F493958

General Info

Members Datasets Scaffolds Average Seq Length
1438 299 1438 69

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0134531|Ga0373945_0134531_462_713
Length 83
Sequence LACSNAAHIGLSDWEVSERLANRLKERRAELGLTQAXXXERVGVTRKTVNTVENGVFTPSATLAIKLAQALELNVEQLFWIKR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
271 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
272 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
273 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
274 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
275 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
276 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
277 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
278 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
279 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
280 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
281 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
282 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
283 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
284 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
289 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
290 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
291 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
292 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
293 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
294 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.13
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12184105 2162886012 Bacteria 2312
2 MBSR1b_contig_7087521 2162886012 Bacteria 809
3 MBSR1b_contig_9730680 2162886012 Bacteria 1538
4 JGI24736J21556_1000825 3300001904 Bacteria 5724
5 JGI24736J21556_1001686 3300001904 Bacteria 4004
6 JGI24736J21556_1002190 3300001904 Bacteria 3460
7 JGI24741J21665_1012416 3300001915 Unclassified 1464
8 JGI24747J21853_1014170 3300001978 Unclassified 828
9 JGI24747J21853_1027721 3300001978 Unclassified 638
10 JGI24740J21852_10000326 3300001979 Bacteria 20201
11 JGI24740J21852_10006270 3300001979 Bacteria 4941
12 JGI24740J21852_10007633 3300001979 Bacteria 4380
13 JGI24740J21852_10028613 3300001979 Bacteria 1840
14 JGI24740J21852_10028708 3300001979 Bacteria 1836
15 JGI24740J21852_10130631 3300001979 Bacteria 627
16 JGI24739J22299_10012347 3300001989 Bacteria 3138
17 JGI24739J22299_10018676 3300001989 Bacteria 2489
18 JGI24739J22299_10044490 3300001989 Bacteria 1462
19 JGI24739J22299_10044853 3300001989 Unclassified 1454
20 JGI24739J22299_10048193 3300001989 Bacteria 1387
21 JGI24737J22298_10000120 3300001990 Bacteria 24095
22 JGI24737J22298_10030309 3300001990 Bacteria 1693
23 JGI24737J22298_10038500 3300001990 Bacteria 1472
24 JGI24737J22298_10065775 3300001990 Unclassified 1086
25 JGI24737J22298_10089490 3300001990 Unclassified 913
26 JGI24737J22298_10093483 3300001990 Bacteria 892
27 JGI24737J22298_10177474 3300001990 Bacteria 629
28 JGI24743J22301_10040619 3300001991 Bacteria 933
29 JGI24735J21928_10015302 3300002067 Bacteria 2394
30 JGI24735J21928_10029874 3300002067 Bacteria 1621
31 JGI24735J21928_10035886 3300002067 Bacteria 1455
32 JGI24735J21928_10049533 3300002067 Bacteria 1214
33 JGI24735J21928_10114009 3300002067 Bacteria 778
34 JGI24745J21846_1002522 3300002073 Bacteria 1877
35 JGI24738J21930_10000025 3300002075 Bacteria 28033
36 JGI24738J21930_10047057 3300002075 Bacteria 877
37 JGI24744J21845_10000021 3300002077 Bacteria 18312
38 JGI24035J26624_1013580 3300002126 Unclassified 827
39 JGI24742J22300_10018813 3300002244 Bacteria 1172
40 rootL2_10220426 3300003322 Bacteria 2035
41 Ga0065712_10071995 3300005290 Bacteria 4951
42 Ga0065712_10194659 3300005290 Bacteria 1133
43 Ga0065715_10172327 3300005293 Bacteria 1537
44 Ga0065715_10337243 3300005293 Unclassified 955
45 Ga0065715_10422874 3300005293 Bacteria 856
46 Ga0065715_10956858 3300005293 Bacteria 544
47 Ga0070658_10041477 3300005327 Bacteria 3713
48 Ga0070658_10042829 3300005327 Bacteria 3657
49 Ga0070658_10085522 3300005327 Bacteria 2594
50 Ga0070658_10091106 3300005327 Bacteria 2513
51 Ga0070658_10092437 3300005327 Bacteria 2494
52 Ga0070658_10186423 3300005327 Bacteria 1747
53 Ga0070658_10207788 3300005327 Bacteria 1653
54 Ga0070658_10261996 3300005327 Bacteria 1468
55 Ga0070658_10322414 3300005327 Bacteria 1319
56 Ga0070658_10374771 3300005327 Unclassified 1220
57 Ga0070658_10383966 3300005327 Bacteria 1205
58 Ga0070658_10554550 3300005327 Bacteria 995
59 Ga0070658_11015606 3300005327 Bacteria 721
60 Ga0070658_11028470 3300005327 Unclassified 716
61 Ga0070658_11115399 3300005327 Bacteria 686
62 Ga0070658_11486415 3300005327 Bacteria 587
63 Ga0070658_11863744 3300005327 Unclassified 520
64 Ga0070676_10001685 3300005328 Bacteria 11221
65 Ga0070676_10010298 3300005328 Bacteria 5070
66 Ga0070676_10095738 3300005328 Bacteria 1826
67 Ga0070676_10196047 3300005328 Bacteria 1321
68 Ga0070676_10278847 3300005328 Bacteria 1126
69 Ga0070676_10724226 3300005328 Bacteria 728
70 Ga0070676_10884124 3300005328 Bacteria 664
71 Ga0070676_10929595 3300005328 Bacteria 649
72 Ga0070683_100004824 3300005329 Bacteria 11168
73 Ga0070683_100076221 3300005329 Bacteria 3134
74 Ga0070683_100160879 3300005329 Bacteria 2130
75 Ga0070683_100189937 3300005329 Bacteria 1950
76 Ga0070683_100417999 3300005329 Unclassified 1279
77 Ga0070683_100448989 3300005329 Bacteria 1230
78 Ga0070683_100674353 3300005329 Bacteria 990
79 Ga0070683_101636196 3300005329 Bacteria 619
80 Ga0070690_100022321 3300005330 Bacteria 3871
81 Ga0070690_100351938 3300005330 Bacteria 1069
82 Ga0070670_100000263 3300005331 Bacteria 46664
83 Ga0070670_100009174 3300005331 Bacteria 8457
84 Ga0070670_100010639 3300005331 Bacteria 7859
85 Ga0070670_100016978 3300005331 Bacteria 6249
86 Ga0070670_100026934 3300005331 Bacteria 4945
87 Ga0070670_100032051 3300005331 Bacteria 4526
88 Ga0070670_100144613 3300005331 Bacteria 2057
89 Ga0070670_100261042 3300005331 Bacteria 1510
90 Ga0070670_100732624 3300005331 Unclassified 890
91 Ga0070677_10000586 3300005333 Bacteria 12335
92 Ga0070677_10068981 3300005333 Bacteria 1482
93 Ga0070677_10306094 3300005333 Bacteria 809
94 Ga0070677_10679030 3300005333 Unclassified 578
95 Ga0068869_100000003 3300005334 Bacteria 136262
96 Ga0068869_100261267 3300005334 Bacteria 1386
97 Ga0068869_100586210 3300005334 Bacteria 940
98 Ga0068869_100648812 3300005334 Bacteria 896
99 Ga0068869_101513092 3300005334 Bacteria 596
100 Ga0070666_10009768 3300005335 Bacteria 5997
101 Ga0070666_10010226 3300005335 Bacteria 5862
102 Ga0070666_10178263 3300005335 Bacteria 1490
103 Ga0070666_10342525 3300005335 Bacteria 1068
104 Ga0070666_10353917 3300005335 Bacteria 1051
105 Ga0070666_10600723 3300005335 Bacteria 803
106 Ga0070680_100002719 3300005336 Bacteria 13113
107 Ga0070680_100002845 3300005336 Bacteria 12866
108 Ga0070680_100008547 3300005336 Bacteria 7843
109 Ga0070680_100142605 3300005336 Bacteria 2009
110 Ga0070680_100145355 3300005336 Bacteria 1989
111 Ga0070680_100216908 3300005336 Unclassified 1615
112 Ga0070680_100494262 3300005336 Bacteria 1046
113 Ga0070680_100680324 3300005336 Bacteria 885
114 Ga0070680_100875704 3300005336 Bacteria 774
115 Ga0070680_100933204 3300005336 Bacteria 749
116 Ga0070680_101004332 3300005336 Bacteria 720
117 Ga0070680_101166480 3300005336 Bacteria 666
118 Ga0070682_100029813 3300005337 Bacteria 3288
119 Ga0070682_100094887 3300005337 Bacteria 1958
120 Ga0070682_100265612 3300005337 Unclassified 1244
121 Ga0070682_101778609 3300005337 Bacteria 537
122 Ga0068868_100000379 3300005338 Bacteria 30367
123 Ga0068868_100017468 3300005338 Bacteria 5347
124 Ga0068868_100275005 3300005338 Bacteria 1424
125 Ga0068868_101458972 3300005338 Bacteria 639
126 Ga0068868_101794130 3300005338 Unclassified 579
127 Ga0068868_101909218 3300005338 Bacteria 562
128 Ga0070660_100001061 3300005339 Bacteria 18495
129 Ga0070660_100001636 3300005339 Bacteria 15411
130 Ga0070660_100007164 3300005339 Bacteria 7756
131 Ga0070660_100009593 3300005339 Bacteria 6816
132 Ga0070660_100090568 3300005339 Bacteria 2411
133 Ga0070660_100100916 3300005339 Bacteria 2286
134 Ga0070660_100125575 3300005339 Bacteria 2050
135 Ga0070660_100203923 3300005339 Bacteria 1604
136 Ga0070660_100263342 3300005339 Bacteria 1408
137 Ga0070660_100335832 3300005339 Bacteria 1243
138 Ga0070660_100464480 3300005339 Bacteria 1051
139 Ga0070660_100472031 3300005339 Bacteria 1042
140 Ga0070660_100715541 3300005339 Bacteria 840
141 Ga0070660_100775950 3300005339 Bacteria 805
142 Ga0070660_100805439 3300005339 Bacteria 790
143 Ga0070660_101104212 3300005339 Bacteria 671
144 Ga0070660_101129677 3300005339 Bacteria 663
145 Ga0070660_101319466 3300005339 Bacteria 612
146 Ga0070660_101511181 3300005339 Unclassified 571
147 Ga0070689_100130255 3300005340 Bacteria 2017
148 Ga0070689_100387268 3300005340 Bacteria 1179
149 Ga0070691_10002720 3300005341 Bacteria 7872
150 Ga0070661_100016333 3300005344 Bacteria 5248
151 Ga0070661_100026281 3300005344 Bacteria 4186
152 Ga0070661_100039268 3300005344 Bacteria 3449
153 Ga0070661_100062468 3300005344 Bacteria 2734
154 Ga0070661_100073229 3300005344 Bacteria 2522
155 Ga0070661_100149077 3300005344 Bacteria 1767
156 Ga0070661_100152024 3300005344 Unclassified 1750
157 Ga0070661_100166651 3300005344 Bacteria 1671
158 Ga0070661_100396159 3300005344 Bacteria 1091
159 Ga0070661_100396290 3300005344 Bacteria 1091
160 Ga0070661_100451576 3300005344 Unclassified 1023
161 Ga0070661_100468515 3300005344 Bacteria 1004
162 Ga0070661_100493322 3300005344 Bacteria 979
163 Ga0070661_100511821 3300005344 Bacteria 962
164 Ga0070661_100551048 3300005344 Bacteria 928
165 Ga0070661_100861860 3300005344 Unclassified 746
166 Ga0070661_100950794 3300005344 Bacteria 711
