F493983

General Info

Members Datasets Scaffolds Average Seq Length
1441 490 1259 207

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10000561|Ga0182008_1000056117
Length 243
Sequence LIEGTAKAVPRQRRETVWVNAAAACDKNAASLLEPTSMDLATLTLFLPACFALNMAPGPNNLLSVSNATRYGYRRACAAGIGRIIAFAGMIALAGAGLSVVLQTSEWLFHAIKIIGAAYLLYLAWQLWRANPEAEQQVAGASVGFWRLARQEFLVAAGNPKAILLFTAFLPQFVDPSRPVPAQFAVLGALFLLLEWIAIGAYAWMGLHMRRWFAEPRGKRVFNRCCAGLLSAAASVLLFAKRA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231014 Pseudomonas sp. GM48 Isolate Nodule
17 2511231015 Pseudomonas sp. GM49 Isolate Nodule
18 2511231016 Pseudomonas sp. GM50 Isolate Nodule
19 2511231017 Pseudomonas sp. GM55 Isolate Nodule
20 2511231018 Pseudomonas sp. GM60 Isolate Nodule
21 2511231019 Pseudomonas sp. GM67 Isolate Nodule
22 2511231020 Pseudomonas sp. GM74 Isolate Nodule
23 2511231021 Pseudomonas sp. GM78 Isolate Nodule
24 2511231022 Pseudomonas sp. GM79 Isolate Nodule
25 2511231031 Pseudomonas sp. GM16 Isolate Nodule
26 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
27 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
28 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
29 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
30 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
31 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
32 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
33 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
34 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
46 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
49 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
50 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
51 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
52 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
53 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
54 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
55 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
56 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
57 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
58 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
59 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
60 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
61 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
62 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
63 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
64 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
65 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
66 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
67 2643221645 Massilia sp. Root351 Isolate Unclassified
68 2643221664 Massilia sp. Root418 Isolate Unclassified
69 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
70 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
71 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
72 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
73 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
74 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
75 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
76 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
77 2738541280 Massilia sp. GV090 Isolate Unclassified
78 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
79 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
80 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
81 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
82 2738541300 Massilia sp. GV016 Isolate Unclassified
83 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
84 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
85 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
86 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
87 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
88 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
89 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
90 2738543018 Massilia sp. GV045 Isolate Unclassified
91 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
92 2738543030 Massilia sp. GV097 Isolate Unclassified
93 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
94 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
95 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
96 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
97 2773857670 Pseudomonas sp. 478 Isolate Unclassified
98 2773857673 Pseudomonas sp. 443 Isolate Unclassified
99 2784132063 Pseudomonas sp. 424 Isolate Unclassified
100 2784132072 Pseudomonas sp. 460 Isolate Unclassified
101 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
102 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
103 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
104 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
105 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
106 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
107 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
108 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
109 2818991450 Burkholderia sp. 604 Isolate Unclassified
110 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
111 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
112 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
113 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
114 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
115 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
116 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
117 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
118 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
119 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
120 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
121 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
122 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
123 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
124 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
125 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
126 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
127 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
128 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
129 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
130 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
131 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
132 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
133 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
134 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
135 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
136 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
137 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
138 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
139 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
140 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
141 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
142 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
143 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
144 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
145 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
146 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
147 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
148 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
149 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
150 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
151 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
152 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
153 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
154 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
155 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
156 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
157 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
158 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
159 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
160 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
161 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
162 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
163 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
164 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
165 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
166 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
167 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
168 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
169 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
170 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
171 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
172 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
173 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
174 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
175 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
176 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
177 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
178 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
179 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
180 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
181 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
182 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
183 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
184 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
185 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
186 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
187 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
188 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
189 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
190 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
191 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
192 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
193 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
194 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
195 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
196 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
197 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
198 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
201 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
202 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
203 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
204 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
205 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
208 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
209 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
210 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
211 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
212 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
213 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
214 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
215 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
216 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
217 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
218 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
219 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
220 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
221 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
222 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
223 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
224 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
225 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
226 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
227 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
228 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
229 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
230 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
231 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
232 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
233 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
234 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
235 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
236 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
237 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
238 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
239 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
240 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
241 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
242 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
243 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
244 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
245 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
246 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
247 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
248 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
249 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
251 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
257 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
258 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
260 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
261 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
263 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
264 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
265 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
268 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
272 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
275 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
294 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
297 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
299 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
300 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
301 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
302 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
303 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
307 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
310 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
313 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
314 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
315 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
316 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
317 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
318 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
319 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
320 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
321 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
322 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
323 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
324 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
325 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
326 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
327 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
328 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
329 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
330 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
331 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
332 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
333 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
334 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
335 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
336 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
337 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
338 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
339 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
340 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
341 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
342 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
343 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
344 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
345 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
346 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
347 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
348 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
349 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
350 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
351 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
362 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
363 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
366 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
380 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
381 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
382 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
383 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
384 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
385 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
386 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
387 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
388 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
389 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
392 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
393 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
394 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
398 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
399 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
400 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
401 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
402 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
403 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
404 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
405 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
406 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
407 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
408 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
409 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
410 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
411 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
412 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
413 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
418 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
419 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
420 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
421 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
422 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
423 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
424 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
425 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
426 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
427 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
428 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
429 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
430 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
437 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
442 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
448 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
449 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
450 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
451 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
459 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
460 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
461 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
462 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
463 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
464 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
465 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
468 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
469 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
470 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
471 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
472 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
473 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
474 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
475 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
476 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
477 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
478 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
479 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
480 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
481 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
482 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
483 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
484 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
485 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
486 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
487 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
488 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
489 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
490 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.37
Metatranscriptomes 0
Isolates 12.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 2.36
Rhizoplane 3.82
Rhizosphere 72.8
Stem 0
Stem Tuber 0
Unclassified 12.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_56 2124908027 Bacteria 59451
