
1221 Ga0395905_0634349 3300037471 Bacteria 970
1222 Ga0395905_0678694 3300037471 Bacteria 932
1223 Ga0395905_0692226 3300037471 Bacteria 922
1224 Ga0395905_0732745 3300037471 Bacteria 891
1225 Ga0395905_0745736 3300037471 Bacteria 882
1226 Ga0395905_0962657 3300037471 Bacteria 756
1227 Ga0436364_0007919 3300037853 Bacteria 27699
1228 Ga0395901_0000102 3300038443 Bacteria 115611
1229 Ga0395901_0004019 3300038443 Bacteria 14813
1230 Ga0395901_0028940 3300038443 Bacteria 5700
1231 Ga0395901_0030409 3300038443 Bacteria 5563
1232 Ga0395901_0033790 3300038443 Bacteria 5281
1233 Ga0395901_0035168 3300038443 Bacteria 5177
1234 Ga0395901_0057583 3300038443 Bacteria 4042
1235 Ga0395901_0070183 3300038443 Bacteria 3650
1236 Ga0395901_0085243 3300038443 Bacteria 3302
1237 Ga0395901_0091315 3300038443 Bacteria 3187
1238 Ga0395901_0137303 3300038443 Bacteria 2569
1239 Ga0395901_0140468 3300038443 Bacteria 2538
1240 Ga0395901_0181695 3300038443 Bacteria 2206
1241 Ga0395901_0217168 3300038443 Bacteria 1999
1242 Ga0395901_0228049 3300038443 Bacteria 1945
1243 Ga0395901_0232340 3300038443 Bacteria 1925
1244 Ga0395901_0254419 3300038443 Bacteria 1829
1245 Ga0395901_0256173 3300038443 Bacteria 1822
1246 Ga0395901_0258076 3300038443 Bacteria 1814
1247 Ga0395901_0264201 3300038443 Bacteria 1791
1248 Ga0395901_0357121 3300038443 Bacteria 1507
1249 Ga0395901_0498115 3300038443 Bacteria 1240
1250 Ga0395901_0539894 3300038443 Bacteria 1183
1251 Ga0395901_0622921 3300038443 Bacteria 1085
1252 Ga0395901_0830993 3300038443 Bacteria 910
1253 Ga0395901_1054824 3300038443 Bacteria 785
1254 Ga0395901_1206039 3300038443 Bacteria 722
1255 Ga0436365_0229933 3300039437 Bacteria 847
1256 Ga0436365_0253280 3300039437 Bacteria 843
1257 Ga0436365_0476910 3300039437 Bacteria 924
1258 Ga0436365_1547320 3300039437 Bacteria 2719
1259 Ga0436363_0079975 3300039450 Bacteria 1937
1260 Ga0439445_0007270 3300042004 Bacteria 2567
1261 Ga0439448_0014567 3300042005 Bacteria 2373
1262 Ga0439448_0144592 3300042005 Bacteria 824
1263 Ga0439455_0010582 3300042012 Bacteria 2032
1264 Ga0450923_055940 3300042125 Bacteria 854
1265 Ga0439458_0000363 3300042157 Bacteria 11400
1266 Ga0439458_0003767 3300042157 Bacteria 3511
1267 Ga0439458_0015022 3300042157 Bacteria 1750
1268 Ga0439464_0001955 3300042439 Bacteria 4989
1269 Ga0466969_0033732 3300044656 Bacteria 2597
1270 Ga0466969_0173469 3300044656 Bacteria 988
1271 Ga0466969_0229495 3300044656 Bacteria 843
1272 Ga0466972_0054799 3300044658 Bacteria 1918
1273 Ga0466972_0087918 3300044658 Bacteria 1475
1274 Ga0466972_0095786 3300044658 Bacteria 1406
1275 Ga0466972_0124749 3300044658 Bacteria 1213
1276 Ga0466965_0051915 3300044683 Bacteria 2035
1277 Ga0466965_0075193 3300044683 Bacteria 1703
1278 Ga0466965_0166438 3300044683 Bacteria 1158
1279 Ga0466965_0209872 3300044683 Bacteria 1035
1280 Ga0466966_0012677 3300044684 Bacteria 5586
1281 Ga0466966_0035140 3300044684 Bacteria 3240
1282 Ga0466966_0193159 3300044684 Bacteria 1233
1283 Ga0466966_0196555 3300044684 Bacteria 1221
1284 Ga0466966_0219074 3300044684 Bacteria 1149
1285 Ga0466961_0005945 3300044693 Bacteria 7731
1286 Ga0466961_0021267 3300044693 Bacteria 4177
1287 Ga0466961_0033510 3300044693 Bacteria 3299
1288 Ga0466961_0215479 3300044693 Bacteria 1184
1289 Ga0466963_0001106 3300044694 Bacteria 14051
1290 Ga0466963_0009734 3300044694 Bacteria 5798
1291 Ga0466963_0055169 3300044694 Bacteria 2642
1292 Ga0466963_0087818 3300044694 Bacteria 2115
1293 Ga0466963_0106823 3300044694 Bacteria 1919
1294 Ga0466963_0205265 3300044694 Bacteria 1378
1295 Ga0466963_0451404 3300044694 Bacteria 907
1296 Ga0466964_0007732 3300044706 Bacteria 4023
1297 Ga0466971_0001233 3300044719 Bacteria 10627
1298 Ga0466971_0062597 3300044719 Bacteria 1683
1299 Ga0466971_0114834 3300044719 Bacteria 1244
1300 Ga0466971_0219581 3300044719 Bacteria 901
1301 Ga0466968_0060698 3300044735 Bacteria 1630
1302 Ga0466970_0018981 3300044765 Bacteria 3562
1303 Ga0466970_0066495 3300044765 Bacteria 1935
1304 Ga0466970_0116455 3300044765 Bacteria 1461
1305 Ga0466970_0224273 3300044765 Bacteria 1049
1306 Ga0466957_0002532 3300044842 Bacteria 9834
1307 Ga0466957_0005858 3300044842 Bacteria 6921
1308 Ga0466957_0027332 3300044842 Bacteria 3391
1309 Ga0466957_0043852 3300044842 Bacteria 2709
1310 Ga0466957_0069416 3300044842 Bacteria 2177
1311 Ga0466957_0588696 3300044842 Bacteria 778
1312 Ga0466957_0649717 3300044842 Bacteria 741
1313 Ga0466959_0014620 3300045049 Bacteria 5710
1314 Ga0466959_0029553 3300045049 Bacteria 4061
1315 Ga0466959_0044761 3300045049 Bacteria 3260
1316 Ga0466959_0223257 3300045049 Bacteria 1306
1317 Ga0466959_0441265 3300045049 Bacteria 883
1318 Ga0466959_0753894 3300045049 Bacteria 651
1319 Ga0466958_0001034 3300045836 Bacteria 12713
1320 Ga0466958_0009773 3300045836 Bacteria 5352
1321 Ga0466958_0014945 3300045836 Bacteria 4439
1322 Ga0466958_0024381 3300045836 Bacteria 3559
1323 Ga0466958_0116893 3300045836 Bacteria 1667
1324 Ga0466958_0135617 3300045836 Bacteria 1548
1325 Ga0466958_0163403 3300045836 Bacteria 1408
1326 Ga0466958_0276171 3300045836 Bacteria 1076
1327 Ga0466967_0000524 3300045976 Bacteria 18692
1328 Ga0466967_0010682 3300045976 Bacteria 6902
1329 Ga0466967_0036825 3300045976 Bacteria 4181
1330 Ga0466967_0053564 3300045976 Bacteria 3546
1331 Ga0466967_0059958 3300045976 Bacteria 3370
1332 Ga0466967_0077292 3300045976 Bacteria 2996
1333 Ga0466967_0091996 3300045976 Bacteria 2757
1334 Ga0466967_0101882 3300045976 Bacteria 2625
1335 Ga0466967_0129249 3300045976 Bacteria 2343
1336 Ga0466967_0344619 3300045976 Bacteria 1441
1337 Ga0466967_0534039 3300045976 Bacteria 1153
1338 Ga0466967_0787515 3300045976 Bacteria 944
1339 Ga0495629_0540758 3300046459 Bacteria 783
1340 Ga0495638_0000402 3300046460 Bacteria 52910
1341 Ga0495580_0279579 3300046472 Bacteria 1139
1342 Ga0495606_0184866 3300046507 Bacteria 1199
1343 Ga0495648_0147649 3300046524 Bacteria 1230
1344 Ga0495663_0004481 3300046525 Bacteria 3924
1345 Ga0495663_0022987 3300046525 Bacteria 1803
1346 Ga0495663_0067866 3300046525 Bacteria 1131
1347 Ga0495642_0075576 3300046528 Bacteria 1413
1348 Ga0495598_0000263 3300046537 Bacteria 9476
1349 Ga0495621_0000044 3300046539 Bacteria 24707
1350 Ga0495622_0003839 3300046557 Bacteria 7019
1351 Ga0495633_0126010 3300046558 Bacteria 1185
1352 Ga0495668_0060614 3300046616 Bacteria 2087
1353 Ga0495625_0138908 3300046660 Bacteria 1640
1354 Ga0495669_0000644 3300046684 Bacteria 15189
1355 Ga0495669_0000912 3300046684 Bacteria 12390
1356 Ga0495669_0022356 3300046684 Bacteria 2746
1357 Ga0495669_0023888 3300046684 Bacteria 2663
1358 Ga0495669_0039102 3300046684 Bacteria 2100
1359 Ga0495670_0000148 3300046691 Bacteria 30968
1360 Ga0495670_0290525 3300046691 Bacteria 875
1361 Ga0495671_0028117 3300046692 Bacteria 2899
1362 Ga0495685_051686 3300047447 Bacteria 1393
1363 Ga0495686_0013368 3300047472 Bacteria 5696
1364 Ga0496100_0000983 3300048903 Bacteria 13709
1365 Ga0496100_0422285 3300048903 Bacteria 1018
1366 Ga0496101_0000216 3300048904 Bacteria 43445
1367 Ga0496101_0015421 3300048904 Bacteria 5150
1368 Ga0496101_0322962 3300048904 Bacteria 1211
1369 Ga0496102_0065035 3300048905 Bacteria 3342
1370 Ga0496102_0229267 3300048905 Bacteria 1751
1371 Ga0496102_0534013 3300048905 Bacteria 1096
1372 Ga0496102_0617534 3300048905 Bacteria 1007
1373 Ga0496103_0002116 3300048906 Bacteria 12635
1374 Ga0496103_0283828 3300048906 Bacteria 1065
1375 Ga0496103_0343101 3300048906 Bacteria 960
1376 Ga0496104_0062973 3300048907 Bacteria 3517
1377 Ga0496104_0224390 3300048907 Bacteria 1791
1378 Ga0496105_0023470 3300048908 Bacteria 5003
1379 Ga0496105_0555913 3300048908 Bacteria 895
1380 Ga0496106_0006534 3300048909 Bacteria 8632
1381 Ga0496106_0025806 3300048909 Bacteria 4372
1382 Ga0496106_0936398 3300048909 Bacteria 683
1383 Ga0496107_0000258 3300048910 Bacteria 28128
1384 Ga0496107_0001322 3300048910 Bacteria 15195
1385 Ga0496107_0017341 3300048910 Bacteria 5064
1386 Ga0496107_0026570 3300048910 Bacteria 4104
1387 Ga0496107_0100133 3300048910 Bacteria 2124
1388 Ga0496107_0116013 3300048910 Bacteria 1971
1389 Ga0496107_0117844 3300048910 Bacteria 1955
1390 Ga0496107_0196175 3300048910 Bacteria 1500
1391 Ga0496108_0001820 3300048911 Bacteria 17010
1392 Ga0496108_0005054 3300048911 Bacteria 10659
1393 Ga0496108_0007117 3300048911 Bacteria 9064
1394 Ga0496108_0025148 3300048911 Bacteria 4905
1395 Ga0496108_0810818 3300048911 Bacteria 807
1396 Ga0496109_0003321 3300048912 Bacteria 13449
1397 Ga0496109_0004047 3300048912 Bacteria 12245
1398 Ga0496109_0004682 3300048912 Bacteria 11420
1399 Ga0496109_0011962 3300048912 Bacteria 7473
1400 Ga0496109_0015314 3300048912 Bacteria 6679
1401 Ga0496109_0020472 3300048912 Bacteria 5843
1402 Ga0496109_0461773 3300048912 Bacteria 1199
1403 Ga0496109_0499572 3300048912 Bacteria 1148
1404 Ga0496110_0000132 3300048913 Bacteria 42838
1405 Ga0496110_0001649 3300048913 Bacteria 16372
1406 Ga0496110_0023225 3300048913 Bacteria 5273
1407 Ga0496110_0032219 3300048913 Bacteria 4525
1408 Ga0496110_0044264 3300048913 Bacteria 3887
1409 Ga0496110_0593956 3300048913 Bacteria 1005
1410 Ga0496111_0005129 3300048914 Bacteria 8345
1411 Ga0496111_0015170 3300048914 Bacteria 5281
1412 Ga0496111_0022981 3300048914 Bacteria 4372
1413 Ga0496111_0128642 3300048914 Bacteria 1873
1414 Ga0496112_0000242 3300048915 Bacteria 35031
1415 Ga0496112_0001463 3300048915 Bacteria 18136
1416 Ga0496112_0013529 3300048915 Bacteria 7537
1417 Ga0496112_0055210 3300048915 Bacteria 3905
1418 Ga0496112_0072781 3300048915 Bacteria 3398
1419 Ga0496112_0346863 3300048915 Bacteria 1427
1420 Ga0496113_0002738 3300048916 Bacteria 10360
1421 Ga0496113_0020713 3300048916 Bacteria 4629
1422 Ga0496113_0022273 3300048916 Bacteria 4479
1423 Ga0496113_0029624 3300048916 Bacteria 3956
1424 Ga0496113_0130800 3300048916 Bacteria 1969
1425 Ga0496114_0000016 3300048917 Bacteria 274656
1426 Ga0496114_0008376 3300048917 Bacteria 8190
1427 Ga0496114_0152070 3300048917 Bacteria 2008
1428 Ga0496115_0000618 3300048918 Bacteria 26985
1429 Ga0496115_0025147 3300048918 Bacteria 4634
1430 Ga0496121_0000163 3300048924 Bacteria 145648
1431 Ga0496125_0055351 3300048928 Bacteria 3233
1432 Ga0496126_0566048 3300048929 Bacteria 900
1433 Ga0501073_0236262 3300049589 Bacteria 1262
1434 Ga0501216_033695 3300049660 Bacteria 956
1435 Ga0501217_022487 3300049661 Bacteria 1496
1436 Ga0501223_000135 3300049663 Bacteria 20935
1437 Ga0501223_008623 3300049663 Bacteria 2076
1438 Ga0501224_000042 3300049664 Bacteria 22403
1439 Ga0501233_001241 3300049668 Bacteria 4345
1440 Ga0501235_017624 3300049669 Bacteria 1580
1441 Ga0501235_043154 3300049669 Bacteria 1034
1442 Ga0501240_009400 3300049673 Bacteria 1276
1443 Ga0501247_021333 3300049677 Bacteria 842
1444 Ga0501253_043504 3300049683 Bacteria 915
1445 Ga0501257_057868 3300049686 Bacteria 976
1446 Ga0501258_002161 3300049687 Bacteria 1700
1447 Ga0501219_009344 3300049703 Bacteria 725
1448 Ga0501225_0000134 3300049705 Bacteria 22398
1449 Ga0501234_004329 3300049707 Bacteria 2229
1450 Ga0501080_0036442 3300049742 Bacteria 4591
1451 Ga0501272_006805 3300049769 Bacteria 1228
1452 Ga0501044_0583014 3300049823 Bacteria 1013
1453 Ga0501226_000099 3300049853 Bacteria 21088
1454 nmdc:mga0k408_71565_c1 3300050493 Bacteria 2024
1455 nmdc:mga0rr50_707860_c1 3300050513 Bacteria 859
1456 nmdc:mga0a205_42162_c1 3300050515 Bacteria 4397
1457 Ga0500643_001114 3300053087 Bacteria 16085
1458 Ga0500646_0141250 3300053090 Bacteria 790
1459 Ga0500647_0158975 3300053091 Bacteria 1050
1460 Ga0500641_0211671 3300053096 Bacteria 824
1461 Ga0500597_023049 3300053120 Bacteria 2484
1462 Ga0500658_0000032 3300053134 Bacteria 90863
1463 Ga0500658_0002496 3300053134 Bacteria 7117
1464 Ga0500559_0300949 3300053136 Bacteria 753
1465 Ga0500624_000003 3300053157 Bacteria 253364
1466 Ga0500637_0000038 3300053178 Bacteria 47386
1467 Ga0590075_045138 3300059424 Bacteria 1129
1468 Ga0466962_0004684 3300061719 Bacteria 6569
1469 Ga0466962_0005622 3300061719 Bacteria 6022
1470 Ga0466962_0017163 3300061719 Bacteria 3488
1471 Ga0466962_0029300 3300061719 Bacteria 2635
1472 Ga0466962_0076366 3300061719 Bacteria 1601

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10001406 Ga0213875_100014061 177
2 3300037853 Ga0436364_0007919 Ga0436364_0007919_12068_12673 177
3 3300039437 Ga0436365_0229933 Ga0436365_0229933_114_722 178
4 3300025933 Ga0207706_10098317 Ga0207706_100983172 179
5 3300025986 Ga0207658_10730913 Ga0207658_107309132 179
6 3300042005 Ga0439448_0144592 Ga0439448_0144592_250_789 179
7 3300025932 Ga0207690_10112637 Ga0207690_101126373 180
8 3300025942 Ga0207689_10581574 Ga0207689_105815742 182
9 3300046460 Ga0495638_0000402 Ga0495638_0000402_14110_14718 182
10 3300046507 Ga0495606_0184866 Ga0495606_0184866_443_1051 182
11 3300046525 Ga0495663_0004481 Ga0495663_0004481_1684_2292 182
12 3300046660 Ga0495625_0138908 Ga0495625_0138908_632_1240 182