167 Ga0070661_101310884 3300005344 Unclassified 608
168 Ga0070661_101476331 3300005344 Bacteria 573
169 Ga0070692_10018894 3300005345 Bacteria 3321
170 Ga0070692_10116136 3300005345 Bacteria 1486
171 Ga0070692_10252129 3300005345 Bacteria 1057
172 Ga0070692_10469879 3300005345 Bacteria 809
173 Ga0070692_11026434 3300005345 Bacteria 578
174 Ga0070668_100009629 3300005347 Bacteria 7169
175 Ga0070668_100285158 3300005347 Bacteria 1380
176 Ga0070668_100343817 3300005347 Bacteria 1261
177 Ga0070669_100000138 3300005353 Bacteria 65433
178 Ga0070669_100030323 3300005353 Bacteria 3902
179 Ga0070669_100058539 3300005353 Bacteria 2828
180 Ga0070669_100107436 3300005353 Bacteria 2114
181 Ga0070669_100259161 3300005353 Bacteria 1387
182 Ga0070669_100979325 3300005353 Unclassified 725
183 Ga0070675_100000118 3300005354 Bacteria 46627
184 Ga0070675_100004728 3300005354 Bacteria 10394
185 Ga0070675_100011372 3300005354 Bacteria 6967
186 Ga0070675_100015241 3300005354 Bacteria 6072
187 Ga0070675_100041832 3300005354 Bacteria 3743
188 Ga0070675_100151915 3300005354 Bacteria 1986
189 Ga0070671_100008614 3300005355 Bacteria 8177
190 Ga0070671_100016142 3300005355 Bacteria 6038
191 Ga0070671_100040667 3300005355 Bacteria 3862
192 Ga0070671_100071905 3300005355 Bacteria 2887
193 Ga0070671_100140133 3300005355 Bacteria 2040
194 Ga0070671_100156688 3300005355 Bacteria 1924
195 Ga0070674_100011429 3300005356 Bacteria 5408
196 Ga0070674_100033900 3300005356 Bacteria 3404
197 Ga0070674_100035287 3300005356 Bacteria 3348
198 Ga0070674_100038702 3300005356 Bacteria 3216
199 Ga0070674_100100532 3300005356 Bacteria 2106
200 Ga0070674_100121041 3300005356 Bacteria 1938
201 Ga0070673_100000154 3300005364 Bacteria 33033
202 Ga0070673_100074228 3300005364 Bacteria 2740
203 Ga0070673_100080781 3300005364 Bacteria 2635
204 Ga0070673_100084327 3300005364 Bacteria 2584
205 Ga0070673_100316901 3300005364 Unclassified 1377
206 Ga0070673_100399022 3300005364 Bacteria 1229
207 Ga0070673_100426591 3300005364 Bacteria 1189
208 Ga0070673_100436389 3300005364 Bacteria 1176
209 Ga0070673_100462840 3300005364 Bacteria 1142
210 Ga0070673_101515390 3300005364 Unclassified 632
211 Ga0070673_101708165 3300005364 Bacteria 596
212 Ga0070688_100624316 3300005365 Bacteria 827
213 Ga0070659_100000360 3300005366 Bacteria 34640
214 Ga0070659_100012198 3300005366 Bacteria 6370
215 Ga0070659_100017244 3300005366 Bacteria 5429
216 Ga0070659_100029747 3300005366 Bacteria 4222
217 Ga0070659_100060923 3300005366 Bacteria 2982
218 Ga0070659_100123730 3300005366 Bacteria 2097
219 Ga0070659_100146822 3300005366 Bacteria 1922
220 Ga0070659_100159693 3300005366 Bacteria 1843
221 Ga0070659_100323498 3300005366 Bacteria 1289
222 Ga0070659_100422054 3300005366 Bacteria 1128
223 Ga0070659_100447113 3300005366 Bacteria 1096
224 Ga0070659_100478413 3300005366 Bacteria 1059
225 Ga0070659_100630693 3300005366 Bacteria 923
226 Ga0070659_100702479 3300005366 Bacteria 874
227 Ga0070659_101112505 3300005366 Bacteria 696
228 Ga0070659_101874318 3300005366 Bacteria 537
229 Ga0070659_101874483 3300005366 Bacteria 537
230 Ga0070659_102037586 3300005366 Bacteria 515
231 Ga0070659_102061611 3300005366 Bacteria 512
232 Ga0070667_100005484 3300005367 Bacteria 10591
233 Ga0070667_100020394 3300005367 Bacteria 5503
234 Ga0070667_100037919 3300005367 Bacteria 4041
235 Ga0070667_100058193 3300005367 Bacteria 3267
236 Ga0070667_100243039 3300005367 Bacteria 1608
237 Ga0070667_100414726 3300005367 Bacteria 1227
238 Ga0070667_100466095 3300005367 Bacteria 1155
239 Ga0070709_10070774 3300005434 Bacteria 2249
240 Ga0070714_100048977 3300005435 Bacteria 3596
241 Ga0070714_101735792 3300005435 Unclassified 610
242 Ga0070713_100081976 3300005436 Bacteria 2753
243 Ga0070713_100776600 3300005436 Bacteria 917
244 Ga0070713_100814678 3300005436 Bacteria 895
245 Ga0070711_100567876 3300005439 Bacteria 943
246 Ga0070663_100006176 3300005455 Bacteria 7176
247 Ga0070663_100011063 3300005455 Bacteria 5649
248 Ga0070663_100033117 3300005455 Bacteria 3567
249 Ga0070663_100070058 3300005455 Bacteria 2549
250 Ga0070663_100135224 3300005455 Bacteria 1876
251 Ga0070663_100209879 3300005455 Bacteria 1524
252 Ga0070663_100241634 3300005455 Bacteria 1425
253 Ga0070663_100242090 3300005455 Bacteria 1424
254 Ga0070663_100268891 3300005455 Bacteria 1355
255 Ga0070663_100398448 3300005455 Unclassified 1124
256 Ga0070663_100444335 3300005455 Bacteria 1068
257 Ga0070663_100582912 3300005455 Bacteria 939
258 Ga0070663_100655867 3300005455 Bacteria 888
259 Ga0070663_100841308 3300005455 Unclassified 789
260 Ga0070663_101034165 3300005455 Bacteria 715
261 Ga0070663_101289936 3300005455 Unclassified 644
262 Ga0070663_101893605 3300005455 Bacteria 536
263 Ga0070678_100039463 3300005456 Bacteria 3332
264 Ga0070678_100047826 3300005456 Bacteria 3076
265 Ga0070678_100527298 3300005456 Bacteria 1046
266 Ga0070678_100839535 3300005456 Unclassified 836
267 Ga0070678_101690086 3300005456 Bacteria 595
268 Ga0070662_100000567 3300005457 Bacteria 22531
269 Ga0070662_100006437 3300005457 Bacteria 7571
270 Ga0070662_100018683 3300005457 Bacteria 4693
271 Ga0070662_100031758 3300005457 Bacteria 3709
272 Ga0070662_100045958 3300005457 Bacteria 3136
273 Ga0070662_100067501 3300005457 Bacteria 2626
274 Ga0070662_100092545 3300005457 Bacteria 2273
275 Ga0070662_100113147 3300005457 Bacteria 2070
276 Ga0070662_100822849 3300005457 Bacteria 790
277 Ga0070662_101103738 3300005457 Bacteria 681
278 Ga0070662_101790391 3300005457 Bacteria 530
279 Ga0070662_101934683 3300005457 Unclassified 509
280 Ga0070662_101986946 3300005457 Bacteria 502
281 Ga0070681_10030311 3300005458 Bacteria 5427
282 Ga0070681_10082296 3300005458 Bacteria 3174
283 Ga0070681_10371226 3300005458 Bacteria 1341
284 Ga0070681_10414541 3300005458 Unclassified 1259
285 Ga0070681_10659696 3300005458 Bacteria 961
286 Ga0070681_10884339 3300005458 Unclassified 812
287 Ga0068867_100000505 3300005459 Bacteria 26038
288 Ga0068867_100165377 3300005459 Bacteria 1748
289 Ga0068867_100185776 3300005459 Bacteria 1655
290 Ga0068867_100878717 3300005459 Bacteria 805
291 Ga0070685_10656807 3300005466 Bacteria 760
292 Ga0070685_11165929 3300005466 Bacteria 584
293 Ga0070685_11532393 3300005466 Unclassified 514
294 Ga0070679_100026734 3300005530 Bacteria 5674
295 Ga0070679_100033833 3300005530 Bacteria 5061
296 Ga0070679_100152034 3300005530 Bacteria 2291
297 Ga0070679_100365090 3300005530 Bacteria 1391
298 Ga0070679_100383250 3300005530 Bacteria 1352
299 Ga0070679_100433395 3300005530 Bacteria 1260
300 Ga0070679_100462374 3300005530 Bacteria 1213
301 Ga0070679_100572064 3300005530 Bacteria 1073
302 Ga0070679_100757173 3300005530 Bacteria 914
303 Ga0070679_100972669 3300005530 Bacteria 793
304 Ga0070679_101473881 3300005530 Unclassified 627
305 Ga0070679_101787528 3300005530 Bacteria 563
306 Ga0070684_100003373 3300005535 Bacteria 11965
307 Ga0070684_100086596 3300005535 Bacteria 2780
308 Ga0070684_100100955 3300005535 Bacteria 2577
309 Ga0070684_100439739 3300005535 Bacteria 1205
310 Ga0070684_100537406 3300005535 Unclassified 1084
311 Ga0070684_100838523 3300005535 Unclassified 860
312 Ga0070684_101024890 3300005535 Bacteria 775
313 Ga0068853_100001049 3300005539 Bacteria 19524
314 Ga0068853_100021524 3300005539 Bacteria 5378
315 Ga0068853_100070165 3300005539 Bacteria 3049
316 Ga0068853_100108230 3300005539 Bacteria 2466
317 Ga0068853_100355567 3300005539 Bacteria 1363
318 Ga0068853_100535140 3300005539 Bacteria 1109
319 Ga0068853_100752237 3300005539 Bacteria 931
320 Ga0068853_101483553 3300005539 Bacteria 656
321 Ga0068853_102093891 3300005539 Unclassified 549
322 Ga0068853_102135275 3300005539 Bacteria 543
323 Ga0070672_100000498 3300005543 Bacteria 22839
324 Ga0070672_100000731 3300005543 Bacteria 19486
325 Ga0070672_100012992 3300005543 Bacteria 5868
326 Ga0070672_100047548 3300005543 Bacteria 3330
327 Ga0070672_100132428 3300005543 Bacteria 2050
328 Ga0070672_100132765 3300005543 Bacteria 2048
329 Ga0070672_100170812 3300005543 Bacteria 1808
330 Ga0070686_100105592 3300005544 Bacteria 1910
331 Ga0070686_100951254 3300005544 Unclassified 702
332 Ga0070693_100195344 3300005547 Unclassified 1311
333 Ga0070693_100212240 3300005547 Bacteria 1263
334 Ga0070665_100064946 3300005548 Bacteria 3661
335 Ga0070665_100103428 3300005548 Bacteria 2851
336 Ga0070665_100189945 3300005548 Bacteria 2055
337 Ga0070665_100254044 3300005548 Bacteria 1758
338 Ga0068855_100003323 3300005563 Bacteria 19678
339 Ga0068855_100008372 3300005563 Bacteria 12507
340 Ga0068855_100112389 3300005563 Bacteria 3126
341 Ga0068855_100114855 3300005563 Bacteria 3086
342 Ga0068855_100127128 3300005563 Bacteria 2913
343 Ga0068855_100169179 3300005563 Bacteria 2475
344 Ga0068855_100204355 3300005563 Bacteria 2223
345 Ga0068855_100411057 3300005563 Bacteria 1481
346 Ga0068855_100414559 3300005563 Bacteria 1474
347 Ga0068855_100628525 3300005563 Bacteria 1155
348 Ga0068855_101018541 3300005563 Bacteria 869
349 Ga0068855_102302592 3300005563 Bacteria 539
350 Ga0070664_100002238 3300005564 Bacteria 15561
351 Ga0070664_100012015 3300005564 Bacteria 7034
352 Ga0070664_100021606 3300005564 Bacteria 5307
353 Ga0070664_100035241 3300005564 Bacteria 4201
354 Ga0070664_100042127 3300005564 Bacteria 3854
355 Ga0070664_100118419 3300005564 Bacteria 2317
356 Ga0070664_100125434 3300005564 Bacteria 2251
357 Ga0070664_100175917 3300005564 Bacteria 1900
358 Ga0070664_100334043 3300005564 Unclassified 1375
359 Ga0070664_100415221 3300005564 Bacteria 1232
360 Ga0070664_101992924 3300005564 Bacteria 551
361 Ga0070664_102288939 3300005564 Bacteria 513
362 Ga0068857_100007857 3300005577 Bacteria 9201
363 Ga0068857_100046023 3300005577 Bacteria 3871