2 JGI24740J21852_10000288 3300001979 Bacteria 21513
3 JGI24739J22299_10006888 3300001989 Bacteria 4281
4 JGI24735J21928_10004611 3300002067 Bacteria 4619
5 JGI24738J21930_10010796 3300002075 Bacteria 2023
6 JGI25156J39149_1000454 3300002705 Bacteria 24952
7 JGI25156J39149_1000636 3300002705 Bacteria 19244
8 JGI25162J39368_1000053 3300002737 Bacteria 148653
9 JGI25162J39368_1000198 3300002737 Bacteria 63149
10 JGI25162J39368_1000361 3300002737 Bacteria 38800
11 JGI25154J39366_1008458 3300002738 Bacteria 1323
12 JGI25158J39367_1003095 3300002739 Bacteria 2617
13 JGI25163J39215_1000117 3300002771 Bacteria 33528
14 JGI25163J39215_1000199 3300002771 Bacteria 23396
15 JGI25164J39214_1000042 3300002772 Bacteria 126523
16 JGI25164J39214_1000080 3300002772 Bacteria 94261
17 JGI25164J39214_1000081 3300002772 Bacteria 93862
18 JGI25164J39214_1000130 3300002772 Bacteria 72405
19 JGI25152J39213_1002453 3300002773 Bacteria 7051
20 JGI25150J39212_1002190 3300002774 Bacteria 4992
21 JGI25150J39212_1007600 3300002774 Bacteria 2168
22 JGI25165J46597_1000060 3300003214 Bacteria 208907
23 JGI25165J46597_1000299 3300003214 Bacteria 62544
24 JGI25153J46596_10004137 3300003215 Bacteria 7887
25 rootH2_10059800 3300003320 Bacteria 5199
26 rootH2_10059801 3300003320 Bacteria 4389
27 rootL2_10152210 3300003322 Bacteria 2727
28 rootL2_10203149 3300003322 Bacteria 2784
29 rootH1_10133742 3300003323 Bacteria 5154
30 rootH1_10171848 3300003323 Bacteria 5208
31 rootH1_10203630 3300003323 Bacteria 1548
32 rootH1_10303299 3300003323 Bacteria 3946
33 JGI25160J50197_1000292 3300003354 Bacteria 35891
34 Ga0055538_1000007 3300003751 Bacteria 399715
35 Ga0055539_1000011 3300003752 Bacteria 399747
36 Ga0055533_1000014 3300003756 Bacteria 399747
37 Ga0055532_1000009 3300003758 Bacteria 399537
38 Ga0055525_1000016 3300003759 Bacteria 399724
39 Ga0055535_1003856 3300003761 Bacteria 3961
40 Ga0055526_1003490 3300003771 Bacteria 9964
41 Ga0055526_1005049 3300003771 Bacteria 7708
42 Ga0055526_1022202 3300003771 Bacteria 2169
43 Ga0055537_1000822 3300003773 Bacteria 15242
44 Ga0055537_1004565 3300003773 Bacteria 3935
45 Ga0055537_1009776 3300003773 Bacteria 2081
46 Ga0055537_1016405 3300003773 Bacteria 1255
47 Ga0055524_1005634 3300003775 Bacteria 5560
48 Ga0055524_1007607 3300003775 Bacteria 4581
49 Ga0055524_1010822 3300003775 Bacteria 3607
50 Ga0055524_1021149 3300003775 Bacteria 2165
51 Ga0055536_1000032 3300003781 Bacteria 150527
52 Ga0055536_1000248 3300003781 Bacteria 42734
53 Ga0055534_1000601 3300003784 Bacteria 18680
54 Ga0055534_1001445 3300003784 Bacteria 9453
55 Ga0055534_1011914 3300003784 Bacteria 1745
56 Ga0055528_1000050 3300003790 Bacteria 93078
57 Ga0055530_10000029 3300003791 Bacteria 127049
58 Ga0055530_10002850 3300003791 Bacteria 10557
59 Ga0055530_10003960 3300003791 Bacteria 8005
60 Ga0055530_10005302 3300003791 Bacteria 6189
61 Ga0055530_10006520 3300003791 Bacteria 5190
62 Ga0055540_1000315 3300003792 Bacteria 42776
63 Ga0055531_10000964 3300003794 Bacteria 23057
64 Ga0055531_10004344 3300003794 Bacteria 8669
65 Ga0055541_1000008 3300003841 Bacteria 399724
66 Ga0055543_1038868 3300004625 Bacteria 808
67 Ga0065165_1000965 3300005262 Bacteria 36121
68 Ga0065165_1086026 3300005262 Bacteria 808
69 Ga0065714_10067227 3300005288 Bacteria 5752
70 Ga0065714_10087349 3300005288 Bacteria 2062
71 Ga0065714_10088954 3300005288 Bacteria 1997
72 Ga0065704_10171211 3300005289 Bacteria 1290
73 Ga0065704_10400004 3300005289 Bacteria 753
74 Ga0065712_10003635 3300005290 Bacteria 7641
75 Ga0070660_100154329 3300005339 Bacteria 1848
76 Ga0070661_100000053 3300005344 Bacteria 89030
77 Ga0070667_100240207 3300005367 Bacteria 1617
78 Ga0070663_100010163 3300005455 Bacteria 5858
79 Ga0070663_100228463 3300005455 Bacteria 1464
80 Ga0070662_100880303 3300005457 Bacteria 763
81 Ga0070664_100000030 3300005564 Bacteria 89030
82 Ga0068859_100149998 3300005617 Bacteria 2407
83 Ga0068851_10001544 3300005834 Bacteria 10091
84 Ga0068863_100135386 3300005841 Bacteria 2353
85 Ga0068858_100021357 3300005842 Bacteria 6047
86 Ga0068860_100006140 3300005843 Bacteria 12086
87 Ga0075364_10036672 3300006051 Bacteria 3170
88 Ga0075432_10000841 3300006058 Bacteria 9638
89 Ga0075432_10042112 3300006058 Bacteria 1597
90 Ga0075432_10058017 3300006058 Bacteria 1374
91 Ga0075432_10093799 3300006058 Bacteria 1101
92 Ga0075362_10037027 3300006177 Bacteria 2137
93 Ga0068871_100769064 3300006358 Bacteria 886
94 Ga0068865_100469285 3300006881 Bacteria 1044
95 Ga0075436_100045680 3300006914 Bacteria 3021
96 Ga0097620_100149997 3300006931 Bacteria 2407
97 Ga0079104_1000901 3300006946 Bacteria 24122
98 Ga0105251_10000051 3300009011 Bacteria 106703
99 Ga0105251_10004107 3300009011 Bacteria 10178
100 Ga0105251_10004479 3300009011 Bacteria 9482
101 Ga0105251_10006905 3300009011 Bacteria 7122
102 Ga0105251_10015364 3300009011 Bacteria 4190
103 Ga0105251_10052845 3300009011 Bacteria 1933
104 Ga0105251_10055434 3300009011 Bacteria 1879
105 Ga0105244_10002484 3300009036 Bacteria 13880
106 Ga0105244_10028331 3300009036 Bacteria 3006
107 Ga0105244_10033371 3300009036 Bacteria 2714
108 Ga0105244_10044079 3300009036 Bacteria 2299
109 Ga0105244_10076989 3300009036 Bacteria 1655
110 Ga0105250_10000090 3300009092 Bacteria 80516
111 Ga0105250_10037908 3300009092 Bacteria 1934
112 Ga0105250_10040687 3300009092 Bacteria 1864
113 Ga0105240_10074125 3300009093 Bacteria 4202
114 Ga0105243_10000252 3300009148 Bacteria 61589
115 Ga0105243_10165545 3300009148 Bacteria 1910
116 Ga0105242_10009765 3300009176 Bacteria 7353
117 Ga0105248_10351485 3300009177 Bacteria 1659
118 Ga0105248_10820398 3300009177 Bacteria 1050
119 Ga0105237_10001925 3300009545 Bacteria 26498
120 Ga0105238_10045426 3300009551 Bacteria 4437
121 Ga0105238_10666698 3300009551 Bacteria 1051
122 Ga0105239_10245574 3300010375 Bacteria 2010
123 Ga0105246_10000121 3300011119 Bacteria 35746
124 Ga0105246_10199615 3300011119 Bacteria 1554
125 Ga0157345_1000052 3300012498 Bacteria 25093
126 Ga0157373_10000956 3300013100 Bacteria 22426
127 Ga0157373_10006613 3300013100 Bacteria 8647
128 Ga0157373_10012072 3300013100 Bacteria 6348
129 Ga0157373_10144963 3300013100 Bacteria 1670
130 Ga0157373_10237809 3300013100 Bacteria 1287
131 Ga0157371_10000115 3300013102 Bacteria 122316
132 Ga0157371_10001056 3300013102 Bacteria 30183
133 Ga0157371_10001414 3300013102 Bacteria 24972
134 Ga0157370_10006897 3300013104 Bacteria 12432
135 Ga0157370_10172116 3300013104 Bacteria 2013
136 Ga0157369_10002704 3300013105 Bacteria 21151
137 Ga0157369_10014014 3300013105 Bacteria 9056
138 Ga0157369_10014686 3300013105 Bacteria 8836
139 Ga0157369_10098144 3300013105 Bacteria 3125
140 Ga0157369_10620254 3300013105 Bacteria 1116
141 Ga0163162_10005044 3300013306 Bacteria 12721
142 Ga0163162_10014155 3300013306 Bacteria 7795
143 Ga0163162_10237399 3300013306 Bacteria 1954
144 Ga0163162_10493274 3300013306 Bacteria 1356
145 Ga0163162_10743183 3300013306 Bacteria 1101
146 Ga0163162_10743385 3300013306 Bacteria 1100
147 Ga0163162_11311177 3300013306 Bacteria 823
148 Ga0157372_10010196 3300013307 Bacteria 9977
149 Ga0157375_10000050 3300013308 Bacteria 134913
150 Ga0157375_10005961 3300013308 Bacteria 10627
151 Ga0157375_10045237 3300013308 Bacteria 4284
152 Ga0157375_10084224 3300013308 Bacteria 3227
153 Ga0182008_10000561 3300014497 Bacteria 27568
154 Ga0182008_10000786 3300014497 Bacteria 22211
155 Ga0182008_10001085 3300014497 Bacteria 18783
156 Ga0182008_10003306 3300014497 Bacteria 9804
157 Ga0182008_10018897 3300014497 Bacteria 3564
158 Ga0157376_10238804 3300014969 Bacteria 1692
159 Ga0182006_1000107 3300015261 Bacteria 89971
160 Ga0182006_1000717 3300015261 Bacteria 22942
161 Ga0182006_1001284 3300015261 Bacteria 15487
162 Ga0182006_1097156 3300015261 Bacteria 1051
163 Ga0182006_1118589 3300015261 Bacteria 922
164 Ga0182007_10000394 3300015262 Bacteria 27020
165 Ga0182007_10000511 3300015262 Bacteria 22909
166 Ga0182007_10011481 3300015262 Bacteria 3447
167 Ga0182005_1002980 3300015265 Bacteria 5862
168 Ga0182005_1008065 3300015265 Bacteria 3123
169 Ga0183361_10005 3300016635 Bacteria 413599
170 Ga0163161_10000183 3300017792 Bacteria 57397
171 Ga0163161_10001377 3300017792 Bacteria 18022
172 Ga0163161_10009209 3300017792 Bacteria 6827
173 Ga0163161_10018624 3300017792 Bacteria 4866
174 Ga0163161_10023963 3300017792 Bacteria 4308
175 Ga0163161_10217483 3300017792 Bacteria 1478
176 Ga0163161_10378542 3300017792 Bacteria 1131
177 Ga0209435_101086 3300025206 Bacteria 3773
178 Ga0209760_100013 3300025207 Bacteria 181451
179 Ga0209760_100107 3300025207 Bacteria 62762
180 Ga0209436_107825 3300025208 Bacteria 2191
181 Ga0209784_100023 3300025224 Bacteria 399841
182 Ga0209566_100019 3300025225 Bacteria 414836
183 Ga0209674_100034 3300025226 Bacteria 414903
184 Ga0209147_100027 3300025229 Bacteria 414610
185 Ga0209563_100037 3300025230 Bacteria 414903
186 Ga0209563_100920 3300025230 Bacteria 8665
187 Ga0207427_100003 3300025231 Bacteria 1035004
188 Ga0207427_100011 3300025231 Bacteria 640076
189 Ga0209437_100002 3300025233 Bacteria 1574801
190 Ga0209437_100025 3300025233 Bacteria 561333
191 Ga0209258_100640 3300025242 Bacteria 26956
192 Ga0207425_1000017 3300025245 Bacteria 423851
193 Ga0207425_1001876 3300025245 Bacteria 8041
194 Ga0209646_1000330 3300025246 Bacteria 35848
195 Ga0209677_100021 3300025253 Bacteria 414954
196 Ga0209759_1000010 3300025256 Bacteria 430463
197 Ga0209759_1000086 3300025256 Bacteria 167075
198 Ga0209759_1002747 3300025256 Bacteria 7474
199 Ga0209129_1000039 3300025258 Bacteria 322444
200 Ga0209129_1005476 3300025258 Bacteria 4475
201 Ga0209233_1000004 3300025261 Bacteria 1574798
202 Ga0209233_1000012 3300025261 Bacteria 1019519
203 Ga0209565_1000018 3300025263 Bacteria 460940
204 Ga0209565_1002127 3300025263 Bacteria 7515
205 Ga0209565_1002265 3300025263 Bacteria 7127
206 Ga0209565_1002465 3300025263 Bacteria 6642
207 Ga0209565_1007404 3300025263 Bacteria 2963
208 Ga0209565_1010838 3300025263 Bacteria 2246
209 Ga0209565_1011491 3300025263 Bacteria 2151
210 Ga0209565_1031677 3300025263 Bacteria 1026
211 Ga0209673_1000090 3300025273 Bacteria 202223
212 Ga0209673_1006024 3300025273 Bacteria 5961
213 Ga0209130_1033529 3300025284 Bacteria 1039
214 Ga0209675_1000005 3300025291 Bacteria 849192
215 Ga0209675_1003745 3300025291 Bacteria 7045
216 Ga0209675_1006631 3300025291 Bacteria 4606
217 Ga0209676_1000003 3300025292 Bacteria 1454178
218 Ga0209676_1000102 3300025292 Bacteria 227372
219 Ga0209676_1007996 3300025292 Bacteria 4819
220 Ga0209564_1000078 3300025295 Bacteria 275766
221 Ga0209564_1002526 3300025295 Bacteria 14121
222 Ga0209564_1004873 3300025295 Bacteria 7972
223 Ga0209564_1005222 3300025295 Bacteria 7515
224 Ga0209564_1027875 3300025295 Bacteria 1822
225 Ga0209758_1000137 3300025297 Bacteria 176734
226 Ga0209050_1000004 3300025298 Bacteria 1600040
227 Ga0209050_1000105 3300025298 Bacteria 227285
228 Ga0209050_1001471 3300025298 Bacteria 25203
229 Ga0209050_1002026 3300025298 Bacteria 18796
230 Ga0209050_1006069 3300025298 Bacteria 7301
231 Ga0209050_1007531 3300025298 Bacteria 6072
232 Ga0209256_1000070 3300025299 Bacteria 245034
233 Ga0209256_1003534 3300025299 Bacteria 10865
234 Ga0209256_1006814 3300025299 Bacteria 5893
235 Ga0207426_1000020 3300025302 Bacteria 558084
236 Ga0207426_1024294 3300025302 Bacteria 2058
237 Ga0209051_1000052 3300025303 Bacteria 283346
238 Ga0209051_1000066 3300025303 Bacteria 227369
239 Ga0209051_1030616 3300025303 Bacteria 2085
240 Ga0209257_1000124 3300025304 Bacteria 218195
241 Ga0209257_1001097 3300025304 Bacteria 35294
242 Ga0209257_1008182 3300025304 Bacteria 6050
243 Ga0207656_10000088 3300025321 Bacteria 33938
244 Ga0207696_1000041 3300025711 Bacteria 311695
245 Ga0207696_1000051 3300025711 Bacteria 276833
246 Ga0207696_1001731 3300025711 Bacteria 11333
247 Ga0207696_1004943 3300025711 Bacteria 5633
248 Ga0207696_1066257 3300025711 Bacteria 1009
249 Ga0207696_1074859 3300025711 Bacteria 939
250 Ga0207655_1000080 3300025728 Bacteria 214570
251 Ga0207655_1000285 3300025728 Bacteria 77315
252 Ga0207655_1000875 3300025728 Bacteria 31869
253 Ga0207655_1002960 3300025728 Bacteria 13054
254 Ga0207655_1002984 3300025728 Bacteria 12977
255 Ga0207655_1016523 3300025728 Bacteria 4031
256 Ga0207655_1019490 3300025728 Bacteria 3541
257 Ga0207655_1040465 3300025728 Bacteria 2011
258 Ga0207655_1048166 3300025728 Bacteria 1752
259 Ga0207655_1115220 3300025728 Bacteria 900
260 Ga0207713_1000354 3300025735 Bacteria 50282
261 Ga0207713_1000953 3300025735 Bacteria 25833
262 Ga0207713_1002745 3300025735 Bacteria 12506
263 Ga0207713_1003122 3300025735 Bacteria 11491
264 Ga0207713_1004239 3300025735 Bacteria 9370
265 Ga0207713_1008216 3300025735 Bacteria 6040
266 Ga0207713_1008329 3300025735 Bacteria 5985
267 Ga0207713_1013685 3300025735 Bacteria 4260
268 Ga0207713_1021170 3300025735 Bacteria 3125
269 Ga0207713_1028947 3300025735 Bacteria 2489
270 Ga0207713_1046087 3300025735 Bacteria 1776
271 Ga0207713_1064331 3300025735 Bacteria 1381
272 Ga0207713_1079137 3300025735 Bacteria 1188
273 Ga0207713_1097533 3300025735 Bacteria 1020
274 Ga0207647_10015672 3300025904 Bacteria 5190
275 Ga0207647_10098467 3300025904 Bacteria 1738
276 Ga0207695_10070101 3300025913 Bacteria 3585
277 Ga0207671_10004590 3300025914 Bacteria 13123
278 Ga0207657_10188096 3300025919 Bacteria 1667
279 Ga0207649_10000070 3300025920 Bacteria 89018
280 Ga0207706_10618156 3300025933 Bacteria 930
281 Ga0207709_10000011 3300025935 Bacteria 552881
282 Ga0207709_10112500 3300025935 Bacteria 1823
283 Ga0207679_10000021 3300025945 Bacteria 221630
284 Ga0207640_10285852 3300025981 Bacteria 1298
285 Ga0207703_10030034 3300026035 Bacteria 4293
286 Ga0207678_10018487 3300026067 Bacteria 6121
287 Ga0207678_10186785 3300026067 Bacteria 1770
288 Ga0207641_10435189 3300026088 Bacteria 1265
289 Ga0209281_1000063 3300027111 Bacteria 288465
290 Ga0209371_1013184 3300027312 Bacteria 2339
291 Ga0209974_10070104 3300027876 Bacteria 1195
292 Ga0207428_10012077 3300027907 Bacteria 7601
293 Ga0207428_10034484 3300027907 Bacteria 4146
294 Ga0207428_10035970 3300027907 Bacteria 4043
295 Ga0207428_10050758 3300027907 Bacteria 3317
296 Ga0207428_10062553 3300027907 Bacteria 2943
297 Ga0207428_10418326 3300027907 Bacteria 980
298 Ga0207428_10514145 3300027907 Bacteria 869
299 Ga0268264_10163730 3300028381 Bacteria 2006
300 Ga0265338_10000023 3300028800 Bacteria 300147
301 Ga0268256_1002198 3300030500 Bacteria 10290
302 Ga0307511_10139980 3300030521 Bacteria 1426
303 Ga0316180_1031230 3300030736 Unclassified 1315
304 Ga0316183_1202622 3300030742 Bacteria 1040
305 Ga0265340_10069277 3300031247 Bacteria 1674
306 Ga0307408_100000401 3300031548 Bacteria 38921
307 Ga0307408_100008266 3300031548 Bacteria 6869
308 Ga0307408_100010005 3300031548 Bacteria 6250
309 Ga0307408_100012271 3300031548 Bacteria 5674
310 Ga0307516_10155526 3300031730 Bacteria 2042
311 Ga0307405_10000324 3300031731 Bacteria 17676
312 Ga0307518_10329951 3300031838 Bacteria 904
313 Ga0307412_10000002 3300031911 Bacteria 743446
314 Ga0307412_10010361 3300031911 Bacteria 5367
315 Ga0307414_10228716 3300032004 Bacteria 1532
316 Ga0307510_10001323 3300033180 Bacteria 27015
317 Ga0395905_0000057 3300037471 Bacteria 203452
318 Ga0395905_0315077 3300037471 Bacteria 1453
319 Ga0237819_02002 3300038705 Bacteria 4542
320 Ga0436361_0447564 3300039447 Bacteria 848
321 Ga0439438_000582 3300041405 Bacteria 16605
322 Ga0439438_012578 3300041405 Bacteria 2591
323 Ga0439438_025951 3300041405 Bacteria 1591
324 Ga0439438_035854 3300041405 Bacteria 1302
325 Ga0439447_000155 3300041407 Bacteria 23690
326 Ga0439447_000844 3300041407 Bacteria 11246
327 Ga0439447_001755 3300041407 Bacteria 7957
328 Ga0439447_005075 3300041407 Bacteria 4425
329 Ga0439447_019553 3300041407 Bacteria 1804
330 Ga0439466_0001396 3300041411 Bacteria 9420
331 Ga0439466_0004877 3300041411 Bacteria 5156
332 Ga0439466_0007443 3300041411 Bacteria 4147
333 Ga0439466_0010487 3300041411 Bacteria 3444
334 Ga0439466_0011288 3300041411 Bacteria 3306
335 Ga0439465_0102865 3300041413 Bacteria 987
336 Ga0439432_007611 3300042006 Bacteria 3829
337 Ga0439432_052119 3300042006 Bacteria 1274
338 Ga0439451_000466 3300042009 Bacteria 7878
339 Ga0439452_000575 3300042010 Bacteria 19128
340 Ga0439452_000972 3300042010 Bacteria 12878
341 Ga0439452_003058 3300042010 Bacteria 5947
342 Ga0439452_008182 3300042010 Bacteria 3161
343 Ga0439452_078862 3300042010 Bacteria 719
344 Ga0439456_001377 3300042013 Bacteria 4868
345 Ga0439456_027680 3300042013 Bacteria 1208
346 Ga0439463_000045 3300042016 Bacteria 26023
347 Ga0439463_011496 3300042016 Bacteria 2174
348 Ga0439463_023909 3300042016 Bacteria 1530
349 Ga0450911_001187 3300042115 Bacteria 6354
350 Ga0450911_003833 3300042115 Bacteria 2567
351 Ga0450919_000828 3300042121 Bacteria 3988
352 Ga0450920_001875 3300042122 Bacteria 3528
353 Ga0450922_000653 3300042124 Bacteria 3624
354 Ga0450922_001455 3300042124 Bacteria 2328
355 Ga0450890_001139 3300042127 Bacteria 3847
356 Ga0450898_007568 3300042134 Bacteria 1692
357 Ga0450899_000115 3300042135 Bacteria 7237
358 Ga0450902_000207 3300042137 Bacteria 6899
359 Ga0450902_006534 3300042137 Bacteria 1786
360 Ga0450903_000525 3300042138 Bacteria 8016
361 Ga0450903_001400 3300042138 Bacteria 4498
362 Ga0450903_007169 3300042138 Bacteria 1842
363 Ga0450903_021249 3300042138 Bacteria 1003
364 Ga0450905_022715 3300042142 Bacteria 933
365 Ga0450906_003107 3300042145 Bacteria 3589
366 Ga0450906_008093 3300042145 Bacteria 2048
367 Ga0450907_007687 3300042146 Bacteria 1797
368 Ga0439446_0000487 3300042156 Bacteria 7909
369 Ga0439446_0011676 3300042156 Bacteria 2388
370 Ga0450908_001499 3300042184 Bacteria 4530
371 Ga0450908_009294 3300042184 Bacteria 1827
372 Ga0450909_002147 3300042185 Bacteria 2785
373 Ga0439464_0027279 3300042439 Bacteria 1588
374 Ga0439460_0001304 3300042461 Bacteria 5854
375 Ga0439460_0010367 3300042461 Bacteria 2382
376 Ga0450893_0035002 3300042532 Bacteria 905
377 Ga0439440_0010448 3300042993 Bacteria 1941
378 Ga0466981_0137376 3300044669 Bacteria 1694
379 Ga0466965_0014245 3300044683 Bacteria 3763
380 Ga0466966_0226826 3300044684 Bacteria 1127
381 Ga0495617_000745 3300046452 Bacteria 16015
382 Ga0495617_000762 3300046452 Bacteria 15768
383 Ga0495617_001347 3300046452 Bacteria 10899
384 Ga0495617_002981 3300046452 Bacteria 6472
385 Ga0495617_004376 3300046452 Bacteria 5147
386 Ga0495617_007588 3300046452 Bacteria 3757
387 Ga0495617_011954 3300046452 Bacteria 2962
388 Ga0495617_075586 3300046452 Bacteria 1105
389 Ga0495627_000488 3300046453 Bacteria 33292
390 Ga0495627_000695 3300046453 Bacteria 25747
391 Ga0495627_002844 3300046453 Bacteria 8001
392 Ga0495627_003025 3300046453 Bacteria 7679
393 Ga0495627_003740 3300046453 Bacteria 6575
394 Ga0495627_011620 3300046453 Bacteria 3153
395 Ga0495592_0001859 3300046454 Bacteria 14860
396 Ga0495592_0126934 3300046454 Bacteria 1788
397 Ga0495603_0002727 3300046455 Bacteria 10412
398 Ga0495603_0004278 3300046455 Bacteria 8506
399 Ga0495603_0051819 3300046455 Bacteria 2437
400 Ga0495603_0095762 3300046455 Bacteria 1734
401 Ga0495590_0000590 3300046457 Bacteria 17170
402 Ga0495590_0002065 3300046457 Bacteria 8421
403 Ga0495590_0002343 3300046457 Bacteria 7866
404 Ga0495590_0018459 3300046457 Bacteria 2497
405 Ga0495590_0033888 3300046457 Bacteria 1784
406 Ga0495590_0039171 3300046457 Bacteria 1653
407 Ga0495590_0060852 3300046457 Bacteria 1322
408 Ga0495590_0070248 3300046457 Bacteria 1228
409 Ga0495590_0096282 3300046457 Bacteria 1049
410 Ga0495591_000151 3300046458 Bacteria 73402
411 Ga0495591_000662 3300046458 Bacteria 25480
412 Ga0495591_000903 3300046458 Bacteria 20685
413 Ga0495591_001053 3300046458 Bacteria 18531
414 Ga0495591_001607 3300046458 Bacteria 13665
415 Ga0495591_001801 3300046458 Bacteria 12697
416 Ga0495591_004551 3300046458 Bacteria 6729
417 Ga0495591_005145 3300046458 Bacteria 6132
418 Ga0495591_006042 3300046458 Bacteria 5453
419 Ga0495591_007960 3300046458 Bacteria 4410
420 Ga0495591_011430 3300046458 Bacteria 3364
421 Ga0495591_013256 3300046458 Bacteria 3027
422 Ga0495591_016356 3300046458 Bacteria 2585
423 Ga0495591_017077 3300046458 Bacteria 2503
424 Ga0495591_058873 3300046458 Bacteria 1026
425 Ga0495629_0000100 3300046459 Bacteria 75845
426 Ga0495629_0004061 3300046459 Bacteria 10994
427 Ga0495629_0005447 3300046459 Bacteria 9489
428 Ga0495629_0017530 3300046459 Bacteria 5132
429 Ga0495629_0030768 3300046459 Bacteria 3803
430 Ga0495638_0001189 3300046460 Bacteria 24911
431 Ga0495638_0001932 3300046460 Bacteria 17825
432 Ga0495638_0001957 3300046460 Bacteria 17643
433 Ga0495638_0002895 3300046460 Bacteria 13721
434 Ga0495638_0003601 3300046460 Bacteria 12113
435 Ga0495638_0004891 3300046460 Bacteria 10071
436 Ga0495638_0026812 3300046460 Bacteria 3733
437 Ga0495638_0034055 3300046460 Bacteria 3253
438 Ga0495638_0039092 3300046460 Bacteria 3013
439 Ga0495638_0062759 3300046460 Bacteria 2292
440 Ga0495638_0087401 3300046460 Bacteria 1883
441 Ga0495638_0095764 3300046460 Bacteria 1782
442 Ga0495638_0167636 3300046460 Bacteria 1262
443 Ga0495638_0233604 3300046460 Bacteria 1021
444 Ga0495638_0252420 3300046460 Bacteria 971
445 Ga0495641_0029432 3300046461 Bacteria 2646
446 Ga0495651_0010786 3300046462 Bacteria 7025
447 Ga0495651_0087480 3300046462 Bacteria 2343
448 Ga0495651_0106718 3300046462 Bacteria 2075