13 3300047472 Ga0495686_0013368 Ga0495686_0013368_4666_5274 182
14 3300048929 Ga0496126_0566048 Ga0496126_0566048_125_733 182
15 3300053087 Ga0500643_001114 Ga0500643_001114_10028_10642 182
16 3300053134 Ga0500658_0002496 Ga0500658_0002496_2031_2639 182
17 3300037471 Ga0395905_0007948 Ga0395905_0007948_5185_5790 186
18 3300048907 Ga0496104_0224390 Ga0496104_0224390_745_1305 186
19 3300005328 Ga0070676_10155888 Ga0070676_101558882 188
20 3300005435 Ga0070714_100158117 Ga0070714_1001581172 188
21 3300013100 Ga0157373_10276281 Ga0157373_102762812 188
22 3300025907 Ga0207645_10055410 Ga0207645_100554104 188
23 3300025929 Ga0207664_10196556 Ga0207664_101965562 188
24 3300005547 Ga0070693_100018195 Ga0070693_1000181952 189
25 3300005564 Ga0070664_100049763 Ga0070664_1000497632 192
26 3300005577 Ga0068857_100021196 Ga0068857_1000211965 192
27 3300005844 Ga0068862_100180275 Ga0068862_1001802752 192
28 3300009177 Ga0105248_10077298 Ga0105248_100772984 192
29 3300011119 Ga0105246_10013975 Ga0105246_100139755 192
30 3300013308 Ga0157375_10580725 Ga0157375_105807252 192
31 3300025918 Ga0207662_10158594 Ga0207662_101585942 192
32 3300025933 Ga0207706_10061628 Ga0207706_100616282 192
33 3300025945 Ga0207679_10019294 Ga0207679_100192942 192
34 3300025960 Ga0207651_10937429 Ga0207651_109374292 192
35 3300026067 Ga0207678_10153210 Ga0207678_101532102 192
36 3300037418 Ga0395900_0401727 Ga0395900_0401727_131_736 192
37 3300038443 Ga0395901_1206039 Ga0395901_1206039_52_657 192
38 3300005530 Ga0070679_100844813 Ga0070679_1008448132 193
39 3300005578 Ga0068854_100024402 Ga0068854_1000244025 193
40 3300025921 Ga0207652_11003670 Ga0207652_110036701 193
41 3300025932 Ga0207690_10627384 Ga0207690_106273842 193
42 3300006358 Ga0068871_100880847 Ga0068871_1008808472 194
43 3300049589 Ga0501073_0236262 Ga0501073_0236262_376_963 194
44 3300005336 Ga0070680_100000958 Ga0070680_10000095812 196
45 3300005458 Ga0070681_10210803 Ga0070681_102108032 196
46 3300005530 Ga0070679_100000001 Ga0070679_100000001126 196
47 3300001989 JGI24739J22299_10049217 JGI24739J22299_100492172 197
48 3300001990 JGI24737J22298_10062968 JGI24737J22298_100629682 197
49 3300002075 JGI24738J21930_10018700 JGI24738J21930_100187002 197
50 3300005293 Ga0065715_10020566 Ga0065715_100205662 197
51 3300005328 Ga0070676_10039319 Ga0070676_100393193 197
52 3300005330 Ga0070690_100920702 Ga0070690_1009207021 197
53 3300005331 Ga0070670_100009473 Ga0070670_1000094738 197
54 3300005338 Ga0068868_100100287 Ga0068868_1001002872 197
55 3300005338 Ga0068868_100141466 Ga0068868_1001414662 197
56 3300005343 Ga0070687_100111864 Ga0070687_1001118642 197
57 3300005344 Ga0070661_100306370 Ga0070661_1003063702 197
58 3300005344 Ga0070661_100442730 Ga0070661_1004427302 197
59 3300005354 Ga0070675_100020764 Ga0070675_1000207644 197
60 3300005354 Ga0070675_100190175 Ga0070675_1001901752 197
61 3300005355 Ga0070671_100214073 Ga0070671_1002140732 197
62 3300005356 Ga0070674_100119087 Ga0070674_1001190873 197
63 3300005366 Ga0070659_100134481 Ga0070659_1001344812 197
64 3300005456 Ga0070678_100043488 Ga0070678_1000434882 197
65 3300005456 Ga0070678_100105276 Ga0070678_1001052762 197
66 3300005457 Ga0070662_100063706 Ga0070662_1000637062 197
67 3300005459 Ga0068867_100448633 Ga0068867_1004486332 197
68 3300005466 Ga0070685_10067028 Ga0070685_100670283 197
69 3300005539 Ga0068853_100810836 Ga0068853_1008108362 197
70 3300005543 Ga0070672_100027432 Ga0070672_1000274322 197
71 3300005548 Ga0070665_100003665 Ga0070665_10000366515 197
72 3300005564 Ga0070664_100021506 Ga0070664_1000215063 197
73 3300005564 Ga0070664_100333645 Ga0070664_1003336451 197
74 3300005578 Ga0068854_100880566 Ga0068854_1008805662 197
75 3300005616 Ga0068852_100489834 Ga0068852_1004898342 197
76 3300005618 Ga0068864_100034386 Ga0068864_1000343862 197
77 3300005840 Ga0068870_10239037 Ga0068870_102390371 197
78 3300005840 Ga0068870_10274292 Ga0068870_102742922 197
79 3300005842 Ga0068858_101159738 Ga0068858_1011597381 197
80 3300009177 Ga0105248_10170769 Ga0105248_101707693 197
81 3300011119 Ga0105246_10152456 Ga0105246_101524562 197
82 3300013100 Ga0157373_10395855 Ga0157373_103958552 197
83 3300013296 Ga0157374_10062443 Ga0157374_100624432 197
84 3300013306 Ga0163162_10013507 Ga0163162_100135073 197
85 3300013308 Ga0157375_10005251 Ga0157375_100052516 197
86 3300014969 Ga0157376_10069220 Ga0157376_100692202 197
87 3300025315 Ga0207697_10009852 Ga0207697_100098525 197
88 3300025901 Ga0207688_10012958 Ga0207688_100129585 197
89 3300025908 Ga0207643_10289546 Ga0207643_102895462 197
90 3300025908 Ga0207643_10325012 Ga0207643_103250122 197
91 3300025918 Ga0207662_10231953 Ga0207662_102319532 197
92 3300025919 Ga0207657_10089600 Ga0207657_100896002 197
93 3300025920 Ga0207649_10141485 Ga0207649_101414853 197
94 3300025923 Ga0207681_10014345 Ga0207681_100143452 197
95 3300025925 Ga0207650_10008503 Ga0207650_100085032 197
96 3300025926 Ga0207659_10103816 Ga0207659_101038162 197
97 3300025926 Ga0207659_10124791 Ga0207659_101247911 197
98 3300025927 Ga0207687_10387260 Ga0207687_103872602 197
99 3300025932 Ga0207690_10136888 Ga0207690_101368882 197
100 3300025933 Ga0207706_10030051 Ga0207706_100300516 197
101 3300025933 Ga0207706_10068017 Ga0207706_100680173 197
102 3300025937 Ga0207669_10026389 Ga0207669_100263894 197
103 3300025940 Ga0207691_10068974 Ga0207691_100689743 197
104 3300025941 Ga0207711_10292154 Ga0207711_102921542 197
105 3300025942 Ga0207689_10052167 Ga0207689_100521672 197
106 3300025945 Ga0207679_10007760 Ga0207679_100077605 197
107 3300025945 Ga0207679_10055729 Ga0207679_100557293 197
108 3300025945 Ga0207679_10200893 Ga0207679_102008933 197
109 3300025949 Ga0207667_10093640 Ga0207667_100936404 197
110 3300025960 Ga0207651_10040444 Ga0207651_100404442 197
111 3300025960 Ga0207651_10069526 Ga0207651_100695264 197
112 3300025960 Ga0207651_10759023 Ga0207651_107590231 197
113 3300025981 Ga0207640_10060515 Ga0207640_100605153 197
114 3300025986 Ga0207658_10013911 Ga0207658_100139115 197
115 3300026023 Ga0207677_10049998 Ga0207677_100499984 197
116 3300026089 Ga0207648_10022543 Ga0207648_100225432 197
117 3300026095 Ga0207676_10048814 Ga0207676_100488144 197
118 3300026118 Ga0207675_100404301 Ga0207675_1004043012 197
119 3300026121 Ga0207683_10005768 Ga0207683_100057689 197
120 3300026121 Ga0207683_10089891 Ga0207683_100898912 197
121 3300026142 Ga0207698_10110105 Ga0207698_101101052 197
122 3300026142 Ga0207698_10309331 Ga0207698_103093312 197
123 3300028379 Ga0268266_10015404 Ga0268266_100154046 197
124 3300037312 Ga0395899_0024186 Ga0395899_0024186_1083_1676 197
125 3300037466 Ga0395898_0326758 Ga0395898_0326758_764_1357 197
126 3300037471 Ga0395905_0460845 Ga0395905_0460845_371_964 197
127 3300048909 Ga0496106_0936398 Ga0496106_0936398_69_662 197
128 3300048915 Ga0496112_0055210 Ga0496112_0055210_3203_3796 197
129 iso_pu_bacteria 2830075706 2830075990 197
130 3300053091 Ga0500647_0158975 Ga0500647_0158975_44_646 199
131 3300010375 Ga0105239_10681708 Ga0105239_106817082 200
132 3300025918 Ga0207662_10443558 Ga0207662_104435581 200
133 3300031824 Ga0307413_10121479 Ga0307413_101214792 200
134 3300031852 Ga0307410_10024252 Ga0307410_100242523 200
135 3300031995 Ga0307409_100010549 Ga0307409_1000105496 200
136 3300032004 Ga0307414_10027528 Ga0307414_100275282 200
137 3300032005 Ga0307411_10050336 Ga0307411_100503362 200
138 3300042004 Ga0439445_0007270 Ga0439445_0007270_1274_1876 200
139 3300046524 Ga0495648_0147649 Ga0495648_0147649_257_865 200
140 3300046557 Ga0495622_0003839 Ga0495622_0003839_4489_5097 200
141 3300046558 Ga0495633_0126010 Ga0495633_0126010_479_1087 200
142 3300046692 Ga0495671_0028117 Ga0495671_0028117_1367_1975 200
143 3300048928 Ga0496125_0055351 Ga0496125_0055351_533_1144 200
144 3300049823 Ga0501044_0583014 Ga0501044_0583014_18_626 200
145 3300053096 Ga0500641_0211671 Ga0500641_0211671_189_797 200
146 3300001990 JGI24737J22298_10003796 JGI24737J22298_100037964 201
147 3300002067 JGI24735J21928_10111022 JGI24735J21928_101110222 201
148 3300005290 Ga0065712_10034447 Ga0065712_100344471 201
149 3300005327 Ga0070658_10444987 Ga0070658_104449871 201
150 3300005327 Ga0070658_10595028 Ga0070658_105950282 201
151 3300005327 Ga0070658_10685197 Ga0070658_106851971 201
152 3300005328 Ga0070676_10044553 Ga0070676_100445533 201
153 3300005331 Ga0070670_100444298 Ga0070670_1004442982 201
154 3300005333 Ga0070677_10024881 Ga0070677_100248812 201
155 3300005334 Ga0068869_100511894 Ga0068869_1005118942 201
156 3300005336 Ga0070680_100626488 Ga0070680_1006264881 201
157 3300005339 Ga0070660_100351772 Ga0070660_1003517721 201
158 3300005353 Ga0070669_100027300 Ga0070669_1000273004 201
159 3300005355 Ga0070671_100042117 Ga0070671_1000421173 201
160 3300005364 Ga0070673_100323919 Ga0070673_1003239192 201
161 3300005366 Ga0070659_100025802 Ga0070659_1000258025 201
162 3300005366 Ga0070659_100104608 Ga0070659_1001046081 201
163 3300005366 Ga0070659_100684772 Ga0070659_1006847721 201
164 3300005435 Ga0070714_100064364 Ga0070714_1000643642 201
165 3300005455 Ga0070663_100514515 Ga0070663_1005145152 201
166 3300005457 Ga0070662_100510131 Ga0070662_1005101312 201
167 3300005530 Ga0070679_100188060 Ga0070679_1001880602 201
168 3300005539 Ga0068853_100621606 Ga0068853_1006216062 201
169 3300005543 Ga0070672_100430338 Ga0070672_1004303382 201
170 3300005564 Ga0070664_100003451 Ga0070664_1000034516 201
171 3300005564 Ga0070664_100068793 Ga0070664_1000687932 201
172 3300005577 Ga0068857_100008327 Ga0068857_1000083276 201
173 3300005578 Ga0068854_100795549 Ga0068854_1007955492 201
174 3300005618 Ga0068864_100635313 Ga0068864_1006353131 201
175 3300005841 Ga0068863_100000823 Ga0068863_10000082327 201
176 3300005841 Ga0068863_100014473 Ga0068863_1000144732 201
177 3300005843 Ga0068860_100055225 Ga0068860_1000552252 201
178 3300005844 Ga0068862_100229728 Ga0068862_1002297282 201
179 3300006931 Ga0097620_100044294 Ga0097620_1000442945 201
180 3300013105 Ga0157369_10606074 Ga0157369_106060742 201
181 3300013297 Ga0157378_10039006 Ga0157378_100390065 201
182 3300013306 Ga0163162_11602884 Ga0163162_116028841 201
183 3300013307 Ga0157372_11093934 Ga0157372_110939342 201
184 3300013307 Ga0157372_11192994 Ga0157372_111929941 201
185 3300014325 Ga0163163_10037220 Ga0163163_100372205 201
186 3300017792 Ga0163161_10804823 Ga0163161_108048232 201
187 3300025893 Ga0207682_10059860 Ga0207682_100598602 201
188 3300025893 Ga0207682_10189538 Ga0207682_101895382 201
189 3300025901 Ga0207688_10117116 Ga0207688_101171162 201
190 3300025904 Ga0207647_10068178 Ga0207647_100681782 201
191 3300025907 Ga0207645_10005404 Ga0207645_1000540413 201
192 3300025907 Ga0207645_10086631 Ga0207645_100866311 201
193 3300025909 Ga0207705_10041136 Ga0207705_100411362 201
194 3300025909 Ga0207705_10080278 Ga0207705_100802782 201
195 3300025923 Ga0207681_10070809 Ga0207681_100708091 201
196 3300025923 Ga0207681_10206218 Ga0207681_102062182 201
197 3300025923 Ga0207681_10677981 Ga0207681_106779812 201
198 3300025925 Ga0207650_10233082 Ga0207650_102330822 201
199 3300025929 Ga0207664_10652066 Ga0207664_106520662 201
200 3300025931 Ga0207644_10023425 Ga0207644_100234252 201
201 3300025933 Ga0207706_10167671 Ga0207706_101676712 201
202 3300025935 Ga0207709_10364671 Ga0207709_103646712 201
203 3300025936 Ga0207670_10366802 Ga0207670_103668022 201
204 3300025942 Ga0207689_10075601 Ga0207689_100756014 201
205 3300025942 Ga0207689_10627362 Ga0207689_106273622 201
206 3300025945 Ga0207679_10004233 Ga0207679_100042338 201
207 3300025960 Ga0207651_10043007 Ga0207651_100430072 201
208 3300026067 Ga0207678_10013114 Ga0207678_100131145 201
209 3300026095 Ga0207676_10167667 Ga0207676_101676672 201
210 3300026095 Ga0207676_10361405 Ga0207676_103614052 201
211 3300026116 Ga0207674_10001184 Ga0207674_1000118414 201
212 3300026116 Ga0207674_10017887 Ga0207674_100178874 201
213 3300026116 Ga0207674_10318448 Ga0207674_103184482 201
214 3300028380 Ga0268265_10183742 Ga0268265_101837422 201
215 3300028381 Ga0268264_10150632 Ga0268264_101506322 201
216 3300031548 Ga0307408_100036299 Ga0307408_1000362992 201
217 3300031548 Ga0307408_100392479 Ga0307408_1003924792 201
218 3300031548 Ga0307408_100403964 Ga0307408_1004039642 201
219 3300031731 Ga0307405_10080849 Ga0307405_100808491 201
220 3300031731 Ga0307405_10550678 Ga0307405_105506781 201
221 3300031824 Ga0307413_10060861 Ga0307413_100608612 201
222 3300031824 Ga0307413_10115193 Ga0307413_101151932 201
223 3300031852 Ga0307410_10036295 Ga0307410_100362952 201
224 3300031852 Ga0307410_10065499 Ga0307410_100654992 201
225 3300031852 Ga0307410_10074793 Ga0307410_100747933 201
226 3300031852 Ga0307410_10344031 Ga0307410_103440312 201
227 3300031852 Ga0307410_10457109 Ga0307410_104571092 201
228 3300031852 Ga0307410_10692178 Ga0307410_106921781 201
229 3300031901 Ga0307406_10011830 Ga0307406_100118304 201
230 3300031901 Ga0307406_10014646 Ga0307406_100146465 201