364 Ga0068857_100046977 3300005577 Bacteria 3832
365 Ga0068857_100054882 3300005577 Bacteria 3536
366 Ga0068857_100109221 3300005577 Bacteria 2485
367 Ga0068857_100110810 3300005577 Unclassified 2467
368 Ga0068857_100247207 3300005577 Bacteria 1634
369 Ga0068857_101446135 3300005577 Unclassified 669
370 Ga0068854_100000358 3300005578 Bacteria 29248
371 Ga0068854_100002217 3300005578 Bacteria 11950
372 Ga0068854_100016747 3300005578 Bacteria 4891
373 Ga0068854_100031767 3300005578 Bacteria 3671
374 Ga0068854_100075978 3300005578 Bacteria 2467
375 Ga0068854_100098669 3300005578 Bacteria 2186
376 Ga0068854_100393482 3300005578 Bacteria 1145
377 Ga0068854_100505896 3300005578 Bacteria 1018
378 Ga0068854_100887250 3300005578 Bacteria 783
379 Ga0068856_100055418 3300005614 Bacteria 3912
380 Ga0068856_100072426 3300005614 Bacteria 3411
381 Ga0068856_100192923 3300005614 Bacteria 2051
382 Ga0068856_100233659 3300005614 Bacteria 1854
383 Ga0068856_100304629 3300005614 Bacteria 1611
384 Ga0068856_100426159 3300005614 Bacteria 1347
385 Ga0068856_100517496 3300005614 Bacteria 1214
386 Ga0068856_100603474 3300005614 Unclassified 1119
387 Ga0068856_100665506 3300005614 Bacteria 1062
388 Ga0068856_100675095 3300005614 Bacteria 1054
389 Ga0068856_101243593 3300005614 Bacteria 760
390 Ga0068856_101270072 3300005614 Bacteria 752
391 Ga0068856_101479160 3300005614 Bacteria 693
392 Ga0068856_102385391 3300005614 Bacteria 536
393 Ga0068856_102466728 3300005614 Unclassified 527
394 Ga0068856_102520540 3300005614 Unclassified 521
395 Ga0070702_100549163 3300005615 Unclassified 857
396 Ga0070702_101286006 3300005615 Bacteria 593
397 Ga0068852_100000496 3300005616 Bacteria 25774
398 Ga0068852_100038865 3300005616 Bacteria 4003
399 Ga0068852_100041765 3300005616 Bacteria 3878
400 Ga0068852_100068787 3300005616 Bacteria 3101
401 Ga0068852_100109029 3300005616 Bacteria 2513
402 Ga0068852_100128588 3300005616 Bacteria 2330
403 Ga0068852_100189965 3300005616 Bacteria 1937
404 Ga0068852_100211311 3300005616 Unclassified 1841
405 Ga0068852_100474944 3300005616 Bacteria 1241
406 Ga0068852_100492396 3300005616 Bacteria 1220
407 Ga0068852_100778530 3300005616 Unclassified 970
408 Ga0068852_100798951 3300005616 Unclassified 957
409 Ga0068852_101242805 3300005616 Unclassified 766
410 Ga0068852_101402594 3300005616 Bacteria 721
411 Ga0068852_101576241 3300005616 Bacteria 679
412 Ga0068852_102588727 3300005616 Unclassified 527
413 Ga0068852_102719997 3300005616 Bacteria 514
414 Ga0068859_100000550 3300005617 Bacteria 37222
415 Ga0068859_100039867 3300005617 Bacteria 4713
416 Ga0068859_100044603 3300005617 Bacteria 4455
417 Ga0068859_102455429 3300005617 Unclassified 574
418 Ga0068864_100000047 3300005618 Bacteria 150798
419 Ga0068864_100055187 3300005618 Bacteria 3430
420 Ga0068864_100065886 3300005618 Bacteria 3142
421 Ga0068864_100086744 3300005618 Bacteria 2754
422 Ga0068864_100239980 3300005618 Bacteria 1679
423 Ga0068864_101229383 3300005618 Bacteria 748
424 Ga0068866_10029895 3300005718 Bacteria 2610
425 Ga0068866_10057527 3300005718 Bacteria 2004
426 Ga0068866_10555978 3300005718 Bacteria 768
427 Ga0068861_100071312 3300005719 Bacteria 2693
428 Ga0068861_100213101 3300005719 Bacteria 1628
429 Ga0068861_100412977 3300005719 Bacteria 1201
430 Ga0068861_100507693 3300005719 Bacteria 1091
431 Ga0068861_101265587 3300005719 Bacteria 716
432 Ga0068851_10036294 3300005834 Bacteria 2467
433 Ga0068851_10043937 3300005834 Bacteria 2253
434 Ga0068851_10072335 3300005834 Bacteria 1786
435 Ga0068851_10152028 3300005834 Bacteria 1266
436 Ga0068851_10192218 3300005834 Bacteria 1135
437 Ga0068851_10206011 3300005834 Bacteria 1100
438 Ga0068851_10352825 3300005834 Unclassified 856
439 Ga0068851_10425204 3300005834 Bacteria 785
440 Ga0068870_10012871 3300005840 Bacteria 3918
441 Ga0068870_10154938 3300005840 Unclassified 1353
442 Ga0068863_100000468 3300005841 Bacteria 41287
443 Ga0068863_100009582 3300005841 Bacteria 9447
444 Ga0068863_100046726 3300005841 Bacteria 4109
445 Ga0068863_100107539 3300005841 Bacteria 2654
446 Ga0068858_100007156 3300005842 Bacteria 10827
447 Ga0068858_100012571 3300005842 Bacteria 7983
448 Ga0068858_102369644 3300005842 Bacteria 524
449 Ga0068860_100003459 3300005843 Bacteria 16243
450 Ga0068860_100034551 3300005843 Bacteria 4850
451 Ga0068860_100089688 3300005843 Bacteria 2927
452 Ga0068860_100330415 3300005843 Bacteria 1497
453 Ga0068860_100384389 3300005843 Bacteria 1386
454 Ga0068860_100612844 3300005843 Bacteria 1095
455 Ga0068862_100021026 3300005844 Bacteria 5452
456 Ga0068862_100040694 3300005844 Bacteria 3951
457 Ga0068862_100126872 3300005844 Bacteria 2253
458 Ga0068862_100172536 3300005844 Bacteria 1937
459 Ga0068862_101168695 3300005844 Bacteria 767
460 Ga0081539_10006545 3300005985 Bacteria 11115
461 Ga0070717_10032089 3300006028 Bacteria 4229
462 Ga0070716_100053318 3300006173 Bacteria 2306
463 Ga0070712_100028025 3300006175 Bacteria 3764
464 Ga0097621_100145236 3300006237 Bacteria 2030
465 Ga0097621_100209194 3300006237 Bacteria 1697
466 Ga0097621_100236400 3300006237 Bacteria 1596
467 Ga0097621_100299332 3300006237 Bacteria 1420
468 Ga0097621_100435882 3300006237 Bacteria 1178
469 Ga0097621_100622251 3300006237 Unclassified 988
470 Ga0075370_11048752 3300006353 Bacteria 500
471 Ga0068871_100085855 3300006358 Bacteria 2614
472 Ga0068871_100159753 3300006358 Bacteria 1927
473 Ga0068871_100495078 3300006358 Bacteria 1101
474 Ga0068865_100018542 3300006881 Bacteria 4492
475 Ga0068865_100043326 3300006881 Bacteria 3074
476 Ga0068865_100068518 3300006881 Bacteria 2508
477 Ga0097620_100000550 3300006931 Bacteria 37222
478 Ga0097620_100039868 3300006931 Bacteria 4713
479 Ga0097620_100044604 3300006931 Bacteria 4455
480 Ga0097620_102454858 3300006931 Unclassified 574
481 Ga0105240_10019167 3300009093 Bacteria 9147
482 Ga0105240_10106651 3300009093 Bacteria 3398
483 Ga0105240_10122417 3300009093 Bacteria 3130
484 Ga0105240_10161790 3300009093 Bacteria 2658
485 Ga0105240_10231615 3300009093 Bacteria 2146
486 Ga0105240_10273875 3300009093 Bacteria 1942
487 Ga0105240_10367007 3300009093 Bacteria 1629
488 Ga0105240_11255323 3300009093 Bacteria 783
489 Ga0105240_12422114 3300009093 Bacteria 543
490 Ga0105245_10000198 3300009098 Bacteria 57372
491 Ga0105245_10079466 3300009098 Bacteria 2995
492 Ga0105245_10155381 3300009098 Bacteria 2166
493 Ga0105245_11976277 3300009098 Bacteria 636
494 Ga0105247_11008162 3300009101 Unclassified 651
495 Ga0105243_10039697 3300009148 Bacteria 3671
496 Ga0105243_10146495 3300009148 Bacteria 2021
497 Ga0105243_10297602 3300009148 Bacteria 1461
498 Ga0105243_10302300 3300009148 Bacteria 1451
499 Ga0105243_10661620 3300009148 Bacteria 1013
500 Ga0105241_10030104 3300009174 Bacteria 4055
501 Ga0105241_10034765 3300009174 Bacteria 3789
502 Ga0105241_10072236 3300009174 Unclassified 2681
503 Ga0105241_10179696 3300009174 Bacteria 1754
504 Ga0105241_11437224 3300009174 Bacteria 661
505 Ga0105241_11969700 3300009174 Unclassified 574
506 Ga0105242_10296953 3300009176 Unclassified 1473
507 Ga0105242_11852826 3300009176 Bacteria 643
508 Ga0105248_10000391 3300009177 Bacteria 50565
509 Ga0105248_10014868 3300009177 Bacteria 8573
510 Ga0105248_10141487 3300009177 Bacteria 2714
511 Ga0105248_10154872 3300009177 Bacteria 2586
512 Ga0105248_10602647 3300009177 Bacteria 1239
513 Ga0105248_10829552 3300009177 Bacteria 1043
514 Ga0105248_11090266 3300009177 Unclassified 902
515 Ga0105248_11826339 3300009177 Bacteria 689
516 Ga0105248_11954204 3300009177 Bacteria 666
517 Ga0105237_10088050 3300009545 Bacteria 3094
518 Ga0105237_11036430 3300009545 Bacteria 827
519 Ga0105238_10023266 3300009551 Bacteria 6316
520 Ga0105238_10031600 3300009551 Bacteria 5390
521 Ga0105238_10142251 3300009551 Bacteria 2375
522 Ga0105238_10200398 3300009551 Unclassified 1971
523 Ga0105238_10273306 3300009551 Bacteria 1670
524 Ga0105249_10011394 3300009553 Bacteria 7809
525 Ga0105249_10962081 3300009553 Bacteria 922
526 Ga0105249_11246791 3300009553 Bacteria 815
527 Ga0105239_10089870 3300010375 Bacteria 3388
528 Ga0105239_10849595 3300010375 Unclassified 1047
529 Ga0105239_12095442 3300010375 Bacteria 657
530 Ga0105239_13213179 3300010375 Bacteria 532
531 Ga0105246_10016356 3300011119 Bacteria 4697
532 Ga0105246_12368084 3300011119 Unclassified 520
533 Ga0157373_10028706 3300013100 Bacteria 4012
534 Ga0157373_10032369 3300013100 Bacteria 3764
535 Ga0157373_10044171 3300013100 Bacteria 3181
536 Ga0157373_10068331 3300013100 Bacteria 2512
537 Ga0157373_10086710 3300013100 Bacteria 2206
538 Ga0157373_10112051 3300013100 Bacteria 1918
539 Ga0157373_10161672 3300013100 Bacteria 1576
540 Ga0157373_10185291 3300013100 Bacteria 1466
541 Ga0157373_10194672 3300013100 Bacteria 1429
542 Ga0157373_10242273 3300013100 Bacteria 1275
543 Ga0157373_10259218 3300013100 Bacteria 1230
544 Ga0157373_10374540 3300013100 Bacteria 1018
545 Ga0157373_10419234 3300013100 Bacteria 961
546 Ga0157373_10535696 3300013100 Unclassified 848
547 Ga0157373_10539798 3300013100 Bacteria 845
548 Ga0157373_10634079 3300013100 Unclassified 779
549 Ga0157373_10657996 3300013100 Bacteria 765
550 Ga0157373_10722558 3300013100 Bacteria 731
551 Ga0157373_10938124 3300013100 Bacteria 643
552 Ga0157373_11410633 3300013100 Unclassified 530
553 Ga0157371_10001384 3300013102 Bacteria 25410
554 Ga0157371_10019626 3300013102 Bacteria 4980
555 Ga0157371_10034456 3300013102 Bacteria 3631
556 Ga0157371_10046702 3300013102 Bacteria 3079
557 Ga0157371_10061265 3300013102 Bacteria 2668
558 Ga0157371_10064294 3300013102 Bacteria 2600
559 Ga0157371_10070770 3300013102 Unclassified 2469
560 Ga0157371_10171841 3300013102 Bacteria 1549
561 Ga0157371_10174093 3300013102 Bacteria 1538