449 Ga0495651_0115739 3300046462 Bacteria 1976
450 Ga0495653_0001528 3300046463 Bacteria 18094
451 Ga0495653_0002120 3300046463 Bacteria 15630
452 Ga0495653_0006298 3300046463 Bacteria 9733
453 Ga0495653_0009338 3300046463 Bacteria 8021
454 Ga0495653_0017188 3300046463 Bacteria 5881
455 Ga0495653_0357049 3300046463 Bacteria 938
456 Ga0495653_0391332 3300046463 Bacteria 885
457 Ga0495650_0002024 3300046471 Bacteria 17741
458 Ga0495650_0002389 3300046471 Bacteria 15350
459 Ga0495650_0002550 3300046471 Bacteria 14477
460 Ga0495650_0005686 3300046471 Bacteria 7994
461 Ga0495650_0025181 3300046471 Bacteria 2794
462 Ga0495650_0030240 3300046471 Bacteria 2455
463 Ga0495650_0035710 3300046471 Bacteria 2185
464 Ga0495650_0039205 3300046471 Bacteria 2045
465 Ga0495650_0047483 3300046471 Bacteria 1795
466 Ga0495580_0000295 3300046472 Bacteria 40524
467 Ga0495580_0002112 3300046472 Bacteria 17432
468 Ga0495580_0002922 3300046472 Bacteria 14684
469 Ga0495580_0014535 3300046472 Bacteria 5967
470 Ga0495580_0023867 3300046472 Bacteria 4484
471 Ga0495580_0064336 3300046472 Bacteria 2571
472 Ga0495580_0094853 3300046472 Bacteria 2075
473 Ga0495580_0160581 3300046472 Bacteria 1556
474 Ga0495582_0007815 3300046473 Bacteria 5912
475 Ga0495582_0009290 3300046473 Bacteria 5423
476 Ga0495582_0043905 3300046473 Bacteria 2461
477 Ga0495582_0068940 3300046473 Bacteria 1955
478 Ga0495605_0001000 3300046474 Bacteria 19106
479 Ga0495605_0001045 3300046474 Bacteria 18527
480 Ga0495605_0001305 3300046474 Bacteria 16514
481 Ga0495605_0005110 3300046474 Bacteria 7650
482 Ga0495605_0007327 3300046474 Bacteria 6264
483 Ga0495605_0009011 3300046474 Bacteria 5616
484 Ga0495605_0013199 3300046474 Bacteria 4562
485 Ga0495605_0017059 3300046474 Bacteria 3920
486 Ga0495605_0026405 3300046474 Bacteria 3019
487 Ga0495605_0028088 3300046474 Bacteria 2907
488 Ga0495605_0030824 3300046474 Bacteria 2745
489 Ga0495605_0036535 3300046474 Bacteria 2476
490 Ga0495605_0118734 3300046474 Bacteria 1200
491 Ga0495605_0130922 3300046474 Bacteria 1131
492 Ga0495605_0155611 3300046474 Bacteria 1017
493 Ga0495605_0175854 3300046474 Bacteria 943
494 Ga0495605_0186261 3300046474 Bacteria 911
495 Ga0495639_0000340 3300046475 Bacteria 22523
496 Ga0495639_0002281 3300046475 Bacteria 8406
497 Ga0495639_0006694 3300046475 Bacteria 4958
498 Ga0495662_0014427 3300046476 Bacteria 3842
499 Ga0495664_0001444 3300046477 Bacteria 12592
500 Ga0495584_0000376 3300046491 Bacteria 30692
501 Ga0495584_0001269 3300046491 Bacteria 15364
502 Ga0495584_0004422 3300046491 Bacteria 7571
503 Ga0495584_0006321 3300046491 Bacteria 6208
504 Ga0495584_0008480 3300046491 Bacteria 5322
505 Ga0495584_0008670 3300046491 Bacteria 5262
506 Ga0495584_0015950 3300046491 Bacteria 3833
507 Ga0495584_0018191 3300046491 Bacteria 3573
508 Ga0495584_0050220 3300046491 Bacteria 2100
509 Ga0495584_0125780 3300046491 Bacteria 1299
510 Ga0495585_0001045 3300046492 Bacteria 22938
511 Ga0495585_0001713 3300046492 Bacteria 16718
512 Ga0495585_0003021 3300046492 Bacteria 11595
513 Ga0495585_0004557 3300046492 Bacteria 8964
514 Ga0495585_0004621 3300046492 Bacteria 8889
515 Ga0495585_0013242 3300046492 Bacteria 4831
516 Ga0495585_0020019 3300046492 Bacteria 3850
517 Ga0495585_0024247 3300046492 Bacteria 3480
518 Ga0495585_0077051 3300046492 Bacteria 1810
519 Ga0495585_0100031 3300046492 Bacteria 1551
520 Ga0495594_0000889 3300046499 Bacteria 15427
521 Ga0495594_0001248 3300046499 Bacteria 13335
522 Ga0495594_0055341 3300046499 Bacteria 2187
523 Ga0495596_0000576 3300046500 Bacteria 22896
524 Ga0495596_0004520 3300046500 Bacteria 6763
525 Ga0495596_0014690 3300046500 Bacteria 3296
526 Ga0495596_0037847 3300046500 Bacteria 1907
527 Ga0495596_0059123 3300046500 Bacteria 1494
528 Ga0495596_0165497 3300046500 Bacteria 859
529 Ga0495596_0165501 3300046500 Bacteria 859
530 Ga0495607_0000094 3300046501 Bacteria 92515
531 Ga0495607_0001437 3300046501 Bacteria 21228
532 Ga0495607_0002626 3300046501 Bacteria 14442
533 Ga0495607_0003226 3300046501 Bacteria 12573
534 Ga0495607_0007600 3300046501 Bacteria 7475
535 Ga0495607_0007944 3300046501 Bacteria 7293
536 Ga0495607_0010078 3300046501 Bacteria 6363
537 Ga0495607_0016903 3300046501 Bacteria 4697
538 Ga0495607_0017684 3300046501 Bacteria 4567
539 Ga0495607_0018811 3300046501 Bacteria 4394
540 Ga0495607_0029334 3300046501 Bacteria 3385
541 Ga0495607_0040146 3300046501 Bacteria 2789
542 Ga0495607_0096404 3300046501 Bacteria 1592
543 Ga0495607_0100171 3300046501 Bacteria 1553
544 Ga0495607_0111280 3300046501 Bacteria 1451
545 Ga0495607_0149772 3300046501 Bacteria 1195
546 Ga0495607_0157995 3300046501 Bacteria 1154
547 Ga0495607_0289449 3300046501 Bacteria 774
548 Ga0495607_0354464 3300046501 Bacteria 676
549 Ga0495583_0000131 3300046506 Bacteria 125393
550 Ga0495583_0001715 3300046506 Bacteria 21058
551 Ga0495583_0002503 3300046506 Bacteria 15572
552 Ga0495583_0005590 3300046506 Bacteria 8478
553 Ga0495583_0005960 3300046506 Bacteria 8089
554 Ga0495583_0108132 3300046506 Bacteria 1180
555 Ga0495606_0000794 3300046507 Bacteria 48239
556 Ga0495606_0001321 3300046507 Bacteria 33870
557 Ga0495606_0001801 3300046507 Bacteria 27281
558 Ga0495606_0004042 3300046507 Bacteria 14955
559 Ga0495606_0006669 3300046507 Bacteria 10584
560 Ga0495606_0006941 3300046507 Bacteria 10298
561 Ga0495606_0008002 3300046507 Bacteria 9294
562 Ga0495606_0009378 3300046507 Bacteria 8286
563 Ga0495606_0012768 3300046507 Bacteria 6696
564 Ga0495606_0015819 3300046507 Bacteria 5788
565 Ga0495606_0017298 3300046507 Bacteria 5458
566 Ga0495606_0031656 3300046507 Bacteria 3673
567 Ga0495606_0036522 3300046507 Bacteria 3346
568 Ga0495606_0062274 3300046507 Bacteria 2382
569 Ga0495608_0000861 3300046511 Bacteria 21168
570 Ga0495610_0001426 3300046512 Bacteria 21148
571 Ga0495610_0003681 3300046512 Bacteria 11769
572 Ga0495610_0005237 3300046512 Bacteria 9277
573 Ga0495610_0007098 3300046512 Bacteria 7558
574 Ga0495610_0007600 3300046512 Bacteria 7177
575 Ga0495610_0010405 3300046512 Bacteria 5784
576 Ga0495610_0011235 3300046512 Bacteria 5489
577 Ga0495610_0012038 3300046512 Bacteria 5237
578 Ga0495610_0013966 3300046512 Bacteria 4745
579 Ga0495610_0018793 3300046512 Bacteria 3887
580 Ga0495610_0019003 3300046512 Bacteria 3860
581 Ga0495610_0025562 3300046512 Bacteria 3166
582 Ga0495610_0037264 3300046512 Bacteria 2476
583 Ga0495610_0039554 3300046512 Bacteria 2384
584 Ga0495610_0108558 3300046512 Bacteria 1232
585 Ga0495616_0000704 3300046513 Bacteria 24772
586 Ga0495616_0001304 3300046513 Bacteria 17440
587 Ga0495616_0001608 3300046513 Bacteria 15484
588 Ga0495616_0005421 3300046513 Bacteria 7859
589 Ga0495616_0006790 3300046513 Bacteria 6898
590 Ga0495616_0007406 3300046513 Bacteria 6567
591 Ga0495616_0157735 3300046513 Bacteria 1022
592 Ga0495616_0213903 3300046513 Bacteria 842
593 Ga0495616_0226801 3300046513 Bacteria 811
594 Ga0495616_0274130 3300046513 Bacteria 718
595 Ga0495616_0314856 3300046513 Bacteria 658
596 Ga0495618_0003821 3300046514 Bacteria 9321
597 Ga0495618_0004456 3300046514 Bacteria 8608
598 Ga0495618_0005144 3300046514 Bacteria 7993
599 Ga0495618_0040193 3300046514 Bacteria 2943
600 Ga0495620_0000532 3300046515 Bacteria 24382
601 Ga0495620_0000700 3300046515 Bacteria 20759
602 Ga0495620_0001612 3300046515 Bacteria 13362
603 Ga0495620_0002510 3300046515 Bacteria 10637
604 Ga0495620_0004727 3300046515 Bacteria 7654
605 Ga0495620_0005152 3300046515 Bacteria 7317
606 Ga0495620_0005775 3300046515 Bacteria 6874
607 Ga0495620_0006517 3300046515 Bacteria 6407
608 Ga0495620_0030410 3300046515 Bacteria 2486
609 Ga0495620_0076301 3300046515 Bacteria 1362
610 Ga0495620_0110363 3300046515 Bacteria 1090
611 Ga0495628_0004005 3300046516 Bacteria 13121
612 Ga0495628_0020935 3300046516 Bacteria 5387
613 Ga0495628_0035834 3300046516 Bacteria 3985
614 Ga0495628_0107394 3300046516 Bacteria 2149
615 Ga0495628_0154829 3300046516 Bacteria 1744
616 Ga0495630_0002987 3300046517 Bacteria 11729
617 Ga0495630_0005336 3300046517 Bacteria 9066
618 Ga0495630_0005672 3300046517 Bacteria 8823
619 Ga0495630_0008780 3300046517 Bacteria 7258
620 Ga0495630_0025620 3300046517 Bacteria 4363
621 Ga0495630_0030484 3300046517 Bacteria 4012
622 Ga0495630_0031355 3300046517 Bacteria 3958
623 Ga0495631_0000401 3300046518 Bacteria 29978
624 Ga0495631_0000547 3300046518 Bacteria 25286
625 Ga0495631_0002572 3300046518 Bacteria 10150
626 Ga0495631_0004526 3300046518 Bacteria 7387
627 Ga0495631_0008360 3300046518 Bacteria 5215
628 Ga0495631_0016102 3300046518 Bacteria 3573
629 Ga0495631_0030203 3300046518 Bacteria 2459
630 Ga0495631_0265063 3300046518 Bacteria 732
631 Ga0495632_0001029 3300046519 Bacteria 24117
632 Ga0495632_0001346 3300046519 Bacteria 20643
633 Ga0495632_0002048 3300046519 Bacteria 15845
634 Ga0495632_0002133 3300046519 Bacteria 15386
635 Ga0495632_0002447 3300046519 Bacteria 14128
636 Ga0495632_0003192 3300046519 Bacteria 11807
637 Ga0495632_0004891 3300046519 Bacteria 8981
638 Ga0495632_0007869 3300046519 Bacteria 6627
639 Ga0495632_0008635 3300046519 Bacteria 6222
640 Ga0495632_0008734 3300046519 Bacteria 6177
641 Ga0495632_0012801 3300046519 Bacteria 4815
642 Ga0495632_0019155 3300046519 Bacteria 3735
643 Ga0495632_0022173 3300046519 Bacteria 3408
644 Ga0495632_0177508 3300046519 Bacteria 976
645 Ga0495632_0218483 3300046519 Bacteria 862
646 Ga0495632_0252443 3300046519 Bacteria 791
647 Ga0495637_0000721 3300046520 Bacteria 22609
648 Ga0495637_0000839 3300046520 Bacteria 20292
649 Ga0495637_0001144 3300046520 Bacteria 16251
650 Ga0495637_0001472 3300046520 Bacteria 13823
651 Ga0495637_0002282 3300046520 Bacteria 10628
652 Ga0495637_0003690 3300046520 Bacteria 8087
653 Ga0495637_0004764 3300046520 Bacteria 6997
654 Ga0495637_0006226 3300046520 Bacteria 5999
655 Ga0495637_0021848 3300046520 Bacteria 2927
656 Ga0495637_0044468 3300046520 Bacteria 1890
657 Ga0495637_0057825 3300046520 Bacteria 1600
658 Ga0495643_0006509 3300046522 Bacteria 7685
659 Ga0495643_0008717 3300046522 Bacteria 6397
660 Ga0495643_0010071 3300046522 Bacteria 5830
661 Ga0495643_0016618 3300046522 Bacteria 4322
662 Ga0495643_0021394 3300046522 Bacteria 3711
663 Ga0495643_0024167 3300046522 Bacteria 3448
664 Ga0495643_0026541 3300046522 Bacteria 3267
665 Ga0495643_0033194 3300046522 Bacteria 2858
666 Ga0495643_0037703 3300046522 Bacteria 2649
667 Ga0495643_0066488 3300046522 Bacteria 1901
668 Ga0495644_0000401 3300046523 Bacteria 19425
669 Ga0495644_0000526 3300046523 Bacteria 16273
670 Ga0495644_0004777 3300046523 Bacteria 5322
671 Ga0495644_0026159 3300046523 Bacteria 2215
672 Ga0495644_0032045 3300046523 Bacteria 1987
673 Ga0495644_0038028 3300046523 Bacteria 1815
674 Ga0495648_0000623 3300046524 Bacteria 37962
675 Ga0495648_0001689 3300046524 Bacteria 21357
676 Ga0495648_0005373 3300046524 Bacteria 10660
677 Ga0495648_0007423 3300046524 Bacteria 8771
678 Ga0495648_0007967 3300046524 Bacteria 8402
679 Ga0495648_0009398 3300046524 Bacteria 7586
680 Ga0495648_0027440 3300046524 Bacteria 3810
681 Ga0495648_0028078 3300046524 Bacteria 3752
682 Ga0495648_0034742 3300046524 Bacteria 3277
683 Ga0495648_0036744 3300046524 Bacteria 3154
684 Ga0495648_0048093 3300046524 Bacteria 2629
685 Ga0495648_0052850 3300046524 Bacteria 2464
686 Ga0495648_0056713 3300046524 Bacteria 2354
687 Ga0495648_0058165 3300046524 Bacteria 2313
688 Ga0495648_0090335 3300046524 Bacteria 1716
689 Ga0495648_0158121 3300046524 Bacteria 1174
690 Ga0495648_0177855 3300046524 Bacteria 1084
691 Ga0495648_0229548 3300046524 Bacteria 909
692 Ga0495648_0319765 3300046524 Bacteria 720
693 Ga0495666_0000881 3300046526 Bacteria 14022
694 Ga0495666_0000942 3300046526 Bacteria 13673
695 Ga0495666_0004188 3300046526 Bacteria 7274
696 Ga0495666_0052872 3300046526 Bacteria 1950
697 Ga0495666_0055680 3300046526 Bacteria 1895
698 Ga0495666_0116609 3300046526 Bacteria 1252
699 Ga0495642_0000250 3300046528 Bacteria 30239
700 Ga0495642_0000798 3300046528 Bacteria 15293
701 Ga0495642_0001543 3300046528 Bacteria 10199
702 Ga0495642_0108357 3300046528 Bacteria 1186
703 Ga0495652_0022420 3300046529 Bacteria 5602
704 Ga0495652_0026999 3300046529 Bacteria 5063
705 Ga0495652_0052937 3300046529 Bacteria 3460
706 Ga0495652_0179067 3300046529 Bacteria 1629
707 Ga0495654_0000119 3300046530 Bacteria 88217
708 Ga0495654_0000444 3300046530 Bacteria 35120
709 Ga0495654_0000803 3300046530 Bacteria 24100
710 Ga0495654_0001798 3300046530 Bacteria 14285
711 Ga0495654_0001816 3300046530 Bacteria 14212
712 Ga0495654_0004330 3300046530 Bacteria 8459
713 Ga0495654_0007041 3300046530 Bacteria 6331
714 Ga0495654_0013866 3300046530 Bacteria 4301
715 Ga0495654_0015407 3300046530 Bacteria 4058
716 Ga0495654_0016762 3300046530 Bacteria 3862
717 Ga0495654_0028250 3300046530 Bacteria 2869
718 Ga0495654_0029130 3300046530 Bacteria 2817
719 Ga0495654_0033314 3300046530 Bacteria 2608
720 Ga0495654_0037272 3300046530 Bacteria 2439
721 Ga0495654_0051030 3300046530 Bacteria 2019
722 Ga0495654_0053380 3300046530 Bacteria 1964
723 Ga0495654_0068490 3300046530 Bacteria 1686
724 Ga0495654_0077912 3300046530 Bacteria 1559
725 Ga0495654_0083507 3300046530 Bacteria 1493
726 Ga0495654_0087635 3300046530 Bacteria 1448
727 Ga0495654_0138122 3300046530 Bacteria 1088
728 Ga0495654_0160689 3300046530 Bacteria 986
729 Ga0495665_0009206 3300046531 Bacteria 5349
730 Ga0495665_0063360 3300046531 Bacteria 1951
731 Ga0495665_0178945 3300046531 Bacteria 1102
732 Ga0495640_0139973 3300046533 Bacteria 1560
733 Ga0495640_0161959 3300046533 Bacteria 1433
734 Ga0495586_0001186 3300046535 Bacteria 14628
735 Ga0495586_0060426 3300046535 Bacteria 2061
736 Ga0495586_0154911 3300046535 Bacteria 1290
737 Ga0495587_0001667 3300046536 Bacteria 14824
738 Ga0495587_0005504 3300046536 Bacteria 8261
739 Ga0495587_0198029 3300046536 Bacteria 1136
740 Ga0495609_0001092 3300046538 Bacteria 18861
741 Ga0495609_0001178 3300046538 Bacteria 18050
742 Ga0495609_0005130 3300046538 Bacteria 6975
743 Ga0495609_0006457 3300046538 Bacteria 5979
744 Ga0495609_0007374 3300046538 Bacteria 5498
745 Ga0495609_0008247 3300046538 Bacteria 5114
746 Ga0495609_0010025 3300046538 Bacteria 4562
747 Ga0495609_0017110 3300046538 Bacteria 3370
748 Ga0495609_0090777 3300046538 Bacteria 1328
749 Ga0495609_0119304 3300046538 Bacteria 1135
750 Ga0495609_0162138 3300046538 Bacteria 947
751 Ga0495597_0001040 3300046542 Bacteria 21198
752 Ga0495597_0002603 3300046542 Bacteria 11243
753 Ga0495597_0006345 3300046542 Bacteria 6124
754 Ga0495597_0007238 3300046542 Bacteria 5653
755 Ga0495597_0007413 3300046542 Bacteria 5571
756 Ga0495597_0016705 3300046542 Bacteria 3464
757 Ga0495597_0021142 3300046542 Bacteria 3025
758 Ga0495597_0027018 3300046542 Bacteria 2634
759 Ga0495597_0029411 3300046542 Bacteria 2508
760 Ga0495597_0030625 3300046542 Bacteria 2451
761 Ga0495597_0095100 3300046542 Bacteria 1261
762 Ga0495597_0118741 3300046542 Bacteria 1103
763 Ga0495597_0210507 3300046542 Bacteria 775
764 Ga0495597_0226619 3300046542 Bacteria 740
765 Ga0495597_0245306 3300046542 Bacteria 705
766 Ga0495645_0000929 3300046543 Bacteria 19941
767 Ga0495645_0134348 3300046543 Bacteria 1731
768 Ga0495645_0244861 3300046543 Bacteria 1194
769 Ga0495622_0000100 3300046557 Bacteria 76484
770 Ga0495622_0000537 3300046557 Bacteria 22795
771 Ga0495622_0002203 3300046557 Bacteria 9505
772 Ga0495622_0002455 3300046557 Bacteria 8984
773 Ga0495622_0003767 3300046557 Bacteria 7092
774 Ga0495622_0033479 3300046557 Bacteria 2398
775 Ga0495622_0113095 3300046557 Bacteria 1242
776 Ga0495633_0000867 3300046558 Bacteria 26255
777 Ga0495633_0003311 3300046558 Bacteria 10827
778 Ga0495633_0011125 3300046558 Bacteria 4877
779 Ga0495633_0060458 3300046558 Bacteria 1775
780 Ga0495633_0143632 3300046558 Bacteria 1103
781 Ga0495667_0046267 3300046559 Bacteria 2878
782 Ga0495656_0003297 3300046615 Bacteria 5447
783 Ga0495656_0138425 3300046615 Bacteria 1165
784 Ga0495668_0000046 3300046616 Bacteria 224203
785 Ga0495668_0002037 3300046616 Bacteria 17610
786 Ga0495668_0002511 3300046616 Bacteria 14993
787 Ga0495668_0010183 3300046616 Bacteria 5714
788 Ga0495668_0011417 3300046616 Bacteria 5317
789 Ga0495668_0015379 3300046616 Bacteria 4470
790 Ga0495634_0001891 3300046642 Bacteria 17961
791 Ga0495634_0004652 3300046642 Bacteria 10688
792 Ga0495634_0016202 3300046642 Bacteria 5333
793 Ga0495634_0025679 3300046642 Bacteria 4115
794 Ga0495611_0000468 3300046648 Bacteria 24110
795 Ga0495611_0003233 3300046648 Bacteria 7210
796 Ga0495611_0009412 3300046648 Bacteria 4129
797 Ga0495611_0034799 3300046648 Bacteria 2228
798 Ga0495611_0041921 3300046648 Bacteria 2043
799 Ga0495611_0151381 3300046648 Bacteria 1083
800 Ga0495611_0189701 3300046648 Bacteria 959
801 Ga0495625_0000656 3300046660 Bacteria 49427
802 Ga0495625_0002907 3300046660 Bacteria 17906
803 Ga0495625_0003826 3300046660 Bacteria 14561
804 Ga0495625_0004795 3300046660 Bacteria 12646
805 Ga0495625_0004936 3300046660 Bacteria 12404
806 Ga0495625_0013653 3300046660 Bacteria 6514
807 Ga0495625_0014469 3300046660 Bacteria 6294
808 Ga0495625_0017184 3300046660 Bacteria 5665
809 Ga0495625_0017980 3300046660 Bacteria 5525
810 Ga0495625_0035357 3300046660 Bacteria 3683
811 Ga0495625_0036130 3300046660 Bacteria 3634
812 Ga0495625_0042924 3300046660 Bacteria 3282
813 Ga0495625_0056966 3300046660 Bacteria 2780
814 Ga0495625_0066346 3300046660 Bacteria 2542
815 Ga0495625_0109437 3300046660 Bacteria 1890
816 Ga0495635_0001260 3300046663 Bacteria 16939
817 Ga0495635_0004925 3300046663 Bacteria 9294
818 Ga0495635_0036110 3300046663 Bacteria 3426
819 Ga0495659_0000187 3300046664 Bacteria 26826
820 Ga0495659_0000756 3300046664 Bacteria 11612
821 Ga0495659_0001064 3300046664 Bacteria 9586
822 Ga0495659_0002715 3300046664 Bacteria 5690
823 Ga0495659_0085173 3300046664 Bacteria 1205
824 Ga0495661_0001936 3300046665 Bacteria 16465
825 Ga0495661_0002542 3300046665 Bacteria 13995
826 Ga0495661_0005297 3300046665 Bacteria 9170
827 Ga0495661_0015539 3300046665 Bacteria 5079
828 Ga0495661_0019331 3300046665 Bacteria 4466
829 Ga0495661_0019413 3300046665 Bacteria 4453
830 Ga0495661_0030604 3300046665 Bacteria 3425
831 Ga0495661_0046123 3300046665 Bacteria 2662
832 Ga0495661_0068629 3300046665 Bacteria 2079
833 Ga0495661_0102995 3300046665 Bacteria 1603
834 Ga0495661_0174244 3300046665 Bacteria 1145
835 Ga0495588_0005089 3300046674 Bacteria 5842
836 Ga0495588_0032240 3300046674 Bacteria 2640
837 Ga0495588_0049467 3300046674 Bacteria 2161
838 Ga0495588_0127731 3300046674 Bacteria 1341
839 Ga0495588_0200062 3300046674 Bacteria 1055
840 Ga0495599_0007511 3300046678 Bacteria 6609
841 Ga0495599_0014538 3300046678 Bacteria 4874
842 Ga0495599_0031814 3300046678 Bacteria 3311
843 Ga0495599_0371728 3300046678 Bacteria 854
844 Ga0495623_0001367 3300046679 Bacteria 16547
845 Ga0495623_0004123 3300046679 Bacteria 9577
846 Ga0495623_0019477 3300046679 Bacteria 4385
847 Ga0495646_0001267 3300046680 Bacteria 14846
848 Ga0495646_0003933 3300046680 Bacteria 9288
849 Ga0495646_0009742 3300046680 Bacteria 6102
850 Ga0495646_0019328 3300046680 Bacteria 4314
851 Ga0495646_0034323 3300046680 Bacteria 3151
852 Ga0495646_0054571 3300046680 Bacteria 2403
853 Ga0495646_0121763 3300046680 Bacteria 1475
854 Ga0495669_0002519 3300046684 Bacteria 7481
855 Ga0495669_0041127 3300046684 Bacteria 2051
856 Ga0495613_0002750 3300046689 Bacteria 13210
857 Ga0495613_0016685 3300046689 Bacteria 5467
858 Ga0495613_0039129 3300046689 Bacteria 3515
859 Ga0495613_0097259 3300046689 Bacteria 2128
860 Ga0495624_0001286 3300046690 Bacteria 19787
861 Ga0495624_0002152 3300046690 Bacteria 15026
862 Ga0495624_0008717 3300046690 Bacteria 7060
863 Ga0495624_0025376 3300046690 Bacteria 3891
864 Ga0495624_0046070 3300046690 Bacteria 2773
865 Ga0495670_0001990 3300046691 Bacteria 10036
866 Ga0495670_0008439 3300046691 Bacteria 5065
867 Ga0495670_0008797 3300046691 Bacteria 4969
868 Ga0495670_0008798 3300046691 Bacteria 4969
869 Ga0495670_0009884 3300046691 Bacteria 4692
870 Ga0495670_0056259 3300046691 Bacteria 1973
871 Ga0495670_0087518 3300046691 Bacteria 1592
872 Ga0495670_0121790 3300046691 Bacteria 1355
873 Ga0495670_0478620 3300046691 Bacteria 675
874 Ga0495671_0000086 3300046692 Bacteria 87499
875 Ga0495671_0003431 3300046692 Bacteria 9734
876 Ga0495671_0003491 3300046692 Bacteria 9641
877 Ga0495671_0004200 3300046692 Bacteria 8674
878 Ga0495671_0004655 3300046692 Bacteria 8127
879 Ga0495671_0005088 3300046692 Bacteria 7737
880 Ga0495671_0005497 3300046692 Bacteria 7416
881 Ga0495671_0007897 3300046692 Bacteria 6018
882 Ga0495671_0009775 3300046692 Bacteria 5343
883 Ga0495671_0013921 3300046692 Bacteria 4339
884 Ga0495671_0059717 3300046692 Bacteria 1883
885 Ga0495671_0081549 3300046692 Bacteria 1585
886 Ga0495671_0204833 3300046692 Bacteria 956
887 Ga0495649_0001286 3300046694 Bacteria 19267
888 Ga0495649_0001615 3300046694 Bacteria 16790
889 Ga0495649_0001875 3300046694 Bacteria 15372
890 Ga0495649_0005499 3300046694 Bacteria 8037
891 Ga0495649_0005936 3300046694 Bacteria 7657
892 Ga0495649_0008206 3300046694 Bacteria 6293
893 Ga0495649_0015998 3300046694 Bacteria 4258
894 Ga0495649_0024273 3300046694 Bacteria 3381
895 Ga0495649_0048053 3300046694 Bacteria 2319
896 Ga0495649_0048331 3300046694 Bacteria 2312
897 Ga0495649_0050521 3300046694 Bacteria 2256
898 Ga0495649_0068269 3300046694 Bacteria 1907
899 Ga0495649_0101251 3300046694 Bacteria 1531