231 3300031901 Ga0307406_10215456 Ga0307406_102154561 201
232 3300031903 Ga0307407_10012647 Ga0307407_100126475 201
233 3300031903 Ga0307407_10198917 Ga0307407_101989172 201
234 3300031911 Ga0307412_10045061 Ga0307412_100450612 201
235 3300031911 Ga0307412_10128072 Ga0307412_101280722 201
236 3300031911 Ga0307412_10181540 Ga0307412_101815402 201
237 3300031911 Ga0307412_10291990 Ga0307412_102919902 201
238 3300031995 Ga0307409_100076692 Ga0307409_1000766922 201
239 3300031995 Ga0307409_100159292 Ga0307409_1001592922 201
240 3300031995 Ga0307409_100173582 Ga0307409_1001735823 201
241 3300031995 Ga0307409_100196560 Ga0307409_1001965602 201
242 3300031995 Ga0307409_100814970 Ga0307409_1008149702 201
243 3300031995 Ga0307409_101076345 Ga0307409_1010763451 201
244 3300032002 Ga0307416_100024627 Ga0307416_1000246273 201
245 3300032002 Ga0307416_100062436 Ga0307416_1000624365 201
246 3300032002 Ga0307416_100398969 Ga0307416_1003989691 201
247 3300032004 Ga0307414_10029219 Ga0307414_100292195 201
248 3300032004 Ga0307414_10034367 Ga0307414_100343674 201
249 3300032004 Ga0307414_10073518 Ga0307414_100735182 201
250 3300032004 Ga0307414_10489437 Ga0307414_104894372 201
251 3300032004 Ga0307414_10558424 Ga0307414_105584242 201
252 3300032004 Ga0307414_10567912 Ga0307414_105679121 201
253 3300032004 Ga0307414_10582363 Ga0307414_105823631 201
254 3300032004 Ga0307414_10629129 Ga0307414_106291292 201
255 3300032004 Ga0307414_11230992 Ga0307414_112309921 201
256 3300032005 Ga0307411_10116365 Ga0307411_101163652 201
257 3300032005 Ga0307411_10132255 Ga0307411_101322552 201
258 3300032005 Ga0307411_10229282 Ga0307411_102292822 201
259 3300032126 Ga0307415_100091323 Ga0307415_1000913233 201
260 3300032126 Ga0307415_100157309 Ga0307415_1001573091 201
261 3300032126 Ga0307415_100309318 Ga0307415_1003093182 201
262 3300037312 Ga0395899_0025940 Ga0395899_0025940_612_1217 201
263 3300037312 Ga0395899_0066901 Ga0395899_0066901_456_1061 201
264 3300037312 Ga0395899_0084784 Ga0395899_0084784_223_828 201
265 3300037312 Ga0395899_0096924 Ga0395899_0096924_469_1074 201
266 3300037312 Ga0395899_0210709 Ga0395899_0210709_129_734 201
267 3300037312 Ga0395899_0431101 Ga0395899_0431101_39_644 201
268 3300037312 Ga0395899_0550280 Ga0395899_0550280_116_721 201
269 3300037418 Ga0395900_0017673 Ga0395900_0017673_888_1493 201
270 3300037418 Ga0395900_0061099 Ga0395900_0061099_1832_2437 201
271 3300037418 Ga0395900_0088941 Ga0395900_0088941_737_1342 201
272 3300037418 Ga0395900_0194342 Ga0395900_0194342_111_716 201
273 3300037418 Ga0395900_0273463 Ga0395900_0273463_664_1269 201
274 3300037418 Ga0395900_0273957 Ga0395900_0273957_840_1445 201
275 3300037418 Ga0395900_0309126 Ga0395900_0309126_863_1468 201
276 3300037418 Ga0395900_0377813 Ga0395900_0377813_189_794 201
277 3300037418 Ga0395900_0923094 Ga0395900_0923094_45_650 201
278 3300037466 Ga0395898_0082820 Ga0395898_0082820_61_666 201
279 3300037466 Ga0395898_0101153 Ga0395898_0101153_1547_2152 201
280 3300037466 Ga0395898_0193635 Ga0395898_0193635_1195_1800 201
281 3300037466 Ga0395898_0213961 Ga0395898_0213961_87_692 201
282 3300037466 Ga0395898_0220426 Ga0395898_0220426_1057_1662 201
283 3300037466 Ga0395898_0257539 Ga0395898_0257539_815_1420 201
284 3300037466 Ga0395898_0446700 Ga0395898_0446700_485_1090 201
285 3300037466 Ga0395898_1086702 Ga0395898_1086702_42_647 201
286 3300037471 Ga0395905_0001572 Ga0395905_0001572_23650_24255 201
287 3300037471 Ga0395905_0008923 Ga0395905_0008923_5278_5883 201
288 3300037471 Ga0395905_0015579 Ga0395905_0015579_3241_3846 201
289 3300037471 Ga0395905_0089835 Ga0395905_0089835_890_1495 201
290 3300037471 Ga0395905_0174510 Ga0395905_0174510_746_1351 201
291 3300037471 Ga0395905_0232198 Ga0395905_0232198_1010_1615 201
292 3300037471 Ga0395905_0269393 Ga0395905_0269393_661_1266 201
293 3300037471 Ga0395905_0362324 Ga0395905_0362324_516_1121 201
294 3300037471 Ga0395905_0634349 Ga0395905_0634349_270_875 201
295 3300037471 Ga0395905_0692226 Ga0395905_0692226_153_758 201
296 3300037471 Ga0395905_0745736 Ga0395905_0745736_37_642 201
297 3300038443 Ga0395901_0028940 Ga0395901_0028940_826_1431 201
298 3300038443 Ga0395901_0030409 Ga0395901_0030409_3293_3898 201
299 3300038443 Ga0395901_0033790 Ga0395901_0033790_1695_2300 201
300 3300038443 Ga0395901_0057583 Ga0395901_0057583_476_1081 201
301 3300038443 Ga0395901_0232340 Ga0395901_0232340_211_822 201
302 3300038443 Ga0395901_0256173 Ga0395901_0256173_43_648 201
303 3300038443 Ga0395901_0357121 Ga0395901_0357121_163_768 201
304 3300038443 Ga0395901_0830993 Ga0395901_0830993_195_800 201
305 3300038443 Ga0395901_1054824 Ga0395901_1054824_163_768 201
306 3300042005 Ga0439448_0014567 Ga0439448_0014567_380_988 201
307 3300042012 Ga0439455_0010582 Ga0439455_0010582_124_732 201
308 3300042125 Ga0450923_055940 Ga0450923_055940_20_625 201
309 3300042157 Ga0439458_0000363 Ga0439458_0000363_5961_6569 201
310 3300042157 Ga0439458_0003767 Ga0439458_0003767_2814_3419 201
311 3300042157 Ga0439458_0015022 Ga0439458_0015022_367_972 201
312 3300044656 Ga0466969_0229495 Ga0466969_0229495_133_738 201
313 3300044683 Ga0466965_0075193 Ga0466965_0075193_431_1036 201
314 3300044694 Ga0466963_0451404 Ga0466963_0451404_58_663 201
315 3300045836 Ga0466958_0135617 Ga0466958_0135617_197_802 201
316 3300045976 Ga0466967_0077292 Ga0466967_0077292_1321_1932 201
317 3300046684 Ga0495669_0023888 Ga0495669_0023888_1392_1997 201
318 3300048910 Ga0496107_0026570 Ga0496107_0026570_677_1282 201
319 3300048912 Ga0496109_0499572 Ga0496109_0499572_255_860 201
320 3300048916 Ga0496113_0002738 Ga0496113_0002738_1163_1768 201
321 3300048924 Ga0496121_0000163 Ga0496121_0000163_80882_81505 201
322 3300049660 Ga0501216_033695 Ga0501216_033695_36_641 201
323 3300049661 Ga0501217_022487 Ga0501217_022487_569_1174 201
324 3300049663 Ga0501223_008623 Ga0501223_008623_20_625 201
325 3300049669 Ga0501235_017624 Ga0501235_017624_562_1167 201
326 3300049673 Ga0501240_009400 Ga0501240_009400_265_870 201
327 3300049677 Ga0501247_021333 Ga0501247_021333_41_646 201
328 3300049683 Ga0501253_043504 Ga0501253_043504_294_899 201
329 3300049686 Ga0501257_057868 Ga0501257_057868_287_892 201
330 3300049687 Ga0501258_002161 Ga0501258_002161_32_637 201
331 3300049703 Ga0501219_009344 Ga0501219_009344_66_671 201
332 3300049707 Ga0501234_004329 Ga0501234_004329_1268_1873 201
333 3300049769 Ga0501272_006805 Ga0501272_006805_59_664 201
334 3300050493 nmdc:mga0k408_71565_c1 nmdc:mga0k408_71565_c1_1265_1870 201
335 3300059424 Ga0590075_045138 Ga0590075_045138_408_1013 201
336 3300001904 JGI24736J21556_1042470 JGI24736J21556_10424701 202
337 3300001915 JGI24741J21665_1011469 JGI24741J21665_10114692 202
338 3300001915 JGI24741J21665_1019648 JGI24741J21665_10196481 202
339 3300001976 JGI24752J21851_1010035 JGI24752J21851_10100352 202
340 3300001979 JGI24740J21852_10000554 JGI24740J21852_100005546 202
341 3300001979 JGI24740J21852_10013366 JGI24740J21852_100133664 202
342 3300001989 JGI24739J22299_10000237 JGI24739J22299_1000023722 202
343 3300001990 JGI24737J22298_10000061 JGI24737J22298_1000006119 202
344 3300001990 JGI24737J22298_10002804 JGI24737J22298_100028045 202
345 3300001990 JGI24737J22298_10003327 JGI24737J22298_100033271 202
346 3300001990 JGI24737J22298_10070255 JGI24737J22298_100702552 202
347 3300001990 JGI24737J22298_10131123 JGI24737J22298_101311231 202
348 3300001991 JGI24743J22301_10020642 JGI24743J22301_100206422 202
349 3300002067 JGI24735J21928_10030339 JGI24735J21928_100303391 202
350 3300002067 JGI24735J21928_10087326 JGI24735J21928_100873261 202
351 3300002075 JGI24738J21930_10000146 JGI24738J21930_1000014619 202
352 3300005290 Ga0065712_10145831 Ga0065712_101458312 202
353 3300005327 Ga0070658_10017589 Ga0070658_100175895 202
354 3300005327 Ga0070658_10021897 Ga0070658_100218974 202
355 3300005327 Ga0070658_10023865 Ga0070658_100238656 202
356 3300005327 Ga0070658_10039281 Ga0070658_100392815 202
357 3300005327 Ga0070658_10053296 Ga0070658_100532964 202
358 3300005327 Ga0070658_10067751 Ga0070658_100677512 202
359 3300005327 Ga0070658_10117370 Ga0070658_101173702 202
360 3300005327 Ga0070658_10156140 Ga0070658_101561402 202
361 3300005327 Ga0070658_10181586 Ga0070658_101815862 202
362 3300005327 Ga0070658_10188578 Ga0070658_101885781 202
363 3300005327 Ga0070658_10384534 Ga0070658_103845342 202
364 3300005327 Ga0070658_10627048 Ga0070658_106270481 202
365 3300005327 Ga0070658_11065821 Ga0070658_110658211 202
366 3300005328 Ga0070676_10002544 Ga0070676_100025442 202
367 3300005328 Ga0070676_10023349 Ga0070676_100233493 202
368 3300005328 Ga0070676_10045623 Ga0070676_100456232 202
369 3300005328 Ga0070676_10525139 Ga0070676_105251391 202
370 3300005329 Ga0070683_100001658 Ga0070683_1000016582 202
371 3300005329 Ga0070683_100001823 Ga0070683_10000182318 202
372 3300005329 Ga0070683_100028420 Ga0070683_1000284204 202
373 3300005329 Ga0070683_100065110 Ga0070683_1000651102 202
374 3300005329 Ga0070683_100217714 Ga0070683_1002177142 202
375 3300005330 Ga0070690_100003412 Ga0070690_1000034125 202
376 3300005330 Ga0070690_100055943 Ga0070690_1000559432 202
377 3300005331 Ga0070670_100035510 Ga0070670_1000355103 202
378 3300005331 Ga0070670_100038046 Ga0070670_1000380464 202
379 3300005331 Ga0070670_100041176 Ga0070670_1000411764 202
380 3300005331 Ga0070670_100186706 Ga0070670_1001867062 202
381 3300005331 Ga0070670_100396545 Ga0070670_1003965452 202
382 3300005333 Ga0070677_10100182 Ga0070677_101001822 202
383 3300005334 Ga0068869_100000493 Ga0068869_1000004936 202
384 3300005334 Ga0068869_100152153 Ga0068869_1001521532 202
385 3300005335 Ga0070666_10000310 Ga0070666_1000031018 202
386 3300005335 Ga0070666_10021897 Ga0070666_100218972 202
387 3300005335 Ga0070666_10032872 Ga0070666_100328725 202
388 3300005335 Ga0070666_10134434 Ga0070666_101344342 202
389 3300005336 Ga0070680_100001306 Ga0070680_10000130613 202
390 3300005336 Ga0070680_100021826 Ga0070680_1000218266 202
391 3300005336 Ga0070680_100024024 Ga0070680_1000240242 202
392 3300005336 Ga0070680_100642075 Ga0070680_1006420752 202
393 3300005337 Ga0070682_100082315 Ga0070682_1000823151 202
394 3300005337 Ga0070682_100735759 Ga0070682_1007357592 202
395 3300005338 Ga0068868_100009873 Ga0068868_1000098734 202
396 3300005338 Ga0068868_100033902 Ga0068868_1000339024 202
397 3300005338 Ga0068868_100248740 Ga0068868_1002487402 202
398 3300005338 Ga0068868_100279854 Ga0068868_1002798542 202
399 3300005338 Ga0068868_100423599 Ga0068868_1004235992 202
400 3300005338 Ga0068868_100437620 Ga0068868_1004376202 202
401 3300005338 Ga0068868_100495680 Ga0068868_1004956802 202
402 3300005339 Ga0070660_100000393 Ga0070660_10000039324 202
403 3300005339 Ga0070660_100002280 Ga0070660_1000022808 202
404 3300005339 Ga0070660_100003937 Ga0070660_10000393712 202
405 3300005339 Ga0070660_100005463 Ga0070660_1000054636 202
406 3300005339 Ga0070660_100023648 Ga0070660_1000236484 202
407 3300005339 Ga0070660_100028115 Ga0070660_1000281152 202
408 3300005339 Ga0070660_100038834 Ga0070660_1000388345 202
409 3300005339 Ga0070660_100089592 Ga0070660_1000895922 202
410 3300005339 Ga0070660_100098760 Ga0070660_1000987601 202
411 3300005339 Ga0070660_100121986 Ga0070660_1001219863 202
412 3300005339 Ga0070660_100127923 Ga0070660_1001279232 202
413 3300005339 Ga0070660_100273793 Ga0070660_1002737932 202
414 3300005339 Ga0070660_100318123 Ga0070660_1003181232 202
415 3300005339 Ga0070660_100343726 Ga0070660_1003437262 202
416 3300005339 Ga0070660_100628948 Ga0070660_1006289482 202
417 3300005339 Ga0070660_100798484 Ga0070660_1007984841 202
418 3300005339 Ga0070660_100820966 Ga0070660_1008209661 202
419 3300005339 Ga0070660_100937614 Ga0070660_1009376141 202
420 3300005340 Ga0070689_100186292 Ga0070689_1001862922 202
421 3300005344 Ga0070661_100019646 Ga0070661_1000196465 202
422 3300005344 Ga0070661_100029190 Ga0070661_1000291903 202
423 3300005344 Ga0070661_100032544 Ga0070661_1000325442 202
424 3300005344 Ga0070661_100044151 Ga0070661_1000441512 202
425 3300005344 Ga0070661_100048864 Ga0070661_1000488643 202
426 3300005344 Ga0070661_100052164 Ga0070661_1000521643 202
427 3300005344 Ga0070661_100078263 Ga0070661_1000782634 202
428 3300005344 Ga0070661_100111625 Ga0070661_1001116252 202
429 3300005344 Ga0070661_100232404 Ga0070661_1002324042 202
430 3300005344 Ga0070661_100238067 Ga0070661_1002380672 202
431 3300005344 Ga0070661_100252692 Ga0070661_1002526922 202
432 3300005344 Ga0070661_100588603 Ga0070661_1005886032 202
433 3300005345 Ga0070692_10005785 Ga0070692_100057852 202
434 3300005345 Ga0070692_10141282 Ga0070692_101412822 202
435 3300005345 Ga0070692_10475130 Ga0070692_104751301 202
436 3300005347 Ga0070668_100001945 Ga0070668_1000019458 202
437 3300005347 Ga0070668_100006904 Ga0070668_1000069042 202
438 3300005347 Ga0070668_100190030 Ga0070668_1001900302 202
439 3300005347 Ga0070668_100199082 Ga0070668_1001990822 202