562 Ga0157371_10311446 3300013102 Bacteria 1141
563 Ga0157371_10674543 3300013102 Unclassified 773
564 Ga0157371_10800777 3300013102 Bacteria 710
565 Ga0157371_10808434 3300013102 Unclassified 707
566 Ga0157371_11050852 3300013102 Bacteria 623
567 Ga0157371_11192518 3300013102 Bacteria 586
568 Ga0157371_11289300 3300013102 Bacteria 565
569 Ga0157370_10021414 3300013104 Bacteria 6443
570 Ga0157370_10032144 3300013104 Bacteria 5126
571 Ga0157370_10051504 3300013104 Bacteria 3933
572 Ga0157370_10079198 3300013104 Bacteria 3094
573 Ga0157370_10147717 3300013104 Bacteria 2188
574 Ga0157370_10200372 3300013104 Bacteria 1852
575 Ga0157370_10205399 3300013104 Bacteria 1827
576 Ga0157370_10263914 3300013104 Bacteria 1591
577 Ga0157370_10273815 3300013104 Bacteria 1560
578 Ga0157370_10470761 3300013104 Unclassified 1155
579 Ga0157370_10488140 3300013104 Bacteria 1132
580 Ga0157370_11114083 3300013104 Unclassified 713
581 Ga0157370_12149892 3300013104 Unclassified 500
582 Ga0157369_10019055 3300013105 Bacteria 7683
583 Ga0157369_10032749 3300013105 Bacteria 5712
584 Ga0157369_10067002 3300013105 Bacteria 3862
585 Ga0157369_10105734 3300013105 Bacteria 2996
586 Ga0157369_10229147 3300013105 Bacteria 1943
587 Ga0157369_10303514 3300013105 Bacteria 1660
588 Ga0157369_10303726 3300013105 Bacteria 1660
589 Ga0157369_10781008 3300013105 Bacteria 982
590 Ga0157369_10857238 3300013105 Bacteria 932
591 Ga0157369_11141838 3300013105 Unclassified 796
592 Ga0157369_11523978 3300013105 Bacteria 680
593 Ga0157369_11650521 3300013105 Bacteria 651
594 Ga0157369_11887339 3300013105 Bacteria 606
595 Ga0157369_12080536 3300013105 Bacteria 576
596 Ga0157369_12553075 3300013105 Bacteria 517
597 Ga0157374_10075095 3300013296 Bacteria 3194
598 Ga0157374_10406267 3300013296 Unclassified 1359
599 Ga0157374_10920629 3300013296 Bacteria 892
600 Ga0157378_10001767 3300013297 Bacteria 19410
601 Ga0157378_10175752 3300013297 Bacteria 2011
602 Ga0157378_10247860 3300013297 Bacteria 1704
603 Ga0157378_10761982 3300013297 Unclassified 991
604 Ga0163162_10120587 3300013306 Bacteria 2727
605 Ga0163162_10307563 3300013306 Bacteria 1717
606 Ga0163162_10354401 3300013306 Bacteria 1600
607 Ga0163162_11161948 3300013306 Bacteria 875
608 Ga0163162_11715661 3300013306 Bacteria 717
609 Ga0163162_12519021 3300013306 Bacteria 592
610 Ga0157372_10052507 3300013307 Bacteria 4540
611 Ga0157372_10062188 3300013307 Bacteria 4182
612 Ga0157372_10101800 3300013307 Bacteria 3280
613 Ga0157372_10144860 3300013307 Bacteria 2739
614 Ga0157372_10322632 3300013307 Bacteria 1798
615 Ga0157372_10328105 3300013307 Bacteria 1782
616 Ga0157372_10474418 3300013307 Unclassified 1458
617 Ga0157372_10552540 3300013307 Bacteria 1342
618 Ga0157372_10568960 3300013307 Bacteria 1321
619 Ga0157372_10745192 3300013307 Unclassified 1139
620 Ga0157372_11936517 3300013307 Bacteria 677
621 Ga0157372_12304218 3300013307 Bacteria 618
622 Ga0157372_12454728 3300013307 Unclassified 598
623 Ga0157372_12555701 3300013307 Bacteria 586
624 Ga0157375_10058173 3300013308 Bacteria 3824
625 Ga0157375_10344508 3300013308 Bacteria 1656
626 Ga0157375_10487404 3300013308 Bacteria 1398
627 Ga0157375_12076720 3300013308 Bacteria 676
628 Ga0157375_12184544 3300013308 Unclassified 659
629 Ga0163163_10557890 3300014325 Bacteria 1208
630 Ga0157380_10064584 3300014326 Bacteria 2939
631 Ga0157380_10149248 3300014326 Bacteria 2019
632 Ga0157377_10056508 3300014745 Bacteria 2229
633 Ga0157377_10405324 3300014745 Bacteria 930
634 Ga0157377_10816922 3300014745 Unclassified 689
635 Ga0157379_10129204 3300014968 Bacteria 2273
636 Ga0157376_11469670 3300014969 Bacteria 714
637 Ga0163161_10030131 3300017792 Bacteria 3860
638 Ga0163161_10076271 3300017792 Bacteria 2461
639 Ga0206356_10011518 3300020070 Bacteria 1028
640 Ga0206353_10269691 3300020082 Unclassified 519
641 Ga0206353_10298511 3300020082 Bacteria 1129
642 Ga0206353_11511563 3300020082 Bacteria 532
643 Ga0213875_10003976 3300021388 Bacteria 8244
644 Ga0207697_10000033 3300025315 Bacteria 50935
645 Ga0207697_10014398 3300025315 Bacteria 3280
646 Ga0207697_10185492 3300025315 Unclassified 913
647 Ga0207697_10432545 3300025315 Unclassified 584
648 Ga0207656_10044421 3300025321 Bacteria 1898
649 Ga0207656_10095796 3300025321 Bacteria 1354
650 Ga0207656_10135141 3300025321 Bacteria 1158
651 Ga0207656_10208577 3300025321 Bacteria 946
652 Ga0207656_10266460 3300025321 Bacteria 842
653 Ga0207656_10343519 3300025321 Bacteria 744
654 Ga0207682_10000575 3300025893 Bacteria 16991
655 Ga0207682_10040195 3300025893 Bacteria 1904
656 Ga0207682_10290537 3300025893 Bacteria 765
657 Ga0207642_10020218 3300025899 Bacteria 2594
658 Ga0207642_10237516 3300025899 Bacteria 1027
659 Ga0207642_10263634 3300025899 Unclassified 983
660 Ga0207642_10408861 3300025899 Bacteria 814
661 Ga0207688_10000292 3300025901 Bacteria 22907
662 Ga0207688_10031108 3300025901 Bacteria 2945
663 Ga0207688_10127052 3300025901 Bacteria 1492
664 Ga0207688_10307086 3300025901 Bacteria 971
665 Ga0207680_10005396 3300025903 Bacteria 6109
666 Ga0207680_10194997 3300025903 Bacteria 1377
667 Ga0207680_10341396 3300025903 Bacteria 1051
668 Ga0207680_11184865 3300025903 Unclassified 545
669 Ga0207647_10000843 3300025904 Bacteria 23770
670 Ga0207647_10009032 3300025904 Bacteria 7098
671 Ga0207647_10009075 3300025904 Bacteria 7081
672 Ga0207647_10029199 3300025904 Bacteria 3571
673 Ga0207647_10054571 3300025904 Bacteria 2458
674 Ga0207647_10087615 3300025904 Bacteria 1859
675 Ga0207647_10089954 3300025904 Bacteria 1832
676 Ga0207647_10092125 3300025904 Bacteria 1807
677 Ga0207647_10110564 3300025904 Bacteria 1625
678 Ga0207647_10160887 3300025904 Bacteria 1310
679 Ga0207647_10271821 3300025904 Bacteria 969
680 Ga0207647_10274131 3300025904 Bacteria 964
681 Ga0207647_10278426 3300025904 Bacteria 955
682 Ga0207699_10267710 3300025906 Bacteria 1183
683 Ga0207645_10004494 3300025907 Bacteria 10316
684 Ga0207645_10043782 3300025907 Bacteria 2865
685 Ga0207645_10228746 3300025907 Bacteria 1227
686 Ga0207645_10884751 3300025907 Bacteria 607
687 Ga0207645_10951513 3300025907 Bacteria 583
688 Ga0207643_10088789 3300025908 Bacteria 1800
689 Ga0207643_10099738 3300025908 Unclassified 1702
690 Ga0207705_10000003 3300025909 Bacteria 709270
691 Ga0207705_10000123 3300025909 Bacteria 85382
692 Ga0207705_10003112 3300025909 Bacteria 12660
693 Ga0207705_10023003 3300025909 Bacteria 4445
694 Ga0207705_10045814 3300025909 Bacteria 3143
695 Ga0207705_10051181 3300025909 Bacteria 2973
696 Ga0207705_10059993 3300025909 Bacteria 2747
697 Ga0207705_10100688 3300025909 Bacteria 2125
698 Ga0207705_10103068 3300025909 Bacteria 2101
699 Ga0207705_10103175 3300025909 Bacteria 2100
700 Ga0207705_10105238 3300025909 Bacteria 2080
701 Ga0207705_10128276 3300025909 Bacteria 1886
702 Ga0207705_10143706 3300025909 Bacteria 1783
703 Ga0207705_10161920 3300025909 Bacteria 1681
704 Ga0207705_10366958 3300025909 Bacteria 1111
705 Ga0207705_10375253 3300025909 Bacteria 1098
706 Ga0207705_10420009 3300025909 Bacteria 1035
707 Ga0207705_10500114 3300025909 Unclassified 944
708 Ga0207705_10518533 3300025909 Bacteria 926
709 Ga0207705_10620608 3300025909 Bacteria 841
710 Ga0207705_10713230 3300025909 Unclassified 780
711 Ga0207705_11377258 3300025909 Unclassified 537
712 Ga0207654_10080823 3300025911 Bacteria 1956
713 Ga0207654_10135449 3300025911 Bacteria 1564
714 Ga0207707_10020792 3300025912 Bacteria 5732
715 Ga0207707_10165812 3300025912 Bacteria 1930
716 Ga0207707_10174381 3300025912 Bacteria 1879
717 Ga0207707_10313568 3300025912 Bacteria 1355
718 Ga0207707_10421980 3300025912 Bacteria 1144
719 Ga0207707_10467163 3300025912 Bacteria 1079
720 Ga0207707_10738394 3300025912 Bacteria 824
721 Ga0207707_11434592 3300025912 Unclassified 549
722 Ga0207695_10018744 3300025913 Bacteria 7990
723 Ga0207695_10019756 3300025913 Bacteria 7745
724 Ga0207695_10056492 3300025913 Bacteria 4084
725 Ga0207695_10195684 3300025913 Bacteria 1937
726 Ga0207695_10322810 3300025913 Bacteria 1433
727 Ga0207695_10331207 3300025913 Bacteria 1411
728 Ga0207671_10407280 3300025914 Bacteria 1082
729 Ga0207671_11361407 3300025914 Bacteria 551
730 Ga0207693_10006527 3300025915 Bacteria 9654
731 Ga0207660_10000052 3300025917 Bacteria 59348
732 Ga0207660_10003718 3300025917 Bacteria 9941
733 Ga0207660_10004906 3300025917 Bacteria 8711
734 Ga0207660_10056549 3300025917 Bacteria 2807
735 Ga0207660_10114244 3300025917 Bacteria 2036
736 Ga0207660_10143740 3300025917 Bacteria 1826
737 Ga0207660_10154765 3300025917 Bacteria 1764
738 Ga0207660_10260533 3300025917 Bacteria 1371
739 Ga0207660_10731663 3300025917 Bacteria 807
740 Ga0207662_10190823 3300025918 Bacteria 1322
741 Ga0207662_10263760 3300025918 Bacteria 1135
742 Ga0207657_10000650 3300025919 Bacteria 36973
743 Ga0207657_10000737 3300025919 Bacteria 34706
744 Ga0207657_10010867 3300025919 Bacteria 9056
745 Ga0207657_10015919 3300025919 Bacteria 7265
746 Ga0207657_10021597 3300025919 Bacteria 6052
747 Ga0207657_10023431 3300025919 Bacteria 5748
748 Ga0207657_10036095 3300025919 Bacteria 4426
749 Ga0207657_10048860 3300025919 Bacteria 3691
750 Ga0207657_10063602 3300025919 Bacteria 3154
751 Ga0207657_10121776 3300025919 Bacteria 2146
752 Ga0207657_10188947 3300025919 Bacteria 1663
753 Ga0207657_10260269 3300025919 Bacteria 1381
754 Ga0207657_10467583 3300025919 Bacteria 989
755 Ga0207657_10499226 3300025919 Bacteria 953
756 Ga0207657_10525912 3300025919 Bacteria 925
757 Ga0207657_10553418 3300025919 Bacteria 899
758 Ga0207657_11206700 3300025919 Bacteria 575
759 Ga0207649_10001784 3300025920 Bacteria 12317
760 Ga0207649_10006365 3300025920 Bacteria 6416
761 Ga0207649_10011578 3300025920 Bacteria 4867
762 Ga0207649_10012717 3300025920 Bacteria 4678