900 Ga0495649_0131941 3300046694 Bacteria 1318
901 Ga0495649_0134034 3300046694 Bacteria 1306
902 Ga0495649_0379558 3300046694 Bacteria 711
903 Ga0495589_0000763 3300046794 Bacteria 20550
904 Ga0495589_0001331 3300046794 Bacteria 14516
905 Ga0495589_0001530 3300046794 Bacteria 13312
906 Ga0495589_0001826 3300046794 Bacteria 12108
907 Ga0495589_0005066 3300046794 Bacteria 6972
908 Ga0495589_0005481 3300046794 Bacteria 6692
909 Ga0495589_0006916 3300046794 Bacteria 5957
910 Ga0495589_0018545 3300046794 Bacteria 3567
911 Ga0495589_0031152 3300046794 Bacteria 2685
912 Ga0495589_0051898 3300046794 Bacteria 2026
913 Ga0495600_0001304 3300046809 Bacteria 13757
914 Ga0495600_0002832 3300046809 Bacteria 10089
915 Ga0495660_0001979 3300046810 Bacteria 13344
916 Ga0495660_0002830 3300046810 Bacteria 10913
917 Ga0495660_0004168 3300046810 Bacteria 8790
918 Ga0495660_0006459 3300046810 Bacteria 6933
919 Ga0495660_0009176 3300046810 Bacteria 5777
920 Ga0495660_0010035 3300046810 Bacteria 5508
921 Ga0495660_0010730 3300046810 Bacteria 5324
922 Ga0495660_0012868 3300046810 Bacteria 4852
923 Ga0495660_0013424 3300046810 Bacteria 4746
924 Ga0495660_0013641 3300046810 Bacteria 4710
925 Ga0495660_0016250 3300046810 Bacteria 4292
926 Ga0495660_0019589 3300046810 Bacteria 3884
927 Ga0495660_0020271 3300046810 Bacteria 3810
928 Ga0495660_0034008 3300046810 Bacteria 2854
929 Ga0495660_0035946 3300046810 Bacteria 2764
930 Ga0495660_0037559 3300046810 Bacteria 2696
931 Ga0495660_0064039 3300046810 Bacteria 1966
932 Ga0495660_0071118 3300046810 Bacteria 1845
933 Ga0495660_0072437 3300046810 Bacteria 1824
934 Ga0495660_0129148 3300046810 Bacteria 1270
935 Ga0495660_0132588 3300046810 Bacteria 1248
936 Ga0495660_0142814 3300046810 Bacteria 1189
937 Ga0495660_0146984 3300046810 Bacteria 1167
938 Ga0495581_0001153 3300047315 Bacteria 14465
939 Ga0495581_0005412 3300047315 Bacteria 7387
940 Ga0495581_0018166 3300047315 Bacteria 4085
941 Ga0495604_0000139 3300047317 Bacteria 62007
942 Ga0495604_0002849 3300047317 Bacteria 13881
943 Ga0495604_0007066 3300047317 Bacteria 8905
944 Ga0495604_0011039 3300047317 Bacteria 7169
945 Ga0495604_0038541 3300047317 Bacteria 3759
946 Ga0495604_0054469 3300047317 Bacteria 3086
947 Ga0495636_0002708 3300047318 Bacteria 6836
948 Ga0495636_0071284 3300047318 Bacteria 1483
949 Ga0495636_0108161 3300047318 Bacteria 1221
950 Ga0495674_0010496 3300047319 Bacteria 8764
951 Ga0495674_0012924 3300047319 Bacteria 7862
952 Ga0495674_0050534 3300047319 Bacteria 3668
953 Ga0495674_0079119 3300047319 Bacteria 2823
954 Ga0495674_0421317 3300047319 Bacteria 1076
955 Ga0495672_0001748 3300047320 Bacteria 20975
956 Ga0495672_0001963 3300047320 Bacteria 19441
957 Ga0495672_0002470 3300047320 Bacteria 16990
958 Ga0495672_0002731 3300047320 Bacteria 15820
959 Ga0495672_0003013 3300047320 Bacteria 14812
960 Ga0495672_0003388 3300047320 Bacteria 13709
961 Ga0495672_0004190 3300047320 Bacteria 11947
962 Ga0495672_0006077 3300047320 Bacteria 9434
963 Ga0495672_0008385 3300047320 Bacteria 7638
964 Ga0495672_0011393 3300047320 Bacteria 6279
965 Ga0495672_0011726 3300047320 Bacteria 6163
966 Ga0495672_0013597 3300047320 Bacteria 5606
967 Ga0495672_0017216 3300047320 Bacteria 4838
968 Ga0495672_0019212 3300047320 Bacteria 4513
969 Ga0495672_0025035 3300047320 Bacteria 3829
970 Ga0495672_0058335 3300047320 Bacteria 2238
971 Ga0495672_0060470 3300047320 Bacteria 2188
972 Ga0495672_0107037 3300047320 Bacteria 1506
973 Ga0495672_0144993 3300047320 Bacteria 1236
974 Ga0495676_0001430 3300047321 Bacteria 20579
975 Ga0495676_0007004 3300047321 Bacteria 10347
976 Ga0495676_0010886 3300047321 Bacteria 8223
977 Ga0495676_0076388 3300047321 Bacteria 2558
978 Ga0495676_0496596 3300047321 Bacteria 801
979 Ga0495680_0004433 3300047322 Bacteria 13408
980 Ga0495680_0004958 3300047322 Bacteria 12594
981 Ga0495680_0005052 3300047322 Bacteria 12458
982 Ga0495680_0016592 3300047322 Bacteria 6321
983 Ga0495680_0022768 3300047322 Bacteria 5217
984 Ga0495680_0025328 3300047322 Bacteria 4912
985 Ga0495680_0038333 3300047322 Bacteria 3830
986 Ga0495680_0047911 3300047322 Bacteria 3358
987 Ga0495680_0163258 3300047322 Bacteria 1616
988 Ga0495683_0000479 3300047323 Bacteria 31100
989 Ga0495683_0000866 3300047323 Bacteria 21366
990 Ga0495683_0001889 3300047323 Bacteria 13113
991 Ga0495683_0006160 3300047323 Bacteria 6575
992 Ga0495683_0006709 3300047323 Bacteria 6268
993 Ga0495683_0009521 3300047323 Bacteria 5174
994 Ga0495683_0010817 3300047323 Bacteria 4812
995 Ga0495683_0011405 3300047323 Bacteria 4676
996 Ga0495683_0014174 3300047323 Bacteria 4153
997 Ga0495683_0015409 3300047323 Bacteria 3979
998 Ga0495683_0028585 3300047323 Bacteria 2849
999 Ga0495683_0033154 3300047323 Bacteria 2629
1000 Ga0495683_0033159 3300047323 Bacteria 2629
1001 Ga0495683_0049961 3300047323 Bacteria 2093
1002 Ga0495683_0079330 3300047323 Bacteria 1603
1003 Ga0495687_002016 3300047443 Bacteria 17193
1004 Ga0495687_002564 3300047443 Bacteria 14339
1005 Ga0495687_002722 3300047443 Bacteria 13710
1006 Ga0495687_006299 3300047443 Bacteria 7312
1007 Ga0495687_006654 3300047443 Bacteria 7022
1008 Ga0495687_124018 3300047443 Bacteria 926
1009 Ga0495675_0014104 3300047444 Bacteria 5052
1010 Ga0495677_0000823 3300047445 Bacteria 12524
1011 Ga0495677_0021872 3300047445 Bacteria 2317
1012 Ga0495677_0072991 3300047445 Bacteria 1280
1013 Ga0495677_0213829 3300047445 Bacteria 750
1014 Ga0495679_000006 3300047446 Bacteria 449956
1015 Ga0495679_000255 3300047446 Bacteria 44133
1016 Ga0495679_000338 3300047446 Bacteria 37011
1017 Ga0495679_000950 3300047446 Bacteria 18019
1018 Ga0495679_001008 3300047446 Bacteria 17324
1019 Ga0495679_002833 3300047446 Bacteria 8597
1020 Ga0495679_003804 3300047446 Bacteria 7146
1021 Ga0495679_015856 3300047446 Bacteria 2740
1022 Ga0495679_084454 3300047446 Bacteria 897
1023 Ga0495679_128260 3300047446 Bacteria 689
1024 Ga0495673_0000753 3300047469 Bacteria 30736
1025 Ga0495673_0001022 3300047469 Bacteria 24666
1026 Ga0495673_0001887 3300047469 Bacteria 15731
1027 Ga0495673_0001929 3300047469 Bacteria 15429
1028 Ga0495673_0001951 3300047469 Bacteria 15314
1029 Ga0495673_0007557 3300047469 Bacteria 6223
1030 Ga0495673_0008279 3300047469 Bacteria 5864
1031 Ga0495673_0008945 3300047469 Bacteria 5577
1032 Ga0495673_0010039 3300047469 Bacteria 5184
1033 Ga0495673_0014726 3300047469 Bacteria 4058
1034 Ga0495673_0014755 3300047469 Bacteria 4052
1035 Ga0495673_0019536 3300047469 Bacteria 3392
1036 Ga0495673_0021204 3300047469 Bacteria 3214
1037 Ga0495673_0024613 3300047469 Bacteria 2904
1038 Ga0495673_0035136 3300047469 Bacteria 2312
1039 Ga0495673_0053740 3300047469 Bacteria 1754
1040 Ga0495673_0057878 3300047469 Bacteria 1672
1041 Ga0495673_0111767 3300047469 Bacteria 1091
1042 Ga0495673_0150140 3300047469 Bacteria 901
1043 Ga0495681_0000859 3300047470 Bacteria 23363
1044 Ga0495681_0001388 3300047470 Bacteria 18274
1045 Ga0495681_0001461 3300047470 Bacteria 17673
1046 Ga0495681_0001998 3300047470 Bacteria 14903
1047 Ga0495681_0002273 3300047470 Bacteria 13809
1048 Ga0495681_0002563 3300047470 Bacteria 12928
1049 Ga0495681_0007561 3300047470 Bacteria 6916
1050 Ga0495681_0010553 3300047470 Bacteria 5587
1051 Ga0495681_0010642 3300047470 Bacteria 5557
1052 Ga0495681_0011435 3300047470 Bacteria 5286
1053 Ga0495681_0012938 3300047470 Bacteria 4877
1054 Ga0495681_0029464 3300047470 Bacteria 2808
1055 Ga0495681_0033465 3300047470 Bacteria 2573
1056 Ga0495681_0045005 3300047470 Bacteria 2116
1057 Ga0495681_0046459 3300047470 Bacteria 2070
1058 Ga0495681_0070875 3300047470 Bacteria 1579
1059 Ga0495681_0084594 3300047470 Bacteria 1410
1060 Ga0495681_0119482 3300047470 Bacteria 1132
1061 Ga0495681_0162908 3300047470 Bacteria 927
1062 Ga0495684_0007183 3300047471 Bacteria 8647
1063 Ga0495684_0026261 3300047471 Bacteria 4474
1064 Ga0495684_0482578 3300047471 Bacteria 856
1065 Ga0495686_0002014 3300047472 Bacteria 20088
1066 Ga0495686_0005315 3300047472 Bacteria 10203
1067 Ga0495686_0005657 3300047472 Bacteria 9784
1068 Ga0495686_0006245 3300047472 Bacteria 9175
1069 Ga0495686_0015272 3300047472 Bacteria 5250
1070 Ga0495686_0049607 3300047472 Bacteria 2640
1071 Ga0495686_0138376 3300047472 Bacteria 1438
1072 Ga0495686_0349437 3300047472 Bacteria 804
1073 Ga0495593_0001890 3300047673 Bacteria 12468
1074 Ga0495593_0003048 3300047673 Bacteria 10096
1075 Ga0495593_0006894 3300047673 Bacteria 6653
1076 Ga0495593_0007757 3300047673 Bacteria 6255
1077 Ga0495593_0015910 3300047673 Bacteria 4250
1078 Ga0495593_0096733 3300047673 Bacteria 1517
1079 Ga0495602_0005007 3300048088 Bacteria 13890
1080 Ga0495602_0006457 3300048088 Bacteria 12295
1081 Ga0495602_0063991 3300048088 Bacteria 3183
1082 Ga0495602_0077740 3300048088 Bacteria 2806
1083 Ga0495602_0116918 3300048088 Bacteria 2154
1084 Ga0495602_0176958 3300048088 Bacteria 1649
1085 Ga0495602_0305300 3300048088 Bacteria 1163
1086 Ga0495602_0320015 3300048088 Bacteria 1129
1087 Ga0495602_0739639 3300048088 Bacteria 665
1088 Ga0495614_0004013 3300048089 Bacteria 6607
1089 Ga0495614_0076418 3300048089 Bacteria 1447
1090 Ga0495614_0089806 3300048089 Bacteria 1336
1091 Ga0495626_0000536 3300048091 Bacteria 37711
1092 Ga0495626_0001094 3300048091 Bacteria 22950
1093 Ga0495626_0001115 3300048091 Bacteria 22667
1094 Ga0495626_0001132 3300048091 Bacteria 22286
1095 Ga0495626_0001219 3300048091 Bacteria 21187
1096 Ga0495626_0001596 3300048091 Bacteria 17673
1097 Ga0495626_0001943 3300048091 Bacteria 15346
1098 Ga0495626_0013436 3300048091 Bacteria 4255
1099 Ga0495626_0015767 3300048091 Bacteria 3858
1100 Ga0495626_0017675 3300048091 Bacteria 3595
1101 Ga0495626_0019064 3300048091 Bacteria 3433
1102 Ga0495626_0024506 3300048091 Bacteria 2957
1103 Ga0495626_0046173 3300048091 Bacteria 2030
1104 Ga0495626_0048001 3300048091 Bacteria 1982
1105 Ga0495626_0089214 3300048091 Bacteria 1358
1106 Ga0495626_0118988 3300048091 Bacteria 1137
1107 Ga0495626_0146873 3300048091 Bacteria 996
1108 Ga0495626_0200848 3300048091 Bacteria 817
1109 Ga0496100_0000689 3300048903 Bacteria 16122
1110 Ga0496100_0042244 3300048903 Bacteria 2911
1111 Ga0496101_0000146 3300048904 Bacteria 61436
1112 Ga0496102_0002255 3300048905 Bacteria 16515
1113 Ga0496102_0031371 3300048905 Bacteria 4766
1114 Ga0496102_0076400 3300048905 Bacteria 3081
1115 Ga0496102_0231059 3300048905 Bacteria 1744
1116 Ga0496103_0000869 3300048906 Bacteria 21970
1117 Ga0496103_0007656 3300048906 Bacteria 6425
1118 Ga0496103_0325571 3300048906 Bacteria 988
1119 Ga0496104_0125782 3300048907 Bacteria 2461
1120 Ga0496104_0150268 3300048907 Bacteria 2236
1121 Ga0496104_0214656 3300048907 Bacteria 1836
1122 Ga0496105_0116921 3300048908 Bacteria 2199
1123 Ga0496105_0150906 3300048908 Bacteria 1910
1124 Ga0496105_0420147 3300048908 Bacteria 1059
1125 Ga0496106_0000025 3300048909 Bacteria 154905
1126 Ga0496106_0033190 3300048909 Bacteria 3851
1127 Ga0496106_0122910 3300048909 Bacteria 2030
1128 Ga0496106_0175482 3300048909 Bacteria 1700
1129 Ga0496107_0050994 3300048910 Bacteria 2984
1130 Ga0496110_0021050 3300048913 Bacteria 5513
1131 Ga0496111_0005004 3300048914 Bacteria 8432
1132 Ga0496112_0004106 3300048915 Bacteria 12240
1133 Ga0496112_0077343 3300048915 Bacteria 3291
1134 Ga0496113_0028999 3300048916 Bacteria 3989
1135 Ga0496114_0273439 3300048917 Bacteria 1489
1136 Ga0496114_0637449 3300048917 Bacteria 938
1137 Ga0496114_0932585 3300048917 Bacteria 750
1138 Ga0496115_0336673 3300048918 Bacteria 1232
1139 Ga0496116_0000850 3300048919 Bacteria 38248
1140 Ga0496116_0003545 3300048919 Bacteria 15358
1141 Ga0496116_0004169 3300048919 Bacteria 13916
1142 Ga0496117_0000100 3300048920 Bacteria 194307
1143 Ga0496117_0002589 3300048920 Bacteria 22507
1144 Ga0496117_0003557 3300048920 Bacteria 17981
1145 Ga0496117_0005466 3300048920 Bacteria 13326
1146 Ga0496117_0006374 3300048920 Bacteria 11985
1147 Ga0496117_0009527 3300048920 Bacteria 9018
1148 Ga0496117_0014885 3300048920 Bacteria 6672
1149 Ga0496117_0016891 3300048920 Bacteria 6124
1150 Ga0496117_0018686 3300048920 Bacteria 5729
1151 Ga0496117_0018975 3300048920 Bacteria 5668
1152 Ga0496117_0022966 3300048920 Bacteria 4989
1153 Ga0496117_0029296 3300048920 Bacteria 4247
1154 Ga0496117_0029407 3300048920 Bacteria 4237
1155 Ga0496117_0042309 3300048920 Bacteria 3325
1156 Ga0496117_0061731 3300048920 Bacteria 2573
1157 Ga0496117_0130995 3300048920 Bacteria 1520
1158 Ga0496117_0261949 3300048920 Bacteria 937
1159 Ga0496118_0000259 3300048921 Bacteria 93615
1160 Ga0496118_0000764 3300048921 Bacteria 51618
1161 Ga0496118_0001443 3300048921 Bacteria 35769
1162 Ga0496118_0004443 3300048921 Bacteria 16636
1163 Ga0496118_0004939 3300048921 Bacteria 15459
1164 Ga0496118_0006129 3300048921 Bacteria 13353
1165 Ga0496118_0012630 3300048921 Bacteria 8081
1166 Ga0496118_0014114 3300048921 Bacteria 7494
1167 Ga0496118_0019758 3300048921 Bacteria 6007
1168 Ga0496118_0025409 3300048921 Bacteria 5081
1169 Ga0496118_0035374 3300048921 Bacteria 4056
1170 Ga0496118_0036573 3300048921 Bacteria 3966
1171 Ga0496118_0058542 3300048921 Bacteria 2878
1172 Ga0496118_0060378 3300048921 Bacteria 2815
1173 Ga0496118_0063124 3300048921 Bacteria 2728
1174 Ga0496119_0001925 3300048922 Bacteria 23695
1175 Ga0496119_0005072 3300048922 Bacteria 12785
1176 Ga0496119_0079815 3300048922 Bacteria 1888
1177 Ga0496119_0104357 3300048922 Bacteria 1586
1178 Ga0496119_0120811 3300048922 Bacteria 1440
1179 Ga0496120_0001659 3300048923 Bacteria 25706
1180 Ga0496120_0001680 3300048923 Bacteria 25410
1181 Ga0496120_0029277 3300048923 Bacteria 3363
1182 Ga0496121_0002008 3300048924 Bacteria 32330
1183 Ga0496121_0003090 3300048924 Bacteria 24094
1184 Ga0496121_0003136 3300048924 Bacteria 23852
1185 Ga0496121_0007455 3300048924 Bacteria 13216
1186 Ga0496121_0010399 3300048924 Bacteria 10501
1187 Ga0496121_0018540 3300048924 Bacteria 7011
1188 Ga0496121_0019189 3300048924 Bacteria 6851
1189 Ga0496121_0048255 3300048924 Bacteria 3624
1190 Ga0496121_0071919 3300048924 Bacteria 2779
1191 Ga0496122_0002383 3300048925 Bacteria 26887
1192 Ga0496122_0029934 3300048925 Bacteria 4575
1193 Ga0496122_0031470 3300048925 Bacteria 4414
1194 Ga0496122_0045025 3300048925 Bacteria 3434
1195 Ga0496122_0055139 3300048925 Bacteria 2977
1196 Ga0496122_0067945 3300048925 Bacteria 2563
1197 Ga0496122_0078331 3300048925 Bacteria 2315
1198 Ga0496123_0006957 3300048926 Bacteria 10807
1199 Ga0496123_0016449 3300048926 Bacteria 6006
1200 Ga0496123_0080355 3300048926 Bacteria 1987
1201 Ga0496123_0125027 3300048926 Bacteria 1437
1202 Ga0496123_0140611 3300048926 Bacteria 1320
1203 Ga0496123_0244790 3300048926 Bacteria 888
1204 Ga0496124_0000338 3300048927 Bacteria 85856
1205 Ga0496124_0007159 3300048927 Bacteria 11933
1206 Ga0496124_0012553 3300048927 Bacteria 8348
1207 Ga0496124_0022558 3300048927 Bacteria 5766
1208 Ga0496124_0033071 3300048927 Bacteria 4554
1209 Ga0496124_0086654 3300048927 Bacteria 2562
1210 Ga0496124_0108920 3300048927 Bacteria 2233
1211 Ga0496124_0190173 3300048927 Bacteria 1572
1212 Ga0496124_0193572 3300048927 Bacteria 1553
1213 Ga0496125_0001717 3300048928 Bacteria 30474
1214 Ga0496125_0011867 3300048928 Bacteria 8680
1215 Ga0496125_0012068 3300048928 Bacteria 8597
1216 Ga0496125_0012384 3300048928 Bacteria 8470
1217 Ga0496125_0019229 3300048928 Bacteria 6451
1218 Ga0496125_0030510 3300048928 Bacteria 4822
1219 Ga0496125_0056589 3300048928 Bacteria 3183
1220 Ga0496125_0079669 3300048928 Bacteria 2511
1221 Ga0496126_0000256 3300048929 Bacteria 114585
1222 Ga0496126_0000598 3300048929 Bacteria 68057
1223 Ga0496126_0002320 3300048929 Bacteria 26101
1224 Ga0496126_0005670 3300048929 Bacteria 14170
1225 Ga0496126_0048541 3300048929 Bacteria 3878
1226 Ga0496126_0278904 3300048929 Bacteria 1385
1227 Ga0496126_0399738 3300048929 Bacteria 1114
1228 Ga0495678_000954 3300049459 Bacteria 25047
1229 Ga0495678_001864 3300049459 Bacteria 15356
1230 Ga0495678_003854 3300049459 Bacteria 9012
1231 Ga0495678_005291 3300049459 Bacteria 7168
1232 Ga0495678_006284 3300049459 Bacteria 6339
1233 Ga0495678_006384 3300049459 Bacteria 6285
1234 Ga0495678_010860 3300049459 Bacteria 4394
1235 Ga0495678_014751 3300049459 Bacteria 3622
1236 Ga0495678_025998 3300049459 Bacteria 2506
1237 Ga0495678_080904 3300049459 Bacteria 1166
1238 Ga0495678_084863 3300049459 Bacteria 1128
1239 Ga0495678_098325 3300049459 Bacteria 1018
1240 Ga0495678_150646 3300049459 Bacteria 751
1241 Ga0495682_0000556 3300049460 Bacteria 25639
1242 Ga0495682_0001075 3300049460 Bacteria 16065
1243 Ga0495682_0019410 3300049460 Bacteria 2557
1244 Ga0495682_0022513 3300049460 Bacteria 2357
1245 Ga0495682_0023384 3300049460 Bacteria 2306
1246 Ga0495682_0080530 3300049460 Bacteria 1171
1247 Ga0495682_0082577 3300049460 Bacteria 1155
1248 Ga0495682_0108119 3300049460 Bacteria 996
1249 Ga0501279_007241 3300049775 Bacteria 1472
1250 nmdc:mga03683_31979_c1 3300050489 Bacteria 2114
1251 nmdc:mga03683_32992_c1 3300050489 Bacteria 2086
1252 nmdc:mga00v17_133316_c1 3300050491 Bacteria 1589
1253 nmdc:mga00v17_256436_c1 3300050491 Bacteria 1134
1254 nmdc:mga00v17_57873_c1 3300050491 Bacteria 2372
1255 nmdc:mga08x19_185677_c1 3300050514 Bacteria 1421
1256 nmdc:mga08x19_39520_c1 3300050514 Bacteria 2999
1257 Ga0500572_001701 3300053111 Bacteria 5724
1258 Ga0500621_035845 3300053126 Bacteria 1989
1259 Ga0500634_0000284 3300053161 Bacteria 16228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10001056 Ga0157371_1000105623 189
2 3300009177 Ga0105248_10820398 Ga0105248_108203982 194
3 3300009011 Ga0105251_10015364 Ga0105251_100153641 195
4 3300025735 Ga0207713_1064331 Ga0207713_10643312 195
5 3300042016 Ga0439463_000045 Ga0439463_000045_13787_14407 195
6 3300047470 Ga0495681_0119482 Ga0495681_0119482_246_866 195
7 3300025295 Ga0209564_1005222 Ga0209564_10052223 196
8 3300044684 Ga0466966_0226826 Ga0466966_0226826_328_948 196
9 3300003771 Ga0055526_1003490 Ga0055526_10034909 198
10 3300003773 Ga0055537_1000822 Ga0055537_10008229 198
11 3300003775 Ga0055524_1005634 Ga0055524_10056345 198
12 3300003784 Ga0055534_1000601 Ga0055534_10006019 198
13 3300003790 Ga0055528_1000050 Ga0055528_100005081 198
14 3300025263 Ga0209565_1000018 Ga0209565_1000018168 198
15 3300025273 Ga0209673_1000090 Ga0209673_10000909 198
16 3300025291 Ga0209675_1000005 Ga0209675_1000005168 198
17 3300025295 Ga0209564_1000078 Ga0209564_100007896 198
18 3300025299 Ga0209256_1000070 Ga0209256_1000070117 198
19 3300046512 Ga0495610_0011235 Ga0495610_0011235_2018_2668 198
20 3300046615 Ga0495656_0138425 Ga0495656_0138425_511_1107 198
21 3300013102 Ga0157371_10000115 Ga0157371_1000011555 199
22 3300047318 Ga0495636_0071284 Ga0495636_0071284_873_1472 199
23 3300047443 Ga0495687_124018 Ga0495687_124018_316_915 199
24 3300002738 JGI25154J39366_1008458 JGI25154J39366_10084582 200
25 3300003751 Ga0055538_1000007 Ga0055538_1000007332 200
26 3300003752 Ga0055539_1000011 Ga0055539_1000011332 200
27 3300003756 Ga0055533_1000014 Ga0055533_1000014332 200
28 3300003758 Ga0055532_1000009 Ga0055532_1000009332 200
29 3300003759 Ga0055525_1000016 Ga0055525_1000016332 200
30 3300003761 Ga0055535_1003856 Ga0055535_10038563 200
31 3300003841 Ga0055541_1000008 Ga0055541_1000008332 200
32 iso_pu_bacteria 8056148874 8056150742 200
33 3300002705 JGI25156J39149_1000636 JGI25156J39149_10006363 201
34 3300003354 JGI25160J50197_1000292 JGI25160J50197_10002928 201
35 3300005262 Ga0065165_1000965 Ga0065165_100096533 201
36 3300025256 Ga0209759_1000010 Ga0209759_1000010352 201
37 3300025302 Ga0207426_1000020 Ga0207426_100002092 201
38 3300027312 Ga0209371_1013184 Ga0209371_10131843 201
39 3300030500 Ga0268256_1002198 Ga0268256_10021982 201
40 iso_pu_bacteria 2501025501 2501069490 202
41 iso_pu_bacteria 2501025504 2501413199 202
42 iso_pu_bacteria 2508501125 2509126926 202
43 iso_pu_bacteria 2510917013 2511087445 202
44 iso_pu_bacteria 2510917014 2511100357 202
45 iso_pu_bacteria 2510917015 2511105976 202
46 iso_pu_bacteria 2511231004 2511257769 202
47 iso_pu_bacteria 2511231006 2511268661 202
48 iso_pu_bacteria 2511231006 2511268692 202
49 iso_pu_bacteria 2511231007 2511271598 202
50 iso_pu_bacteria 2511231008 2511276785 202
51 iso_pu_bacteria 2511231010 2511291319 202
52 iso_pu_bacteria 2511231011 2511296513 202
53 iso_pu_bacteria 2511231012 2511302789 202
54 iso_pu_bacteria 2511231014 2511311758 202
55 iso_pu_bacteria 2511231015 2511323360 202
56 iso_pu_bacteria 2511231016 2511326706 202
57 iso_pu_bacteria 2511231017 2511331438 202
58 iso_pu_bacteria 2511231018 2511338212 202
59 iso_pu_bacteria 2511231019 2511343264 202
60 iso_pu_bacteria 2511231020 2511350945 202
61 iso_pu_bacteria 2511231021 2511358829 202
62 iso_pu_bacteria 2511231022 2511360802 202
63 iso_pu_bacteria 2511231031 2511414318 202
64 iso_pu_bacteria 2512047018 2512323494 202
65 iso_pu_bacteria 2513237082 2513551891 202
66 iso_pu_bacteria 2513237083 2513563338 202
67 iso_pu_bacteria 2513237151 2513963309 202
68 iso_pu_bacteria 2513237166 2514049554 202
69 iso_pu_bacteria 2515154189 2516017794 202
70 iso_pu_bacteria 2526164713 2527076783 202
71 iso_pu_bacteria 2562617112 2563063456 202
72 iso_pu_bacteria 2597489887 2597857741 202
73 iso_pu_bacteria 2599185161 2599363705 202
74 iso_pu_bacteria 2599185162 2599370025 202
75 iso_pu_bacteria 2599185163 2599372332 202
76 iso_pu_bacteria 2599185164 2599378417 202
77 iso_pu_bacteria 2599185165 2599384206 202