440 3300005347 Ga0070668_100463232 Ga0070668_1004632322 202
441 3300005347 Ga0070668_100501718 Ga0070668_1005017181 202
442 3300005353 Ga0070669_100000532 Ga0070669_10000053214 202
443 3300005353 Ga0070669_100062653 Ga0070669_1000626532 202
444 3300005353 Ga0070669_100071452 Ga0070669_1000714524 202
445 3300005353 Ga0070669_100134791 Ga0070669_1001347912 202
446 3300005353 Ga0070669_100212886 Ga0070669_1002128861 202
447 3300005354 Ga0070675_100112106 Ga0070675_1001121062 202
448 3300005354 Ga0070675_100531338 Ga0070675_1005313381 202
449 3300005354 Ga0070675_100668336 Ga0070675_1006683361 202
450 3300005354 Ga0070675_100940898 Ga0070675_1009408981 202
451 3300005354 Ga0070675_100946478 Ga0070675_1009464781 202
452 3300005355 Ga0070671_100000539 Ga0070671_10000053912 202
453 3300005355 Ga0070671_100002550 Ga0070671_10000255011 202
454 3300005355 Ga0070671_100003074 Ga0070671_10000307414 202
455 3300005355 Ga0070671_100016185 Ga0070671_1000161852 202
456 3300005355 Ga0070671_100026869 Ga0070671_1000268694 202
457 3300005355 Ga0070671_100032270 Ga0070671_1000322705 202
458 3300005355 Ga0070671_100050903 Ga0070671_1000509034 202
459 3300005355 Ga0070671_100053548 Ga0070671_1000535482 202
460 3300005355 Ga0070671_100062437 Ga0070671_1000624372 202
461 3300005355 Ga0070671_100115568 Ga0070671_1001155682 202
462 3300005355 Ga0070671_100180199 Ga0070671_1001801992 202
463 3300005355 Ga0070671_100201057 Ga0070671_1002010572 202
464 3300005355 Ga0070671_100359329 Ga0070671_1003593291 202
465 3300005356 Ga0070674_100003566 Ga0070674_1000035664 202
466 3300005356 Ga0070674_100681879 Ga0070674_1006818791 202
467 3300005364 Ga0070673_100000058 Ga0070673_10000005841 202
468 3300005364 Ga0070673_100012087 Ga0070673_1000120876 202
469 3300005364 Ga0070673_100046028 Ga0070673_1000460281 202
470 3300005364 Ga0070673_100060327 Ga0070673_1000603272 202
471 3300005364 Ga0070673_100074397 Ga0070673_1000743973 202
472 3300005364 Ga0070673_100113693 Ga0070673_1001136932 202
473 3300005364 Ga0070673_100280687 Ga0070673_1002806872 202
474 3300005364 Ga0070673_100725899 Ga0070673_1007258991 202
475 3300005366 Ga0070659_100000564 Ga0070659_1000005644 202
476 3300005366 Ga0070659_100002195 Ga0070659_10000219512 202
477 3300005366 Ga0070659_100004781 Ga0070659_1000047817 202
478 3300005366 Ga0070659_100010127 Ga0070659_1000101272 202
479 3300005366 Ga0070659_100011224 Ga0070659_1000112241 202
480 3300005366 Ga0070659_100028544 Ga0070659_1000285442 202
481 3300005366 Ga0070659_100033959 Ga0070659_1000339595 202
482 3300005366 Ga0070659_100035593 Ga0070659_1000355931 202
483 3300005366 Ga0070659_100115699 Ga0070659_1001156992 202
484 3300005366 Ga0070659_100131281 Ga0070659_1001312812 202
485 3300005366 Ga0070659_100174552 Ga0070659_1001745522 202
486 3300005366 Ga0070659_100277579 Ga0070659_1002775792 202
487 3300005366 Ga0070659_100398942 Ga0070659_1003989422 202
488 3300005366 Ga0070659_100413615 Ga0070659_1004136152 202
489 3300005366 Ga0070659_100681747 Ga0070659_1006817471 202
490 3300005367 Ga0070667_100003138 Ga0070667_10000313814 202
491 3300005367 Ga0070667_100004233 Ga0070667_10000423314 202
492 3300005367 Ga0070667_100005598 Ga0070667_1000055983 202
493 3300005367 Ga0070667_100010390 Ga0070667_1000103907 202
494 3300005367 Ga0070667_100018968 Ga0070667_1000189685 202
495 3300005367 Ga0070667_100031834 Ga0070667_1000318342 202
496 3300005367 Ga0070667_100033987 Ga0070667_1000339874 202
497 3300005367 Ga0070667_100064440 Ga0070667_1000644402 202
498 3300005367 Ga0070667_100120142 Ga0070667_1001201422 202
499 3300005367 Ga0070667_100167494 Ga0070667_1001674942 202
500 3300005367 Ga0070667_101358638 Ga0070667_1013586381 202
501 3300005435 Ga0070714_100058647 Ga0070714_1000586472 202
502 3300005435 Ga0070714_100074579 Ga0070714_1000745792 202
503 3300005436 Ga0070713_100003292 Ga0070713_1000032928 202
504 3300005444 Ga0070694_100006264 Ga0070694_1000062643 202
505 3300005455 Ga0070663_100012256 Ga0070663_1000122565 202
506 3300005455 Ga0070663_100016552 Ga0070663_1000165526 202
507 3300005455 Ga0070663_100122000 Ga0070663_1001220002 202
508 3300005455 Ga0070663_100201660 Ga0070663_1002016602 202
509 3300005455 Ga0070663_100254250 Ga0070663_1002542502 202
510 3300005455 Ga0070663_100586929 Ga0070663_1005869291 202
511 3300005456 Ga0070678_100007681 Ga0070678_1000076814 202
512 3300005456 Ga0070678_100062075 Ga0070678_1000620752 202
513 3300005456 Ga0070678_100261294 Ga0070678_1002612942 202
514 3300005456 Ga0070678_100362589 Ga0070678_1003625892 202
515 3300005457 Ga0070662_100000280 Ga0070662_10000028013 202
516 3300005457 Ga0070662_100001326 Ga0070662_1000013267 202
517 3300005457 Ga0070662_100020245 Ga0070662_1000202454 202
518 3300005457 Ga0070662_100027057 Ga0070662_1000270572 202
519 3300005457 Ga0070662_100027986 Ga0070662_1000279865 202
520 3300005457 Ga0070662_100033379 Ga0070662_1000333795 202
521 3300005457 Ga0070662_100069225 Ga0070662_1000692254 202
522 3300005457 Ga0070662_100079152 Ga0070662_1000791522 202
523 3300005457 Ga0070662_100111698 Ga0070662_1001116982 202
524 3300005457 Ga0070662_100179597 Ga0070662_1001795972 202
525 3300005457 Ga0070662_100206771 Ga0070662_1002067711 202
526 3300005457 Ga0070662_100443490 Ga0070662_1004434901 202
527 3300005457 Ga0070662_100473881 Ga0070662_1004738812 202
528 3300005458 Ga0070681_10042653 Ga0070681_100426535 202
529 3300005458 Ga0070681_10066769 Ga0070681_100667694 202
530 3300005458 Ga0070681_10167647 Ga0070681_101676471 202
531 3300005458 Ga0070681_10437079 Ga0070681_104370792 202
532 3300005459 Ga0068867_100001818 Ga0068867_1000018182 202
533 3300005459 Ga0068867_100006658 Ga0068867_10000665810 202
534 3300005459 Ga0068867_100015265 Ga0068867_1000152656 202
535 3300005459 Ga0068867_100171287 Ga0068867_1001712872 202
536 3300005459 Ga0068867_100520497 Ga0068867_1005204972 202
537 3300005466 Ga0070685_10031058 Ga0070685_100310584 202
538 3300005466 Ga0070685_10288612 Ga0070685_102886122 202
539 3300005530 Ga0070679_100000346 Ga0070679_10000034635 202
540 3300005530 Ga0070679_100039289 Ga0070679_1000392895 202
541 3300005530 Ga0070679_100061768 Ga0070679_1000617682 202
542 3300005530 Ga0070679_100083269 Ga0070679_1000832695 202
543 3300005530 Ga0070679_100114370 Ga0070679_1001143703 202
544 3300005530 Ga0070679_100278865 Ga0070679_1002788652 202
545 3300005530 Ga0070679_100327932 Ga0070679_1003279322 202
546 3300005535 Ga0070684_100030606 Ga0070684_1000306062 202
547 3300005535 Ga0070684_100040434 Ga0070684_1000404345 202
548 3300005535 Ga0070684_100272786 Ga0070684_1002727861 202
549 3300005535 Ga0070684_100582407 Ga0070684_1005824072 202
550 3300005539 Ga0068853_100000783 Ga0068853_1000007838 202
551 3300005539 Ga0068853_100024992 Ga0068853_1000249924 202
552 3300005539 Ga0068853_100026040 Ga0068853_1000260402 202
553 3300005539 Ga0068853_100369126 Ga0068853_1003691262 202
554 3300005539 Ga0068853_100399054 Ga0068853_1003990541 202
555 3300005539 Ga0068853_100595251 Ga0068853_1005952512 202
556 3300005539 Ga0068853_100779199 Ga0068853_1007791991 202
557 3300005543 Ga0070672_100016934 Ga0070672_1000169346 202
558 3300005543 Ga0070672_100019222 Ga0070672_1000192223 202
559 3300005543 Ga0070672_100193914 Ga0070672_1001939142 202
560 3300005543 Ga0070672_100205070 Ga0070672_1002050702 202
561 3300005543 Ga0070672_100252346 Ga0070672_1002523462 202
562 3300005543 Ga0070672_100300040 Ga0070672_1003000401 202
563 3300005544 Ga0070686_100012997 Ga0070686_1000129974 202
564 3300005544 Ga0070686_100076545 Ga0070686_1000765452 202
565 3300005547 Ga0070693_100006149 Ga0070693_1000061493 202
566 3300005547 Ga0070693_100913005 Ga0070693_1009130051 202
567 3300005548 Ga0070665_100001540 Ga0070665_10000154010 202
568 3300005548 Ga0070665_100004875 Ga0070665_10000487515 202
569 3300005548 Ga0070665_100024758 Ga0070665_1000247582 202
570 3300005548 Ga0070665_100025156 Ga0070665_1000251566 202
571 3300005548 Ga0070665_100025496 Ga0070665_1000254964 202
572 3300005548 Ga0070665_100111470 Ga0070665_1001114703 202
573 3300005548 Ga0070665_100144084 Ga0070665_1001440843 202
574 3300005548 Ga0070665_100412631 Ga0070665_1004126312 202
575 3300005548 Ga0070665_101064141 Ga0070665_1010641411 202
576 3300005563 Ga0068855_100001416 Ga0068855_10000141617 202
577 3300005563 Ga0068855_100001751 Ga0068855_10000175124 202
578 3300005563 Ga0068855_100009125 Ga0068855_1000091258 202
579 3300005563 Ga0068855_100084213 Ga0068855_1000842132 202
580 3300005563 Ga0068855_100160217 Ga0068855_1001602174 202
581 3300005563 Ga0068855_100339635 Ga0068855_1003396351 202
582 3300005563 Ga0068855_100701767 Ga0068855_1007017672 202
583 3300005564 Ga0070664_100006576 Ga0070664_1000065762 202
584 3300005564 Ga0070664_100011906 Ga0070664_1000119067 202
585 3300005564 Ga0070664_100015311 Ga0070664_1000153116 202
586 3300005564 Ga0070664_100019922 Ga0070664_1000199222 202
587 3300005564 Ga0070664_100027924 Ga0070664_1000279243 202
588 3300005564 Ga0070664_100035891 Ga0070664_1000358915 202
589 3300005564 Ga0070664_100241687 Ga0070664_1002416872 202
590 3300005564 Ga0070664_100289564 Ga0070664_1002895642 202
591 3300005564 Ga0070664_100824534 Ga0070664_1008245342 202
592 3300005577 Ga0068857_100011289 Ga0068857_1000112895 202
593 3300005577 Ga0068857_100021706 Ga0068857_1000217066 202
594 3300005577 Ga0068857_100086971 Ga0068857_1000869714 202
595 3300005577 Ga0068857_100096793 Ga0068857_1000967933 202
596 3300005577 Ga0068857_100260968 Ga0068857_1002609682 202
597 3300005577 Ga0068857_100261684 Ga0068857_1002616842 202
598 3300005577 Ga0068857_100327933 Ga0068857_1003279332 202
599 3300005578 Ga0068854_100008111 Ga0068854_1000081115 202
600 3300005578 Ga0068854_100045803 Ga0068854_1000458032 202
601 3300005578 Ga0068854_100103511 Ga0068854_1001035112 202
602 3300005578 Ga0068854_100215394 Ga0068854_1002153942 202
603 3300005578 Ga0068854_100521394 Ga0068854_1005213942 202
604 3300005578 Ga0068854_100653974 Ga0068854_1006539741 202
605 3300005614 Ga0068856_100000977 Ga0068856_10000097716 202
606 3300005614 Ga0068856_100091821 Ga0068856_1000918214 202
607 3300005614 Ga0068856_100126282 Ga0068856_1001262822 202
608 3300005614 Ga0068856_100141328 Ga0068856_1001413282 202
609 3300005614 Ga0068856_100314168 Ga0068856_1003141682 202
610 3300005614 Ga0068856_100564362 Ga0068856_1005643622 202
611 3300005616 Ga0068852_100002885 Ga0068852_1000028857 202
612 3300005616 Ga0068852_100003205 Ga0068852_1000032056 202
613 3300005616 Ga0068852_100020958 Ga0068852_1000209583 202
614 3300005616 Ga0068852_100025534 Ga0068852_1000255341 202
615 3300005616 Ga0068852_100073242 Ga0068852_1000732422 202
616 3300005616 Ga0068852_100089769 Ga0068852_1000897691 202
617 3300005616 Ga0068852_100112384 Ga0068852_1001123842 202
618 3300005616 Ga0068852_100139205 Ga0068852_1001392052 202
619 3300005616 Ga0068852_100431326 Ga0068852_1004313262 202
620 3300005616 Ga0068852_100509456 Ga0068852_1005094562 202
621 3300005616 Ga0068852_101083848 Ga0068852_1010838482 202
622 3300005617 Ga0068859_100000136 Ga0068859_10000013657 202
623 3300005617 Ga0068859_100001019 Ga0068859_1000010192 202
624 3300005617 Ga0068859_100038073 Ga0068859_1000380731 202
625 3300005617 Ga0068859_100137838 Ga0068859_1001378381 202
626 3300005617 Ga0068859_100457198 Ga0068859_1004571982 202
627 3300005618 Ga0068864_100000235 Ga0068864_10000023523 202
628 3300005618 Ga0068864_100000540 Ga0068864_10000054021 202
629 3300005618 Ga0068864_100000711 Ga0068864_10000071113 202
630 3300005618 Ga0068864_100002756 Ga0068864_10000275615 202
631 3300005618 Ga0068864_100018916 Ga0068864_1000189164 202
632 3300005618 Ga0068864_100138617 Ga0068864_1001386171 202
633 3300005618 Ga0068864_100216013 Ga0068864_1002160132 202
634 3300005618 Ga0068864_101369687 Ga0068864_1013696871 202
635 3300005718 Ga0068866_10052875 Ga0068866_100528752 202
636 3300005718 Ga0068866_10053658 Ga0068866_100536582 202
637 3300005718 Ga0068866_10068670 Ga0068866_100686702 202
638 3300005719 Ga0068861_100063756 Ga0068861_1000637564 202
639 3300005834 Ga0068851_10042367 Ga0068851_100423674 202
640 3300005834 Ga0068851_10047340 Ga0068851_100473402 202
641 3300005834 Ga0068851_10242794 Ga0068851_102427942 202
642 3300005834 Ga0068851_10291676 Ga0068851_102916761 202
643 3300005834 Ga0068851_10461840 Ga0068851_104618401 202
644 3300005841 Ga0068863_100000140 Ga0068863_10000014059 202
645 3300005841 Ga0068863_100000607 Ga0068863_1000006077 202
646 3300005841 Ga0068863_100010426 Ga0068863_1000104266 202
647 3300005841 Ga0068863_100076272 Ga0068863_1000762722 202
648 3300005841 Ga0068863_100112544 Ga0068863_1001125442 202
649 3300005841 Ga0068863_100542283 Ga0068863_1005422831 202
650 3300005841 Ga0068863_101090698 Ga0068863_1010906981 202
651 3300005842 Ga0068858_100000514 Ga0068858_10000051423 202
652 3300005842 Ga0068858_100002498 Ga0068858_10000249816 202
653 3300005842 Ga0068858_100004922 Ga0068858_1000049226 202