763 Ga0207649_10015696 3300025920 Bacteria 4256
764 Ga0207649_10034711 3300025920 Bacteria 3024
765 Ga0207649_10070495 3300025920 Bacteria 2229
766 Ga0207649_10074022 3300025920 Bacteria 2184
767 Ga0207649_10124307 3300025920 Bacteria 1744
768 Ga0207649_10172187 3300025920 Unclassified 1509
769 Ga0207649_10295594 3300025920 Bacteria 1182
770 Ga0207649_10390995 3300025920 Bacteria 1038
771 Ga0207649_10468911 3300025920 Bacteria 953
772 Ga0207649_10517557 3300025920 Bacteria 909
773 Ga0207649_10674434 3300025920 Bacteria 800
774 Ga0207649_10983925 3300025920 Unclassified 663
775 Ga0207649_11689175 3300025920 Bacteria 501
776 Ga0207652_10000034 3300025921 Bacteria 138571
777 Ga0207652_10017239 3300025921 Bacteria 5908
778 Ga0207652_10110971 3300025921 Bacteria 2432
779 Ga0207652_10146778 3300025921 Bacteria 2111
780 Ga0207652_10197200 3300025921 Bacteria 1812
781 Ga0207652_10339560 3300025921 Bacteria 1356
782 Ga0207652_10386634 3300025921 Bacteria 1263
783 Ga0207652_10758607 3300025921 Bacteria 863
784 Ga0207652_11227242 3300025921 Unclassified 652
785 Ga0207652_11456424 3300025921 Bacteria 589
786 Ga0207652_11475586 3300025921 Bacteria 584
787 Ga0207681_10000693 3300025923 Bacteria 22175
788 Ga0207681_10096542 3300025923 Bacteria 2122
789 Ga0207681_10117195 3300025923 Bacteria 1947
790 Ga0207681_10205588 3300025923 Viruses 1514
791 Ga0207681_10328899 3300025923 Bacteria 1218
792 Ga0207681_11553352 3300025923 Unclassified 554
793 Ga0207694_10045276 3300025924 Bacteria 3399
794 Ga0207694_10069953 3300025924 Bacteria 2742
795 Ga0207694_10077885 3300025924 Bacteria 2598
796 Ga0207694_10102002 3300025924 Bacteria 2274
797 Ga0207694_10231938 3300025924 Bacteria 1507
798 Ga0207694_10248661 3300025924 Bacteria 1454
799 Ga0207650_10007652 3300025925 Bacteria 7359
800 Ga0207650_10015288 3300025925 Bacteria 5342
801 Ga0207650_10086473 3300025925 Bacteria 2387
802 Ga0207650_10096781 3300025925 Bacteria 2265
803 Ga0207650_10214435 3300025925 Bacteria 1547
804 Ga0207650_10246335 3300025925 Unclassified 1445
805 Ga0207650_10267193 3300025925 Bacteria 1389
806 Ga0207650_10871499 3300025925 Unclassified 764
807 Ga0207659_10004364 3300025926 Bacteria 8548
808 Ga0207659_10018156 3300025926 Bacteria 4607
809 Ga0207659_10030264 3300025926 Bacteria 3697
810 Ga0207659_10040014 3300025926 Bacteria 3275
811 Ga0207659_10045616 3300025926 Bacteria 3091
812 Ga0207659_10159329 3300025926 Bacteria 1770
813 Ga0207687_10002290 3300025927 Bacteria 13038
814 Ga0207687_10018919 3300025927 Bacteria 4555
815 Ga0207700_11953438 3300025928 Bacteria 513
816 Ga0207664_10145875 3300025929 Unclassified 2007
817 Ga0207664_10176010 3300025929 Bacteria 1834
818 Ga0207664_10230215 3300025929 Bacteria 1611
819 Ga0207664_10230415 3300025929 Bacteria 1610
820 Ga0207664_10476919 3300025929 Unclassified 1115
821 Ga0207644_10017928 3300025931 Bacteria 4787
822 Ga0207644_10036809 3300025931 Bacteria 3438
823 Ga0207644_10058859 3300025931 Bacteria 2778
824 Ga0207644_10125093 3300025931 Bacteria 1961
825 Ga0207644_10554971 3300025931 Bacteria 951
826 Ga0207690_10000402 3300025932 Bacteria 28577
827 Ga0207690_10011654 3300025932 Bacteria 5255
828 Ga0207690_10012929 3300025932 Bacteria 5002
829 Ga0207690_10019112 3300025932 Bacteria 4211
830 Ga0207690_10066676 3300025932 Bacteria 2466
831 Ga0207690_10073038 3300025932 Bacteria 2371
832 Ga0207690_10143075 3300025932 Bacteria 1765
833 Ga0207690_10478430 3300025932 Bacteria 1005
834 Ga0207690_10525871 3300025932 Unclassified 959
835 Ga0207690_10612079 3300025932 Bacteria 890
836 Ga0207690_10756612 3300025932 Bacteria 801
837 Ga0207690_11612052 3300025932 Unclassified 542
838 Ga0207706_10000020 3300025933 Bacteria 162063
839 Ga0207706_10003262 3300025933 Bacteria 15536
840 Ga0207706_10004173 3300025933 Bacteria 13606
841 Ga0207706_10005171 3300025933 Bacteria 12177
842 Ga0207706_10006593 3300025933 Bacteria 10752
843 Ga0207706_10019845 3300025933 Bacteria 6041
844 Ga0207706_10035503 3300025933 Bacteria 4431
845 Ga0207706_10040853 3300025933 Bacteria 4112
846 Ga0207706_10047951 3300025933 Bacteria 3778
847 Ga0207706_10065947 3300025933 Bacteria 3187
848 Ga0207706_10077672 3300025933 Bacteria 2920
849 Ga0207706_10216315 3300025933 Bacteria 1679
850 Ga0207709_10080339 3300025935 Bacteria 2099
851 Ga0207670_10454597 3300025936 Unclassified 1033
852 Ga0207669_10010218 3300025937 Bacteria 4511
853 Ga0207669_10040544 3300025937 Bacteria 2702
854 Ga0207669_10139706 3300025937 Bacteria 1679
855 Ga0207669_10237695 3300025937 Bacteria 1348
856 Ga0207669_11563119 3300025937 Bacteria 563
857 Ga0207704_10021933 3300025938 Bacteria 3412
858 Ga0207704_10033801 3300025938 Bacteria 2912
859 Ga0207704_10091814 3300025938 Bacteria 1997
860 Ga0207704_10617810 3300025938 Bacteria 889
861 Ga0207704_11725713 3300025938 Unclassified 538
862 Ga0207665_10021532 3300025939 Bacteria 4240
863 Ga0207691_10000047 3300025940 Bacteria 99519
864 Ga0207691_10000965 3300025940 Bacteria 28542
865 Ga0207691_10007401 3300025940 Bacteria 10572
866 Ga0207691_10050490 3300025940 Bacteria 3807
867 Ga0207691_10121692 3300025940 Bacteria 2312
868 Ga0207691_10315452 3300025940 Viruses 1341
869 Ga0207691_10748873 3300025940 Unclassified 823
870 Ga0207711_10004299 3300025941 Bacteria 12174
871 Ga0207711_10009547 3300025941 Bacteria 8093
872 Ga0207711_10024125 3300025941 Bacteria 5090
873 Ga0207711_10058616 3300025941 Bacteria 3314
874 Ga0207711_10089717 3300025941 Bacteria 2701
875 Ga0207711_10533751 3300025941 Unclassified 1094
876 Ga0207711_10615309 3300025941 Bacteria 1013
877 Ga0207711_11524579 3300025941 Bacteria 611
878 Ga0207711_11813059 3300025941 Unclassified 553
879 Ga0207689_10000002 3300025942 Bacteria 198437
880 Ga0207689_10266223 3300025942 Bacteria 1418
881 Ga0207689_10640332 3300025942 Bacteria 895
882 Ga0207689_10829421 3300025942 Bacteria 780
883 Ga0207689_11170274 3300025942 Bacteria 648
884 Ga0207689_11309656 3300025942 Unclassified 609
885 Ga0207661_10056868 3300025944 Bacteria 3142
886 Ga0207661_10127539 3300025944 Bacteria 2175
887 Ga0207661_10287861 3300025944 Bacteria 1470
888 Ga0207661_10354801 3300025944 Bacteria 1324
889 Ga0207661_10598913 3300025944 Bacteria 1011
890 Ga0207661_10763771 3300025944 Bacteria 890
891 Ga0207661_10859131 3300025944 Bacteria 835
892 Ga0207661_11622786 3300025944 Bacteria 591
893 Ga0207679_10007873 3300025945 Bacteria 6770
894 Ga0207679_10037931 3300025945 Bacteria 3430
895 Ga0207679_10039475 3300025945 Bacteria 3371
896 Ga0207679_10059816 3300025945 Bacteria 2828
897 Ga0207679_10179243 3300025945 Bacteria 1751
898 Ga0207679_10395067 3300025945 Unclassified 1215
899 Ga0207679_10757377 3300025945 Bacteria 883
900 Ga0207679_11207700 3300025945 Bacteria 694
901 Ga0207679_11930932 3300025945 Bacteria 538
902 Ga0207667_10007119 3300025949 Bacteria 13500
903 Ga0207667_10036894 3300025949 Bacteria 5232
904 Ga0207667_10059513 3300025949 Bacteria 4000
905 Ga0207667_10133092 3300025949 Bacteria 2561
906 Ga0207667_10150781 3300025949 Bacteria 2393
907 Ga0207667_10160072 3300025949 Bacteria 2316
908 Ga0207667_10207978 3300025949 Bacteria 2006
909 Ga0207667_10255147 3300025949 Bacteria 1794
910 Ga0207667_10309922 3300025949 Bacteria 1612
911 Ga0207667_10522891 3300025949 Bacteria 1202
912 Ga0207667_10574209 3300025949 Bacteria 1139
913 Ga0207667_10632866 3300025949 Bacteria 1077
914 Ga0207651_10000445 3300025960 Bacteria 17481
915 Ga0207651_10019452 3300025960 Bacteria 4070
916 Ga0207651_10090358 3300025960 Bacteria 2238
917 Ga0207651_10416778 3300025960 Bacteria 1145
918 Ga0207651_10597363 3300025960 Bacteria 964
919 Ga0207712_10037848 3300025961 Bacteria 3294
920 Ga0207668_10070640 3300025972 Bacteria 2491
921 Ga0207668_10092459 3300025972 Bacteria 2226
922 Ga0207668_11450801 3300025972 Bacteria 619
923 Ga0207668_11592117 3300025972 Unclassified 590
924 Ga0207668_11806805 3300025972 Viruses 551
925 Ga0207640_10005047 3300025981 Bacteria 7182
926 Ga0207640_10020329 3300025981 Bacteria 3940
927 Ga0207640_10054024 3300025981 Bacteria 2624
928 Ga0207640_10134820 3300025981 Bacteria 1791
929 Ga0207640_10163431 3300025981 Bacteria 1650
930 Ga0207640_10175525 3300025981 Bacteria 1601
931 Ga0207640_10195826 3300025981 Bacteria 1527
932 Ga0207640_10489324 3300025981 Bacteria 1022
933 Ga0207640_11014866 3300025981 Unclassified 730
934 Ga0207640_11369056 3300025981 Unclassified 633
935 Ga0207640_11770060 3300025981 Bacteria 558
936 Ga0207658_10002153 3300025986 Bacteria 14633
937 Ga0207658_10017290 3300025986 Bacteria 4968
938 Ga0207658_10056442 3300025986 Bacteria 2914
939 Ga0207658_10057665 3300025986 Bacteria 2887
940 Ga0207658_10110800 3300025986 Bacteria 2169
941 Ga0207658_10245601 3300025986 Bacteria 1519
942 Ga0207658_10537699 3300025986 Bacteria 1044
943 Ga0207677_10005621 3300026023 Bacteria 6813
944 Ga0207677_10027302 3300026023 Bacteria 3593
945 Ga0207677_11230725 3300026023 Bacteria 686
946 Ga0207677_11403487 3300026023 Bacteria 643
947 Ga0207677_11497746 3300026023 Bacteria 623
948 Ga0207677_12142454 3300026023 Unclassified 520
949 Ga0207703_10001138 3300026035 Bacteria 25123
950 Ga0207703_10022187 3300026035 Bacteria 4977
951 Ga0207703_10549067 3300026035 Bacteria 1089
952 Ga0207639_10001353 3300026041 Bacteria 16541
953 Ga0207639_10017111 3300026041 Bacteria 5136
954 Ga0207639_10052213 3300026041 Bacteria 3114
955 Ga0207639_10090932 3300026041 Bacteria 2442
956 Ga0207639_10146302 3300026041 Bacteria 1974
957 Ga0207639_10165382 3300026041 Bacteria 1868
958 Ga0207639_10246791 3300026041 Bacteria 1555
959 Ga0207639_10334140 3300026041 Bacteria 1349
960 Ga0207639_10615287 3300026041 Bacteria 1003
961 Ga0207639_11611787 3300026041 Bacteria 609
962 Ga0207639_11633023 3300026041 Bacteria 604
963 Ga0207639_11762236 3300026041 Unclassified 580