78 iso_pu_bacteria 2599185166 2599391191 202
79 iso_pu_bacteria 2599185167 2599398529 202
80 iso_pu_bacteria 2599185168 2599407436 202
81 iso_pu_bacteria 2599185179 2599450583 202
82 iso_pu_bacteria 2599185181 2599460143 202
83 iso_pu_bacteria 2599185185 2599484331 202
84 iso_pu_bacteria 2599185186 2599489164 202
85 iso_pu_bacteria 2599185189 2599507163 202
86 iso_pu_bacteria 2599185191 2599520706 202
87 iso_pu_bacteria 2599185257 2599802401 202
88 iso_pu_bacteria 2599185288 2599880375 202
89 iso_pu_bacteria 2599185303 2599946944 202
90 iso_pu_bacteria 2599185356 2600212752 202
91 iso_pu_bacteria 2600255067 2600814681 202
92 iso_pu_bacteria 2600255313 2601772920 202
93 iso_pu_bacteria 2600255318 2601796089 202
94 iso_pu_bacteria 2603880185 2606075058 202
95 iso_pu_bacteria 2603880199 2606127921 202
96 iso_pu_bacteria 2619619299 2621300045 202
97 iso_pu_bacteria 2623620443 2624480138 202
98 iso_pu_bacteria 2623620446 2624492600 202
99 iso_pu_bacteria 2643221554 2643789400 202
100 iso_pu_bacteria 2643221565 2643844672 202
101 iso_pu_bacteria 2643221571 2643873889 202
102 iso_pu_bacteria 2643221589 2643956912 202
103 iso_pu_bacteria 2643221602 2644024835 202
104 iso_pu_bacteria 2643221633 2644186809 202
105 iso_pu_bacteria 2643221645 2644255453 202
106 iso_pu_bacteria 2643221664 2644359975 202
107 iso_pu_bacteria 2643221713 2644620423 202
108 iso_pu_bacteria 2671180172 2671769980 202
109 iso_pu_bacteria 2675903420 2677896211 202
110 iso_pu_bacteria 2711768613 2713474331 202
111 iso_pu_bacteria 2713897149 2715758467 202
112 iso_pu_bacteria 2718217991 2719643843 202
113 iso_pu_bacteria 2721755607 2723248901 202
114 iso_pu_bacteria 2738541265 2738670047 202
115 iso_pu_bacteria 2738541280 2738742730 202
116 iso_pu_bacteria 2738541282 2738748440 202
117 iso_pu_bacteria 2738541294 2738806599 202
118 iso_pu_bacteria 2738541296 2738822188 202
119 iso_pu_bacteria 2738541298 2738834670 202
120 iso_pu_bacteria 2738541300 2738847028 202
121 iso_pu_bacteria 2738541303 2738857482 202
122 iso_pu_bacteria 2738541306 2738875874 202
123 iso_pu_bacteria 2738541309 2738893959 202
124 iso_pu_bacteria 2738543002 2739187826 202
125 iso_pu_bacteria 2738543004 2739200161 202
126 iso_pu_bacteria 2738543008 2739222472 202
127 iso_pu_bacteria 2738543015 2739258644 202
128 iso_pu_bacteria 2738543018 2739277288 202
129 iso_pu_bacteria 2738543025 2739315944 202
130 iso_pu_bacteria 2738543030 2739346152 202
131 iso_pu_bacteria 2740892503 2743737184 202
132 iso_pu_bacteria 2744054900 2746091293 202
133 iso_pu_bacteria 2744054901 2746097726 202
134 iso_pu_bacteria 2751185846 2753565348 202
135 iso_pu_bacteria 2773857670 2774123307 202
136 iso_pu_bacteria 2773857673 2774137956 202
137 iso_pu_bacteria 2784132063 2784264971 202
138 iso_pu_bacteria 2784132072 2784315831 202
139 iso_pu_bacteria 2791355137 2792838030 202
140 iso_pu_bacteria 2806310745 2807456920 202
141 iso_pu_bacteria 2808606377 2808932599 202
142 iso_pu_bacteria 2808606381 2808954720 202
143 iso_pu_bacteria 2808606382 2808958362 202
144 iso_pu_bacteria 2808606385 2808979278 202
145 iso_pu_bacteria 2808606388 2808994838 202
146 iso_pu_bacteria 2816332298 2817491384 202
147 iso_pu_bacteria 2818991450 2819620384 202
148 iso_pu_bacteria 2818991456 2819656809 202
149 iso_pu_bacteria 2834028612 2834033594 202
150 iso_pu_bacteria 2842324504 2842325239 202
151 iso_pu_bacteria 2842348783 2842349518 202
152 iso_pu_bacteria 2842454564 2842455243 202
153 iso_pu_bacteria 2842826826 2842827104 202
154 iso_pu_bacteria 2842837860 2842839109 202
155 iso_pu_bacteria 2844665904 2844670188 202
156 iso_pu_bacteria 2852612431 2852614274 202
157 iso_pu_bacteria 2852657418 2852659586 202
158 iso_pu_bacteria 2852667396 2852667988 202
159 iso_pu_bacteria 2856287931 2856291075 202
160 iso_pu_bacteria 2857357740 2857364113 202
161 iso_pu_bacteria 2860339153 2860342286 202
162 iso_pu_bacteria 2860867994 2860870774 202
163 iso_pu_bacteria 2878029506 2878032049 202
164 iso_pu_bacteria 2880230671 2880232988 202
165 iso_pu_bacteria 2883087390 2883090816 202
166 iso_pu_bacteria 2885270888 2885276094 202
167 iso_pu_bacteria 2900634093 2900640280 202
168 iso_pu_bacteria 2902682994 2902685452 202
169 iso_pu_bacteria 2904483920 2904489146 202
170 iso_pu_bacteria 2904518522 2904520296 202
171 iso_pu_bacteria 2904550169 2904550410 202
172 iso_pu_bacteria 2904615490 2904621321 202
173 iso_pu_bacteria 2908446538 2908449462 202
174 iso_pu_bacteria 2917070673 2917073508 202
175 iso_pu_bacteria 2919063839 2919068518 202
176 iso_pu_bacteria 2919456309 2919458956 202
177 iso_pu_bacteria 2919527303 2919529758 202
178 iso_pu_bacteria 2919697872 2919702716 202
179 iso_pu_bacteria 2923153595 2923156217 202
180 iso_pu_bacteria 2928108538 2928109016 202
181 iso_pu_bacteria 2928135762 2928136239 202
182 iso_pu_bacteria 2928503688 2928503980 202
183 iso_pu_bacteria 2929189879 2929192749 202
184 iso_pu_bacteria 2931390751 2931393739 202
185 iso_pu_bacteria 2931396565 2931402369 202
186 iso_pu_bacteria 2935353572 2935357482 202
187 iso_pu_bacteria 2939636861 2939638539 202
188 iso_pu_bacteria 2945928738 2945933283 202
189 iso_pu_bacteria 2945934425 2945938360 202
190 iso_pu_bacteria 2945961074 2945964005 202
191 iso_pu_bacteria 2946027586 2946030751 202
192 iso_pu_bacteria 2947233263 2947237998 202
193 iso_pu_bacteria 2969304461 2969308029 202
194 iso_pu_bacteria 2984286254 2984289825 202
195 iso_pu_bacteria 2990703756 2990708362 202
196 iso_pu_bacteria 3007395558 3007401703 202
197 iso_pu_bacteria 3007419365 3007423966 202
198 iso_pu_bacteria 3007511990 3007514568 202
199 iso_pu_bacteria 3007614139 3007616325 202
200 iso_pu_bacteria 3007619802 3007621429 202
201 iso_pu_bacteria 3007718800 3007722314 202
202 iso_pu_bacteria 637000220 637320022 202
203 iso_pu_bacteria 641736151 642423489 202
204 iso_pu_bacteria 642555112 642596449 202
205 iso_pu_bacteria 642555113 642617071 202
206 iso_pu_bacteria 8003955200 8003957059 202
207 iso_pu_bacteria 8015687852 8015690426 202
208 iso_pu_bacteria 8019775933 8019781637 202
209 iso_pu_bacteria 8054347763 8054352436 202
210 iso_pu_bacteria 8055266321 8055268611 202
211 iso_pu_bacteria 8055301274 8055303783 202
212 iso_pu_bacteria 8055770955 8055773560 202
213 iso_pu_bacteria 8055817908 8055821294 202
214 iso_pu_bacteria 8056125926 8056129258 202
215 iso_pu_bacteria 8056155041 8056157665 202
216 iso_pu_bacteria 8056161164 8056165881 202
217 iso_pu_bacteria 8056172158 8056173841 202
218 iso_pu_bacteria 8056569372 8056574209 202
219 iso_pu_bacteria 8057798959 8057800810 202
220 3300042156 Ga0439446_0000487 Ga0439446_0000487_5831_6442 203
221 3300030736 Ga0316180_1031230 Ga0316180_10312302 205
222 2124908027 MRS2a_Contig_56 MRS2a_00433880 206
223 3300001979 JGI24740J21852_10000288 JGI24740J21852_100002888 206
224 3300001989 JGI24739J22299_10006888 JGI24739J22299_100068881 206
225 3300002067 JGI24735J21928_10004611 JGI24735J21928_100046111 206
226 3300002075 JGI24738J21930_10010796 JGI24738J21930_100107962 206
227 3300002705 JGI25156J39149_1000454 JGI25156J39149_10004545 206
228 3300002737 JGI25162J39368_1000053 JGI25162J39368_100005391 206
229 3300002737 JGI25162J39368_1000198 JGI25162J39368_100019847 206
230 3300002737 JGI25162J39368_1000361 JGI25162J39368_100036118 206
231 3300002739 JGI25158J39367_1003095 JGI25158J39367_10030953 206
232 3300002771 JGI25163J39215_1000117 JGI25163J39215_100011718 206
233 3300002771 JGI25163J39215_1000199 JGI25163J39215_100019918 206
234 3300002772 JGI25164J39214_1000042 JGI25164J39214_100004269 206
235 3300002772 JGI25164J39214_1000080 JGI25164J39214_100008091 206
236 3300002772 JGI25164J39214_1000081 JGI25164J39214_100008177 206
237 3300002772 JGI25164J39214_1000130 JGI25164J39214_100013046 206
238 3300002773 JGI25152J39213_1002453 JGI25152J39213_10024533 206
239 3300002774 JGI25150J39212_1002190 JGI25150J39212_10021903 206
240 3300002774 JGI25150J39212_1007600 JGI25150J39212_10076002 206
241 3300003214 JGI25165J46597_1000060 JGI25165J46597_100006092 206
242 3300003214 JGI25165J46597_1000299 JGI25165J46597_100029918 206
243 3300003215 JGI25153J46596_10004137 JGI25153J46596_100041373 206
244 3300003320 rootH2_10059800 rootH2_100598003 206
245 3300003320 rootH2_10059801 rootH2_100598013 206
246 3300003322 rootL2_10152210 rootL2_101522102 206
247 3300003322 rootL2_10203149 rootL2_102031492 206
248 3300003323 rootH1_10133742 rootH1_101337421 206
249 3300003323 rootH1_10171848 rootH1_101718484 206
250 3300003323 rootH1_10203630 rootH1_102036301 206
251 3300003323 rootH1_10303299 rootH1_103032994 206
252 3300003771 Ga0055526_1005049 Ga0055526_10050495 206
253 3300003771 Ga0055526_1022202 Ga0055526_10222022 206
254 3300003773 Ga0055537_1004565 Ga0055537_10045652 206
255 3300003773 Ga0055537_1009776 Ga0055537_10097763 206
256 3300003773 Ga0055537_1016405 Ga0055537_10164052 206
257 3300003775 Ga0055524_1007607 Ga0055524_10076073 206
258 3300003775 Ga0055524_1010822 Ga0055524_10108225 206
259 3300003775 Ga0055524_1021149 Ga0055524_10211492 206
260 3300003781 Ga0055536_1000032 Ga0055536_100003214 206
261 3300003781 Ga0055536_1000248 Ga0055536_100024842 206
262 3300003784 Ga0055534_1001445 Ga0055534_10014456 206
263 3300003784 Ga0055534_1011914 Ga0055534_10119143 206
264 3300003791 Ga0055530_10000029 Ga0055530_1000002914 206
265 3300003791 Ga0055530_10002850 Ga0055530_100028506 206
266 3300003791 Ga0055530_10003960 Ga0055530_100039606 206
267 3300003791 Ga0055530_10005302 Ga0055530_100053023 206
268 3300003791 Ga0055530_10006520 Ga0055530_100065204 206
269 3300003792 Ga0055540_1000315 Ga0055540_10003156 206
270 3300003794 Ga0055531_10000964 Ga0055531_100009643 206
271 3300003794 Ga0055531_10004344 Ga0055531_100043445 206
272 3300004625 Ga0055543_1038868 Ga0055543_10388681 206
273 3300005262 Ga0065165_1086026 Ga0065165_10860261 206
274 3300005288 Ga0065714_10067227 Ga0065714_100672275 206
275 3300005288 Ga0065714_10087349 Ga0065714_100873492 206
276 3300005288 Ga0065714_10088954 Ga0065714_100889542 206
277 3300005289 Ga0065704_10171211 Ga0065704_101712111 206
278 3300005289 Ga0065704_10400004 Ga0065704_104000041 206
279 3300005290 Ga0065712_10003635 Ga0065712_100036355 206
280 3300005339 Ga0070660_100154329 Ga0070660_1001543292 206
281 3300005344 Ga0070661_100000053 Ga0070661_10000005363 206
282 3300005367 Ga0070667_100240207 Ga0070667_1002402071 206
283 3300005455 Ga0070663_100010163 Ga0070663_1000101634 206
284 3300005455 Ga0070663_100228463 Ga0070663_1002284632 206
285 3300005457 Ga0070662_100880303 Ga0070662_1008803031 206
286 3300005564 Ga0070664_100000030 Ga0070664_10000003061 206
287 3300005617 Ga0068859_100149998 Ga0068859_1001499985 206
288 3300005834 Ga0068851_10001544 Ga0068851_100015448 206
289 3300005841 Ga0068863_100135386 Ga0068863_1001353862 206
290 3300005842 Ga0068858_100021357 Ga0068858_1000213579 206
291 3300005843 Ga0068860_100006140 Ga0068860_10000614016 206
292 3300006051 Ga0075364_10036672 Ga0075364_100366723 206
293 3300006058 Ga0075432_10000841 Ga0075432_100008415 206
294 3300006058 Ga0075432_10042112 Ga0075432_100421121 206
295 3300006058 Ga0075432_10058017 Ga0075432_100580172 206
296 3300006058 Ga0075432_10093799 Ga0075432_100937991 206
297 3300006177 Ga0075362_10037027 Ga0075362_100370272 206
298 3300006358 Ga0068871_100769064 Ga0068871_1007690641 206
299 3300006881 Ga0068865_100469285 Ga0068865_1004692852 206
300 3300006914 Ga0075436_100045680 Ga0075436_1000456802 206
301 3300006931 Ga0097620_100149997 Ga0097620_1001499975 206
302 3300006946 Ga0079104_1000901 Ga0079104_100090113 206
303 3300009011 Ga0105251_10000051 Ga0105251_1000005125 206
304 3300009011 Ga0105251_10004107 Ga0105251_100041079 206
305 3300009011 Ga0105251_10004479 Ga0105251_100044799 206
306 3300009011 Ga0105251_10006905 Ga0105251_100069051 206
307 3300009011 Ga0105251_10052845 Ga0105251_100528453 206
308 3300009011 Ga0105251_10055434 Ga0105251_100554343 206
309 3300009036 Ga0105244_10002484 Ga0105244_100024844 206
310 3300009036 Ga0105244_10028331 Ga0105244_100283313 206
311 3300009036 Ga0105244_10033371 Ga0105244_100333712 206
312 3300009036 Ga0105244_10044079 Ga0105244_100440793 206
313 3300009036 Ga0105244_10076989 Ga0105244_100769892 206
314 3300009092 Ga0105250_10000090 Ga0105250_1000009018 206
315 3300009092 Ga0105250_10037908 Ga0105250_100379083 206
316 3300009092 Ga0105250_10040687 Ga0105250_100406872 206
317 3300009093 Ga0105240_10074125 Ga0105240_100741256 206
318 3300009148 Ga0105243_10000252 Ga0105243_1000025238 206
319 3300009148 Ga0105243_10165545 Ga0105243_101655451 206
320 3300009176 Ga0105242_10009765 Ga0105242_100097654 206
321 3300009177 Ga0105248_10351485 Ga0105248_103514852 206
322 3300009545 Ga0105237_10001925 Ga0105237_100019257 206
323 3300009551 Ga0105238_10045426 Ga0105238_100454262 206
324 3300009551 Ga0105238_10666698 Ga0105238_106666981 206
325 3300010375 Ga0105239_10245574 Ga0105239_102455742 206
326 3300011119 Ga0105246_10000121 Ga0105246_1000012126 206
327 3300011119 Ga0105246_10199615 Ga0105246_101996152 206
328 3300012498 Ga0157345_1000052 Ga0157345_100005223 206
329 3300013100 Ga0157373_10000956 Ga0157373_100009565 206
330 3300013100 Ga0157373_10006613 Ga0157373_100066138 206
331 3300013100 Ga0157373_10012072 Ga0157373_100120725 206
332 3300013100 Ga0157373_10144963 Ga0157373_101449631 206
333 3300013100 Ga0157373_10237809 Ga0157373_102378092 206
334 3300013102 Ga0157371_10001414 Ga0157371_1000141417 206
335 3300013104 Ga0157370_10006897 Ga0157370_1000689713 206
336 3300013104 Ga0157370_10172116 Ga0157370_101721162 206
337 3300013105 Ga0157369_10002704 Ga0157369_100027041 206
338 3300013105 Ga0157369_10014014 Ga0157369_100140145 206
339 3300013105 Ga0157369_10014686 Ga0157369_100146864 206
340 3300013105 Ga0157369_10098144 Ga0157369_100981442 206
341 3300013105 Ga0157369_10620254 Ga0157369_106202542 206
342 3300013306 Ga0163162_10005044 Ga0163162_1000504410 206
343 3300013306 Ga0163162_10014155 Ga0163162_100141556 206
344 3300013306 Ga0163162_10237399 Ga0163162_102373992 206
345 3300013306 Ga0163162_10493274 Ga0163162_104932742 206
346 3300013306 Ga0163162_10743183 Ga0163162_107431832 206
347 3300013306 Ga0163162_10743385 Ga0163162_107433852 206
348 3300013306 Ga0163162_11311177 Ga0163162_113111771 206
349 3300013307 Ga0157372_10010196 Ga0157372_1001019612 206
350 3300013308 Ga0157375_10000050 Ga0157375_1000005029 206
351 3300013308 Ga0157375_10005961 Ga0157375_100059614 206
352 3300013308 Ga0157375_10045237 Ga0157375_100452373 206
353 3300013308 Ga0157375_10084224 Ga0157375_100842243 206
354 3300014497 Ga0182008_10000561 Ga0182008_1000056117 206
355 3300014497 Ga0182008_10000786 Ga0182008_1000078615 206
356 3300014497 Ga0182008_10001085 Ga0182008_1000108516 206
357 3300014497 Ga0182008_10003306 Ga0182008_100033063 206
358 3300014497 Ga0182008_10018897 Ga0182008_100188972 206
359 3300014969 Ga0157376_10238804 Ga0157376_102388043 206
360 3300015261 Ga0182006_1000107 Ga0182006_10001076 206
361 3300015261 Ga0182006_1000717 Ga0182006_100071713 206
362 3300015261 Ga0182006_1001284 Ga0182006_100128413 206
363 3300015261 Ga0182006_1097156 Ga0182006_10971561 206
364 3300015261 Ga0182006_1118589 Ga0182006_11185891 206
365 3300015262 Ga0182007_10000394 Ga0182007_100003947 206
366 3300015262 Ga0182007_10000511 Ga0182007_1000051114 206
367 3300015262 Ga0182007_10011481 Ga0182007_100114816 206
368 3300015265 Ga0182005_1002980 Ga0182005_10029803 206
369 3300015265 Ga0182005_1008065 Ga0182005_10080654 206
370 3300016635 Ga0183361_10005 Ga0183361_10005339 206
371 3300017792 Ga0163161_10000183 Ga0163161_1000018322 206
372 3300017792 Ga0163161_10001377 Ga0163161_1000137719 206
373 3300017792 Ga0163161_10009209 Ga0163161_100092095 206
374 3300017792 Ga0163161_10018624 Ga0163161_100186247 206
375 3300017792 Ga0163161_10023963 Ga0163161_100239635 206
376 3300017792 Ga0163161_10217483 Ga0163161_102174832 206
377 3300017792 Ga0163161_10378542 Ga0163161_103785421 206
378 3300025206 Ga0209435_101086 Ga0209435_1010861 206
379 3300025207 Ga0209760_100013 Ga0209760_10001369 206
380 3300025207 Ga0209760_100107 Ga0209760_1001075 206
381 3300025208 Ga0209436_107825 Ga0209436_1078252 206
382 3300025224 Ga0209784_100023 Ga0209784_100023327 206
383 3300025225 Ga0209566_100019 Ga0209566_100019340 206
384 3300025226 Ga0209674_100034 Ga0209674_100034340 206
385 3300025229 Ga0209147_100027 Ga0209147_100027342 206
386 3300025230 Ga0209563_100037 Ga0209563_100037340 206
387 3300025230 Ga0209563_100920 Ga0209563_1009206 206
388 3300025231 Ga0207427_100003 Ga0207427_100003436 206
389 3300025231 Ga0207427_100011 Ga0207427_100011458 206
390 3300025233 Ga0209437_100002 Ga0209437_100002577 206
391 3300025233 Ga0209437_100025 Ga0209437_100025112 206
392 3300025242 Ga0209258_100640 Ga0209258_10064018 206
393 3300025245 Ga0207425_1000017 Ga0207425_1000017110 206
394 3300025245 Ga0207425_1001876 Ga0207425_10018764 206
395 3300025246 Ga0209646_1000330 Ga0209646_10003307 206
396 3300025253 Ga0209677_100021 Ga0209677_100021340 206
397 3300025256 Ga0209759_1000086 Ga0209759_100008634 206
398 3300025256 Ga0209759_1002747 Ga0209759_10027475 206
399 3300025258 Ga0209129_1000039 Ga0209129_1000039289 206
400 3300025258 Ga0209129_1005476 Ga0209129_10054766 206
401 3300025261 Ga0209233_1000004 Ga0209233_1000004848 206
402 3300025261 Ga0209233_1000012 Ga0209233_1000012631 206
403 3300025263 Ga0209565_1002127 Ga0209565_10021273 206
404 3300025263 Ga0209565_1002265 Ga0209565_10022655 206
405 3300025263 Ga0209565_1002465 Ga0209565_10024653 206
406 3300025263 Ga0209565_1007404 Ga0209565_10074042 206
407 3300025263 Ga0209565_1010838 Ga0209565_10108382 206
408 3300025263 Ga0209565_1011491 Ga0209565_10114913 206
409 3300025263 Ga0209565_1031677 Ga0209565_10316772 206
410 3300025273 Ga0209673_1006024 Ga0209673_10060242 206
411 3300025284 Ga0209130_1033529 Ga0209130_10335292 206
412 3300025291 Ga0209675_1003745 Ga0209675_10037455 206
413 3300025291 Ga0209675_1006631 Ga0209675_10066313 206
414 3300025292 Ga0209676_1000003 Ga0209676_10000031109 206
415 3300025292 Ga0209676_1000102 Ga0209676_100010267 206
416 3300025292 Ga0209676_1007996 Ga0209676_10079965 206
417 3300025295 Ga0209564_1002526 Ga0209564_10025268 206
418 3300025295 Ga0209564_1004873 Ga0209564_10048735 206
419 3300025295 Ga0209564_1027875 Ga0209564_10278752 206
420 3300025297 Ga0209758_1000137 Ga0209758_10001377 206
421 3300025298 Ga0209050_1000004 Ga0209050_10000041091 206
422 3300025298 Ga0209050_1000105 Ga0209050_100010567 206
423 3300025298 Ga0209050_1001471 Ga0209050_10014716 206
424 3300025298 Ga0209050_1002026 Ga0209050_100202616 206
425 3300025298 Ga0209050_1006069 Ga0209050_10060693 206
426 3300025298 Ga0209050_1007531 Ga0209050_10075313 206
427 3300025299 Ga0209256_1003534 Ga0209256_10035349 206
428 3300025299 Ga0209256_1006814 Ga0209256_10068146 206
429 3300025302 Ga0207426_1024294 Ga0207426_10242942 206
430 3300025303 Ga0209051_1000052 Ga0209051_1000052165 206
431 3300025303 Ga0209051_1000066 Ga0209051_100006667 206
432 3300025303 Ga0209051_1030616 Ga0209051_10306162 206
433 3300025304 Ga0209257_1000124 Ga0209257_1000124123 206
434 3300025304 Ga0209257_1001097 Ga0209257_100109731 206
435 3300025304 Ga0209257_1008182 Ga0209257_10081826 206
436 3300025321 Ga0207656_10000088 Ga0207656_100000886 206
437 3300025711 Ga0207696_1000041 Ga0207696_100004118 206
438 3300025711 Ga0207696_1000051 Ga0207696_100005155 206
439 3300025711 Ga0207696_1001731 Ga0207696_10017313 206
440 3300025711 Ga0207696_1004943 Ga0207696_10049436 206
441 3300025711 Ga0207696_1066257 Ga0207696_10662572 206
442 3300025711 Ga0207696_1074859 Ga0207696_10748591 206
443 3300025728 Ga0207655_1000080 Ga0207655_100008038 206
444 3300025728 Ga0207655_1000285 Ga0207655_100028522 206
445 3300025728 Ga0207655_1000875 Ga0207655_100087519 206
446 3300025728 Ga0207655_1002960 Ga0207655_10029603 206
447 3300025728 Ga0207655_1002984 Ga0207655_10029842 206
448 3300025728 Ga0207655_1016523 Ga0207655_10165235 206
449 3300025728 Ga0207655_1019490 Ga0207655_10194905 206
450 3300025728 Ga0207655_1040465 Ga0207655_10404653 206
451 3300025728 Ga0207655_1048166 Ga0207655_10481663 206
452 3300025728 Ga0207655_1115220 Ga0207655_11152202 206
453 3300025735 Ga0207713_1000354 Ga0207713_100035444 206
454 3300025735 Ga0207713_1000953 Ga0207713_100095327 206
455 3300025735 Ga0207713_1002745 Ga0207713_100274513 206
456 3300025735 Ga0207713_1003122 Ga0207713_10031223 206
457 3300025735 Ga0207713_1004239 Ga0207713_10042397 206
458 3300025735 Ga0207713_1008216 Ga0207713_10082164 206
459 3300025735 Ga0207713_1008329 Ga0207713_10083293 206
460 3300025735 Ga0207713_1013685 Ga0207713_10136852 206
461 3300025735 Ga0207713_1021170 Ga0207713_10211703 206
462 3300025735 Ga0207713_1028947 Ga0207713_10289473 206
463 3300025735 Ga0207713_1046087 Ga0207713_10460873 206
464 3300025735 Ga0207713_1079137 Ga0207713_10791372 206
465 3300025735 Ga0207713_1097533 Ga0207713_10975331 206
466 3300025904 Ga0207647_10015672 Ga0207647_100156723 206
467 3300025904 Ga0207647_10098467 Ga0207647_100984673 206
468 3300025913 Ga0207695_10070101 Ga0207695_100701011 206
469 3300025914 Ga0207671_10004590 Ga0207671_100045905 206
470 3300025919 Ga0207657_10188096 Ga0207657_101880962 206
471 3300025920 Ga0207649_10000070 Ga0207649_1000007018 206
472 3300025933 Ga0207706_10618156 Ga0207706_106181561 206
473 3300025935 Ga0207709_10000011 Ga0207709_10000011127 206
474 3300025935 Ga0207709_10112500 Ga0207709_101125003 206