654 3300005842 Ga0068858_100010521 Ga0068858_1000105219 202
655 3300005842 Ga0068858_100063754 Ga0068858_1000637544 202
656 3300005842 Ga0068858_100186695 Ga0068858_1001866953 202
657 3300005843 Ga0068860_100010118 Ga0068860_1000101182 202
658 3300005843 Ga0068860_100023633 Ga0068860_1000236334 202
659 3300005843 Ga0068860_100026574 Ga0068860_1000265743 202
660 3300005843 Ga0068860_100041001 Ga0068860_1000410014 202
661 3300005843 Ga0068860_100064802 Ga0068860_1000648022 202
662 3300005843 Ga0068860_100512191 Ga0068860_1005121912 202
663 3300005843 Ga0068860_100902708 Ga0068860_1009027081 202
664 3300005843 Ga0068860_101189332 Ga0068860_1011893322 202
665 3300005843 Ga0068860_101242153 Ga0068860_1012421532 202
666 3300005844 Ga0068862_100002905 Ga0068862_1000029054 202
667 3300005844 Ga0068862_100015049 Ga0068862_1000150493 202
668 3300005844 Ga0068862_100031153 Ga0068862_1000311533 202
669 3300005844 Ga0068862_100101125 Ga0068862_1001011252 202
670 3300006028 Ga0070717_10003557 Ga0070717_100035576 202
671 3300006175 Ga0070712_100014929 Ga0070712_1000149292 202
672 3300006237 Ga0097621_100010815 Ga0097621_1000108154 202
673 3300006237 Ga0097621_100013664 Ga0097621_1000136642 202
674 3300006237 Ga0097621_100057276 Ga0097621_1000572764 202
675 3300006237 Ga0097621_100113096 Ga0097621_1001130962 202
676 3300006237 Ga0097621_100159051 Ga0097621_1001590512 202
677 3300006358 Ga0068871_100004382 Ga0068871_1000043824 202
678 3300006358 Ga0068871_100025554 Ga0068871_1000255543 202
679 3300006358 Ga0068871_100160884 Ga0068871_1001608842 202
680 3300006358 Ga0068871_100440275 Ga0068871_1004402752 202
681 3300006852 Ga0075433_10103395 Ga0075433_101033952 202
682 3300006852 Ga0075433_10484422 Ga0075433_104844222 202
683 3300006881 Ga0068865_100000697 Ga0068865_10000069716 202
684 3300006881 Ga0068865_100118352 Ga0068865_1001183522 202
685 3300006881 Ga0068865_100144685 Ga0068865_1001446852 202
686 3300006881 Ga0068865_100202395 Ga0068865_1002023952 202
687 3300006881 Ga0068865_100374859 Ga0068865_1003748592 202
688 3300006881 Ga0068865_100393772 Ga0068865_1003937722 202
689 3300006931 Ga0097620_100000136 Ga0097620_10000013657 202
690 3300006931 Ga0097620_100001019 Ga0097620_10000101929 202
691 3300006931 Ga0097620_100038074 Ga0097620_1000380741 202
692 3300006931 Ga0097620_100068363 Ga0097620_1000683634 202
693 3300006931 Ga0097620_100137833 Ga0097620_1001378331 202
694 3300006931 Ga0097620_100457183 Ga0097620_1004571832 202
695 3300009011 Ga0105251_10113015 Ga0105251_101130151 202
696 3300009093 Ga0105240_10046035 Ga0105240_100460356 202
697 3300009093 Ga0105240_10133084 Ga0105240_101330844 202
698 3300009093 Ga0105240_10266040 Ga0105240_102660402 202
699 3300009093 Ga0105240_10328118 Ga0105240_103281182 202
700 3300009093 Ga0105240_10366055 Ga0105240_103660552 202
701 3300009093 Ga0105240_10378002 Ga0105240_103780022 202
702 3300009093 Ga0105240_10440717 Ga0105240_104407172 202
703 3300009093 Ga0105240_10924809 Ga0105240_109248092 202
704 3300009098 Ga0105245_10000170 Ga0105245_1000017021 202
705 3300009098 Ga0105245_10179041 Ga0105245_101790412 202
706 3300009098 Ga0105245_10336415 Ga0105245_103364152 202
707 3300009101 Ga0105247_10123506 Ga0105247_101235062 202
708 3300009101 Ga0105247_10139882 Ga0105247_101398822 202
709 3300009148 Ga0105243_10061789 Ga0105243_100617892 202
710 3300009148 Ga0105243_10275539 Ga0105243_102755392 202
711 3300009148 Ga0105243_10384871 Ga0105243_103848712 202
712 3300009174 Ga0105241_10248246 Ga0105241_102482462 202
713 3300009174 Ga0105241_10273175 Ga0105241_102731752 202
714 3300009174 Ga0105241_10337261 Ga0105241_103372612 202
715 3300009174 Ga0105241_10595251 Ga0105241_105952512 202
716 3300009176 Ga0105242_10032902 Ga0105242_100329025 202
717 3300009176 Ga0105242_10069659 Ga0105242_100696594 202
718 3300009177 Ga0105248_10000184 Ga0105248_1000018462 202
719 3300009177 Ga0105248_10001269 Ga0105248_1000126915 202
720 3300009177 Ga0105248_10002216 Ga0105248_100022166 202
721 3300009177 Ga0105248_10003825 Ga0105248_1000382511 202
722 3300009177 Ga0105248_10004489 Ga0105248_100044892 202
723 3300009177 Ga0105248_10004542 Ga0105248_1000454217 202
724 3300009177 Ga0105248_10006079 Ga0105248_1000607914 202
725 3300009177 Ga0105248_10038619 Ga0105248_100386194 202
726 3300009177 Ga0105248_10051265 Ga0105248_100512654 202
727 3300009177 Ga0105248_10060789 Ga0105248_100607895 202
728 3300009177 Ga0105248_10160406 Ga0105248_101604062 202
729 3300009177 Ga0105248_10316338 Ga0105248_103163382 202
730 3300009177 Ga0105248_10362628 Ga0105248_103626282 202
731 3300009177 Ga0105248_10483120 Ga0105248_104831202 202
732 3300009177 Ga0105248_10754812 Ga0105248_107548122 202
733 3300009545 Ga0105237_10026407 Ga0105237_100264077 202
734 3300009545 Ga0105237_10154612 Ga0105237_101546122 202
735 3300009551 Ga0105238_10035751 Ga0105238_100357516 202
736 3300009551 Ga0105238_10312184 Ga0105238_103121842 202
737 3300009551 Ga0105238_10470858 Ga0105238_104708582 202
738 3300009553 Ga0105249_10148990 Ga0105249_101489901 202
739 3300010375 Ga0105239_10054221 Ga0105239_100542216 202
740 3300010375 Ga0105239_10166849 Ga0105239_101668494 202
741 3300010375 Ga0105239_10630895 Ga0105239_106308952 202
742 3300011119 Ga0105246_10021263 Ga0105246_100212634 202
743 3300011119 Ga0105246_10173877 Ga0105246_101738772 202
744 3300011119 Ga0105246_10481792 Ga0105246_104817922 202
745 3300013100 Ga0157373_10008290 Ga0157373_100082905 202
746 3300013100 Ga0157373_10018941 Ga0157373_100189416 202
747 3300013100 Ga0157373_10059724 Ga0157373_100597244 202
748 3300013100 Ga0157373_10123172 Ga0157373_101231721 202
749 3300013100 Ga0157373_10213065 Ga0157373_102130651 202
750 3300013100 Ga0157373_10236318 Ga0157373_102363182 202
751 3300013100 Ga0157373_10239212 Ga0157373_102392122 202
752 3300013102 Ga0157371_10000443 Ga0157371_1000044342 202
753 3300013102 Ga0157371_10001298 Ga0157371_100012984 202
754 3300013102 Ga0157371_10011268 Ga0157371_100112682 202
755 3300013102 Ga0157371_10014444 Ga0157371_100144445 202
756 3300013102 Ga0157371_10053663 Ga0157371_100536632 202
757 3300013102 Ga0157371_10191084 Ga0157371_101910842 202
758 3300013102 Ga0157371_10630271 Ga0157371_106302712 202
759 3300013102 Ga0157371_10701206 Ga0157371_107012061 202
760 3300013104 Ga0157370_10009490 Ga0157370_1000949010 202
761 3300013104 Ga0157370_10017776 Ga0157370_100177768 202
762 3300013104 Ga0157370_10027786 Ga0157370_100277862 202
763 3300013104 Ga0157370_10059021 Ga0157370_100590214 202
764 3300013104 Ga0157370_10117052 Ga0157370_101170523 202
765 3300013104 Ga0157370_10166058 Ga0157370_101660583 202
766 3300013104 Ga0157370_10328859 Ga0157370_103288592 202
767 3300013104 Ga0157370_10439202 Ga0157370_104392022 202
768 3300013104 Ga0157370_10712949 Ga0157370_107129491 202
769 3300013105 Ga0157369_10003984 Ga0157369_1000398410 202
770 3300013105 Ga0157369_10012031 Ga0157369_100120314 202
771 3300013105 Ga0157369_10040140 Ga0157369_100401407 202
772 3300013105 Ga0157369_10048252 Ga0157369_100482522 202
773 3300013105 Ga0157369_10141638 Ga0157369_101416382 202
774 3300013105 Ga0157369_10169637 Ga0157369_101696372 202
775 3300013105 Ga0157369_10330244 Ga0157369_103302442 202
776 3300013105 Ga0157369_10330245 Ga0157369_103302452 202
777 3300013105 Ga0157369_10574609 Ga0157369_105746092 202
778 3300013105 Ga0157369_10771331 Ga0157369_107713312 202
779 3300013296 Ga0157374_10001338 Ga0157374_100013382 202
780 3300013296 Ga0157374_10303596 Ga0157374_103035962 202
781 3300013296 Ga0157374_10423366 Ga0157374_104233662 202
782 3300013297 Ga0157378_10000312 Ga0157378_1000031231 202
783 3300013297 Ga0157378_10136098 Ga0157378_101360982 202
784 3300013297 Ga0157378_10692289 Ga0157378_106922892 202
785 3300013306 Ga0163162_10006506 Ga0163162_100065062 202
786 3300013306 Ga0163162_10031200 Ga0163162_100312002 202
787 3300013306 Ga0163162_10159178 Ga0163162_101591783 202
788 3300013306 Ga0163162_10279680 Ga0163162_102796802 202
789 3300013306 Ga0163162_10502271 Ga0163162_105022712 202
790 3300013307 Ga0157372_10033724 Ga0157372_100337244 202
791 3300013307 Ga0157372_10106044 Ga0157372_101060442 202
792 3300013307 Ga0157372_10325153 Ga0157372_103251532 202
793 3300013307 Ga0157372_10364542 Ga0157372_103645422 202
794 3300013307 Ga0157372_10395211 Ga0157372_103952112 202
795 3300013307 Ga0157372_10484191 Ga0157372_104841912 202
796 3300013307 Ga0157372_10953470 Ga0157372_109534701 202
797 3300013307 Ga0157372_11150057 Ga0157372_111500572 202
798 3300013308 Ga0157375_10020027 Ga0157375_100200276 202
799 3300013308 Ga0157375_10063193 Ga0157375_100631934 202
800 3300013308 Ga0157375_10089094 Ga0157375_100890942 202
801 3300013308 Ga0157375_10271190 Ga0157375_102711902 202
802 3300013308 Ga0157375_10328983 Ga0157375_103289832 202
803 3300014325 Ga0163163_10000131 Ga0163163_1000013154 202
804 3300014325 Ga0163163_10096601 Ga0163163_100966014 202
805 3300014325 Ga0163163_10539024 Ga0163163_105390242 202
806 3300014326 Ga0157380_10545974 Ga0157380_105459741 202
807 3300014968 Ga0157379_10001982 Ga0157379_100019824 202
808 3300014968 Ga0157379_10083728 Ga0157379_100837282 202
809 3300014968 Ga0157379_10143504 Ga0157379_101435042 202
810 3300014968 Ga0157379_10244883 Ga0157379_102448832 202
811 3300020069 Ga0197907_10024488 Ga0197907_100244882 202
812 3300020082 Ga0206353_10478740 Ga0206353_104787406 202
813 3300020082 Ga0206353_11034454 Ga0206353_110344545 202
814 3300021384 Ga0213876_10013376 Ga0213876_100133764 202
815 3300025315 Ga0207697_10000063 Ga0207697_1000006320 202
816 3300025315 Ga0207697_10043989 Ga0207697_100439892 202
817 3300025315 Ga0207697_10046735 Ga0207697_100467352 202
818 3300025321 Ga0207656_10001771 Ga0207656_100017712 202
819 3300025321 Ga0207656_10052489 Ga0207656_100524892 202
820 3300025321 Ga0207656_10079603 Ga0207656_100796032 202
821 3300025321 Ga0207656_10089308 Ga0207656_100893083 202
822 3300025893 Ga0207682_10041349 Ga0207682_100413492 202
823 3300025899 Ga0207642_10014356 Ga0207642_100143563 202
824 3300025899 Ga0207642_10017422 Ga0207642_100174222 202
825 3300025899 Ga0207642_10343867 Ga0207642_103438672 202
826 3300025900 Ga0207710_10092037 Ga0207710_100920372 202
827 3300025901 Ga0207688_10000106 Ga0207688_100001068 202
828 3300025901 Ga0207688_10138871 Ga0207688_101388712 202
829 3300025901 Ga0207688_10543354 Ga0207688_105433541 202
830 3300025903 Ga0207680_10000858 Ga0207680_1000085815 202
831 3300025903 Ga0207680_10005013 Ga0207680_100050135 202
832 3300025903 Ga0207680_10024301 Ga0207680_100243013 202
833 3300025903 Ga0207680_10184985 Ga0207680_101849852 202
834 3300025903 Ga0207680_10201679 Ga0207680_102016791 202
835 3300025903 Ga0207680_10264281 Ga0207680_102642811 202
836 3300025904 Ga0207647_10000246 Ga0207647_1000024619 202
837 3300025904 Ga0207647_10000844 Ga0207647_100008447 202
838 3300025904 Ga0207647_10004004 Ga0207647_100040044 202
839 3300025904 Ga0207647_10008871 Ga0207647_100088718 202
840 3300025904 Ga0207647_10028642 Ga0207647_100286425 202
841 3300025904 Ga0207647_10029689 Ga0207647_100296892 202
842 3300025904 Ga0207647_10072817 Ga0207647_100728173 202
843 3300025904 Ga0207647_10329220 Ga0207647_103292202 202
844 3300025907 Ga0207645_10002473 Ga0207645_100024738 202
845 3300025907 Ga0207645_10005761 Ga0207645_100057619 202
846 3300025907 Ga0207645_10113185 Ga0207645_101131851 202
847 3300025909 Ga0207705_10000270 Ga0207705_1000027045 202
848 3300025909 Ga0207705_10000654 Ga0207705_1000065424 202
849 3300025909 Ga0207705_10001164 Ga0207705_100011649 202
850 3300025909 Ga0207705_10003976 Ga0207705_100039764 202
851 3300025909 Ga0207705_10017246 Ga0207705_100172465 202
852 3300025909 Ga0207705_10041115 Ga0207705_100411152 202
853 3300025909 Ga0207705_10045686 Ga0207705_100456863 202
854 3300025909 Ga0207705_10051569 Ga0207705_100515692 202
855 3300025909 Ga0207705_10087171 Ga0207705_100871712 202
856 3300025909 Ga0207705_10154995 Ga0207705_101549952 202
857 3300025909 Ga0207705_10205694 Ga0207705_102056942 202
858 3300025909 Ga0207705_10254737 Ga0207705_102547372 202
859 3300025909 Ga0207705_10281638 Ga0207705_102816382 202
860 3300025909 Ga0207705_10380892 Ga0207705_103808922 202
861 3300025911 Ga0207654_10139524 Ga0207654_101395242 202
862 3300025911 Ga0207654_10232285 Ga0207654_102322851 202
863 3300025911 Ga0207654_10252406 Ga0207654_102524062 202
864 3300025912 Ga0207707_10124542 Ga0207707_101245422 202
865 3300025912 Ga0207707_10155670 Ga0207707_101556702 202
866 3300025913 Ga0207695_10282837 Ga0207695_102828372 202
867 3300025914 Ga0207671_10013747 Ga0207671_100137473 202
868 3300025914 Ga0207671_10093411 Ga0207671_100934112 202
869 3300025915 Ga0207693_10012089 Ga0207693_100120897 202
870 3300025917 Ga0207660_10002965 Ga0207660_100029656 202
871 3300025917 Ga0207660_10313906 Ga0207660_103139062 202
872 3300025917 Ga0207660_10379394 Ga0207660_103793942 202
873 3300025919 Ga0207657_10000120 Ga0207657_1000012016 202