964 Ga0207639_11912090 3300026041 Unclassified 554
965 Ga0207678_10006540 3300026067 Bacteria 10333
966 Ga0207678_10015579 3300026067 Bacteria 6684
967 Ga0207678_10018913 3300026067 Bacteria 6053
968 Ga0207678_10025008 3300026067 Bacteria 5214
969 Ga0207678_10043209 3300026067 Bacteria 3901
970 Ga0207678_10065020 3300026067 Bacteria 3133
971 Ga0207678_10076845 3300026067 Bacteria 2860
972 Ga0207678_10110051 3300026067 Bacteria 2350
973 Ga0207678_10121721 3300026067 Bacteria 2227
974 Ga0207678_10207561 3300026067 Bacteria 1676
975 Ga0207678_10208293 3300026067 Unclassified 1672
976 Ga0207678_10228961 3300026067 Bacteria 1591
977 Ga0207678_10270784 3300026067 Bacteria 1456
978 Ga0207678_10515292 3300026067 Bacteria 1043
979 Ga0207678_11133765 3300026067 Bacteria 692
980 Ga0207678_11560445 3300026067 Unclassified 582
981 Ga0207678_11797961 3300026067 Bacteria 536
982 Ga0207678_11897897 3300026067 Unclassified 520
983 Ga0207702_10018250 3300026078 Bacteria 5803
984 Ga0207702_10022150 3300026078 Bacteria 5266
985 Ga0207702_10059466 3300026078 Bacteria 3255
986 Ga0207702_10094209 3300026078 Bacteria 2628
987 Ga0207702_10100608 3300026078 Bacteria 2551
988 Ga0207702_10115283 3300026078 Bacteria 2396
989 Ga0207702_10364673 3300026078 Bacteria 1385
990 Ga0207702_10420486 3300026078 Bacteria 1292
991 Ga0207702_10606993 3300026078 Bacteria 1074
992 Ga0207702_11026899 3300026078 Bacteria 818
993 Ga0207702_11775955 3300026078 Bacteria 609
994 Ga0207702_11781218 3300026078 Bacteria 608
995 Ga0207702_11999711 3300026078 Bacteria 570
996 Ga0207641_10029908 3300026088 Bacteria 4506
997 Ga0207641_10035960 3300026088 Bacteria 4131
998 Ga0207641_10038273 3300026088 Bacteria 4009
999 Ga0207641_10038977 3300026088 Bacteria 3973
1000 Ga0207648_10001030 3300026089 Bacteria 31326
1001 Ga0207648_10008589 3300026089 Bacteria 9879
1002 Ga0207648_10017417 3300026089 Bacteria 6539
1003 Ga0207648_10306920 3300026089 Unclassified 1424
1004 Ga0207648_11858697 3300026089 Bacteria 564
1005 Ga0207676_10002452 3300026095 Bacteria 13225
1006 Ga0207676_10020947 3300026095 Bacteria 4791
1007 Ga0207676_10103568 3300026095 Bacteria 2365
1008 Ga0207676_10201084 3300026095 Bacteria 1760
1009 Ga0207676_11153597 3300026095 Bacteria 767
1010 Ga0207676_11407193 3300026095 Bacteria 693
1011 Ga0207674_10000881 3300026116 Bacteria 39300
1012 Ga0207674_10003695 3300026116 Bacteria 18679
1013 Ga0207674_10003858 3300026116 Bacteria 18268
1014 Ga0207674_10009133 3300026116 Bacteria 11375
1015 Ga0207674_10024503 3300026116 Bacteria 6447
1016 Ga0207674_10025828 3300026116 Bacteria 6253
1017 Ga0207674_10076856 3300026116 Bacteria 3346
1018 Ga0207674_10087743 3300026116 Unclassified 3104
1019 Ga0207674_10609263 3300026116 Unclassified 1055
1020 Ga0207675_100076555 3300026118 Bacteria 3133
1021 Ga0207675_100090656 3300026118 Bacteria 2874
1022 Ga0207675_100151741 3300026118 Bacteria 2205
1023 Ga0207675_100183861 3300026118 Bacteria 2002
1024 Ga0207675_100587450 3300026118 Bacteria 1116
1025 Ga0207683_10025482 3300026121 Bacteria 5102
1026 Ga0207683_10047168 3300026121 Bacteria 3773
1027 Ga0207683_10070129 3300026121 Bacteria 3096
1028 Ga0207683_10147378 3300026121 Bacteria 2123
1029 Ga0207683_10172218 3300026121 Bacteria 1961
1030 Ga0207683_10200667 3300026121 Bacteria 1813
1031 Ga0207683_10479691 3300026121 Bacteria 1148
1032 Ga0207683_10710280 3300026121 Unclassified 932
1033 Ga0207683_11406516 3300026121 Bacteria 645
1034 Ga0207683_11957699 3300026121 Unclassified 535
1035 Ga0207698_10000833 3300026142 Bacteria 17878
1036 Ga0207698_10012259 3300026142 Bacteria 5602
1037 Ga0207698_10027421 3300026142 Bacteria 4043
1038 Ga0207698_10037677 3300026142 Bacteria 3564
1039 Ga0207698_10052935 3300026142 Bacteria 3112
1040 Ga0207698_10098688 3300026142 Bacteria 2414
1041 Ga0207698_10122962 3300026142 Bacteria 2200
1042 Ga0207698_10129172 3300026142 Bacteria 2156
1043 Ga0207698_10157462 3300026142 Bacteria 1981
1044 Ga0207698_10198863 3300026142 Bacteria 1793
1045 Ga0207698_10204929 3300026142 Bacteria 1770
1046 Ga0207698_10257494 3300026142 Bacteria 1601
1047 Ga0207698_10827717 3300026142 Unclassified 929
1048 Ga0207698_10898072 3300026142 Bacteria 893
1049 Ga0207698_10999026 3300026142 Bacteria 847
1050 Ga0207698_11126819 3300026142 Bacteria 798
1051 Ga0207698_11367799 3300026142 Bacteria 723
1052 Ga0207698_11629675 3300026142 Bacteria 661
1053 Ga0209371_1093876 3300027312 Unclassified 503
1054 Ga0268266_10077396 3300028379 Bacteria 2892
1055 Ga0268266_10171699 3300028379 Bacteria 1968
1056 Ga0268266_11502150 3300028379 Bacteria 649
1057 Ga0268265_10011171 3300028380 Bacteria 6068
1058 Ga0268265_10017415 3300028380 Bacteria 4957
1059 Ga0268265_10039949 3300028380 Bacteria 3461
1060 Ga0268265_10082933 3300028380 Bacteria 2536
1061 Ga0268265_11972104 3300028380 Bacteria 591
1062 Ga0268265_12247413 3300028380 Bacteria 552
1063 Ga0268264_10005212 3300028381 Bacteria 11009
1064 Ga0268264_10015885 3300028381 Bacteria 6166
1065 Ga0268264_10098845 3300028381 Bacteria 2531
1066 Ga0268264_10121527 3300028381 Bacteria 2302
1067 Ga0268264_11130262 3300028381 Bacteria 792
1068 Ga0307515_10140586 3300028794 Bacteria 2592
1069 Ga0307515_10312331 3300028794 Bacteria 1246
1070 Ga0268256_1083929 3300030500 Unclassified 591
1071 Ga0307408_100013973 3300031548 Bacteria 5332
1072 Ga0307408_100324725 3300031548 Bacteria 1297
1073 Ga0307408_100390461 3300031548 Bacteria 1192
1074 Ga0307408_100875038 3300031548 Bacteria 820
1075 Ga0307408_101199459 3300031548 Bacteria 708
1076 Ga0307405_10016561 3300031731 Bacteria 4022
1077 Ga0307405_10148264 3300031731 Bacteria 1646
1078 Ga0307405_10469059 3300031731 Bacteria 1002
1079 Ga0307413_10002065 3300031824 Bacteria 8023
1080 Ga0307413_10008328 3300031824 Bacteria 4888
1081 Ga0307413_10024423 3300031824 Bacteria 3295
1082 Ga0307413_10037309 3300031824 Bacteria 2806
1083 Ga0307413_10102172 3300031824 Bacteria 1897
1084 Ga0307413_10108401 3300031824 Bacteria 1853
1085 Ga0307413_11089268 3300031824 Bacteria 689
1086 Ga0307413_11732783 3300031824 Bacteria 558
1087 Ga0307410_10000580 3300031852 Bacteria 15026
1088 Ga0307410_10002208 3300031852 Bacteria 9273
1089 Ga0307410_10034043 3300031852 Bacteria 3295
1090 Ga0307410_10143394 3300031852 Bacteria 1770
1091 Ga0307410_10154655 3300031852 Bacteria 1711
1092 Ga0307410_10185472 3300031852 Unclassified 1578
1093 Ga0307410_10355217 3300031852 Bacteria 1172
1094 Ga0307410_10408570 3300031852 Bacteria 1098
1095 Ga0307410_10765496 3300031852 Bacteria 818
1096 Ga0307410_11925874 3300031852 Bacteria 526
1097 Ga0307406_10056629 3300031901 Bacteria 2511
1098 Ga0307406_10135147 3300031901 Bacteria 1737
1099 Ga0307406_10383679 3300031901 Bacteria 1108
1100 Ga0307406_10656085 3300031901 Bacteria 871
1101 Ga0307406_10879751 3300031901 Bacteria 761
1102 Ga0307406_11482701 3300031901 Bacteria 596
1103 Ga0307407_10018490 3300031903 Bacteria 3526
1104 Ga0307407_10034146 3300031903 Bacteria 2782
1105 Ga0307407_10034308 3300031903 Bacteria 2776
1106 Ga0307407_10036229 3300031903 Bacteria 2717
1107 Ga0307407_10161882 3300031903 Bacteria 1465
1108 Ga0307407_10225264 3300031903 Bacteria 1270
1109 Ga0307407_10387966 3300031903 Bacteria 999
1110 Ga0307412_10010321 3300031911 Bacteria 5377
1111 Ga0307412_10025110 3300031911 Bacteria 3686
1112 Ga0307412_10038238 3300031911 Bacteria 3088
1113 Ga0307412_10257886 3300031911 Unclassified 1357
1114 Ga0307412_10287486 3300031911 Bacteria 1293
1115 Ga0307409_100006675 3300031995 Bacteria 6817
1116 Ga0307409_100024957 3300031995 Bacteria 4181
1117 Ga0307409_100038094 3300031995 Bacteria 3552
1118 Ga0307409_100043042 3300031995 Bacteria 3386
1119 Ga0307409_100365478 3300031995 Bacteria 1366
1120 Ga0307409_100424517 3300031995 Bacteria 1276
1121 Ga0307409_100571644 3300031995 Bacteria 1113
1122 Ga0307409_100635291 3300031995 Bacteria 1059
1123 Ga0307409_100677867 3300031995 Bacteria 1028
1124 Ga0307416_100016562 3300032002 Bacteria 5129
1125 Ga0307416_100073987 3300032002 Bacteria 2844
1126 Ga0307416_100094873 3300032002 Bacteria 2574
1127 Ga0307416_100106830 3300032002 Bacteria 2455
1128 Ga0307416_100117962 3300032002 Bacteria 2357
1129 Ga0307416_100257309 3300032002 Bacteria 1703
1130 Ga0307416_102253554 3300032002 Bacteria 645
1131 Ga0307416_102593870 3300032002 Bacteria 604
1132 Ga0307414_10003998 3300032004 Bacteria 7958
1133 Ga0307414_10011823 3300032004 Bacteria 5138
1134 Ga0307414_10023874 3300032004 Bacteria 3887
1135 Ga0307414_10039342 3300032004 Bacteria 3184
1136 Ga0307414_10044759 3300032004 Bacteria 3026
1137 Ga0307414_10053155 3300032004 Bacteria 2823
1138 Ga0307414_10069673 3300032004 Bacteria 2529
1139 Ga0307414_10226292 3300032004 Bacteria 1539
1140 Ga0307414_10337975 3300032004 Bacteria 1288
1141 Ga0307414_11366985 3300032004 Bacteria 658
1142 Ga0307414_11961619 3300032004 Bacteria 546
1143 Ga0307411_10000482 3300032005 Bacteria 13901
1144 Ga0307411_10001353 3300032005 Bacteria 9917
1145 Ga0307411_10001715 3300032005 Bacteria 9204
1146 Ga0307411_10007015 3300032005 Bacteria 5694
1147 Ga0307411_10009555 3300032005 Bacteria 5109
1148 Ga0307411_10015233 3300032005 Bacteria 4312
1149 Ga0307411_10045285 3300032005 Bacteria 2829
1150 Ga0307411_10077491 3300032005 Bacteria 2275
1151 Ga0307411_11075664 3300032005 Unclassified 724
1152 Ga0307411_11697157 3300032005 Bacteria 584
1153 Ga0307415_100001134 3300032126 Bacteria 12448
1154 Ga0307415_100004978 3300032126 Bacteria 6990
1155 Ga0307415_100032435 3300032126 Bacteria 3377
1156 Ga0307415_100073293 3300032126 Bacteria 2415
1157 Ga0307415_101401858 3300032126 Bacteria 665
1158 Ga0307415_101641355 3300032126 Bacteria 618
1159 Ga0307415_101867823 3300032126 Bacteria 582
1160 Ga0373944_0134228 3300035089 Bacteria 862