475 3300025945 Ga0207679_10000021 Ga0207679_1000002160 206
476 3300025981 Ga0207640_10285852 Ga0207640_102858522 206
477 3300026035 Ga0207703_10030034 Ga0207703_100300341 206
478 3300026067 Ga0207678_10018487 Ga0207678_100184875 206
479 3300026067 Ga0207678_10186785 Ga0207678_101867852 206
480 3300026088 Ga0207641_10435189 Ga0207641_104351892 206
481 3300027111 Ga0209281_1000063 Ga0209281_1000063103 206
482 3300027876 Ga0209974_10070104 Ga0209974_100701041 206
483 3300027907 Ga0207428_10012077 Ga0207428_100120773 206
484 3300027907 Ga0207428_10034484 Ga0207428_100344844 206
485 3300027907 Ga0207428_10035970 Ga0207428_100359703 206
486 3300027907 Ga0207428_10050758 Ga0207428_100507582 206
487 3300027907 Ga0207428_10062553 Ga0207428_100625532 206
488 3300027907 Ga0207428_10418326 Ga0207428_104183262 206
489 3300027907 Ga0207428_10514145 Ga0207428_105141451 206
490 3300028381 Ga0268264_10163730 Ga0268264_101637303 206
491 3300028800 Ga0265338_10000023 Ga0265338_10000023215 206
492 3300030521 Ga0307511_10139980 Ga0307511_101399802 206
493 3300030742 Ga0316183_1202622 Ga0316183_12026222 206
494 3300031247 Ga0265340_10069277 Ga0265340_100692772 206
495 3300031548 Ga0307408_100000401 Ga0307408_10000040130 206
496 3300031548 Ga0307408_100008266 Ga0307408_1000082666 206
497 3300031548 Ga0307408_100010005 Ga0307408_1000100051 206
498 3300031548 Ga0307408_100012271 Ga0307408_1000122712 206
499 3300031730 Ga0307516_10155526 Ga0307516_101555262 206
500 3300031731 Ga0307405_10000324 Ga0307405_1000032419 206
501 3300031838 Ga0307518_10329951 Ga0307518_103299511 206
502 3300031911 Ga0307412_10000002 Ga0307412_10000002565 206
503 3300031911 Ga0307412_10010361 Ga0307412_100103612 206
504 3300032004 Ga0307414_10228716 Ga0307414_102287163 206
505 3300033180 Ga0307510_10001323 Ga0307510_1000132310 206
506 3300037471 Ga0395905_0000057 Ga0395905_0000057_28555_29178 206
507 3300037471 Ga0395905_0315077 Ga0395905_0315077_246_869 206
508 3300038705 Ga0237819_02002 Ga0237819_02002_3055_3675 206
509 3300039447 Ga0436361_0447564 Ga0436361_0447564_187_807 206
510 3300041405 Ga0439438_000582 Ga0439438_000582_14657_15280 206
511 3300041405 Ga0439438_012578 Ga0439438_012578_335_955 206
512 3300041405 Ga0439438_025951 Ga0439438_025951_750_1370 206
513 3300041405 Ga0439438_035854 Ga0439438_035854_36_656 206
514 3300041407 Ga0439447_000155 Ga0439447_000155_2892_3512 206
515 3300041407 Ga0439447_000844 Ga0439447_000844_7872_8492 206
516 3300041407 Ga0439447_001755 Ga0439447_001755_5355_5975 206
517 3300041407 Ga0439447_005075 Ga0439447_005075_1846_2466 206
518 3300041407 Ga0439447_019553 Ga0439447_019553_429_1061 206
519 3300041411 Ga0439466_0001396 Ga0439466_0001396_5290_5910 206
520 3300041411 Ga0439466_0004877 Ga0439466_0004877_3446_4066 206
521 3300041411 Ga0439466_0007443 Ga0439466_0007443_1720_2340 206
522 3300041411 Ga0439466_0010487 Ga0439466_0010487_866_1486 206
523 3300041411 Ga0439466_0011288 Ga0439466_0011288_837_1469 206
524 3300041413 Ga0439465_0102865 Ga0439465_0102865_334_954 206
525 3300042006 Ga0439432_007611 Ga0439432_007611_23_643 206
526 3300042006 Ga0439432_052119 Ga0439432_052119_173_805 206
527 3300042009 Ga0439451_000466 Ga0439451_000466_7062_7694 206
528 3300042010 Ga0439452_000575 Ga0439452_000575_6119_6739 206
529 3300042010 Ga0439452_000972 Ga0439452_000972_6880_7500 206
530 3300042010 Ga0439452_003058 Ga0439452_003058_3134_3754 206
531 3300042010 Ga0439452_008182 Ga0439452_008182_1451_2071 206
532 3300042010 Ga0439452_078862 Ga0439452_078862_18_638 206
533 3300042013 Ga0439456_001377 Ga0439456_001377_3244_3864 206
534 3300042013 Ga0439456_027680 Ga0439456_027680_320_952 206
535 3300042016 Ga0439463_011496 Ga0439463_011496_1412_2032 206
536 3300042016 Ga0439463_023909 Ga0439463_023909_207_827 206
537 3300042115 Ga0450911_001187 Ga0450911_001187_4075_4695 206
538 3300042115 Ga0450911_003833 Ga0450911_003833_509_1129 206
539 3300042121 Ga0450919_000828 Ga0450919_000828_445_1065 206
540 3300042122 Ga0450920_001875 Ga0450920_001875_740_1360 206
541 3300042124 Ga0450922_000653 Ga0450922_000653_2950_3570 206
542 3300042124 Ga0450922_001455 Ga0450922_001455_804_1424 206
543 3300042127 Ga0450890_001139 Ga0450890_001139_1241_1861 206
544 3300042134 Ga0450898_007568 Ga0450898_007568_168_788 206
545 3300042135 Ga0450899_000115 Ga0450899_000115_6119_6739 206
546 3300042137 Ga0450902_000207 Ga0450902_000207_6010_6630 206
547 3300042137 Ga0450902_006534 Ga0450902_006534_275_895 206
548 3300042138 Ga0450903_000525 Ga0450903_000525_3004_3624 206
549 3300042138 Ga0450903_001400 Ga0450903_001400_3396_4016 206
550 3300042138 Ga0450903_007169 Ga0450903_007169_180_800 206
551 3300042138 Ga0450903_021249 Ga0450903_021249_284_904 206
552 3300042142 Ga0450905_022715 Ga0450905_022715_152_772 206
553 3300042145 Ga0450906_003107 Ga0450906_003107_2163_2783 206
554 3300042145 Ga0450906_008093 Ga0450906_008093_934_1554 206
555 3300042146 Ga0450907_007687 Ga0450907_007687_781_1401 206
556 3300042156 Ga0439446_0011676 Ga0439446_0011676_408_1028 206
557 3300042184 Ga0450908_001499 Ga0450908_001499_15_635 206
558 3300042184 Ga0450908_009294 Ga0450908_009294_647_1267 206
559 3300042185 Ga0450909_002147 Ga0450909_002147_22_642 206
560 3300042439 Ga0439464_0027279 Ga0439464_0027279_611_1231 206
561 3300042461 Ga0439460_0001304 Ga0439460_0001304_3929_4549 206
562 3300042461 Ga0439460_0010367 Ga0439460_0010367_207_827 206
563 3300042532 Ga0450893_0035002 Ga0450893_0035002_105_725 206
564 3300042993 Ga0439440_0010448 Ga0439440_0010448_624_1244 206
565 3300044669 Ga0466981_0137376 Ga0466981_0137376_272_892 206
566 3300044683 Ga0466965_0014245 Ga0466965_0014245_2080_2700 206
567 3300046452 Ga0495617_000745 Ga0495617_000745_12208_12828 206
568 3300046452 Ga0495617_000762 Ga0495617_000762_6024_6644 206
569 3300046452 Ga0495617_001347 Ga0495617_001347_7217_7837 206
570 3300046452 Ga0495617_002981 Ga0495617_002981_1430_2050 206
571 3300046452 Ga0495617_004376 Ga0495617_004376_1380_2000 206
572 3300046452 Ga0495617_007588 Ga0495617_007588_418_1038 206
573 3300046452 Ga0495617_011954 Ga0495617_011954_630_1250 206
574 3300046452 Ga0495617_075586 Ga0495617_075586_256_876 206
575 3300046453 Ga0495627_000488 Ga0495627_000488_22137_22757 206
576 3300046453 Ga0495627_000695 Ga0495627_000695_4814_5434 206
577 3300046453 Ga0495627_002844 Ga0495627_002844_4073_4693 206
578 3300046453 Ga0495627_003025 Ga0495627_003025_2222_2842 206
579 3300046453 Ga0495627_003740 Ga0495627_003740_3492_4148 206
580 3300046453 Ga0495627_011620 Ga0495627_011620_1664_2284 206
581 3300046454 Ga0495592_0001859 Ga0495592_0001859_9835_10548 206
582 3300046454 Ga0495592_0126934 Ga0495592_0126934_925_1545 206
583 3300046455 Ga0495603_0002727 Ga0495603_0002727_9630_10250 206
584 3300046455 Ga0495603_0004278 Ga0495603_0004278_2345_2965 206
585 3300046455 Ga0495603_0051819 Ga0495603_0051819_710_1330 206
586 3300046455 Ga0495603_0095762 Ga0495603_0095762_570_1301 206
587 3300046457 Ga0495590_0000590 Ga0495590_0000590_4523_5143 206
588 3300046457 Ga0495590_0002065 Ga0495590_0002065_5930_6550 206
589 3300046457 Ga0495590_0002343 Ga0495590_0002343_4344_5000 206
590 3300046457 Ga0495590_0018459 Ga0495590_0018459_576_1196 206
591 3300046457 Ga0495590_0033888 Ga0495590_0033888_332_952 206
592 3300046457 Ga0495590_0039171 Ga0495590_0039171_324_944 206
593 3300046457 Ga0495590_0060852 Ga0495590_0060852_303_923 206
594 3300046457 Ga0495590_0070248 Ga0495590_0070248_472_1095 206
595 3300046457 Ga0495590_0096282 Ga0495590_0096282_116_736 206
596 3300046458 Ga0495591_000151 Ga0495591_000151_42401_43021 206
597 3300046458 Ga0495591_000662 Ga0495591_000662_5118_5738 206
598 3300046458 Ga0495591_000903 Ga0495591_000903_10594_11250 206
599 3300046458 Ga0495591_001053 Ga0495591_001053_13188_13808 206
600 3300046458 Ga0495591_001607 Ga0495591_001607_818_1531 206
601 3300046458 Ga0495591_001801 Ga0495591_001801_2734_3354 206
602 3300046458 Ga0495591_004551 Ga0495591_004551_2750_3406 206
603 3300046458 Ga0495591_005145 Ga0495591_005145_2807_3427 206
604 3300046458 Ga0495591_006042 Ga0495591_006042_2764_3384 206
605 3300046458 Ga0495591_007960 Ga0495591_007960_280_900 206
606 3300046458 Ga0495591_011430 Ga0495591_011430_51_671 206
607 3300046458 Ga0495591_013256 Ga0495591_013256_325_945 206
608 3300046458 Ga0495591_016356 Ga0495591_016356_810_1430 206
609 3300046458 Ga0495591_017077 Ga0495591_017077_1414_2070 206
610 3300046458 Ga0495591_058873 Ga0495591_058873_361_981 206
611 3300046459 Ga0495629_0000100 Ga0495629_0000100_47236_47856 206
612 3300046459 Ga0495629_0004061 Ga0495629_0004061_8095_8715 206
613 3300046459 Ga0495629_0005447 Ga0495629_0005447_7833_8546 206
614 3300046459 Ga0495629_0017530 Ga0495629_0017530_2129_2749 206
615 3300046459 Ga0495629_0030768 Ga0495629_0030768_1060_1725 206
616 3300046460 Ga0495638_0001189 Ga0495638_0001189_17827_18447 206
617 3300046460 Ga0495638_0001932 Ga0495638_0001932_7753_8409 206
618 3300046460 Ga0495638_0001957 Ga0495638_0001957_15991_16611 206
619 3300046460 Ga0495638_0002895 Ga0495638_0002895_5736_6356 206
620 3300046460 Ga0495638_0003601 Ga0495638_0003601_3580_4200 206
621 3300046460 Ga0495638_0004891 Ga0495638_0004891_3476_4096 206
622 3300046460 Ga0495638_0026812 Ga0495638_0026812_2489_3109 206
623 3300046460 Ga0495638_0034055 Ga0495638_0034055_231_851 206
624 3300046460 Ga0495638_0039092 Ga0495638_0039092_2094_2714 206
625 3300046460 Ga0495638_0062759 Ga0495638_0062759_655_1275 206
626 3300046460 Ga0495638_0087401 Ga0495638_0087401_1081_1701 206
627 3300046460 Ga0495638_0095764 Ga0495638_0095764_423_1043 206
628 3300046460 Ga0495638_0167636 Ga0495638_0167636_130_750 206
629 3300046460 Ga0495638_0233604 Ga0495638_0233604_80_736 206
630 3300046460 Ga0495638_0252420 Ga0495638_0252420_279_899 206
631 3300046461 Ga0495641_0029432 Ga0495641_0029432_83_703 206
632 3300046462 Ga0495651_0010786 Ga0495651_0010786_656_1369 206
633 3300046462 Ga0495651_0087480 Ga0495651_0087480_1583_2239 206
634 3300046462 Ga0495651_0106718 Ga0495651_0106718_185_805 206
635 3300046462 Ga0495651_0115739 Ga0495651_0115739_1322_1942 206
636 3300046463 Ga0495653_0001528 Ga0495653_0001528_3782_4402 206
637 3300046463 Ga0495653_0002120 Ga0495653_0002120_14663_15283 206
638 3300046463 Ga0495653_0006298 Ga0495653_0006298_4983_5696 206
639 3300046463 Ga0495653_0009338 Ga0495653_0009338_7110_7730 206
640 3300046463 Ga0495653_0017188 Ga0495653_0017188_1917_2537 206
641 3300046463 Ga0495653_0357049 Ga0495653_0357049_50_670 206
642 3300046463 Ga0495653_0391332 Ga0495653_0391332_86_706 206
643 3300046471 Ga0495650_0002024 Ga0495650_0002024_16761_17381 206
644 3300046471 Ga0495650_0002389 Ga0495650_0002389_9975_10595 206
645 3300046471 Ga0495650_0002550 Ga0495650_0002550_9950_10570 206
646 3300046471 Ga0495650_0005686 Ga0495650_0005686_3797_4417 206
647 3300046471 Ga0495650_0025181 Ga0495650_0025181_2164_2784 206
648 3300046471 Ga0495650_0030240 Ga0495650_0030240_212_832 206
649 3300046471 Ga0495650_0035710 Ga0495650_0035710_216_836 206
650 3300046471 Ga0495650_0039205 Ga0495650_0039205_380_1000 206
651 3300046471 Ga0495650_0047483 Ga0495650_0047483_97_717 206
652 3300046472 Ga0495580_0000295 Ga0495580_0000295_28843_29499 206
653 3300046472 Ga0495580_0002112 Ga0495580_0002112_3782_4402 206
654 3300046472 Ga0495580_0002922 Ga0495580_0002922_5064_5684 206
655 3300046472 Ga0495580_0014535 Ga0495580_0014535_1201_1824 206
656 3300046472 Ga0495580_0023867 Ga0495580_0023867_3036_3656 206
657 3300046472 Ga0495580_0064336 Ga0495580_0064336_1667_2380 206
658 3300046472 Ga0495580_0094853 Ga0495580_0094853_1035_1655 206
659 3300046472 Ga0495580_0160581 Ga0495580_0160581_516_1136 206
660 3300046473 Ga0495582_0007815 Ga0495582_0007815_982_1602 206
661 3300046473 Ga0495582_0009290 Ga0495582_0009290_1038_1658 206
662 3300046473 Ga0495582_0043905 Ga0495582_0043905_859_1572 206
663 3300046473 Ga0495582_0068940 Ga0495582_0068940_363_983 206
664 3300046474 Ga0495605_0001000 Ga0495605_0001000_2224_2844 206
665 3300046474 Ga0495605_0001045 Ga0495605_0001045_13511_14131 206
666 3300046474 Ga0495605_0001305 Ga0495605_0001305_10220_10840 206
667 3300046474 Ga0495605_0005110 Ga0495605_0005110_2210_2830 206
668 3300046474 Ga0495605_0007327 Ga0495605_0007327_1839_2459 206
669 3300046474 Ga0495605_0009011 Ga0495605_0009011_2530_3150 206
670 3300046474 Ga0495605_0013199 Ga0495605_0013199_730_1350 206
671 3300046474 Ga0495605_0017059 Ga0495605_0017059_2355_3011 206
672 3300046474 Ga0495605_0026405 Ga0495605_0026405_730_1350 206
673 3300046474 Ga0495605_0028088 Ga0495605_0028088_2218_2841 206
674 3300046474 Ga0495605_0030824 Ga0495605_0030824_581_1201 206
675 3300046474 Ga0495605_0036535 Ga0495605_0036535_1105_1725 206
676 3300046474 Ga0495605_0118734 Ga0495605_0118734_210_830 206
677 3300046474 Ga0495605_0130922 Ga0495605_0130922_122_742 206
678 3300046474 Ga0495605_0155611 Ga0495605_0155611_14_634 206
679 3300046474 Ga0495605_0175854 Ga0495605_0175854_231_887 206
680 3300046474 Ga0495605_0186261 Ga0495605_0186261_164_784 206
681 3300046475 Ga0495639_0000340 Ga0495639_0000340_13504_14124 206
682 3300046475 Ga0495639_0002281 Ga0495639_0002281_1168_1788 206
683 3300046475 Ga0495639_0006694 Ga0495639_0006694_1140_1760 206
684 3300046476 Ga0495662_0014427 Ga0495662_0014427_2995_3615 206
685 3300046477 Ga0495664_0001444 Ga0495664_0001444_247_867 206
686 3300046491 Ga0495584_0000376 Ga0495584_0000376_14386_15006 206
687 3300046491 Ga0495584_0001269 Ga0495584_0001269_5874_6494 206
688 3300046491 Ga0495584_0004422 Ga0495584_0004422_4091_4711 206
689 3300046491 Ga0495584_0006321 Ga0495584_0006321_1494_2114 206
690 3300046491 Ga0495584_0008480 Ga0495584_0008480_2098_2718 206
691 3300046491 Ga0495584_0008670 Ga0495584_0008670_583_1203 206
692 3300046491 Ga0495584_0015950 Ga0495584_0015950_693_1313 206
693 3300046491 Ga0495584_0018191 Ga0495584_0018191_445_1065 206
694 3300046491 Ga0495584_0050220 Ga0495584_0050220_1412_2032 206
695 3300046491 Ga0495584_0125780 Ga0495584_0125780_633_1256 206
696 3300046492 Ga0495585_0001045 Ga0495585_0001045_5047_5667 206
697 3300046492 Ga0495585_0001713 Ga0495585_0001713_6306_6962 206
698 3300046492 Ga0495585_0003021 Ga0495585_0003021_6822_7442 206
699 3300046492 Ga0495585_0004557 Ga0495585_0004557_4391_5011 206
700 3300046492 Ga0495585_0004621 Ga0495585_0004621_449_1096 206
701 3300046492 Ga0495585_0013242 Ga0495585_0013242_3400_4020 206
702 3300046492 Ga0495585_0020019 Ga0495585_0020019_957_1577 206
703 3300046492 Ga0495585_0024247 Ga0495585_0024247_599_1219 206
704 3300046492 Ga0495585_0077051 Ga0495585_0077051_249_869 206
705 3300046492 Ga0495585_0100031 Ga0495585_0100031_584_1204 206
706 3300046499 Ga0495594_0000889 Ga0495594_0000889_1383_2003 206
707 3300046499 Ga0495594_0001248 Ga0495594_0001248_1333_1953 206
708 3300046499 Ga0495594_0055341 Ga0495594_0055341_1363_1983 206
709 3300046500 Ga0495596_0000576 Ga0495596_0000576_11683_12339 206
710 3300046500 Ga0495596_0004520 Ga0495596_0004520_2945_3658 206
711 3300046500 Ga0495596_0014690 Ga0495596_0014690_277_897 206
712 3300046500 Ga0495596_0037847 Ga0495596_0037847_894_1514 206
713 3300046500 Ga0495596_0059123 Ga0495596_0059123_487_1107 206
714 3300046500 Ga0495596_0165497 Ga0495596_0165497_199_819 206
715 3300046500 Ga0495596_0165501 Ga0495596_0165501_199_819 206
716 3300046501 Ga0495607_0000094 Ga0495607_0000094_51960_52598 206
717 3300046501 Ga0495607_0001437 Ga0495607_0001437_16526_17146 206
718 3300046501 Ga0495607_0002626 Ga0495607_0002626_3515_4135 206
719 3300046501 Ga0495607_0003226 Ga0495607_0003226_4908_5528 206
720 3300046501 Ga0495607_0007600 Ga0495607_0007600_1464_2120 206
721 3300046501 Ga0495607_0007944 Ga0495607_0007944_3882_4502 206
722 3300046501 Ga0495607_0010078 Ga0495607_0010078_1394_2014 206
723 3300046501 Ga0495607_0016903 Ga0495607_0016903_1818_2438 206
724 3300046501 Ga0495607_0017684 Ga0495607_0017684_3730_4350 206
725 3300046501 Ga0495607_0018811 Ga0495607_0018811_336_992 206
726 3300046501 Ga0495607_0029334 Ga0495607_0029334_1523_2179 206
727 3300046501 Ga0495607_0040146 Ga0495607_0040146_640_1260 206
728 3300046501 Ga0495607_0096404 Ga0495607_0096404_759_1379 206
729 3300046501 Ga0495607_0100171 Ga0495607_0100171_463_1083 206
730 3300046501 Ga0495607_0111280 Ga0495607_0111280_147_767 206
731 3300046501 Ga0495607_0149772 Ga0495607_0149772_519_1139 206
732 3300046501 Ga0495607_0157995 Ga0495607_0157995_389_1009 206
733 3300046501 Ga0495607_0289449 Ga0495607_0289449_82_702 206
734 3300046501 Ga0495607_0354464 Ga0495607_0354464_27_647 206
735 3300046506 Ga0495583_0000131 Ga0495583_0000131_109410_110030 206
736 3300046506 Ga0495583_0001715 Ga0495583_0001715_16340_16960 206
737 3300046506 Ga0495583_0002503 Ga0495583_0002503_12900_13520 206
738 3300046506 Ga0495583_0005590 Ga0495583_0005590_3604_4335 206
739 3300046506 Ga0495583_0005960 Ga0495583_0005960_638_1258 206
740 3300046506 Ga0495583_0108132 Ga0495583_0108132_88_708 206
741 3300046507 Ga0495606_0000794 Ga0495606_0000794_23476_24096 206
742 3300046507 Ga0495606_0001321 Ga0495606_0001321_5160_5780 206
743 3300046507 Ga0495606_0001801 Ga0495606_0001801_21569_22189 206
744 3300046507 Ga0495606_0004042 Ga0495606_0004042_6866_7486 206
745 3300046507 Ga0495606_0006669 Ga0495606_0006669_3943_4563 206
746 3300046507 Ga0495606_0006941 Ga0495606_0006941_6479_7099 206
747 3300046507 Ga0495606_0008002 Ga0495606_0008002_288_908 206
748 3300046507 Ga0495606_0009378 Ga0495606_0009378_3664_4284 206
749 3300046507 Ga0495606_0012768 Ga0495606_0012768_1222_1842 206
750 3300046507 Ga0495606_0015819 Ga0495606_0015819_168_788 206
751 3300046507 Ga0495606_0017298 Ga0495606_0017298_2909_3529 206
752 3300046507 Ga0495606_0031656 Ga0495606_0031656_2732_3388 206
753 3300046507 Ga0495606_0036522 Ga0495606_0036522_1629_2249 206
754 3300046507 Ga0495606_0062274 Ga0495606_0062274_1444_2064 206
755 3300046511 Ga0495608_0000861 Ga0495608_0000861_19809_20522 206
756 3300046512 Ga0495610_0001426 Ga0495610_0001426_16438_17058 206
757 3300046512 Ga0495610_0003681 Ga0495610_0003681_1998_2618 206
758 3300046512 Ga0495610_0005237 Ga0495610_0005237_3291_3911 206
759 3300046512 Ga0495610_0007098 Ga0495610_0007098_6460_7080 206
760 3300046512 Ga0495610_0007600 Ga0495610_0007600_3435_4055 206
761 3300046512 Ga0495610_0010405 Ga0495610_0010405_1436_2056 206
762 3300046512 Ga0495610_0012038 Ga0495610_0012038_2041_2661 206
763 3300046512 Ga0495610_0013966 Ga0495610_0013966_3782_4402 206
764 3300046512 Ga0495610_0018793 Ga0495610_0018793_716_1336 206
765 3300046512 Ga0495610_0019003 Ga0495610_0019003_13_633 206
766 3300046512 Ga0495610_0025562 Ga0495610_0025562_868_1488 206
767 3300046512 Ga0495610_0037264 Ga0495610_0037264_1811_2431 206
768 3300046512 Ga0495610_0039554 Ga0495610_0039554_824_1480 206
769 3300046512 Ga0495610_0108558 Ga0495610_0108558_443_1099 206
770 3300046513 Ga0495616_0000704 Ga0495616_0000704_19097_19717 206
771 3300046513 Ga0495616_0001304 Ga0495616_0001304_4414_5034 206
772 3300046513 Ga0495616_0001608 Ga0495616_0001608_5852_6472 206
773 3300046513 Ga0495616_0005421 Ga0495616_0005421_5037_5657 206
774 3300046513 Ga0495616_0006790 Ga0495616_0006790_5456_6076 206
775 3300046513 Ga0495616_0007406 Ga0495616_0007406_5587_6207 206
776 3300046513 Ga0495616_0157735 Ga0495616_0157735_350_970 206
777 3300046513 Ga0495616_0213903 Ga0495616_0213903_43_663 206
778 3300046513 Ga0495616_0226801 Ga0495616_0226801_112_735 206
779 3300046513 Ga0495616_0274130 Ga0495616_0274130_73_693 206
780 3300046513 Ga0495616_0314856 Ga0495616_0314856_15_635 206
781 3300046514 Ga0495618_0003821 Ga0495618_0003821_7757_8470 206
782 3300046514 Ga0495618_0004456 Ga0495618_0004456_3223_3843 206
783 3300046514 Ga0495618_0005144 Ga0495618_0005144_1894_2514 206
784 3300046514 Ga0495618_0040193 Ga0495618_0040193_170_790 206
785 3300046515 Ga0495620_0000532 Ga0495620_0000532_20204_20824 206
786 3300046515 Ga0495620_0000700 Ga0495620_0000700_15961_16581 206
787 3300046515 Ga0495620_0001612 Ga0495620_0001612_10829_11449 206
788 3300046515 Ga0495620_0002510 Ga0495620_0002510_3564_4184 206
789 3300046515 Ga0495620_0004727 Ga0495620_0004727_4740_5360 206
790 3300046515 Ga0495620_0005152 Ga0495620_0005152_2024_2644 206
791 3300046515 Ga0495620_0005775 Ga0495620_0005775_3399_4019 206
792 3300046515 Ga0495620_0006517 Ga0495620_0006517_1111_1767 206
793 3300046515 Ga0495620_0030410 Ga0495620_0030410_1209_1829 206
794 3300046515 Ga0495620_0076301 Ga0495620_0076301_668_1288 206
795 3300046515 Ga0495620_0110363 Ga0495620_0110363_342_962 206
796 3300046516 Ga0495628_0004005 Ga0495628_0004005_1856_2476 206
797 3300046516 Ga0495628_0020935 Ga0495628_0020935_1907_2527 206
798 3300046516 Ga0495628_0035834 Ga0495628_0035834_2634_3347 206
799 3300046516 Ga0495628_0107394 Ga0495628_0107394_1378_1998 206
800 3300046516 Ga0495628_0154829 Ga0495628_0154829_944_1600 206
801 3300046517 Ga0495630_0002987 Ga0495630_0002987_9775_10395 206
802 3300046517 Ga0495630_0005336 Ga0495630_0005336_3323_3943 206
803 3300046517 Ga0495630_0005672 Ga0495630_0005672_7369_7989 206
804 3300046517 Ga0495630_0008780 Ga0495630_0008780_3885_4598 206
805 3300046517 Ga0495630_0025620 Ga0495630_0025620_2757_3377 206
806 3300046517 Ga0495630_0030484 Ga0495630_0030484_114_770 206
807 3300046517 Ga0495630_0031355 Ga0495630_0031355_830_1450 206
808 3300046518 Ga0495631_0000401 Ga0495631_0000401_22033_22653 206
809 3300046518 Ga0495631_0000547 Ga0495631_0000547_3325_3945 206