874 3300025919 Ga0207657_10000165 Ga0207657_1000016567 202
875 3300025919 Ga0207657_10001091 Ga0207657_100010917 202
876 3300025919 Ga0207657_10001609 Ga0207657_1000160921 202
877 3300025919 Ga0207657_10002106 Ga0207657_1000210620 202
878 3300025919 Ga0207657_10003456 Ga0207657_100034565 202
879 3300025919 Ga0207657_10004437 Ga0207657_100044375 202
880 3300025919 Ga0207657_10005819 Ga0207657_1000581912 202
881 3300025919 Ga0207657_10005832 Ga0207657_100058322 202
882 3300025919 Ga0207657_10011038 Ga0207657_100110382 202
883 3300025919 Ga0207657_10017485 Ga0207657_100174852 202
884 3300025919 Ga0207657_10017706 Ga0207657_100177065 202
885 3300025919 Ga0207657_10032178 Ga0207657_100321786 202
886 3300025919 Ga0207657_10102080 Ga0207657_101020803 202
887 3300025919 Ga0207657_10139823 Ga0207657_101398233 202
888 3300025919 Ga0207657_10161483 Ga0207657_101614832 202
889 3300025919 Ga0207657_10194432 Ga0207657_101944322 202
890 3300025919 Ga0207657_10775900 Ga0207657_107759002 202
891 3300025919 Ga0207657_10802812 Ga0207657_108028121 202
892 3300025920 Ga0207649_10010318 Ga0207649_100103186 202
893 3300025920 Ga0207649_10011924 Ga0207649_100119244 202
894 3300025920 Ga0207649_10013268 Ga0207649_100132682 202
895 3300025920 Ga0207649_10062182 Ga0207649_100621824 202
896 3300025920 Ga0207649_10077716 Ga0207649_100777162 202
897 3300025920 Ga0207649_10235614 Ga0207649_102356142 202
898 3300025920 Ga0207649_10318919 Ga0207649_103189192 202
899 3300025920 Ga0207649_10340436 Ga0207649_103404361 202
900 3300025921 Ga0207652_10000058 Ga0207652_1000005873 202
901 3300025921 Ga0207652_10089469 Ga0207652_100894692 202
902 3300025921 Ga0207652_10108877 Ga0207652_101088772 202
903 3300025921 Ga0207652_10110899 Ga0207652_101108992 202
904 3300025921 Ga0207652_10189828 Ga0207652_101898282 202
905 3300025921 Ga0207652_10570331 Ga0207652_105703312 202
906 3300025923 Ga0207681_10000712 Ga0207681_1000071220 202
907 3300025923 Ga0207681_10022820 Ga0207681_100228204 202
908 3300025923 Ga0207681_10027653 Ga0207681_100276533 202
909 3300025923 Ga0207681_10649515 Ga0207681_106495152 202
910 3300025924 Ga0207694_10456197 Ga0207694_104561972 202
911 3300025924 Ga0207694_10470875 Ga0207694_104708752 202
912 3300025925 Ga0207650_10026694 Ga0207650_100266945 202
913 3300025925 Ga0207650_10031526 Ga0207650_100315265 202
914 3300025926 Ga0207659_10080229 Ga0207659_100802292 202
915 3300025926 Ga0207659_10113627 Ga0207659_101136273 202
916 3300025926 Ga0207659_10116773 Ga0207659_101167731 202
917 3300025926 Ga0207659_10456971 Ga0207659_104569712 202
918 3300025927 Ga0207687_10006289 Ga0207687_100062892 202
919 3300025927 Ga0207687_10080248 Ga0207687_100802483 202
920 3300025927 Ga0207687_10328309 Ga0207687_103283092 202
921 3300025928 Ga0207700_10035226 Ga0207700_100352265 202
922 3300025928 Ga0207700_10090811 Ga0207700_100908112 202
923 3300025928 Ga0207700_10339899 Ga0207700_103398992 202
924 3300025929 Ga0207664_10033370 Ga0207664_100333704 202
925 3300025929 Ga0207664_10039005 Ga0207664_100390052 202
926 3300025929 Ga0207664_10078218 Ga0207664_100782182 202
927 3300025929 Ga0207664_10147318 Ga0207664_101473182 202
928 3300025929 Ga0207664_10482032 Ga0207664_104820322 202
929 3300025931 Ga0207644_10000202 Ga0207644_1000020229 202
930 3300025931 Ga0207644_10000240 Ga0207644_1000024014 202
931 3300025931 Ga0207644_10006364 Ga0207644_100063647 202
932 3300025931 Ga0207644_10008507 Ga0207644_100085072 202
933 3300025931 Ga0207644_10014968 Ga0207644_100149686 202
934 3300025931 Ga0207644_10018147 Ga0207644_100181475 202
935 3300025931 Ga0207644_10046836 Ga0207644_100468364 202
936 3300025931 Ga0207644_10064724 Ga0207644_100647242 202
937 3300025931 Ga0207644_10083602 Ga0207644_100836022 202
938 3300025931 Ga0207644_10091658 Ga0207644_100916582 202
939 3300025931 Ga0207644_10231304 Ga0207644_102313042 202
940 3300025931 Ga0207644_10333026 Ga0207644_103330262 202
941 3300025932 Ga0207690_10002306 Ga0207690_100023065 202
942 3300025932 Ga0207690_10002510 Ga0207690_100025105 202
943 3300025932 Ga0207690_10019265 Ga0207690_100192655 202
944 3300025932 Ga0207690_10079755 Ga0207690_100797553 202
945 3300025932 Ga0207690_10102134 Ga0207690_101021342 202
946 3300025932 Ga0207690_10120709 Ga0207690_101207092 202
947 3300025932 Ga0207690_10157910 Ga0207690_101579102 202
948 3300025932 Ga0207690_10294697 Ga0207690_102946972 202
949 3300025932 Ga0207690_10385811 Ga0207690_103858112 202
950 3300025932 Ga0207690_10394873 Ga0207690_103948732 202
951 3300025932 Ga0207690_10411044 Ga0207690_104110442 202
952 3300025932 Ga0207690_10521684 Ga0207690_105216841 202
953 3300025932 Ga0207690_10578457 Ga0207690_105784572 202
954 3300025932 Ga0207690_10736471 Ga0207690_107364712 202
955 3300025932 Ga0207690_10758356 Ga0207690_107583561 202
956 3300025933 Ga0207706_10000224 Ga0207706_1000022435 202
957 3300025933 Ga0207706_10004274 Ga0207706_1000427410 202
958 3300025933 Ga0207706_10028329 Ga0207706_100283291 202
959 3300025933 Ga0207706_10028595 Ga0207706_100285951 202
960 3300025933 Ga0207706_10030442 Ga0207706_100304422 202
961 3300025933 Ga0207706_10031271 Ga0207706_100312714 202
962 3300025933 Ga0207706_10033742 Ga0207706_100337424 202
963 3300025933 Ga0207706_10045603 Ga0207706_100456032 202
964 3300025933 Ga0207706_10198709 Ga0207706_101987092 202
965 3300025933 Ga0207706_10241487 Ga0207706_102414872 202
966 3300025933 Ga0207706_10549615 Ga0207706_105496151 202
967 3300025934 Ga0207686_10050884 Ga0207686_100508842 202
968 3300025934 Ga0207686_10071490 Ga0207686_100714903 202
969 3300025935 Ga0207709_10181495 Ga0207709_101814952 202
970 3300025935 Ga0207709_10569512 Ga0207709_105695121 202
971 3300025936 Ga0207670_10118305 Ga0207670_101183052 202
972 3300025936 Ga0207670_10444732 Ga0207670_104447322 202
973 3300025937 Ga0207669_10041168 Ga0207669_100411683 202
974 3300025937 Ga0207669_10060717 Ga0207669_100607172 202
975 3300025938 Ga0207704_10192122 Ga0207704_101921222 202
976 3300025938 Ga0207704_10238290 Ga0207704_102382902 202
977 3300025938 Ga0207704_10309929 Ga0207704_103099292 202
978 3300025938 Ga0207704_10451038 Ga0207704_104510382 202
979 3300025938 Ga0207704_10659217 Ga0207704_106592172 202
980 3300025940 Ga0207691_10000750 Ga0207691_100007506 202
981 3300025940 Ga0207691_10005051 Ga0207691_100050516 202
982 3300025940 Ga0207691_10041076 Ga0207691_100410762 202
983 3300025940 Ga0207691_10064962 Ga0207691_100649623 202
984 3300025940 Ga0207691_10136077 Ga0207691_101360772 202
985 3300025940 Ga0207691_10139727 Ga0207691_101397272 202
986 3300025940 Ga0207691_10205367 Ga0207691_102053671 202
987 3300025940 Ga0207691_10456349 Ga0207691_104563492 202
988 3300025941 Ga0207711_10000105 Ga0207711_1000010551 202
989 3300025941 Ga0207711_10000190 Ga0207711_1000019012 202
990 3300025941 Ga0207711_10000908 Ga0207711_1000090824 202
991 3300025941 Ga0207711_10001131 Ga0207711_100011317 202
992 3300025941 Ga0207711_10005280 Ga0207711_100052802 202
993 3300025941 Ga0207711_10013254 Ga0207711_100132545 202
994 3300025941 Ga0207711_10015748 Ga0207711_100157482 202
995 3300025941 Ga0207711_10043714 Ga0207711_100437142 202
996 3300025941 Ga0207711_10076879 Ga0207711_100768795 202
997 3300025941 Ga0207711_10080732 Ga0207711_100807322 202
998 3300025941 Ga0207711_10218526 Ga0207711_102185262 202
999 3300025941 Ga0207711_10342601 Ga0207711_103426011 202
1000 3300025941 Ga0207711_10379902 Ga0207711_103799022 202
1001 3300025941 Ga0207711_10489546 Ga0207711_104895462 202
1002 3300025942 Ga0207689_10000051 Ga0207689_1000005167 202
1003 3300025942 Ga0207689_10015875 Ga0207689_100158756 202
1004 3300025944 Ga0207661_10051216 Ga0207661_100512162 202
1005 3300025944 Ga0207661_10064717 Ga0207661_100647174 202
1006 3300025944 Ga0207661_10179652 Ga0207661_101796522 202
1007 3300025944 Ga0207661_10299069 Ga0207661_102990692 202
1008 3300025944 Ga0207661_10301220 Ga0207661_103012202 202
1009 3300025945 Ga0207679_10007961 Ga0207679_100079617 202
1010 3300025945 Ga0207679_10020675 Ga0207679_100206756 202
1011 3300025945 Ga0207679_10021485 Ga0207679_100214853 202
1012 3300025945 Ga0207679_10054860 Ga0207679_100548604 202
1013 3300025945 Ga0207679_10068998 Ga0207679_100689982 202
1014 3300025945 Ga0207679_10128916 Ga0207679_101289163 202
1015 3300025945 Ga0207679_10243639 Ga0207679_102436392 202
1016 3300025945 Ga0207679_10333453 Ga0207679_103334532 202
1017 3300025945 Ga0207679_10447361 Ga0207679_104473611 202
1018 3300025949 Ga0207667_10000579 Ga0207667_1000057944 202
1019 3300025949 Ga0207667_10006485 Ga0207667_100064857 202
1020 3300025949 Ga0207667_10012465 Ga0207667_1001246512 202
1021 3300025949 Ga0207667_10077499 Ga0207667_100774994 202
1022 3300025949 Ga0207667_10106520 Ga0207667_101065204 202
1023 3300025949 Ga0207667_10144043 Ga0207667_101440433 202
1024 3300025949 Ga0207667_10185753 Ga0207667_101857532 202
1025 3300025949 Ga0207667_10278147 Ga0207667_102781472 202
1026 3300025949 Ga0207667_10355773 Ga0207667_103557732 202
1027 3300025949 Ga0207667_10493976 Ga0207667_104939762 202
1028 3300025949 Ga0207667_11358254 Ga0207667_113582541 202
1029 3300025960 Ga0207651_10002058 Ga0207651_1000205812 202
1030 3300025960 Ga0207651_10012659 Ga0207651_100126595 202
1031 3300025960 Ga0207651_10042262 Ga0207651_100422624 202
1032 3300025960 Ga0207651_10044775 Ga0207651_100447754 202
1033 3300025960 Ga0207651_10045728 Ga0207651_100457284 202
1034 3300025960 Ga0207651_10064604 Ga0207651_100646044 202
1035 3300025960 Ga0207651_10131441 Ga0207651_101314412 202
1036 3300025960 Ga0207651_10633758 Ga0207651_106337581 202
1037 3300025960 Ga0207651_10637626 Ga0207651_106376262 202
1038 3300025961 Ga0207712_10001657 Ga0207712_100016574 202
1039 3300025972 Ga0207668_10000086 Ga0207668_1000008638 202
1040 3300025972 Ga0207668_10007893 Ga0207668_100078937 202
1041 3300025972 Ga0207668_10093274 Ga0207668_100932742 202
1042 3300025972 Ga0207668_10329190 Ga0207668_103291902 202
1043 3300025981 Ga0207640_10000428 Ga0207640_1000042825 202
1044 3300025981 Ga0207640_10003885 Ga0207640_100038854 202
1045 3300025981 Ga0207640_10013224 Ga0207640_100132242 202
1046 3300025981 Ga0207640_10019431 Ga0207640_100194315 202
1047 3300025981 Ga0207640_10124261 Ga0207640_101242612 202
1048 3300025981 Ga0207640_10515705 Ga0207640_105157052 202
1049 3300025981 Ga0207640_10731013 Ga0207640_107310132 202
1050 3300025986 Ga0207658_10002031 Ga0207658_1000203111 202
1051 3300025986 Ga0207658_10002254 Ga0207658_100022548 202
1052 3300025986 Ga0207658_10004381 Ga0207658_1000438110 202
1053 3300025986 Ga0207658_10006625 Ga0207658_100066255 202
1054 3300025986 Ga0207658_10008246 Ga0207658_100082462 202
1055 3300025986 Ga0207658_10008914 Ga0207658_100089142 202
1056 3300025986 Ga0207658_10087867 Ga0207658_100878672 202
1057 3300025986 Ga0207658_10139172 Ga0207658_101391722 202
1058 3300025986 Ga0207658_10157544 Ga0207658_101575442 202
1059 3300025986 Ga0207658_10288021 Ga0207658_102880212 202
1060 3300025986 Ga0207658_10359128 Ga0207658_103591282 202
1061 3300026023 Ga0207677_10007697 Ga0207677_100076974 202
1062 3300026023 Ga0207677_10052858 Ga0207677_100528582 202
1063 3300026023 Ga0207677_10156406 Ga0207677_101564062 202
1064 3300026023 Ga0207677_10161055 Ga0207677_101610552 202
1065 3300026023 Ga0207677_10205187 Ga0207677_102051872 202
1066 3300026023 Ga0207677_10239355 Ga0207677_102393551 202
1067 3300026023 Ga0207677_10727067 Ga0207677_107270672 202
1068 3300026035 Ga0207703_10006394 Ga0207703_100063944 202
1069 3300026035 Ga0207703_10007523 Ga0207703_100075236 202
1070 3300026035 Ga0207703_10010010 Ga0207703_100100108 202
1071 3300026035 Ga0207703_10013542 Ga0207703_100135426 202
1072 3300026035 Ga0207703_10030430 Ga0207703_100304302 202
1073 3300026035 Ga0207703_10101815 Ga0207703_101018153 202
1074 3300026041 Ga0207639_10001075 Ga0207639_100010753 202
1075 3300026041 Ga0207639_10002776 Ga0207639_100027762 202
1076 3300026041 Ga0207639_10035974 Ga0207639_100359742 202
1077 3300026041 Ga0207639_10088157 Ga0207639_100881571 202
1078 3300026041 Ga0207639_10218731 Ga0207639_102187312 202
1079 3300026041 Ga0207639_10299963 Ga0207639_102999632 202
1080 3300026041 Ga0207639_10319150 Ga0207639_103191502 202
1081 3300026041 Ga0207639_10376492 Ga0207639_103764921 202
1082 3300026041 Ga0207639_10380550 Ga0207639_103805502 202
1083 3300026067 Ga0207678_10000217 Ga0207678_1000021711 202
1084 3300026067 Ga0207678_10000315 Ga0207678_1000031523 202
1085 3300026067 Ga0207678_10002797 Ga0207678_1000279710 202
1086 3300026067 Ga0207678_10007956 Ga0207678_1000795610 202
1087 3300026067 Ga0207678_10027502 Ga0207678_100275025 202
1088 3300026067 Ga0207678_10039959 Ga0207678_100399593 202
1089 3300026067 Ga0207678_10049040 Ga0207678_100490402 202
1090 3300026067 Ga0207678_10288488 Ga0207678_102884882 202
1091 3300026078 Ga0207702_10005472 Ga0207702_1000547213 202
1092 3300026078 Ga0207702_10017620 Ga0207702_100176202 202
1093 3300026078 Ga0207702_10093897 Ga0207702_100938974 202