1161 Ga0373932_0072569 3300035112 Bacteria 1071
1162 Ga0373945_0134531 3300035116 Bacteria 993
1163 Ga0373957_0371018 3300035120 Bacteria 613
1164 Ga0373943_0016633 3300035170 Bacteria 3356
1165 Ga0373943_0308219 3300035170 Bacteria 900
1166 Ga0373946_0789629 3300035171 Bacteria 500
1167 Ga0373942_0071322 3300035207 Bacteria 1015
1168 Ga0373962_0134947 3300035242 Bacteria 797
1169 Ga0373931_0117483 3300035691 Bacteria 1516
1170 Ga0373935_0018990 3300035692 Bacteria 4191
1171 Ga0373935_0026138 3300035692 Bacteria 3600
1172 Ga0373935_0068973 3300035692 Bacteria 2276
1173 Ga0373927_0017611 3300035695 Bacteria 4701
1174 Ga0373933_1097538 3300035724 Bacteria 524
1175 Ga0373947_0011601 3300035725 Bacteria 5056
1176 Ga0373947_0126153 3300035725 Bacteria 1630
1177 Ga0373925_0191628 3300037068 Bacteria 1622
1178 Ga0373925_0402698 3300037068 Bacteria 1116
1179 Ga0373925_1772837 3300037068 Bacteria 504
1180 Ga0395899_0001745 3300037312 Bacteria 18084
1181 Ga0395899_0009558 3300037312 Bacteria 7442
1182 Ga0395899_0042541 3300037312 Bacteria 3391
1183 Ga0395899_0063041 3300037312 Bacteria 2728
1184 Ga0395899_0130854 3300037312 Bacteria 1792
1185 Ga0395899_0196785 3300037312 Bacteria 1408
1186 Ga0395899_0257759 3300037312 Bacteria 1194
1187 Ga0395899_0367681 3300037312 Unclassified 958
1188 Ga0395899_0492470 3300037312 Bacteria 796
1189 Ga0395899_0660639 3300037312 Bacteria 659
1190 Ga0395900_0012634 3300037418 Bacteria 8634
1191 Ga0395900_0019379 3300037418 Bacteria 6938
1192 Ga0395900_0020642 3300037418 Bacteria 6731
1193 Ga0395900_0027008 3300037418 Bacteria 5877
1194 Ga0395900_0046034 3300037418 Bacteria 4492
1195 Ga0395900_0068019 3300037418 Bacteria 3660
1196 Ga0395900_0099185 3300037418 Bacteria 2992
1197 Ga0395900_0225531 3300037418 Bacteria 1886
1198 Ga0395900_0255127 3300037418 Bacteria 1753
1199 Ga0395900_0280515 3300037418 Bacteria 1658
1200 Ga0395900_0312396 3300037418 Bacteria 1554
1201 Ga0395900_0360817 3300037418 Bacteria 1424
1202 Ga0395900_0368505 3300037418 Bacteria 1406
1203 Ga0395900_0496319 3300037418 Archaea 1171
1204 Ga0395900_0610455 3300037418 Bacteria 1030
1205 Ga0395900_0796822 3300037418 Bacteria 873
1206 Ga0395900_0868959 3300037418 Bacteria 826
1207 Ga0395900_0966330 3300037418 Bacteria 773
1208 Ga0395900_0972796 3300037418 Bacteria 769
1209 Ga0395900_0993656 3300037418 Bacteria 759
1210 Ga0395900_1286540 3300037418 Bacteria 645
1211 Ga0395900_1301148 3300037418 Bacteria 641
1212 Ga0395900_1717124 3300037418 Bacteria 538
1213 Ga0395900_1902304 3300037418 Unclassified 505
1214 Ga0395898_0039260 3300037466 Bacteria 4686
1215 Ga0395898_0061721 3300037466 Bacteria 3642
1216 Ga0395898_0061937 3300037466 Bacteria 3634
1217 Ga0395898_0096170 3300037466 Bacteria 2845
1218 Ga0395898_0110545 3300037466 Bacteria 2634
1219 Ga0395898_0117940 3300037466 Bacteria 2542
1220 Ga0395898_0300800 3300037466 Bacteria 1530
1221 Ga0395898_0452083 3300037466 Bacteria 1223
1222 Ga0395898_0667705 3300037466 Bacteria 981
1223 Ga0395905_0016433 3300037471 Bacteria 7034
1224 Ga0395905_0019802 3300037471 Bacteria 6378
1225 Ga0395905_0026664 3300037471 Bacteria 5448
1226 Ga0395905_0049125 3300037471 Bacteria 3953
1227 Ga0395905_0051022 3300037471 Bacteria 3874
1228 Ga0395905_0051704 3300037471 Bacteria 3848
1229 Ga0395905_0059745 3300037471 Bacteria 3564
1230 Ga0395905_0103166 3300037471 Bacteria 2677
1231 Ga0395905_0129480 3300037471 Bacteria 2373
1232 Ga0395905_0144055 3300037471 Bacteria 2242
1233 Ga0395905_0213687 3300037471 Bacteria 1806
1234 Ga0395905_0220794 3300037471 Bacteria 1774
1235 Ga0395905_0237534 3300037471 Bacteria 1703
1236 Ga0395905_0348032 3300037471 Bacteria 1374
1237 Ga0395905_0353964 3300037471 Bacteria 1360
1238 Ga0395905_0477055 3300037471 Bacteria 1146
1239 Ga0395905_0489164 3300037471 Unclassified 1130
1240 Ga0395905_0598449 3300037471 Unclassified 1004
1241 Ga0395905_0621161 3300037471 Bacteria 982
1242 Ga0395905_0674005 3300037471 Bacteria 936
1243 Ga0395905_0712316 3300037471 Bacteria 906
1244 Ga0395905_0806486 3300037471 Bacteria 842
1245 Ga0395905_0824629 3300037471 Bacteria 830
1246 Ga0395905_1334890 3300037471 Bacteria 621
1247 Ga0395905_1728328 3300037471 Bacteria 531
1248 Ga0436364_1351497 3300037853 Bacteria 37033
1249 Ga0395901_0000375 3300038443 Bacteria 53750
1250 Ga0395901_0017695 3300038443 Bacteria 7275
1251 Ga0395901_0022105 3300038443 Bacteria 6516
1252 Ga0395901_0036955 3300038443 Bacteria 5050
1253 Ga0395901_0055408 3300038443 Bacteria 4123
1254 Ga0395901_0076377 3300038443 Bacteria 3495
1255 Ga0395901_0112392 3300038443 Bacteria 2860
1256 Ga0395901_0268024 3300038443 Bacteria 1776
1257 Ga0395901_0385748 3300038443 Bacteria 1441
1258 Ga0395901_0388812 3300038443 Bacteria 1434
1259 Ga0395901_0409918 3300038443 Bacteria 1391
1260 Ga0395901_0782891 3300038443 Unclassified 944
1261 Ga0395901_1323482 3300038443 Bacteria 681
1262 Ga0395901_1431553 3300038443 Bacteria 649
1263 Ga0395901_1628543 3300038443 Bacteria 598
1264 Ga0436363_1013070 3300039450 Bacteria 507
1265 Ga0439465_0091778 3300041413 Bacteria 1040
1266 Ga0451853_0383103 3300041512 Bacteria 839
1267 Ga0439449_0027027 3300042007 Bacteria 2142
1268 Ga0466969_0013700 3300044656 Bacteria 4268
1269 Ga0466969_0590723 3300044656 Unclassified 509
1270 Ga0466972_0020043 3300044658 Bacteria 3343
1271 Ga0466972_0477893 3300044658 Bacteria 586
1272 Ga0466972_0515566 3300044658 Unclassified 563
1273 Ga0466965_0199342 3300044683 Bacteria 1061
1274 Ga0466965_0268301 3300044683 Bacteria 919
1275 Ga0466965_0895379 3300044683 Bacteria 517
1276 Ga0466966_0010189 3300044684 Bacteria 6235
1277 Ga0466966_0351396 3300044684 Bacteria 886
1278 Ga0466966_0398877 3300044684 Unclassified 826
1279 Ga0466966_0620870 3300044684 Bacteria 651
1280 Ga0466961_0014580 3300044693 Bacteria 5050
1281 Ga0466961_0117941 3300044693 Bacteria 1667
1282 Ga0466961_0158077 3300044693 Bacteria 1413
1283 Ga0466963_0015497 3300044694 Bacteria 4723
1284 Ga0466963_0021350 3300044694 Bacteria 4083
1285 Ga0466963_0026403 3300044694 Bacteria 3714
1286 Ga0466963_0063142 3300044694 Bacteria 2478
1287 Ga0466963_0065040 3300044694 Bacteria 2444
1288 Ga0466963_0143758 3300044694 Bacteria 1654
1289 Ga0466963_0225817 3300044694 Bacteria 1312
1290 Ga0466963_0390564 3300044694 Bacteria 981
1291 Ga0466964_0304607 3300044706 Bacteria 804
1292 Ga0466964_0611761 3300044706 Bacteria 599
1293 Ga0466964_0672212 3300044706 Bacteria 575
1294 Ga0466971_0033337 3300044719 Bacteria 2308
1295 Ga0466971_0245297 3300044719 Unclassified 852
1296 Ga0466968_0055251 3300044735 Bacteria 1703
1297 Ga0466970_0033484 3300044765 Bacteria 2716
1298 Ga0466970_0058687 3300044765 Bacteria 2060
1299 Ga0466957_0017877 3300044842 Bacteria 4159
1300 Ga0466957_0018414 3300044842 Bacteria 4102
1301 Ga0466957_0084033 3300044842 Bacteria 1987
1302 Ga0466957_0767563 3300044842 Bacteria 683
1303 Ga0466960_0010721 3300044901 Bacteria 3813
1304 Ga0466960_0759332 3300044901 Bacteria 585
1305 Ga0466959_0122416 3300045049 Bacteria 1848
1306 Ga0466959_0134007 3300045049 Bacteria 1754
1307 Ga0466959_0376247 3300045049 Bacteria 967
1308 Ga0466959_0652243 3300045049 Unclassified 706
1309 Ga0451576_2075681 3300045051 Bacteria 585
1310 Ga0466958_0011303 3300045836 Bacteria 5026
1311 Ga0466958_0081518 3300045836 Bacteria 1991
1312 Ga0466958_0085266 3300045836 Bacteria 1949
1313 Ga0466958_0899515 3300045836 Unclassified 577
1314 Ga0466967_0003504 3300045976 Bacteria 10254
1315 Ga0466967_0027967 3300045976 Bacteria 4699
1316 Ga0466967_0033683 3300045976 Bacteria 4339
1317 Ga0466967_0055209 3300045976 Bacteria 3499
1318 Ga0466967_0091459 3300045976 Bacteria 2765
1319 Ga0466967_0107292 3300045976 Bacteria 2561
1320 Ga0466967_0201514 3300045976 Bacteria 1885
1321 Ga0466967_0381907 3300045976 Bacteria 1368
1322 Ga0466967_0808309 3300045976 Bacteria 931
1323 Ga0466967_0829056 3300045976 Bacteria 919
1324 Ga0466967_0950919 3300045976 Unclassified 855
1325 Ga0466967_1284461 3300045976 Viruses 729
1326 Ga0466967_1297479 3300045976 Bacteria 725
1327 Ga0495585_0022540 3300046492 Bacteria 3615
1328 Ga0495631_0501333 3300046518 Bacteria 517
1329 Ga0495644_0388211 3300046523 Bacteria 552
1330 Ga0495663_0089084 3300046525 Bacteria 1004
1331 Ga0495663_0169371 3300046525 Bacteria 752
1332 Ga0495663_0292274 3300046525 Bacteria 585
1333 Ga0495654_0322447 3300046530 Unclassified 626
1334 Ga0495665_0367064 3300046531 Bacteria 732
1335 Ga0495598_0000245 3300046537 Bacteria 9722
1336 Ga0495621_0003228 3300046539 Bacteria 4479
1337 Ga0495621_0235492 3300046539 Unclassified 744
1338 Ga0495633_0054203 3300046558 Bacteria 1886
1339 Ga0495668_0034707 3300046616 Bacteria 2828
1340 Ga0495668_0165693 3300046616 Bacteria 1210
1341 Ga0495625_0413474 3300046660 Bacteria 840
1342 Ga0495635_0409225 3300046663 Bacteria 900
1343 Ga0495661_0242034 3300046665 Bacteria 925
1344 Ga0495669_0000810 3300046684 Bacteria 13326
1345 Ga0495669_0006559 3300046684 Bacteria 4865
1346 Ga0495669_0015703 3300046684 Bacteria 3242
1347 Ga0495669_0069829 3300046684 Bacteria 1599
1348 Ga0495669_0089109 3300046684 Bacteria 1422
1349 Ga0495670_0005629 3300046691 Bacteria 6144
1350 Ga0495677_0004420 3300047445 Bacteria 5399
1351 Ga0495677_0011290 3300047445 Bacteria 3270
1352 Ga0495673_0291843 3300047469 Unclassified 586
1353 Ga0496100_0011309 3300048903 Bacteria 5079
1354 Ga0496100_0090808 3300048903 Bacteria 2083
1355 Ga0496100_0665044 3300048903 Bacteria 812
1356 Ga0496100_1153442 3300048903 Bacteria 611
1357 Ga0496101_0103118 3300048904 Bacteria 2137
1358 Ga0496101_0401726 3300048904 Bacteria 1079
1359 Ga0496101_0590951 3300048904 Bacteria 878
1360 Ga0496102_0174800 3300048905 Bacteria 2022
1361 Ga0496102_0417453 3300048905 Bacteria 1260
1362 Ga0496102_1121063 3300048905 Bacteria 706
1363 Ga0496103_0016593 3300048906 Bacteria 4395