810 3300046518 Ga0495631_0002572 Ga0495631_0002572_2993_3613 206
811 3300046518 Ga0495631_0004526 Ga0495631_0004526_5150_5770 206
812 3300046518 Ga0495631_0008360 Ga0495631_0008360_1266_1922 206
813 3300046518 Ga0495631_0016102 Ga0495631_0016102_2370_2990 206
814 3300046518 Ga0495631_0030203 Ga0495631_0030203_1398_2018 206
815 3300046518 Ga0495631_0265063 Ga0495631_0265063_13_633 206
816 3300046519 Ga0495632_0001029 Ga0495632_0001029_14666_15286 206
817 3300046519 Ga0495632_0001346 Ga0495632_0001346_15485_16105 206
818 3300046519 Ga0495632_0002048 Ga0495632_0002048_10597_11217 206
819 3300046519 Ga0495632_0002133 Ga0495632_0002133_8882_9502 206
820 3300046519 Ga0495632_0002447 Ga0495632_0002447_4579_5235 206
821 3300046519 Ga0495632_0003192 Ga0495632_0003192_4666_5322 206
822 3300046519 Ga0495632_0004891 Ga0495632_0004891_2382_3038 206
823 3300046519 Ga0495632_0007869 Ga0495632_0007869_3944_4564 206
824 3300046519 Ga0495632_0008635 Ga0495632_0008635_3922_4542 206
825 3300046519 Ga0495632_0008734 Ga0495632_0008734_1653_2273 206
826 3300046519 Ga0495632_0012801 Ga0495632_0012801_2748_3368 206
827 3300046519 Ga0495632_0019155 Ga0495632_0019155_1727_2347 206
828 3300046519 Ga0495632_0022173 Ga0495632_0022173_261_881 206
829 3300046519 Ga0495632_0177508 Ga0495632_0177508_170_790 206
830 3300046519 Ga0495632_0218483 Ga0495632_0218483_85_705 206
831 3300046519 Ga0495632_0252443 Ga0495632_0252443_142_762 206
832 3300046520 Ga0495637_0000721 Ga0495637_0000721_16390_17010 206
833 3300046520 Ga0495637_0000839 Ga0495637_0000839_14908_15528 206
834 3300046520 Ga0495637_0001144 Ga0495637_0001144_6008_6664 206
835 3300046520 Ga0495637_0001472 Ga0495637_0001472_3614_4234 206
836 3300046520 Ga0495637_0002282 Ga0495637_0002282_7043_7663 206
837 3300046520 Ga0495637_0003690 Ga0495637_0003690_3193_3813 206
838 3300046520 Ga0495637_0004764 Ga0495637_0004764_432_1052 206
839 3300046520 Ga0495637_0006226 Ga0495637_0006226_1463_2083 206
840 3300046520 Ga0495637_0021848 Ga0495637_0021848_1858_2478 206
841 3300046520 Ga0495637_0044468 Ga0495637_0044468_454_1074 206
842 3300046520 Ga0495637_0057825 Ga0495637_0057825_561_1181 206
843 3300046522 Ga0495643_0006509 Ga0495643_0006509_4759_5379 206
844 3300046522 Ga0495643_0008717 Ga0495643_0008717_3225_3845 206
845 3300046522 Ga0495643_0010071 Ga0495643_0010071_3471_4091 206
846 3300046522 Ga0495643_0016618 Ga0495643_0016618_1534_2154 206
847 3300046522 Ga0495643_0021394 Ga0495643_0021394_1028_1648 206
848 3300046522 Ga0495643_0024167 Ga0495643_0024167_2369_3025 206
849 3300046522 Ga0495643_0026541 Ga0495643_0026541_1088_1708 206
850 3300046522 Ga0495643_0033194 Ga0495643_0033194_16_636 206
851 3300046522 Ga0495643_0037703 Ga0495643_0037703_1534_2190 206
852 3300046522 Ga0495643_0066488 Ga0495643_0066488_15_635 206
853 3300046523 Ga0495644_0000401 Ga0495644_0000401_4690_5346 206
854 3300046523 Ga0495644_0000526 Ga0495644_0000526_12388_13044 206
855 3300046523 Ga0495644_0004777 Ga0495644_0004777_4196_4816 206
856 3300046523 Ga0495644_0026159 Ga0495644_0026159_1197_1817 206
857 3300046523 Ga0495644_0032045 Ga0495644_0032045_493_1113 206
858 3300046523 Ga0495644_0038028 Ga0495644_0038028_1130_1750 206
859 3300046524 Ga0495648_0000623 Ga0495648_0000623_3301_3921 206
860 3300046524 Ga0495648_0001689 Ga0495648_0001689_4445_5065 206
861 3300046524 Ga0495648_0005373 Ga0495648_0005373_4596_5216 206
862 3300046524 Ga0495648_0007423 Ga0495648_0007423_2308_2928 206
863 3300046524 Ga0495648_0007967 Ga0495648_0007967_4256_4876 206
864 3300046524 Ga0495648_0009398 Ga0495648_0009398_2467_3087 206
865 3300046524 Ga0495648_0027440 Ga0495648_0027440_2257_2877 206
866 3300046524 Ga0495648_0028078 Ga0495648_0028078_2367_2987 206
867 3300046524 Ga0495648_0034742 Ga0495648_0034742_566_1186 206
868 3300046524 Ga0495648_0036744 Ga0495648_0036744_2469_3089 206
869 3300046524 Ga0495648_0048093 Ga0495648_0048093_1371_1991 206
870 3300046524 Ga0495648_0052850 Ga0495648_0052850_492_1112 206
871 3300046524 Ga0495648_0056713 Ga0495648_0056713_800_1420 206
872 3300046524 Ga0495648_0058165 Ga0495648_0058165_872_1492 206
873 3300046524 Ga0495648_0090335 Ga0495648_0090335_33_689 206
874 3300046524 Ga0495648_0158121 Ga0495648_0158121_66_686 206
875 3300046524 Ga0495648_0177855 Ga0495648_0177855_115_735 206
876 3300046524 Ga0495648_0229548 Ga0495648_0229548_86_706 206
877 3300046524 Ga0495648_0319765 Ga0495648_0319765_73_693 206
878 3300046526 Ga0495666_0000881 Ga0495666_0000881_6088_6801 206
879 3300046526 Ga0495666_0000942 Ga0495666_0000942_9413_10033 206
880 3300046526 Ga0495666_0004188 Ga0495666_0004188_662_1282 206
881 3300046526 Ga0495666_0052872 Ga0495666_0052872_1239_1859 206
882 3300046526 Ga0495666_0055680 Ga0495666_0055680_568_1254 206
883 3300046526 Ga0495666_0116609 Ga0495666_0116609_73_693 206
884 3300046528 Ga0495642_0000250 Ga0495642_0000250_16763_17383 206
885 3300046528 Ga0495642_0000798 Ga0495642_0000798_8880_9500 206
886 3300046528 Ga0495642_0001543 Ga0495642_0001543_4351_4971 206
887 3300046528 Ga0495642_0108357 Ga0495642_0108357_547_1167 206
888 3300046529 Ga0495652_0022420 Ga0495652_0022420_852_1565 206
889 3300046529 Ga0495652_0026999 Ga0495652_0026999_662_1282 206
890 3300046529 Ga0495652_0052937 Ga0495652_0052937_1092_1712 206
891 3300046529 Ga0495652_0179067 Ga0495652_0179067_780_1478 206
892 3300046530 Ga0495654_0000119 Ga0495654_0000119_4050_4670 206
893 3300046530 Ga0495654_0000444 Ga0495654_0000444_14789_15409 206
894 3300046530 Ga0495654_0000803 Ga0495654_0000803_14953_15573 206
895 3300046530 Ga0495654_0001798 Ga0495654_0001798_110_730 206
896 3300046530 Ga0495654_0001816 Ga0495654_0001816_13186_13806 206
897 3300046530 Ga0495654_0004330 Ga0495654_0004330_6268_6888 206
898 3300046530 Ga0495654_0007041 Ga0495654_0007041_2634_3254 206
899 3300046530 Ga0495654_0013866 Ga0495654_0013866_90_746 206
900 3300046530 Ga0495654_0015407 Ga0495654_0015407_2942_3598 206
901 3300046530 Ga0495654_0016762 Ga0495654_0016762_2642_3262 206
902 3300046530 Ga0495654_0028250 Ga0495654_0028250_132_752 206
903 3300046530 Ga0495654_0029130 Ga0495654_0029130_1826_2446 206
904 3300046530 Ga0495654_0033314 Ga0495654_0033314_1971_2591 206
905 3300046530 Ga0495654_0037272 Ga0495654_0037272_1777_2397 206
906 3300046530 Ga0495654_0051030 Ga0495654_0051030_1147_1767 206
907 3300046530 Ga0495654_0053380 Ga0495654_0053380_265_885 206
908 3300046530 Ga0495654_0068490 Ga0495654_0068490_457_1077 206
909 3300046530 Ga0495654_0077912 Ga0495654_0077912_58_678 206
910 3300046530 Ga0495654_0083507 Ga0495654_0083507_73_693 206
911 3300046530 Ga0495654_0087635 Ga0495654_0087635_34_654 206
912 3300046530 Ga0495654_0138122 Ga0495654_0138122_93_713 206
913 3300046530 Ga0495654_0160689 Ga0495654_0160689_135_755 206
914 3300046531 Ga0495665_0009206 Ga0495665_0009206_191_904 206
915 3300046531 Ga0495665_0063360 Ga0495665_0063360_670_1290 206
916 3300046531 Ga0495665_0178945 Ga0495665_0178945_320_940 206
917 3300046533 Ga0495640_0139973 Ga0495640_0139973_656_1369 206
918 3300046533 Ga0495640_0161959 Ga0495640_0161959_212_832 206
919 3300046535 Ga0495586_0001186 Ga0495586_0001186_10376_10996 206
920 3300046535 Ga0495586_0060426 Ga0495586_0060426_172_792 206
921 3300046535 Ga0495586_0154911 Ga0495586_0154911_328_1041 206
922 3300046536 Ga0495587_0001667 Ga0495587_0001667_3914_4534 206
923 3300046536 Ga0495587_0005504 Ga0495587_0005504_5670_6383 206
924 3300046536 Ga0495587_0198029 Ga0495587_0198029_178_798 206
925 3300046538 Ga0495609_0001092 Ga0495609_0001092_17042_17662 206
926 3300046538 Ga0495609_0001178 Ga0495609_0001178_12771_13391 206
927 3300046538 Ga0495609_0005130 Ga0495609_0005130_1643_2263 206
928 3300046538 Ga0495609_0006457 Ga0495609_0006457_4931_5551 206
929 3300046538 Ga0495609_0007374 Ga0495609_0007374_358_978 206
930 3300046538 Ga0495609_0008247 Ga0495609_0008247_3126_3746 206
931 3300046538 Ga0495609_0010025 Ga0495609_0010025_3472_4092 206
932 3300046538 Ga0495609_0017110 Ga0495609_0017110_2444_3091 206
933 3300046538 Ga0495609_0090777 Ga0495609_0090777_236_856 206
934 3300046538 Ga0495609_0119304 Ga0495609_0119304_265_903 206
935 3300046538 Ga0495609_0162138 Ga0495609_0162138_284_904 206
936 3300046542 Ga0495597_0001040 Ga0495597_0001040_3721_4341 206
937 3300046542 Ga0495597_0002603 Ga0495597_0002603_4396_5016 206
938 3300046542 Ga0495597_0006345 Ga0495597_0006345_3314_3934 206
939 3300046542 Ga0495597_0007238 Ga0495597_0007238_3331_3987 206
940 3300046542 Ga0495597_0007413 Ga0495597_0007413_2782_3402 206
941 3300046542 Ga0495597_0016705 Ga0495597_0016705_1823_2443 206
942 3300046542 Ga0495597_0021142 Ga0495597_0021142_2084_2740 206
943 3300046542 Ga0495597_0027018 Ga0495597_0027018_1711_2367 206
944 3300046542 Ga0495597_0029411 Ga0495597_0029411_444_1064 206
945 3300046542 Ga0495597_0030625 Ga0495597_0030625_626_1246 206
946 3300046542 Ga0495597_0095100 Ga0495597_0095100_312_932 206
947 3300046542 Ga0495597_0118741 Ga0495597_0118741_280_900 206
948 3300046542 Ga0495597_0210507 Ga0495597_0210507_105_725 206
949 3300046542 Ga0495597_0226619 Ga0495597_0226619_20_640 206
950 3300046542 Ga0495597_0245306 Ga0495597_0245306_51_671 206
951 3300046543 Ga0495645_0000929 Ga0495645_0000929_15171_15791 206
952 3300046543 Ga0495645_0134348 Ga0495645_0134348_219_839 206
953 3300046543 Ga0495645_0244861 Ga0495645_0244861_39_659 206
954 3300046557 Ga0495622_0000100 Ga0495622_0000100_22956_23624 206
955 3300046557 Ga0495622_0000537 Ga0495622_0000537_22050_22670 206
956 3300046557 Ga0495622_0002203 Ga0495622_0002203_489_1109 206
957 3300046557 Ga0495622_0002455 Ga0495622_0002455_7259_7879 206
958 3300046557 Ga0495622_0003767 Ga0495622_0003767_6366_6986 206
959 3300046557 Ga0495622_0033479 Ga0495622_0033479_325_948 206
960 3300046557 Ga0495622_0113095 Ga0495622_0113095_209_829 206
961 3300046558 Ga0495633_0000867 Ga0495633_0000867_20573_21193 206
962 3300046558 Ga0495633_0003311 Ga0495633_0003311_7714_8334 206
963 3300046558 Ga0495633_0011125 Ga0495633_0011125_3530_4150 206
964 3300046558 Ga0495633_0060458 Ga0495633_0060458_672_1292 206
965 3300046558 Ga0495633_0143632 Ga0495633_0143632_366_986 206
966 3300046559 Ga0495667_0046267 Ga0495667_0046267_1522_2235 206
967 3300046615 Ga0495656_0003297 Ga0495656_0003297_4758_5378 206
968 3300046616 Ga0495668_0000046 Ga0495668_0000046_120169_120789 206
969 3300046616 Ga0495668_0002037 Ga0495668_0002037_5083_5703 206
970 3300046616 Ga0495668_0002511 Ga0495668_0002511_9428_10084 206
971 3300046616 Ga0495668_0010183 Ga0495668_0010183_3807_4427 206
972 3300046616 Ga0495668_0011417 Ga0495668_0011417_1403_2023 206
973 3300046616 Ga0495668_0015379 Ga0495668_0015379_1589_2209 206
974 3300046642 Ga0495634_0001891 Ga0495634_0001891_6675_7295 206
975 3300046642 Ga0495634_0004652 Ga0495634_0004652_4664_5284 206
976 3300046642 Ga0495634_0016202 Ga0495634_0016202_1366_2079 206
977 3300046642 Ga0495634_0025679 Ga0495634_0025679_1759_2379 206
978 3300046648 Ga0495611_0000468 Ga0495611_0000468_5022_5642 206
979 3300046648 Ga0495611_0003233 Ga0495611_0003233_3971_4591 206
980 3300046648 Ga0495611_0009412 Ga0495611_0009412_3123_3743 206
981 3300046648 Ga0495611_0034799 Ga0495611_0034799_158_778 206
982 3300046648 Ga0495611_0041921 Ga0495611_0041921_818_1438 206
983 3300046648 Ga0495611_0151381 Ga0495611_0151381_218_838 206
984 3300046648 Ga0495611_0189701 Ga0495611_0189701_196_816 206
985 3300046660 Ga0495625_0000656 Ga0495625_0000656_21057_21677 206
986 3300046660 Ga0495625_0002907 Ga0495625_0002907_4954_5574 206
987 3300046660 Ga0495625_0003826 Ga0495625_0003826_5237_5893 206
988 3300046660 Ga0495625_0004795 Ga0495625_0004795_7861_8481 206
989 3300046660 Ga0495625_0004936 Ga0495625_0004936_7188_7808 206
990 3300046660 Ga0495625_0013653 Ga0495625_0013653_4207_4827 206
991 3300046660 Ga0495625_0014469 Ga0495625_0014469_979_1599 206
992 3300046660 Ga0495625_0017184 Ga0495625_0017184_4672_5292 206
993 3300046660 Ga0495625_0017980 Ga0495625_0017980_853_1473 206
994 3300046660 Ga0495625_0035357 Ga0495625_0035357_1706_2326 206
995 3300046660 Ga0495625_0036130 Ga0495625_0036130_2634_3290 206
996 3300046660 Ga0495625_0042924 Ga0495625_0042924_1490_2110 206
997 3300046660 Ga0495625_0056966 Ga0495625_0056966_2030_2650 206
998 3300046660 Ga0495625_0066346 Ga0495625_0066346_260_880 206
999 3300046660 Ga0495625_0109437 Ga0495625_0109437_994_1614 206
1000 3300046663 Ga0495635_0001260 Ga0495635_0001260_10734_11354 206
1001 3300046663 Ga0495635_0004925 Ga0495635_0004925_3215_3835 206
1002 3300046663 Ga0495635_0036110 Ga0495635_0036110_269_889 206
1003 3300046664 Ga0495659_0000187 Ga0495659_0000187_13488_14108 206
1004 3300046664 Ga0495659_0000756 Ga0495659_0000756_10902_11522 206
1005 3300046664 Ga0495659_0001064 Ga0495659_0001064_5491_6111 206
1006 3300046664 Ga0495659_0002715 Ga0495659_0002715_4953_5573 206
1007 3300046664 Ga0495659_0085173 Ga0495659_0085173_370_990 206
1008 3300046665 Ga0495661_0001936 Ga0495661_0001936_8238_8858 206
1009 3300046665 Ga0495661_0002542 Ga0495661_0002542_8608_9228 206
1010 3300046665 Ga0495661_0005297 Ga0495661_0005297_1366_2079 206
1011 3300046665 Ga0495661_0015539 Ga0495661_0015539_2855_3475 206
1012 3300046665 Ga0495661_0019331 Ga0495661_0019331_2753_3373 206
1013 3300046665 Ga0495661_0019413 Ga0495661_0019413_410_1030 206
1014 3300046665 Ga0495661_0030604 Ga0495661_0030604_548_1204 206
1015 3300046665 Ga0495661_0046123 Ga0495661_0046123_1561_2181 206
1016 3300046665 Ga0495661_0068629 Ga0495661_0068629_39_659 206
1017 3300046665 Ga0495661_0102995 Ga0495661_0102995_766_1422 206
1018 3300046665 Ga0495661_0174244 Ga0495661_0174244_353_973 206
1019 3300046674 Ga0495588_0005089 Ga0495588_0005089_4223_4843 206
1020 3300046674 Ga0495588_0032240 Ga0495588_0032240_700_1320 206
1021 3300046674 Ga0495588_0049467 Ga0495588_0049467_1261_1881 206
1022 3300046674 Ga0495588_0127731 Ga0495588_0127731_568_1188 206
1023 3300046674 Ga0495588_0200062 Ga0495588_0200062_17_637 206
1024 3300046678 Ga0495599_0007511 Ga0495599_0007511_472_1092 206
1025 3300046678 Ga0495599_0014538 Ga0495599_0014538_1619_2332 206
1026 3300046678 Ga0495599_0031814 Ga0495599_0031814_2309_2929 206
1027 3300046678 Ga0495599_0371728 Ga0495599_0371728_63_719 206
1028 3300046679 Ga0495623_0001367 Ga0495623_0001367_5706_6326 206
1029 3300046679 Ga0495623_0004123 Ga0495623_0004123_1555_2175 206
1030 3300046679 Ga0495623_0019477 Ga0495623_0019477_3639_4259 206
1031 3300046680 Ga0495646_0001267 Ga0495646_0001267_8279_8899 206
1032 3300046680 Ga0495646_0003933 Ga0495646_0003933_7999_8619 206
1033 3300046680 Ga0495646_0009742 Ga0495646_0009742_3383_4096 206
1034 3300046680 Ga0495646_0019328 Ga0495646_0019328_3042_3662 206
1035 3300046680 Ga0495646_0034323 Ga0495646_0034323_280_936 206
1036 3300046680 Ga0495646_0054571 Ga0495646_0054571_25_723 206
1037 3300046680 Ga0495646_0121763 Ga0495646_0121763_228_848 206
1038 3300046684 Ga0495669_0002519 Ga0495669_0002519_928_1548 206
1039 3300046684 Ga0495669_0041127 Ga0495669_0041127_33_653 206
1040 3300046689 Ga0495613_0002750 Ga0495613_0002750_8034_8747 206
1041 3300046689 Ga0495613_0016685 Ga0495613_0016685_1492_2112 206
1042 3300046689 Ga0495613_0039129 Ga0495613_0039129_461_1081 206
1043 3300046689 Ga0495613_0097259 Ga0495613_0097259_829_1449 206
1044 3300046690 Ga0495624_0001286 Ga0495624_0001286_4579_5199 206
1045 3300046690 Ga0495624_0002152 Ga0495624_0002152_3034_3654 206
1046 3300046690 Ga0495624_0008717 Ga0495624_0008717_133_789 206
1047 3300046690 Ga0495624_0025376 Ga0495624_0025376_1470_2090 206
1048 3300046690 Ga0495624_0046070 Ga0495624_0046070_1400_2020 206
1049 3300046691 Ga0495670_0001990 Ga0495670_0001990_6486_7106 206
1050 3300046691 Ga0495670_0008439 Ga0495670_0008439_965_1612 206
1051 3300046691 Ga0495670_0008797 Ga0495670_0008797_759_1379 206
1052 3300046691 Ga0495670_0008798 Ga0495670_0008798_1110_1730 206
1053 3300046691 Ga0495670_0009884 Ga0495670_0009884_2431_3051 206
1054 3300046691 Ga0495670_0056259 Ga0495670_0056259_681_1301 206
1055 3300046691 Ga0495670_0087518 Ga0495670_0087518_827_1447 206
1056 3300046691 Ga0495670_0121790 Ga0495670_0121790_195_815 206
1057 3300046691 Ga0495670_0478620 Ga0495670_0478620_13_633 206
1058 3300046692 Ga0495671_0000086 Ga0495671_0000086_3445_4065 206
1059 3300046692 Ga0495671_0003431 Ga0495671_0003431_8774_9394 206
1060 3300046692 Ga0495671_0003491 Ga0495671_0003491_3380_4000 206
1061 3300046692 Ga0495671_0004200 Ga0495671_0004200_2257_2877 206
1062 3300046692 Ga0495671_0004655 Ga0495671_0004655_4663_5283 206
1063 3300046692 Ga0495671_0005088 Ga0495671_0005088_4297_4917 206
1064 3300046692 Ga0495671_0005497 Ga0495671_0005497_6524_7144 206
1065 3300046692 Ga0495671_0007897 Ga0495671_0007897_2012_2632 206
1066 3300046692 Ga0495671_0009775 Ga0495671_0009775_390_1010 206
1067 3300046692 Ga0495671_0013921 Ga0495671_0013921_3120_3740 206
1068 3300046692 Ga0495671_0059717 Ga0495671_0059717_818_1438 206
1069 3300046692 Ga0495671_0081549 Ga0495671_0081549_191_904 206
1070 3300046692 Ga0495671_0204833 Ga0495671_0204833_325_945 206
1071 3300046694 Ga0495649_0001286 Ga0495649_0001286_4696_5352 206
1072 3300046694 Ga0495649_0001615 Ga0495649_0001615_2657_3277 206
1073 3300046694 Ga0495649_0001875 Ga0495649_0001875_5879_6499 206
1074 3300046694 Ga0495649_0005499 Ga0495649_0005499_4685_5305 206
1075 3300046694 Ga0495649_0005936 Ga0495649_0005936_4855_5475 206
1076 3300046694 Ga0495649_0008206 Ga0495649_0008206_2891_3511 206
1077 3300046694 Ga0495649_0015998 Ga0495649_0015998_1355_1975 206
1078 3300046694 Ga0495649_0024273 Ga0495649_0024273_2271_2891 206
1079 3300046694 Ga0495649_0048053 Ga0495649_0048053_306_926 206
1080 3300046694 Ga0495649_0048331 Ga0495649_0048331_318_938 206
1081 3300046694 Ga0495649_0050521 Ga0495649_0050521_1460_2080 206
1082 3300046694 Ga0495649_0068269 Ga0495649_0068269_712_1332 206
1083 3300046694 Ga0495649_0101251 Ga0495649_0101251_474_1205 206
1084 3300046694 Ga0495649_0131941 Ga0495649_0131941_80_700 206
1085 3300046694 Ga0495649_0134034 Ga0495649_0134034_464_1084 206
1086 3300046694 Ga0495649_0379558 Ga0495649_0379558_31_651 206
1087 3300046794 Ga0495589_0000763 Ga0495589_0000763_7116_7736 206
1088 3300046794 Ga0495589_0001331 Ga0495589_0001331_6065_6685 206
1089 3300046794 Ga0495589_0001530 Ga0495589_0001530_4385_5005 206
1090 3300046794 Ga0495589_0001826 Ga0495589_0001826_10786_11406 206
1091 3300046794 Ga0495589_0005066 Ga0495589_0005066_3418_4074 206
1092 3300046794 Ga0495589_0005481 Ga0495589_0005481_5739_6395 206
1093 3300046794 Ga0495589_0006916 Ga0495589_0006916_4964_5584 206
1094 3300046794 Ga0495589_0018545 Ga0495589_0018545_2849_3469 206
1095 3300046794 Ga0495589_0031152 Ga0495589_0031152_1781_2494 206
1096 3300046794 Ga0495589_0051898 Ga0495589_0051898_916_1536 206
1097 3300046809 Ga0495600_0001304 Ga0495600_0001304_3120_3833 206
1098 3300046809 Ga0495600_0002832 Ga0495600_0002832_3802_4422 206
1099 3300046810 Ga0495660_0001979 Ga0495660_0001979_3996_4616 206
1100 3300046810 Ga0495660_0002830 Ga0495660_0002830_2392_3012 206
1101 3300046810 Ga0495660_0004168 Ga0495660_0004168_36_656 206
1102 3300046810 Ga0495660_0006459 Ga0495660_0006459_60_680 206
1103 3300046810 Ga0495660_0009176 Ga0495660_0009176_2320_2940 206
1104 3300046810 Ga0495660_0010035 Ga0495660_0010035_1549_2169 206
1105 3300046810 Ga0495660_0010730 Ga0495660_0010730_1388_2008 206
1106 3300046810 Ga0495660_0012868 Ga0495660_0012868_701_1321 206
1107 3300046810 Ga0495660_0013424 Ga0495660_0013424_1412_2068 206
1108 3300046810 Ga0495660_0013641 Ga0495660_0013641_971_1591 206
1109 3300046810 Ga0495660_0016250 Ga0495660_0016250_707_1327 206
1110 3300046810 Ga0495660_0019589 Ga0495660_0019589_2519_3139 206
1111 3300046810 Ga0495660_0020271 Ga0495660_0020271_751_1371 206
1112 3300046810 Ga0495660_0034008 Ga0495660_0034008_1871_2491 206
1113 3300046810 Ga0495660_0035946 Ga0495660_0035946_724_1344 206
1114 3300046810 Ga0495660_0037559 Ga0495660_0037559_205_861 206
1115 3300046810 Ga0495660_0064039 Ga0495660_0064039_651_1271 206
1116 3300046810 Ga0495660_0071118 Ga0495660_0071118_649_1269 206
1117 3300046810 Ga0495660_0072437 Ga0495660_0072437_762_1382 206
1118 3300046810 Ga0495660_0129148 Ga0495660_0129148_427_1047 206
1119 3300046810 Ga0495660_0132588 Ga0495660_0132588_61_681 206
1120 3300046810 Ga0495660_0142814 Ga0495660_0142814_48_668 206
1121 3300046810 Ga0495660_0146984 Ga0495660_0146984_158_778 206
1122 3300047315 Ga0495581_0001153 Ga0495581_0001153_8334_8954 206
1123 3300047315 Ga0495581_0005412 Ga0495581_0005412_2256_2876 206
1124 3300047315 Ga0495581_0018166 Ga0495581_0018166_837_1550 206
1125 3300047317 Ga0495604_0000139 Ga0495604_0000139_19309_19929 206
1126 3300047317 Ga0495604_0002849 Ga0495604_0002849_2995_3615 206
1127 3300047317 Ga0495604_0007066 Ga0495604_0007066_739_1359 206
1128 3300047317 Ga0495604_0011039 Ga0495604_0011039_2434_3054 206
1129 3300047317 Ga0495604_0038541 Ga0495604_0038541_930_1550 206
1130 3300047317 Ga0495604_0054469 Ga0495604_0054469_25_681 206
1131 3300047318 Ga0495636_0002708 Ga0495636_0002708_3091_3711 206
1132 3300047318 Ga0495636_0108161 Ga0495636_0108161_114_734 206
1133 3300047319 Ga0495674_0010496 Ga0495674_0010496_234_854 206
1134 3300047319 Ga0495674_0012924 Ga0495674_0012924_6485_7108 206
1135 3300047319 Ga0495674_0050534 Ga0495674_0050534_428_1048 206
1136 3300047319 Ga0495674_0079119 Ga0495674_0079119_769_1389 206
1137 3300047319 Ga0495674_0421317 Ga0495674_0421317_71_691 206