1094 3300026078 Ga0207702_10153594 Ga0207702_101535943 202
1095 3300026078 Ga0207702_10154406 Ga0207702_101544061 202
1096 3300026078 Ga0207702_10235661 Ga0207702_102356612 202
1097 3300026078 Ga0207702_10346474 Ga0207702_103464742 202
1098 3300026088 Ga0207641_10000172 Ga0207641_1000017244 202
1099 3300026088 Ga0207641_10005515 Ga0207641_100055158 202
1100 3300026088 Ga0207641_10015982 Ga0207641_100159825 202
1101 3300026088 Ga0207641_10032293 Ga0207641_100322932 202
1102 3300026088 Ga0207641_10040796 Ga0207641_100407962 202
1103 3300026088 Ga0207641_10126929 Ga0207641_101269292 202
1104 3300026088 Ga0207641_10673407 Ga0207641_106734072 202
1105 3300026089 Ga0207648_10000221 Ga0207648_1000022167 202
1106 3300026089 Ga0207648_10001535 Ga0207648_1000153521 202
1107 3300026089 Ga0207648_10006756 Ga0207648_100067565 202
1108 3300026089 Ga0207648_10259227 Ga0207648_102592273 202
1109 3300026095 Ga0207676_10000300 Ga0207676_1000030018 202
1110 3300026095 Ga0207676_10002706 Ga0207676_100027062 202
1111 3300026095 Ga0207676_10003558 Ga0207676_100035582 202
1112 3300026095 Ga0207676_10016196 Ga0207676_100161962 202
1113 3300026095 Ga0207676_10024594 Ga0207676_100245942 202
1114 3300026095 Ga0207676_10173408 Ga0207676_101734082 202
1115 3300026116 Ga0207674_10003022 Ga0207674_1000302216 202
1116 3300026116 Ga0207674_10005356 Ga0207674_100053567 202
1117 3300026116 Ga0207674_10008550 Ga0207674_100085506 202
1118 3300026116 Ga0207674_10020272 Ga0207674_100202725 202
1119 3300026116 Ga0207674_10052864 Ga0207674_100528645 202
1120 3300026116 Ga0207674_10079796 Ga0207674_100797962 202
1121 3300026116 Ga0207674_10081806 Ga0207674_100818064 202
1122 3300026116 Ga0207674_10085026 Ga0207674_100850262 202
1123 3300026116 Ga0207674_10192441 Ga0207674_101924413 202
1124 3300026116 Ga0207674_10296315 Ga0207674_102963152 202
1125 3300026116 Ga0207674_10469513 Ga0207674_104695132 202
1126 3300026118 Ga0207675_100020392 Ga0207675_1000203921 202
1127 3300026121 Ga0207683_10000541 Ga0207683_1000054116 202
1128 3300026121 Ga0207683_10074642 Ga0207683_100746422 202
1129 3300026121 Ga0207683_10100173 Ga0207683_101001732 202
1130 3300026121 Ga0207683_10939727 Ga0207683_109397271 202
1131 3300026142 Ga0207698_10012230 Ga0207698_100122304 202
1132 3300026142 Ga0207698_10020271 Ga0207698_100202712 202
1133 3300026142 Ga0207698_10037606 Ga0207698_100376062 202
1134 3300026142 Ga0207698_10056518 Ga0207698_100565182 202
1135 3300026142 Ga0207698_10133638 Ga0207698_101336383 202
1136 3300026142 Ga0207698_10220099 Ga0207698_102200991 202
1137 3300026142 Ga0207698_10310483 Ga0207698_103104832 202
1138 3300026142 Ga0207698_10728093 Ga0207698_107280932 202
1139 3300026142 Ga0207698_10975298 Ga0207698_109752982 202
1140 3300027876 Ga0209974_10228584 Ga0209974_102285841 202
1141 3300028379 Ga0268266_10000200 Ga0268266_1000020015 202
1142 3300028379 Ga0268266_10020187 Ga0268266_100201875 202
1143 3300028379 Ga0268266_10054140 Ga0268266_100541405 202
1144 3300028379 Ga0268266_10140599 Ga0268266_101405992 202
1145 3300028379 Ga0268266_10262485 Ga0268266_102624852 202
1146 3300028379 Ga0268266_10616948 Ga0268266_106169482 202
1147 3300028379 Ga0268266_10689863 Ga0268266_106898631 202
1148 3300028380 Ga0268265_10002225 Ga0268265_1000222515 202
1149 3300028380 Ga0268265_10002511 Ga0268265_1000251112 202
1150 3300028380 Ga0268265_10006624 Ga0268265_100066246 202
1151 3300028380 Ga0268265_10011030 Ga0268265_100110304 202
1152 3300028380 Ga0268265_10103327 Ga0268265_101033272 202
1153 3300028380 Ga0268265_10426725 Ga0268265_104267252 202
1154 3300028381 Ga0268264_10002073 Ga0268264_1000207313 202
1155 3300028381 Ga0268264_10002535 Ga0268264_100025354 202
1156 3300028381 Ga0268264_10010431 Ga0268264_100104314 202
1157 3300028381 Ga0268264_10079039 Ga0268264_100790393 202
1158 3300028381 Ga0268264_10141908 Ga0268264_101419082 202
1159 3300028381 Ga0268264_10427383 Ga0268264_104273832 202
1160 3300028381 Ga0268264_10450474 Ga0268264_104504743 202
1161 3300028381 Ga0268264_11028374 Ga0268264_110283741 202
1162 3300028794 Ga0307515_10204124 Ga0307515_102041242 202
1163 3300028794 Ga0307515_10385968 Ga0307515_103859682 202
1164 3300031548 Ga0307408_100003312 Ga0307408_1000033126 202
1165 3300031548 Ga0307408_100038158 Ga0307408_1000381582 202
1166 3300031548 Ga0307408_100324419 Ga0307408_1003244191 202
1167 3300031731 Ga0307405_10017102 Ga0307405_100171024 202
1168 3300031731 Ga0307405_10141497 Ga0307405_101414972 202
1169 3300031824 Ga0307413_10090824 Ga0307413_100908242 202
1170 3300031824 Ga0307413_10150850 Ga0307413_101508502 202
1171 3300031852 Ga0307410_10025577 Ga0307410_100255774 202
1172 3300031852 Ga0307410_10035920 Ga0307410_100359203 202
1173 3300031852 Ga0307410_10079510 Ga0307410_100795102 202
1174 3300031852 Ga0307410_10399993 Ga0307410_103999932 202
1175 3300031901 Ga0307406_10171798 Ga0307406_101717982 202
1176 3300031901 Ga0307406_10173390 Ga0307406_101733902 202
1177 3300031901 Ga0307406_10220984 Ga0307406_102209842 202
1178 3300031901 Ga0307406_10371745 Ga0307406_103717452 202
1179 3300031903 Ga0307407_10020835 Ga0307407_100208354 202
1180 3300031911 Ga0307412_10121129 Ga0307412_101211292 202
1181 3300031911 Ga0307412_10749395 Ga0307412_107493951 202
1182 3300031995 Ga0307409_100021707 Ga0307409_1000217072 202
1183 3300031995 Ga0307409_100028355 Ga0307409_1000283554 202
1184 3300031995 Ga0307409_100095169 Ga0307409_1000951693 202
1185 3300032002 Ga0307416_100004550 Ga0307416_1000045503 202
1186 3300032002 Ga0307416_100401131 Ga0307416_1004011311 202
1187 3300032004 Ga0307414_10048927 Ga0307414_100489272 202
1188 3300032004 Ga0307414_10051407 Ga0307414_100514072 202
1189 3300032004 Ga0307414_10087717 Ga0307414_100877173 202
1190 3300032004 Ga0307414_10500492 Ga0307414_105004921 202
1191 3300032005 Ga0307411_10004546 Ga0307411_100045467 202
1192 3300032005 Ga0307411_10014761 Ga0307411_100147614 202
1193 3300032005 Ga0307411_10202493 Ga0307411_102024932 202
1194 3300032005 Ga0307411_10206353 Ga0307411_102063532 202
1195 3300032126 Ga0307415_100021401 Ga0307415_1000214012 202
1196 3300032126 Ga0307415_100172291 Ga0307415_1001722912 202
1197 3300032126 Ga0307415_100297493 Ga0307415_1002974932 202
1198 3300032126 Ga0307415_100433020 Ga0307415_1004330202 202
1199 3300032126 Ga0307415_100576341 Ga0307415_1005763412 202
1200 3300032126 Ga0307415_100607544 Ga0307415_1006075441 202
1201 3300032126 Ga0307415_100804576 Ga0307415_1008045762 202
1202 3300035170 Ga0373943_0002312 Ga0373943_0002312_5613_6221 202
1203 3300035171 Ga0373946_0346531 Ga0373946_0346531_11_619 202
1204 3300035692 Ga0373935_0039935 Ga0373935_0039935_186_794 202
1205 3300035692 Ga0373935_0043735 Ga0373935_0043735_172_780 202
1206 3300035725 Ga0373947_0136102 Ga0373947_0136102_400_1008 202
1207 3300037312 Ga0395899_0000270 Ga0395899_0000270_58974_59582 202
1208 3300037312 Ga0395899_0000998 Ga0395899_0000998_20734_21342 202
1209 3300037312 Ga0395899_0010843 Ga0395899_0010843_1785_2393 202
1210 3300037312 Ga0395899_0013488 Ga0395899_0013488_92_700 202
1211 3300037312 Ga0395899_0019430 Ga0395899_0019430_4191_4799 202
1212 3300037312 Ga0395899_0021014 Ga0395899_0021014_3045_3653 202
1213 3300037312 Ga0395899_0036079 Ga0395899_0036079_1795_2403 202
1214 3300037312 Ga0395899_0081252 Ga0395899_0081252_618_1226 202
1215 3300037312 Ga0395899_0104740 Ga0395899_0104740_630_1238 202
1216 3300037312 Ga0395899_0156960 Ga0395899_0156960_315_923 202
1217 3300037312 Ga0395899_0172348 Ga0395899_0172348_653_1261 202
1218 3300037312 Ga0395899_0200272 Ga0395899_0200272_480_1088 202
1219 3300037312 Ga0395899_0200807 Ga0395899_0200807_753_1361 202
1220 3300037312 Ga0395899_0273064 Ga0395899_0273064_528_1136 202
1221 3300037312 Ga0395899_0291071 Ga0395899_0291071_315_923 202
1222 3300037312 Ga0395899_0551644 Ga0395899_0551644_84_692 202
1223 3300037418 Ga0395900_0000290 Ga0395900_0000290_54360_54968 202
1224 3300037418 Ga0395900_0004722 Ga0395900_0004722_9909_10517 202
1225 3300037418 Ga0395900_0009456 Ga0395900_0009456_1774_2382 202
1226 3300037418 Ga0395900_0010539 Ga0395900_0010539_2773_3381 202
1227 3300037418 Ga0395900_0016179 Ga0395900_0016179_4986_5594 202
1228 3300037418 Ga0395900_0018333 Ga0395900_0018333_5873_6481 202
1229 3300037418 Ga0395900_0048442 Ga0395900_0048442_1665_2273 202
1230 3300037418 Ga0395900_0049164 Ga0395900_0049164_2152_2760 202
1231 3300037418 Ga0395900_0104526 Ga0395900_0104526_1186_1794 202
1232 3300037418 Ga0395900_0144501 Ga0395900_0144501_31_639 202
1233 3300037418 Ga0395900_0146941 Ga0395900_0146941_334_942 202
1234 3300037418 Ga0395900_0169335 Ga0395900_0169335_31_639 202
1235 3300037418 Ga0395900_0179984 Ga0395900_0179984_862_1470 202
1236 3300037418 Ga0395900_0288513 Ga0395900_0288513_949_1557 202
1237 3300037418 Ga0395900_0320797 Ga0395900_0320797_27_635 202
1238 3300037418 Ga0395900_0324669 Ga0395900_0324669_679_1287 202
1239 3300037418 Ga0395900_0351444 Ga0395900_0351444_479_1087 202
1240 3300037418 Ga0395900_0359551 Ga0395900_0359551_133_741 202
1241 3300037418 Ga0395900_0415919 Ga0395900_0415919_508_1116 202
1242 3300037418 Ga0395900_0566503 Ga0395900_0566503_298_906 202
1243 3300037418 Ga0395900_0569971 Ga0395900_0569971_80_688 202
1244 3300037418 Ga0395900_0620172 Ga0395900_0620172_361_969 202
1245 3300037418 Ga0395900_0658113 Ga0395900_0658113_40_648 202
1246 3300037418 Ga0395900_0762565 Ga0395900_0762565_70_678 202
1247 3300037466 Ga0395898_0000054 Ga0395898_0000054_219848_220456 202
1248 3300037466 Ga0395898_0002537 Ga0395898_0002537_154_762 202
1249 3300037466 Ga0395898_0031011 Ga0395898_0031011_1822_2430 202
1250 3300037466 Ga0395898_0041320 Ga0395898_0041320_1124_1732 202
1251 3300037466 Ga0395898_0049411 Ga0395898_0049411_2432_3040 202
1252 3300037466 Ga0395898_0097378 Ga0395898_0097378_1915_2523 202
1253 3300037466 Ga0395898_0143643 Ga0395898_0143643_680_1288 202
1254 3300037466 Ga0395898_0351126 Ga0395898_0351126_442_1050 202
1255 3300037466 Ga0395898_0778331 Ga0395898_0778331_19_627 202
1256 3300037471 Ga0395905_0000046 Ga0395905_0000046_180854_181462 202
1257 3300037471 Ga0395905_0000464 Ga0395905_0000464_249_857 202
1258 3300037471 Ga0395905_0004285 Ga0395905_0004285_10412_11020 202
1259 3300037471 Ga0395905_0005705 Ga0395905_0005705_2904_3512 202
1260 3300037471 Ga0395905_0010834 Ga0395905_0010834_5575_6183 202
1261 3300037471 Ga0395905_0011831 Ga0395905_0011831_3836_4444 202
1262 3300037471 Ga0395905_0014345 Ga0395905_0014345_4490_5098 202
1263 3300037471 Ga0395905_0040463 Ga0395905_0040463_498_1106 202
1264 3300037471 Ga0395905_0041225 Ga0395905_0041225_3502_4110 202
1265 3300037471 Ga0395905_0043230 Ga0395905_0043230_443_1051 202
1266 3300037471 Ga0395905_0054150 Ga0395905_0054150_2580_3188 202
1267 3300037471 Ga0395905_0058041 Ga0395905_0058041_1133_1741 202
1268 3300037471 Ga0395905_0074110 Ga0395905_0074110_1827_2435 202
1269 3300037471 Ga0395905_0075701 Ga0395905_0075701_1529_2137 202
1270 3300037471 Ga0395905_0083499 Ga0395905_0083499_549_1157 202
1271 3300037471 Ga0395905_0100386 Ga0395905_0100386_440_1048 202
1272 3300037471 Ga0395905_0105816 Ga0395905_0105816_962_1570 202
1273 3300037471 Ga0395905_0107970 Ga0395905_0107970_439_1047 202
1274 3300037471 Ga0395905_0123602 Ga0395905_0123602_1795_2403 202
1275 3300037471 Ga0395905_0127904 Ga0395905_0127904_641_1249 202
1276 3300037471 Ga0395905_0130666 Ga0395905_0130666_599_1207 202
1277 3300037471 Ga0395905_0135173 Ga0395905_0135173_1369_1977 202
1278 3300037471 Ga0395905_0139783 Ga0395905_0139783_363_971 202
1279 3300037471 Ga0395905_0146126 Ga0395905_0146126_31_639 202
1280 3300037471 Ga0395905_0153301 Ga0395905_0153301_567_1175 202
1281 3300037471 Ga0395905_0215712 Ga0395905_0215712_923_1531 202
1282 3300037471 Ga0395905_0370976 Ga0395905_0370976_159_767 202
1283 3300037471 Ga0395905_0467786 Ga0395905_0467786_495_1103 202
1284 3300037471 Ga0395905_0488949 Ga0395905_0488949_449_1057 202
1285 3300037471 Ga0395905_0491798 Ga0395905_0491798_63_671 202
1286 3300037471 Ga0395905_0538859 Ga0395905_0538859_179_787 202
1287 3300037471 Ga0395905_0596773 Ga0395905_0596773_103_711 202
1288 3300037471 Ga0395905_0597877 Ga0395905_0597877_80_688 202
1289 3300037471 Ga0395905_0678694 Ga0395905_0678694_84_692 202
1290 3300037471 Ga0395905_0732745 Ga0395905_0732745_160_768 202
1291 3300037471 Ga0395905_0962657 Ga0395905_0962657_57_665 202
1292 3300038443 Ga0395901_0000102 Ga0395901_0000102_42655_43263 202
1293 3300038443 Ga0395901_0004019 Ga0395901_0004019_10412_11020 202
1294 3300038443 Ga0395901_0035168 Ga0395901_0035168_2298_2906 202
1295 3300038443 Ga0395901_0070183 Ga0395901_0070183_3022_3630 202
1296 3300038443 Ga0395901_0085243 Ga0395901_0085243_2451_3059 202
1297 3300038443 Ga0395901_0091315 Ga0395901_0091315_2520_3128 202
1298 3300038443 Ga0395901_0137303 Ga0395901_0137303_357_965 202
1299 3300038443 Ga0395901_0140468 Ga0395901_0140468_1856_2464 202
1300 3300038443 Ga0395901_0181695 Ga0395901_0181695_1411_2019 202
1301 3300038443 Ga0395901_0217168 Ga0395901_0217168_1015_1623 202
1302 3300038443 Ga0395901_0228049 Ga0395901_0228049_1038_1646 202
1303 3300038443 Ga0395901_0254419 Ga0395901_0254419_23_631 202
1304 3300038443 Ga0395901_0258076 Ga0395901_0258076_1082_1690 202
1305 3300038443 Ga0395901_0264201 Ga0395901_0264201_445_1053 202
1306 3300038443 Ga0395901_0498115 Ga0395901_0498115_291_899 202
1307 3300038443 Ga0395901_0539894 Ga0395901_0539894_209_817 202
1308 3300038443 Ga0395901_0622921 Ga0395901_0622921_300_908 202
1309 3300039437 Ga0436365_0253280 Ga0436365_0253280_123_731 202
1310 3300039437 Ga0436365_0476910 Ga0436365_0476910_282_890 202
1311 3300039437 Ga0436365_1547320 Ga0436365_1547320_1743_2405 202
1312 3300039450 Ga0436363_0079975 Ga0436363_0079975_998_1606 202
1313 3300042439 Ga0439464_0001955 Ga0439464_0001955_1652_2260 202
1314 3300044656 Ga0466969_0033732 Ga0466969_0033732_434_1042 202
1315 3300044656 Ga0466969_0173469 Ga0466969_0173469_168_776 202
1316 3300044658 Ga0466972_0054799 Ga0466972_0054799_350_958 202
1317 3300044658 Ga0466972_0087918 Ga0466972_0087918_276_884 202
1318 3300044658 Ga0466972_0095786 Ga0466972_0095786_377_985 202
1319 3300044658 Ga0466972_0124749 Ga0466972_0124749_247_855 202
1320 3300044683 Ga0466965_0051915 Ga0466965_0051915_20_628 202
1321 3300044683 Ga0466965_0166438 Ga0466965_0166438_429_1037 202
1322 3300044683 Ga0466965_0209872 Ga0466965_0209872_365_973 202
1323 3300044684 Ga0466966_0012677 Ga0466966_0012677_4616_5224 202
1324 3300044684 Ga0466966_0035140 Ga0466966_0035140_563_1171 202
1325 3300044684 Ga0466966_0193159 Ga0466966_0193159_363_971 202
1326 3300044684 Ga0466966_0196555 Ga0466966_0196555_205_813 202
1327 3300044684 Ga0466966_0219074 Ga0466966_0219074_209_817 202
1328 3300044693 Ga0466961_0005945 Ga0466961_0005945_2835_3443 202
1329 3300044693 Ga0466961_0021267 Ga0466961_0021267_2866_3474 202
1330 3300044693 Ga0466961_0033510 Ga0466961_0033510_1645_2253 202
1331 3300044693 Ga0466961_0215479 Ga0466961_0215479_461_1069 202
1332 3300044694 Ga0466963_0001106 Ga0466963_0001106_6450_7058 202
1333 3300044694 Ga0466963_0009734 Ga0466963_0009734_1172_1780 202
1334 3300044694 Ga0466963_0055169 Ga0466963_0055169_404_1012 202
1335 3300044694 Ga0466963_0087818 Ga0466963_0087818_544_1152 202
1336 3300044694 Ga0466963_0106823 Ga0466963_0106823_696_1304 202
1337 3300044694 Ga0466963_0205265 Ga0466963_0205265_469_1077 202
1338 3300044706 Ga0466964_0007732 Ga0466964_0007732_1445_2053 202
1339 3300044719 Ga0466971_0001233 Ga0466971_0001233_4589_5197 202
1340 3300044719 Ga0466971_0062597 Ga0466971_0062597_672_1280 202
1341 3300044719 Ga0466971_0114834 Ga0466971_0114834_291_899 202
1342 3300044719 Ga0466971_0219581 Ga0466971_0219581_148_756 202
1343 3300044735 Ga0466968_0060698 Ga0466968_0060698_824_1432 202
1344 3300044765 Ga0466970_0018981 Ga0466970_0018981_2259_2867 202
1345 3300044765 Ga0466970_0066495 Ga0466970_0066495_675_1283 202
1346 3300044765 Ga0466970_0116455 Ga0466970_0116455_787_1395 202
1347 3300044765 Ga0466970_0224273 Ga0466970_0224273_308_916 202
1348 3300044842 Ga0466957_0002532 Ga0466957_0002532_7588_8196 202
1349 3300044842 Ga0466957_0005858 Ga0466957_0005858_4394_5002 202
1350 3300044842 Ga0466957_0027332 Ga0466957_0027332_2521_3129 202
1351 3300044842 Ga0466957_0043852 Ga0466957_0043852_704_1312 202
1352 3300044842 Ga0466957_0069416 Ga0466957_0069416_363_971 202
1353 3300044842 Ga0466957_0588696 Ga0466957_0588696_124_732 202
1354 3300044842 Ga0466957_0649717 Ga0466957_0649717_41_649 202
1355 3300045049 Ga0466959_0014620 Ga0466959_0014620_3205_3813 202
1356 3300045049 Ga0466959_0029553 Ga0466959_0029553_2916_3524 202
1357 3300045049 Ga0466959_0044761 Ga0466959_0044761_632_1240 202
1358 3300045049 Ga0466959_0223257 Ga0466959_0223257_337_945 202
1359 3300045049 Ga0466959_0441265 Ga0466959_0441265_107_715 202
1360 3300045049 Ga0466959_0753894 Ga0466959_0753894_23_631 202
1361 3300045836 Ga0466958_0001034 Ga0466958_0001034_7120_7728 202
1362 3300045836 Ga0466958_0009773 Ga0466958_0009773_1624_2232 202
1363 3300045836 Ga0466958_0014945 Ga0466958_0014945_2719_3327 202
1364 3300045836 Ga0466958_0024381 Ga0466958_0024381_1320_1928 202
1365 3300045836 Ga0466958_0116893 Ga0466958_0116893_988_1596 202
1366 3300045836 Ga0466958_0163403 Ga0466958_0163403_136_744 202
1367 3300045836 Ga0466958_0276171 Ga0466958_0276171_404_1012 202
1368 3300045976 Ga0466967_0000524 Ga0466967_0000524_10834_11442 202
1369 3300045976 Ga0466967_0010682 Ga0466967_0010682_6151_6759 202
1370 3300045976 Ga0466967_0036825 Ga0466967_0036825_3336_3944 202
1371 3300045976 Ga0466967_0053564 Ga0466967_0053564_1481_2089 202
1372 3300045976 Ga0466967_0059958 Ga0466967_0059958_2146_2754 202
1373 3300045976 Ga0466967_0091996 Ga0466967_0091996_388_996 202
1374 3300045976 Ga0466967_0101882 Ga0466967_0101882_388_996 202
1375 3300045976 Ga0466967_0129249 Ga0466967_0129249_1107_1715 202
1376 3300045976 Ga0466967_0344619 Ga0466967_0344619_141_749 202
1377 3300045976 Ga0466967_0534039 Ga0466967_0534039_283_891 202
1378 3300045976 Ga0466967_0787515 Ga0466967_0787515_73_681 202
1379 3300046459 Ga0495629_0540758 Ga0495629_0540758_162_770 202
1380 3300046472 Ga0495580_0279579 Ga0495580_0279579_41_649 202
1381 3300046525 Ga0495663_0022987 Ga0495663_0022987_647_1255 202
1382 3300046525 Ga0495663_0067866 Ga0495663_0067866_389_997 202
1383 3300046528 Ga0495642_0075576 Ga0495642_0075576_568_1176 202
1384 3300046537 Ga0495598_0000263 Ga0495598_0000263_697_1305 202
1385 3300046539 Ga0495621_0000044 Ga0495621_0000044_3073_3681 202
1386 3300046616 Ga0495668_0060614 Ga0495668_0060614_1309_1917 202
1387 3300046684 Ga0495669_0000644 Ga0495669_0000644_6634_7242 202
1388 3300046684 Ga0495669_0000912 Ga0495669_0000912_6547_7155 202
1389 3300046684 Ga0495669_0022356 Ga0495669_0022356_1653_2261 202
1390 3300046684 Ga0495669_0039102 Ga0495669_0039102_535_1143 202
1391 3300046691 Ga0495670_0000148 Ga0495670_0000148_11797_12405 202
1392 3300046691 Ga0495670_0290525 Ga0495670_0290525_175_783 202
1393 3300047447 Ga0495685_051686 Ga0495685_051686_465_1073 202
1394 3300048903 Ga0496100_0000983 Ga0496100_0000983_4338_4946 202
1395 3300048903 Ga0496100_0422285 Ga0496100_0422285_148_756 202
1396 3300048904 Ga0496101_0000216 Ga0496101_0000216_19828_20436 202
1397 3300048904 Ga0496101_0015421 Ga0496101_0015421_1835_2443 202
1398 3300048904 Ga0496101_0322962 Ga0496101_0322962_267_875 202
1399 3300048905 Ga0496102_0065035 Ga0496102_0065035_1502_2110 202
1400 3300048905 Ga0496102_0229267 Ga0496102_0229267_966_1574 202
1401 3300048905 Ga0496102_0534013 Ga0496102_0534013_120_728 202
1402 3300048905 Ga0496102_0617534 Ga0496102_0617534_14_622 202
1403 3300048906 Ga0496103_0002116 Ga0496103_0002116_5264_5872 202
1404 3300048906 Ga0496103_0283828 Ga0496103_0283828_367_1011 202
1405 3300048906 Ga0496103_0343101 Ga0496103_0343101_178_786 202
1406 3300048907 Ga0496104_0062973 Ga0496104_0062973_1314_1922 202
1407 3300048908 Ga0496105_0023470 Ga0496105_0023470_3003_3611 202
1408 3300048908 Ga0496105_0555913 Ga0496105_0555913_79_687 202
1409 3300048909 Ga0496106_0006534 Ga0496106_0006534_3021_3629 202
1410 3300048909 Ga0496106_0025806 Ga0496106_0025806_2151_2759 202
1411 3300048910 Ga0496107_0000258 Ga0496107_0000258_20675_21283 202
1412 3300048910 Ga0496107_0001322 Ga0496107_0001322_11737_12345 202
1413 3300048910 Ga0496107_0017341 Ga0496107_0017341_2001_2609 202
1414 3300048910 Ga0496107_0100133 Ga0496107_0100133_864_1472 202
1415 3300048910 Ga0496107_0116013 Ga0496107_0116013_516_1124 202
1416 3300048910 Ga0496107_0117844 Ga0496107_0117844_1007_1615 202
1417 3300048910 Ga0496107_0196175 Ga0496107_0196175_623_1231 202
1418 3300048911 Ga0496108_0001820 Ga0496108_0001820_7745_8353 202
1419 3300048911 Ga0496108_0005054 Ga0496108_0005054_6181_6789 202
1420 3300048911 Ga0496108_0007117 Ga0496108_0007117_4277_4885 202
1421 3300048911 Ga0496108_0025148 Ga0496108_0025148_2149_2757 202
1422 3300048911 Ga0496108_0810818 Ga0496108_0810818_182_790 202
1423 3300048912 Ga0496109_0003321 Ga0496109_0003321_4210_4818 202
1424 3300048912 Ga0496109_0004047 Ga0496109_0004047_7787_8395 202
1425 3300048912 Ga0496109_0004682 Ga0496109_0004682_2932_3540 202
1426 3300048912 Ga0496109_0011962 Ga0496109_0011962_1384_1992 202
1427 3300048912 Ga0496109_0015314 Ga0496109_0015314_5024_5632 202
1428 3300048912 Ga0496109_0020472 Ga0496109_0020472_4169_4777 202
1429 3300048912 Ga0496109_0461773 Ga0496109_0461773_202_810 202
1430 3300048913 Ga0496110_0000132 Ga0496110_0000132_41795_42403 202
1431 3300048913 Ga0496110_0001649 Ga0496110_0001649_11863_12471 202
1432 3300048913 Ga0496110_0023225 Ga0496110_0023225_1737_2345 202
1433 3300048913 Ga0496110_0032219 Ga0496110_0032219_3255_3863 202
1434 3300048913 Ga0496110_0044264 Ga0496110_0044264_1724_2332 202
1435 3300048913 Ga0496110_0593956 Ga0496110_0593956_219_827 202
1436 3300048914 Ga0496111_0005129 Ga0496111_0005129_4338_4946 202
1437 3300048914 Ga0496111_0015170 Ga0496111_0015170_2850_3458 202
1438 3300048914 Ga0496111_0022981 Ga0496111_0022981_53_661 202
1439 3300048914 Ga0496111_0128642 Ga0496111_0128642_777_1385 202
1440 3300048915 Ga0496112_0000242 Ga0496112_0000242_6738_7346 202
1441 3300048915 Ga0496112_0001463 Ga0496112_0001463_8765_9373 202
1442 3300048915 Ga0496112_0013529 Ga0496112_0013529_2979_3587 202
1443 3300048915 Ga0496112_0072781 Ga0496112_0072781_1149_1757 202
1444 3300048915 Ga0496112_0346863 Ga0496112_0346863_477_1085 202
1445 3300048916 Ga0496113_0020713 Ga0496113_0020713_3166_3774 202
1446 3300048916 Ga0496113_0022273 Ga0496113_0022273_1871_2479 202
1447 3300048916 Ga0496113_0029624 Ga0496113_0029624_746_1354 202
1448 3300048916 Ga0496113_0130800 Ga0496113_0130800_1084_1692 202
1449 3300048917 Ga0496114_0000016 Ga0496114_0000016_59729_60337 202
1450 3300048917 Ga0496114_0008376 Ga0496114_0008376_1232_1840 202
1451 3300048917 Ga0496114_0152070 Ga0496114_0152070_1240_1848 202
1452 3300048918 Ga0496115_0000618 Ga0496115_0000618_22948_23556 202
1453 3300048918 Ga0496115_0025147 Ga0496115_0025147_104_712 202
1454 3300049663 Ga0501223_000135 Ga0501223_000135_7033_7641 202
1455 3300049664 Ga0501224_000042 Ga0501224_000042_14727_15335 202
1456 3300049668 Ga0501233_001241 Ga0501233_001241_2873_3481 202
1457 3300049669 Ga0501235_043154 Ga0501235_043154_151_759 202
1458 3300049705 Ga0501225_0000134 Ga0501225_0000134_14727_15335 202
1459 3300049742 Ga0501080_0036442 Ga0501080_0036442_3910_4518 202
1460 3300049853 Ga0501226_000099 Ga0501226_000099_7068_7676 202
1461 3300050513 nmdc:mga0rr50_707860_c1 nmdc:mga0rr50_707860_c1_52_660 202
1462 3300050515 nmdc:mga0a205_42162_c1 nmdc:mga0a205_42162_c1_1648_2256 202
1463 3300053090 Ga0500646_0141250 Ga0500646_0141250_35_649 202
1464 3300053120 Ga0500597_023049 Ga0500597_023049_1142_1756 202
1465 3300053134 Ga0500658_0000032 Ga0500658_0000032_56422_57030 202
1466 3300053136 Ga0500559_0300949 Ga0500559_0300949_13_636 202
1467 3300053157 Ga0500624_000003 Ga0500624_000003_41492_42106 202
1468 3300053178 Ga0500637_0000038 Ga0500637_0000038_41463_42077 202
1469 3300061719 Ga0466962_0004684 Ga0466962_0004684_4878_5486 202
1470 3300061719 Ga0466962_0005622 Ga0466962_0005622_2831_3439 202
1471 3300061719 Ga0466962_0017163 Ga0466962_0017163_426_1034 202
1472 3300061719 Ga0466962_0029300 Ga0466962_0029300_919_1527 202
1473 3300061719 Ga0466962_0076366 Ga0466962_0076366_444_1052 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

98

186

0.95

PF00677

Lum_binding

Lumazine binding domain

3

85

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9477 1 198
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9383 1 198
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9329 1 199
1kzl-assembly1.cif.gz_A riboflavin synthase from s.pombe bound to carboxyethyllumazine 0.929 1 200
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9237 1 199
ID Description Score Start End Superfamily
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9519 100 199 2.40.30.20
af_B7FAH8_195_301_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9446 100 200 2.40.30.20
af_A0A1D8PP67_110_218_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9434 100 200 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9353 1 87 2.40.30.20
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9336 100 199 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A848SQ51-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.986 1 150 GO:0004746
GO:0009231
AF-A0A371B283-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9803 1 202 GO:0004746
GO:0009231
AF-A0A326GKD7-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.98 1 198 GO:0004746
GO:0009231
AF-A0A2E5DMR8-F1-model_v4 deleted 0.9797 1 192
AF-A0A848SQ51-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9795 1 150 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
92.33 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map