1138 3300047320 Ga0495672_0001748 Ga0495672_0001748_8776_9396 206
1139 3300047320 Ga0495672_0001963 Ga0495672_0001963_14026_14682 206
1140 3300047320 Ga0495672_0002470 Ga0495672_0002470_12013_12633 206
1141 3300047320 Ga0495672_0002731 Ga0495672_0002731_11910_12530 206
1142 3300047320 Ga0495672_0003013 Ga0495672_0003013_6033_6653 206
1143 3300047320 Ga0495672_0003388 Ga0495672_0003388_4580_5200 206
1144 3300047320 Ga0495672_0004190 Ga0495672_0004190_4699_5355 206
1145 3300047320 Ga0495672_0006077 Ga0495672_0006077_3322_3942 206
1146 3300047320 Ga0495672_0008385 Ga0495672_0008385_1026_1646 206
1147 3300047320 Ga0495672_0011393 Ga0495672_0011393_1355_1975 206
1148 3300047320 Ga0495672_0011726 Ga0495672_0011726_1744_2364 206
1149 3300047320 Ga0495672_0013597 Ga0495672_0013597_4572_5192 206
1150 3300047320 Ga0495672_0017216 Ga0495672_0017216_714_1334 206
1151 3300047320 Ga0495672_0019212 Ga0495672_0019212_2802_3422 206
1152 3300047320 Ga0495672_0025035 Ga0495672_0025035_768_1388 206
1153 3300047320 Ga0495672_0058335 Ga0495672_0058335_451_1074 206
1154 3300047320 Ga0495672_0060470 Ga0495672_0060470_812_1432 206
1155 3300047320 Ga0495672_0107037 Ga0495672_0107037_793_1413 206
1156 3300047320 Ga0495672_0144993 Ga0495672_0144993_124_744 206
1157 3300047321 Ga0495676_0001430 Ga0495676_0001430_4845_5465 206
1158 3300047321 Ga0495676_0007004 Ga0495676_0007004_4166_4786 206
1159 3300047321 Ga0495676_0010886 Ga0495676_0010886_539_1252 206
1160 3300047321 Ga0495676_0076388 Ga0495676_0076388_408_1073 206
1161 3300047321 Ga0495676_0496596 Ga0495676_0496596_59_679 206
1162 3300047322 Ga0495680_0004433 Ga0495680_0004433_8227_8847 206
1163 3300047322 Ga0495680_0004958 Ga0495680_0004958_3656_4276 206
1164 3300047322 Ga0495680_0005052 Ga0495680_0005052_6202_6822 206
1165 3300047322 Ga0495680_0016592 Ga0495680_0016592_662_1282 206
1166 3300047322 Ga0495680_0022768 Ga0495680_0022768_2954_3574 206
1167 3300047322 Ga0495680_0025328 Ga0495680_0025328_2856_3542 206
1168 3300047322 Ga0495680_0038333 Ga0495680_0038333_1085_1705 206
1169 3300047322 Ga0495680_0047911 Ga0495680_0047911_1879_2592 206
1170 3300047322 Ga0495680_0163258 Ga0495680_0163258_76_732 206
1171 3300047323 Ga0495683_0000479 Ga0495683_0000479_8626_9246 206
1172 3300047323 Ga0495683_0000866 Ga0495683_0000866_16278_16898 206
1173 3300047323 Ga0495683_0001889 Ga0495683_0001889_4563_5276 206
1174 3300047323 Ga0495683_0006160 Ga0495683_0006160_2251_2871 206
1175 3300047323 Ga0495683_0006709 Ga0495683_0006709_4333_4989 206
1176 3300047323 Ga0495683_0009521 Ga0495683_0009521_3414_4034 206
1177 3300047323 Ga0495683_0010817 Ga0495683_0010817_185_805 206
1178 3300047323 Ga0495683_0011405 Ga0495683_0011405_2475_3095 206
1179 3300047323 Ga0495683_0014174 Ga0495683_0014174_1383_2039 206
1180 3300047323 Ga0495683_0015409 Ga0495683_0015409_1096_1716 206
1181 3300047323 Ga0495683_0028585 Ga0495683_0028585_1959_2579 206
1182 3300047323 Ga0495683_0033154 Ga0495683_0033154_1444_2064 206
1183 3300047323 Ga0495683_0033159 Ga0495683_0033159_489_1109 206
1184 3300047323 Ga0495683_0049961 Ga0495683_0049961_992_1615 206
1185 3300047323 Ga0495683_0079330 Ga0495683_0079330_917_1537 206
1186 3300047443 Ga0495687_002016 Ga0495687_002016_7578_8198 206
1187 3300047443 Ga0495687_002564 Ga0495687_002564_9137_9784 206
1188 3300047443 Ga0495687_002722 Ga0495687_002722_4096_4716 206
1189 3300047443 Ga0495687_006299 Ga0495687_006299_2182_2802 206
1190 3300047443 Ga0495687_006654 Ga0495687_006654_470_1090 206
1191 3300047444 Ga0495675_0014104 Ga0495675_0014104_1385_2005 206
1192 3300047445 Ga0495677_0000823 Ga0495677_0000823_414_1034 206
1193 3300047445 Ga0495677_0021872 Ga0495677_0021872_1315_1935 206
1194 3300047445 Ga0495677_0072991 Ga0495677_0072991_45_668 206
1195 3300047445 Ga0495677_0213829 Ga0495677_0213829_71_727 206
1196 3300047446 Ga0495679_000006 Ga0495679_000006_292294_292914 206
1197 3300047446 Ga0495679_000255 Ga0495679_000255_13335_13955 206
1198 3300047446 Ga0495679_000338 Ga0495679_000338_21942_22655 206
1199 3300047446 Ga0495679_000950 Ga0495679_000950_3782_4402 206
1200 3300047446 Ga0495679_001008 Ga0495679_001008_9727_10347 206
1201 3300047446 Ga0495679_002833 Ga0495679_002833_4693_5313 206
1202 3300047446 Ga0495679_003804 Ga0495679_003804_3310_3930 206
1203 3300047446 Ga0495679_015856 Ga0495679_015856_703_1323 206
1204 3300047446 Ga0495679_084454 Ga0495679_084454_175_795 206
1205 3300047446 Ga0495679_128260 Ga0495679_128260_48_668 206
1206 3300047469 Ga0495673_0000753 Ga0495673_0000753_5129_5749 206
1207 3300047469 Ga0495673_0001022 Ga0495673_0001022_22254_22874 206
1208 3300047469 Ga0495673_0001887 Ga0495673_0001887_2525_3145 206
1209 3300047469 Ga0495673_0001929 Ga0495673_0001929_8719_9432 206
1210 3300047469 Ga0495673_0001951 Ga0495673_0001951_45_665 206
1211 3300047469 Ga0495673_0007557 Ga0495673_0007557_825_1481 206
1212 3300047469 Ga0495673_0008279 Ga0495673_0008279_840_1460 206
1213 3300047469 Ga0495673_0008945 Ga0495673_0008945_3026_3646 206
1214 3300047469 Ga0495673_0010039 Ga0495673_0010039_1767_2423 206
1215 3300047469 Ga0495673_0014726 Ga0495673_0014726_1995_2615 206
1216 3300047469 Ga0495673_0014755 Ga0495673_0014755_954_1574 206
1217 3300047469 Ga0495673_0019536 Ga0495673_0019536_2748_3371 206
1218 3300047469 Ga0495673_0021204 Ga0495673_0021204_642_1262 206
1219 3300047469 Ga0495673_0024613 Ga0495673_0024613_146_766 206
1220 3300047469 Ga0495673_0035136 Ga0495673_0035136_1491_2111 206
1221 3300047469 Ga0495673_0053740 Ga0495673_0053740_893_1657 206
1222 3300047469 Ga0495673_0057878 Ga0495673_0057878_646_1266 206
1223 3300047469 Ga0495673_0111767 Ga0495673_0111767_254_874 206
1224 3300047469 Ga0495673_0150140 Ga0495673_0150140_147_767 206
1225 3300047470 Ga0495681_0000859 Ga0495681_0000859_16584_17204 206
1226 3300047470 Ga0495681_0001388 Ga0495681_0001388_12400_13056 206
1227 3300047470 Ga0495681_0001461 Ga0495681_0001461_14366_14986 206
1228 3300047470 Ga0495681_0001998 Ga0495681_0001998_6551_7171 206
1229 3300047470 Ga0495681_0002273 Ga0495681_0002273_4247_4867 206
1230 3300047470 Ga0495681_0002563 Ga0495681_0002563_8853_9509 206
1231 3300047470 Ga0495681_0007561 Ga0495681_0007561_1427_2047 206
1232 3300047470 Ga0495681_0010553 Ga0495681_0010553_3564_4184 206
1233 3300047470 Ga0495681_0010642 Ga0495681_0010642_3878_4498 206
1234 3300047470 Ga0495681_0011435 Ga0495681_0011435_4393_5013 206
1235 3300047470 Ga0495681_0012938 Ga0495681_0012938_1028_1648 206
1236 3300047470 Ga0495681_0029464 Ga0495681_0029464_43_663 206
1237 3300047470 Ga0495681_0033465 Ga0495681_0033465_958_1578 206
1238 3300047470 Ga0495681_0045005 Ga0495681_0045005_122_742 206
1239 3300047470 Ga0495681_0046459 Ga0495681_0046459_928_1548 206
1240 3300047470 Ga0495681_0070875 Ga0495681_0070875_721_1341 206
1241 3300047470 Ga0495681_0084594 Ga0495681_0084594_445_1065 206
1242 3300047470 Ga0495681_0162908 Ga0495681_0162908_201_821 206
1243 3300047471 Ga0495684_0007183 Ga0495684_0007183_7878_8498 206
1244 3300047471 Ga0495684_0026261 Ga0495684_0026261_3448_4068 206
1245 3300047471 Ga0495684_0482578 Ga0495684_0482578_59_715 206
1246 3300047472 Ga0495686_0002014 Ga0495686_0002014_17179_17799 206
1247 3300047472 Ga0495686_0005315 Ga0495686_0005315_7367_7987 206
1248 3300047472 Ga0495686_0005657 Ga0495686_0005657_5419_6039 206
1249 3300047472 Ga0495686_0006245 Ga0495686_0006245_8091_8711 206
1250 3300047472 Ga0495686_0015272 Ga0495686_0015272_4333_4989 206
1251 3300047472 Ga0495686_0049607 Ga0495686_0049607_91_711 206
1252 3300047472 Ga0495686_0138376 Ga0495686_0138376_200_820 206
1253 3300047472 Ga0495686_0349437 Ga0495686_0349437_125_745 206
1254 3300047673 Ga0495593_0001890 Ga0495593_0001890_2970_3683 206
1255 3300047673 Ga0495593_0003048 Ga0495593_0003048_5529_6149 206
1256 3300047673 Ga0495593_0006894 Ga0495593_0006894_3577_4197 206
1257 3300047673 Ga0495593_0007757 Ga0495593_0007757_5383_6003 206
1258 3300047673 Ga0495593_0015910 Ga0495593_0015910_1802_2422 206
1259 3300047673 Ga0495593_0096733 Ga0495593_0096733_224_844 206
1260 3300048088 Ga0495602_0005007 Ga0495602_0005007_8556_9176 206
1261 3300048088 Ga0495602_0006457 Ga0495602_0006457_8095_8715 206
1262 3300048088 Ga0495602_0063991 Ga0495602_0063991_2330_2950 206
1263 3300048088 Ga0495602_0077740 Ga0495602_0077740_243_863 206
1264 3300048088 Ga0495602_0116918 Ga0495602_0116918_1140_1760 206
1265 3300048088 Ga0495602_0176958 Ga0495602_0176958_426_1124 206
1266 3300048088 Ga0495602_0305300 Ga0495602_0305300_413_1033 206
1267 3300048088 Ga0495602_0320015 Ga0495602_0320015_435_1112 206
1268 3300048088 Ga0495602_0739639 Ga0495602_0739639_19_639 206
1269 3300048089 Ga0495614_0004013 Ga0495614_0004013_5527_6147 206
1270 3300048089 Ga0495614_0076418 Ga0495614_0076418_23_736 206
1271 3300048089 Ga0495614_0089806 Ga0495614_0089806_59_679 206
1272 3300048091 Ga0495626_0000536 Ga0495626_0000536_30614_31234 206
1273 3300048091 Ga0495626_0001094 Ga0495626_0001094_17407_18027 206
1274 3300048091 Ga0495626_0001115 Ga0495626_0001115_13656_14276 206
1275 3300048091 Ga0495626_0001132 Ga0495626_0001132_5229_5849 206
1276 3300048091 Ga0495626_0001219 Ga0495626_0001219_4376_4996 206
1277 3300048091 Ga0495626_0001596 Ga0495626_0001596_10799_11455 206
1278 3300048091 Ga0495626_0001943 Ga0495626_0001943_5845_6465 206
1279 3300048091 Ga0495626_0013436 Ga0495626_0013436_3379_3999 206
1280 3300048091 Ga0495626_0015767 Ga0495626_0015767_1060_1680 206
1281 3300048091 Ga0495626_0017675 Ga0495626_0017675_217_837 206
1282 3300048091 Ga0495626_0019064 Ga0495626_0019064_500_1120 206
1283 3300048091 Ga0495626_0024506 Ga0495626_0024506_2093_2713 206
1284 3300048091 Ga0495626_0046173 Ga0495626_0046173_289_909 206
1285 3300048091 Ga0495626_0048001 Ga0495626_0048001_473_1093 206
1286 3300048091 Ga0495626_0089214 Ga0495626_0089214_326_1057 206
1287 3300048091 Ga0495626_0118988 Ga0495626_0118988_411_1031 206
1288 3300048091 Ga0495626_0146873 Ga0495626_0146873_289_909 206
1289 3300048091 Ga0495626_0200848 Ga0495626_0200848_180_800 206
1290 3300048903 Ga0496100_0000689 Ga0496100_0000689_8937_9560 206
1291 3300048903 Ga0496100_0042244 Ga0496100_0042244_98_721 206
1292 3300048904 Ga0496101_0000146 Ga0496101_0000146_54285_54908 206
1293 3300048905 Ga0496102_0002255 Ga0496102_0002255_5570_6190 206
1294 3300048905 Ga0496102_0031371 Ga0496102_0031371_3070_3693 206
1295 3300048905 Ga0496102_0076400 Ga0496102_0076400_1842_2561 206
1296 3300048905 Ga0496102_0231059 Ga0496102_0231059_87_707 206
1297 3300048906 Ga0496103_0000869 Ga0496103_0000869_14243_14866 206
1298 3300048906 Ga0496103_0007656 Ga0496103_0007656_5477_6097 206
1299 3300048906 Ga0496103_0325571 Ga0496103_0325571_128_748 206
1300 3300048907 Ga0496104_0125782 Ga0496104_0125782_98_721 206
1301 3300048907 Ga0496104_0150268 Ga0496104_0150268_495_1118 206
1302 3300048907 Ga0496104_0214656 Ga0496104_0214656_834_1454 206
1303 3300048908 Ga0496105_0116921 Ga0496105_0116921_843_1574 206
1304 3300048908 Ga0496105_0150906 Ga0496105_0150906_769_1389 206
1305 3300048908 Ga0496105_0420147 Ga0496105_0420147_289_909 206
1306 3300048909 Ga0496106_0000025 Ga0496106_0000025_43904_44533 206
1307 3300048909 Ga0496106_0033190 Ga0496106_0033190_3102_3722 206
1308 3300048909 Ga0496106_0122910 Ga0496106_0122910_1280_1900 206
1309 3300048909 Ga0496106_0175482 Ga0496106_0175482_771_1394 206
1310 3300048910 Ga0496107_0050994 Ga0496107_0050994_1081_1812 206
1311 3300048913 Ga0496110_0021050 Ga0496110_0021050_3446_4102 206
1312 3300048914 Ga0496111_0005004 Ga0496111_0005004_3519_4139 206
1313 3300048915 Ga0496112_0004106 Ga0496112_0004106_5261_5884 206
1314 3300048915 Ga0496112_0077343 Ga0496112_0077343_1330_1950 206
1315 3300048916 Ga0496113_0028999 Ga0496113_0028999_1017_1640 206
1316 3300048917 Ga0496114_0273439 Ga0496114_0273439_21_641 206
1317 3300048917 Ga0496114_0637449 Ga0496114_0637449_41_661 206
1318 3300048917 Ga0496114_0932585 Ga0496114_0932585_75_704 206
1319 3300048918 Ga0496115_0336673 Ga0496115_0336673_121_741 206
1320 3300048919 Ga0496116_0000850 Ga0496116_0000850_16332_16952 206
1321 3300048919 Ga0496116_0003545 Ga0496116_0003545_10624_11244 206
1322 3300048919 Ga0496116_0004169 Ga0496116_0004169_12816_13436 206
1323 3300048920 Ga0496117_0000100 Ga0496117_0000100_117783_118403 206
1324 3300048920 Ga0496117_0002589 Ga0496117_0002589_3049_3669 206
1325 3300048920 Ga0496117_0003557 Ga0496117_0003557_4488_5108 206
1326 3300048920 Ga0496117_0005466 Ga0496117_0005466_2405_3025 206
1327 3300048920 Ga0496117_0006374 Ga0496117_0006374_5006_5629 206
1328 3300048920 Ga0496117_0009527 Ga0496117_0009527_1131_1751 206
1329 3300048920 Ga0496117_0014885 Ga0496117_0014885_2611_3231 206
1330 3300048920 Ga0496117_0016891 Ga0496117_0016891_1552_2172 206
1331 3300048920 Ga0496117_0018686 Ga0496117_0018686_4014_4634 206
1332 3300048920 Ga0496117_0018975 Ga0496117_0018975_3548_4168 206
1333 3300048920 Ga0496117_0022966 Ga0496117_0022966_2635_3255 206
1334 3300048920 Ga0496117_0029296 Ga0496117_0029296_2545_3264 206
1335 3300048920 Ga0496117_0029407 Ga0496117_0029407_3082_3702 206
1336 3300048920 Ga0496117_0042309 Ga0496117_0042309_2353_2973 206
1337 3300048920 Ga0496117_0061731 Ga0496117_0061731_1565_2185 206
1338 3300048920 Ga0496117_0130995 Ga0496117_0130995_633_1262 206
1339 3300048920 Ga0496117_0261949 Ga0496117_0261949_131_751 206
1340 3300048921 Ga0496118_0000259 Ga0496118_0000259_54208_54927 206
1341 3300048921 Ga0496118_0000764 Ga0496118_0000764_470_1090 206
1342 3300048921 Ga0496118_0001443 Ga0496118_0001443_6361_6984 206
1343 3300048921 Ga0496118_0004443 Ga0496118_0004443_4497_5117 206
1344 3300048921 Ga0496118_0004939 Ga0496118_0004939_6369_6989 206
1345 3300048921 Ga0496118_0006129 Ga0496118_0006129_1747_2367 206
1346 3300048921 Ga0496118_0012630 Ga0496118_0012630_2969_3589 206
1347 3300048921 Ga0496118_0014114 Ga0496118_0014114_3442_4062 206
1348 3300048921 Ga0496118_0019758 Ga0496118_0019758_1593_2213 206
1349 3300048921 Ga0496118_0025409 Ga0496118_0025409_3972_4601 206
1350 3300048921 Ga0496118_0035374 Ga0496118_0035374_3125_3745 206
1351 3300048921 Ga0496118_0036573 Ga0496118_0036573_509_1129 206
1352 3300048921 Ga0496118_0058542 Ga0496118_0058542_2201_2821 206
1353 3300048921 Ga0496118_0060378 Ga0496118_0060378_2015_2635 206
1354 3300048921 Ga0496118_0063124 Ga0496118_0063124_888_1508 206
1355 3300048922 Ga0496119_0001925 Ga0496119_0001925_3019_3639 206
1356 3300048922 Ga0496119_0005072 Ga0496119_0005072_152_772 206
1357 3300048922 Ga0496119_0079815 Ga0496119_0079815_360_980 206
1358 3300048922 Ga0496119_0104357 Ga0496119_0104357_657_1277 206
1359 3300048922 Ga0496119_0120811 Ga0496119_0120811_483_1106 206
1360 3300048923 Ga0496120_0001659 Ga0496120_0001659_3239_3859 206
1361 3300048923 Ga0496120_0001680 Ga0496120_0001680_13442_14062 206
1362 3300048923 Ga0496120_0029277 Ga0496120_0029277_1528_2148 206
1363 3300048924 Ga0496121_0002008 Ga0496121_0002008_4019_4648 206
1364 3300048924 Ga0496121_0003090 Ga0496121_0003090_6813_7433 206
1365 3300048924 Ga0496121_0003136 Ga0496121_0003136_18456_19187 206
1366 3300048924 Ga0496121_0007455 Ga0496121_0007455_3935_4555 206
1367 3300048924 Ga0496121_0010399 Ga0496121_0010399_5209_5832 206
1368 3300048924 Ga0496121_0018540 Ga0496121_0018540_2712_3332 206
1369 3300048924 Ga0496121_0019189 Ga0496121_0019189_2558_3178 206
1370 3300048924 Ga0496121_0048255 Ga0496121_0048255_1721_2341 206
1371 3300048924 Ga0496121_0071919 Ga0496121_0071919_1004_1624 206
1372 3300048925 Ga0496122_0002383 Ga0496122_0002383_12766_13386 206
1373 3300048925 Ga0496122_0029934 Ga0496122_0029934_3845_4468 206
1374 3300048925 Ga0496122_0031470 Ga0496122_0031470_1073_1693 206
1375 3300048925 Ga0496122_0045025 Ga0496122_0045025_2444_3064 206
1376 3300048925 Ga0496122_0055139 Ga0496122_0055139_2255_2875 206
1377 3300048925 Ga0496122_0067945 Ga0496122_0067945_1154_1774 206
1378 3300048925 Ga0496122_0078331 Ga0496122_0078331_268_888 206
1379 3300048926 Ga0496123_0006957 Ga0496123_0006957_8178_8798 206
1380 3300048926 Ga0496123_0016449 Ga0496123_0016449_3693_4313 206
1381 3300048926 Ga0496123_0080355 Ga0496123_0080355_1001_1621 206
1382 3300048926 Ga0496123_0125027 Ga0496123_0125027_473_1093 206
1383 3300048926 Ga0496123_0140611 Ga0496123_0140611_346_966 206
1384 3300048926 Ga0496123_0244790 Ga0496123_0244790_227_850 206
1385 3300048927 Ga0496124_0000338 Ga0496124_0000338_35610_36230 206
1386 3300048927 Ga0496124_0007159 Ga0496124_0007159_4714_5370 206
1387 3300048927 Ga0496124_0012553 Ga0496124_0012553_1247_1867 206
1388 3300048927 Ga0496124_0022558 Ga0496124_0022558_2596_3216 206
1389 3300048927 Ga0496124_0033071 Ga0496124_0033071_823_1443 206
1390 3300048927 Ga0496124_0086654 Ga0496124_0086654_1431_2051 206
1391 3300048927 Ga0496124_0108920 Ga0496124_0108920_983_1603 206
1392 3300048927 Ga0496124_0190173 Ga0496124_0190173_134_754 206
1393 3300048927 Ga0496124_0193572 Ga0496124_0193572_675_1295 206
1394 3300048928 Ga0496125_0001717 Ga0496125_0001717_22984_23604 206
1395 3300048928 Ga0496125_0011867 Ga0496125_0011867_6860_7480 206
1396 3300048928 Ga0496125_0012068 Ga0496125_0012068_7163_7783 206
1397 3300048928 Ga0496125_0012384 Ga0496125_0012384_2003_2623 206
1398 3300048928 Ga0496125_0019229 Ga0496125_0019229_5746_6366 206
1399 3300048928 Ga0496125_0030510 Ga0496125_0030510_1459_2079 206
1400 3300048928 Ga0496125_0056589 Ga0496125_0056589_2298_2918 206
1401 3300048928 Ga0496125_0079669 Ga0496125_0079669_1533_2153 206
1402 3300048929 Ga0496126_0000256 Ga0496126_0000256_113516_114145 206
1403 3300048929 Ga0496126_0000598 Ga0496126_0000598_26405_27061 206
1404 3300048929 Ga0496126_0002320 Ga0496126_0002320_11295_11915 206
1405 3300048929 Ga0496126_0005670 Ga0496126_0005670_3284_3904 206
1406 3300048929 Ga0496126_0048541 Ga0496126_0048541_243_863 206
1407 3300048929 Ga0496126_0278904 Ga0496126_0278904_538_1158 206
1408 3300048929 Ga0496126_0399738 Ga0496126_0399738_71_691 206
1409 3300049459 Ga0495678_000954 Ga0495678_000954_3369_3989 206
1410 3300049459 Ga0495678_001864 Ga0495678_001864_5883_6503 206
1411 3300049459 Ga0495678_003854 Ga0495678_003854_1034_1654 206
1412 3300049459 Ga0495678_005291 Ga0495678_005291_1642_2262 206
1413 3300049459 Ga0495678_006284 Ga0495678_006284_4246_4866 206
1414 3300049459 Ga0495678_006384 Ga0495678_006384_3397_4017 206
1415 3300049459 Ga0495678_010860 Ga0495678_010860_3385_4041 206
1416 3300049459 Ga0495678_014751 Ga0495678_014751_389_1009 206
1417 3300049459 Ga0495678_025998 Ga0495678_025998_1180_1944 206
1418 3300049459 Ga0495678_080904 Ga0495678_080904_45_665 206
1419 3300049459 Ga0495678_084863 Ga0495678_084863_246_866 206
1420 3300049459 Ga0495678_098325 Ga0495678_098325_336_956 206
1421 3300049459 Ga0495678_150646 Ga0495678_150646_36_692 206
1422 3300049460 Ga0495682_0000556 Ga0495682_0000556_4553_5173 206
1423 3300049460 Ga0495682_0001075 Ga0495682_0001075_12102_12722 206
1424 3300049460 Ga0495682_0019410 Ga0495682_0019410_499_1119 206
1425 3300049460 Ga0495682_0022513 Ga0495682_0022513_1708_2331 206
1426 3300049460 Ga0495682_0023384 Ga0495682_0023384_24_755 206
1427 3300049460 Ga0495682_0080530 Ga0495682_0080530_73_693 206
1428 3300049460 Ga0495682_0082577 Ga0495682_0082577_390_1010 206
1429 3300049460 Ga0495682_0108119 Ga0495682_0108119_74_697 206
1430 3300049775 Ga0501279_007241 Ga0501279_007241_696_1316 206
1431 3300050489 nmdc:mga03683_31979_c1 nmdc:mga03683_31979_c1_326_946 206
1432 3300050489 nmdc:mga03683_32992_c1 nmdc:mga03683_32992_c1_467_1087 206
1433 3300050491 nmdc:mga00v17_133316_c1 nmdc:mga00v17_133316_c1_903_1523 206
1434 3300050491 nmdc:mga00v17_256436_c1 nmdc:mga00v17_256436_c1_461_1081 206
1435 3300050491 nmdc:mga00v17_57873_c1 nmdc:mga00v17_57873_c1_252_872 206
1436 3300050514 nmdc:mga08x19_185677_c1 nmdc:mga08x19_185677_c1_383_1003 206
1437 3300050514 nmdc:mga08x19_39520_c1 nmdc:mga08x19_39520_c1_140_760 206
1438 3300053111 Ga0500572_001701 Ga0500572_001701_2808_3428 206
1439 3300053126 Ga0500621_035845 Ga0500621_035845_887_1507 206
1440 3300053161 Ga0500634_0000284 Ga0500634_0000284_8106_8726 206
1441 iso_pu_bacteria 2501025502 2501083726 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

51

241

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t69-assembly1.cif.gz_A human vmat2 in complex with tetrabenazine 0.5318 2 205
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.5311 4 202
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.5117 4 197
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.5086 2 200
8t69-assembly1.cif.gz_A human vmat2 in complex with tetrabenazine 0.4793 2 205
ID Description Score Start End Superfamily
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6324 1 203 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6271 3 203 1.20.1250.20
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6225 1 203 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6192 3 203 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.612 3 203 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3T1DUN5-F1-model_v4 deleted 0.9757 1 205
AF-A0A3T1DUN5-F1-model_v4 deleted 0.9664 1 205
AF-A0A7R6PIE0-F1-model_v4 Homoserine/homoserine lactone/beta-hydroxynorvaline efflux permease 0.9657 1 202 GO:0005886
GO:0015171
AF-A0A0P0RF24-F1-model_v4 Putative threonine efflux protein 0.9635 1 206 GO:0005886
GO:0015171
AF-A0A4V1ZF04-F1-model_v4 deleted 0.9633 1 205

Feature Viewer

pLDDT pTM Quality
86.57 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map