1364 Ga0496103_0554720 3300048906 Bacteria 733
1365 Ga0496103_0723868 3300048906 Bacteria 630
1366 Ga0496105_0111978 3300048908 Bacteria 2252
1367 Ga0496106_0114498 3300048909 Bacteria 2103
1368 Ga0496106_0119511 3300048909 Bacteria 2059
1369 Ga0496106_0467618 3300048909 Bacteria 1013
1370 Ga0496106_0887514 3300048909 Bacteria 704
1371 Ga0496107_0055863 3300048910 Bacteria 2851
1372 Ga0496107_0234322 3300048910 Bacteria 1366
1373 Ga0496107_0492007 3300048910 Bacteria 910
1374 Ga0496107_1216271 3300048910 Unclassified 541
1375 Ga0496107_1263327 3300048910 Bacteria 529
1376 Ga0496108_0002538 3300048911 Bacteria 14612
1377 Ga0496108_0682993 3300048911 Unclassified 891
1378 Ga0496109_0062972 3300048912 Bacteria 3392
1379 Ga0496109_0110353 3300048912 Bacteria 2557
1380 Ga0496109_0262677 3300048912 Bacteria 1626
1381 Ga0496109_0263341 3300048912 Unclassified 1624
1382 Ga0496109_0594627 3300048912 Bacteria 1042
1383 Ga0496110_0013487 3300048913 Bacteria 6759
1384 Ga0496110_0113127 3300048913 Bacteria 2440
1385 Ga0496110_0836686 3300048913 Unclassified 825
1386 Ga0496111_0008887 3300048914 Bacteria 6678
1387 Ga0496111_0020076 3300048914 Bacteria 4647
1388 Ga0496112_0015503 3300048915 Bacteria 7116
1389 Ga0496112_0138208 3300048915 Bacteria 2406
1390 Ga0496112_0208212 3300048915 Bacteria 1913
1391 Ga0496112_1868353 3300048915 Bacteria 512
1392 Ga0496113_0009435 3300048916 Bacteria 6401
1393 Ga0496113_0132654 3300048916 Bacteria 1956
1394 Ga0496113_0519110 3300048916 Unclassified 956
1395 Ga0496114_0056118 3300048917 Bacteria 3286
1396 Ga0496114_0642338 3300048917 Bacteria 934
1397 Ga0496115_0581588 3300048918 Bacteria 892
1398 Ga0501067_0176854 3300049583 Bacteria 1188
1399 Ga0501068_0128974 3300049584 Bacteria 1581
1400 Ga0501069_0422469 3300049585 Bacteria 790
1401 Ga0501071_1306210 3300049587 Bacteria 560
1402 Ga0501074_0469947 3300049590 Bacteria 891
1403 Ga0501199_005511 3300049650 Bacteria 1272
1404 Ga0501202_004051 3300049652 Bacteria 2547
1405 Ga0501209_109454 3300049656 Bacteria 814
1406 Ga0501210_028551 3300049657 Bacteria 568
1407 Ga0501214_092115 3300049659 Bacteria 524
1408 Ga0501217_060816 3300049661 Bacteria 1008
1409 Ga0501223_032069 3300049663 Bacteria 1022
1410 Ga0501223_069596 3300049663 Bacteria 694
1411 Ga0501224_023317 3300049664 Bacteria 924
1412 Ga0501227_086556 3300049665 Bacteria 825
1413 Ga0501235_233810 3300049669 Bacteria 509
1414 Ga0501239_006043 3300049672 Bacteria 1234
1415 Ga0501247_005158 3300049677 Bacteria 1448
1416 Ga0501249_020066 3300049679 Bacteria 1452
1417 Ga0501257_078140 3300049686 Bacteria 851
1418 Ga0501258_001706 3300049687 Bacteria 1838
1419 Ga0501225_0028003 3300049705 Bacteria 1549
1420 Ga0501225_0134213 3300049705 Bacteria 744
1421 Ga0501225_0207670 3300049705 Bacteria 625
1422 Ga0501245_051310 3300049708 Bacteria 732
1423 Ga0501080_0328096 3300049742 Bacteria 1384
1424 Ga0501263_087914 3300049760 Bacteria 521
1425 Ga0501267_012987 3300049764 Bacteria 862
1426 Ga0501268_000552 3300049765 Bacteria 4122
1427 Ga0501270_103247 3300049767 Bacteria 598
1428 Ga0501273_005489 3300049770 Bacteria 1434
1429 Ga0501279_007452 3300049775 Bacteria 1453
1430 Ga0501212_041599 3300049851 Bacteria 761
1431 Ga0501212_063489 3300049851 Bacteria 643
1432 nmdc:mga07m45_920923_c1 3300050496 Bacteria 500
1433 Ga0495655_0330809 3300053083 Unclassified 529
1434 Ga0500658_0000247 3300053134 Bacteria 25342
1435 Ga0466962_0014679 3300061719 Bacteria 3775
1436 Ga0466962_0037107 3300061719 Bacteria 2333
1437 Ga0466962_0341252 3300061719 Unclassified 745
1438 Ga0530510_1002198 3300061734 Bacteria 639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_11048752 Ga0075370_110487522 66
2 3300050496 nmdc:mga07m45_920923_c1 nmdc:mga07m45_920923_c1_120_335 66
3 3300005366 Ga0070659_100146822 Ga0070659_1001468224 67
4 3300005455 Ga0070663_101034165 Ga0070663_1010341652 67
5 3300026041 Ga0207639_11611787 Ga0207639_116117872 67
6 3300026067 Ga0207678_10270784 Ga0207678_102707842 67
7 3300031548 Ga0307408_100390461 Ga0307408_1003904612 67
8 3300031731 Ga0307405_10469059 Ga0307405_104690592 67
9 3300031824 Ga0307413_10008328 Ga0307413_100083283 67
10 3300031824 Ga0307413_10037309 Ga0307413_100373096 67
11 3300031824 Ga0307413_10108401 Ga0307413_101084014 67
12 3300031852 Ga0307410_10185472 Ga0307410_101854723 67
13 3300031852 Ga0307410_10355217 Ga0307410_103552172 67
14 3300031852 Ga0307410_10408570 Ga0307410_104085702 67
15 3300031901 Ga0307406_10656085 Ga0307406_106560852 67
16 3300031903 Ga0307407_10018490 Ga0307407_100184905 67
17 3300031903 Ga0307407_10034146 Ga0307407_100341463 67
18 3300031903 Ga0307407_10387966 Ga0307407_103879662 67
19 3300031911 Ga0307412_10257886 Ga0307412_102578862 67
20 3300031995 Ga0307409_100365478 Ga0307409_1003654783 67
21 3300031995 Ga0307409_100424517 Ga0307409_1004245172 67
22 3300031995 Ga0307409_100635291 Ga0307409_1006352912 67
23 3300032002 Ga0307416_100094873 Ga0307416_1000948733 67
24 3300032004 Ga0307414_10003998 Ga0307414_100039984 67
25 3300032004 Ga0307414_10044759 Ga0307414_100447593 67
26 3300032004 Ga0307414_10069673 Ga0307414_100696732 67
27 3300032005 Ga0307411_10001353 Ga0307411_100013538 67
28 3300032005 Ga0307411_10009555 Ga0307411_100095557 67
29 3300032005 Ga0307411_10045285 Ga0307411_100452853 67
30 3300032126 Ga0307415_100073293 Ga0307415_1000732932 67
31 3300049705 Ga0501225_0207670 Ga0501225_0207670_183_386 67
32 2162886012 MBSR1b_contig_12184105 MBSR1b_0186.00006180 68
33 2162886012 MBSR1b_contig_7087521 MBSR1b_0848.00002280 68
34 2162886012 MBSR1b_contig_9730680 MBSR1b_0185.00006900 68
35 3300001904 JGI24736J21556_1000825 JGI24736J21556_10008259 68
36 3300001904 JGI24736J21556_1001686 JGI24736J21556_10016864 68
37 3300001904 JGI24736J21556_1002190 JGI24736J21556_10021904 68
38 3300001915 JGI24741J21665_1012416 JGI24741J21665_10124162 68
39 3300001978 JGI24747J21853_1014170 JGI24747J21853_10141702 68
40 3300001978 JGI24747J21853_1027721 JGI24747J21853_10277211 68
41 3300001979 JGI24740J21852_10000326 JGI24740J21852_1000032625 68
42 3300001979 JGI24740J21852_10006270 JGI24740J21852_100062708 68
43 3300001979 JGI24740J21852_10007633 JGI24740J21852_100076335 68
44 3300001979 JGI24740J21852_10028613 JGI24740J21852_100286133 68
45 3300001979 JGI24740J21852_10028708 JGI24740J21852_100287082 68
46 3300001979 JGI24740J21852_10130631 JGI24740J21852_101306312 68
47 3300001989 JGI24739J22299_10012347 JGI24739J22299_100123474 68
48 3300001989 JGI24739J22299_10018676 JGI24739J22299_100186762 68
49 3300001989 JGI24739J22299_10044490 JGI24739J22299_100444902 68
50 3300001989 JGI24739J22299_10044853 JGI24739J22299_100448532 68
51 3300001989 JGI24739J22299_10048193 JGI24739J22299_100481933 68
52 3300001990 JGI24737J22298_10000120 JGI24737J22298_1000012012 68
53 3300001990 JGI24737J22298_10030309 JGI24737J22298_100303092 68
54 3300001990 JGI24737J22298_10038500 JGI24737J22298_100385002 68
55 3300001990 JGI24737J22298_10065775 JGI24737J22298_100657752 68
56 3300001990 JGI24737J22298_10089490 JGI24737J22298_100894902 68
57 3300001990 JGI24737J22298_10093483 JGI24737J22298_100934832 68
58 3300001990 JGI24737J22298_10177474 JGI24737J22298_101774742 68
59 3300001991 JGI24743J22301_10040619 JGI24743J22301_100406192 68
60 3300002067 JGI24735J21928_10015302 JGI24735J21928_100153022 68
61 3300002067 JGI24735J21928_10029874 JGI24735J21928_100298742 68
62 3300002067 JGI24735J21928_10035886 JGI24735J21928_100358862 68
63 3300002067 JGI24735J21928_10049533 JGI24735J21928_100495332 68
64 3300002067 JGI24735J21928_10114009 JGI24735J21928_101140092 68
65 3300002073 JGI24745J21846_1002522 JGI24745J21846_10025224 68
66 3300002075 JGI24738J21930_10000025 JGI24738J21930_1000002510 68
67 3300002075 JGI24738J21930_10047057 JGI24738J21930_100470572 68
68 3300002077 JGI24744J21845_10000021 JGI24744J21845_100000212 68
69 3300002126 JGI24035J26624_1013580 JGI24035J26624_10135801 68
70 3300002244 JGI24742J22300_10018813 JGI24742J22300_100188132 68
71 3300003322 rootL2_10220426 rootL2_102204262 68
72 3300005290 Ga0065712_10071995 Ga0065712_100719955 68
73 3300005290 Ga0065712_10194659 Ga0065712_101946591 68
74 3300005293 Ga0065715_10172327 Ga0065715_101723272 68
75 3300005293 Ga0065715_10337243 Ga0065715_103372432 68
76 3300005293 Ga0065715_10422874 Ga0065715_104228742 68
77 3300005293 Ga0065715_10956858 Ga0065715_109568582 68
78 3300005327 Ga0070658_10041477 Ga0070658_100414772 68
79 3300005327 Ga0070658_10042829 Ga0070658_100428294 68
80 3300005327 Ga0070658_10085522 Ga0070658_100855222 68
81 3300005327 Ga0070658_10091106 Ga0070658_100911063 68
82 3300005327 Ga0070658_10092437 Ga0070658_100924373 68
83 3300005327 Ga0070658_10186423 Ga0070658_101864232 68
84 3300005327 Ga0070658_10207788 Ga0070658_102077882 68
85 3300005327 Ga0070658_10261996 Ga0070658_102619962 68
86 3300005327 Ga0070658_10322414 Ga0070658_103224142 68
87 3300005327 Ga0070658_10374771 Ga0070658_103747712 68
88 3300005327 Ga0070658_10383966 Ga0070658_103839663 68
89 3300005327 Ga0070658_10554550 Ga0070658_105545502 68
90 3300005327 Ga0070658_11015606 Ga0070658_110156062 68
91 3300005327 Ga0070658_11028470 Ga0070658_110284701 68
92 3300005327 Ga0070658_11115399 Ga0070658_111153992 68
93 3300005327 Ga0070658_11486415 Ga0070658_114864151 68
94 3300005327 Ga0070658_11863744 Ga0070658_118637442 68
95 3300005328 Ga0070676_10001685 Ga0070676_1000168511 68
96 3300005328 Ga0070676_10010298 Ga0070676_100102983 68
97 3300005328 Ga0070676_10095738 Ga0070676_100957382 68
98 3300005328 Ga0070676_10196047 Ga0070676_101960472 68
99 3300005328 Ga0070676_10278847 Ga0070676_102788471 68
100 3300005328 Ga0070676_10724226 Ga0070676_107242261 68
101 3300005328 Ga0070676_10884124 Ga0070676_108841242 68
102 3300005328 Ga0070676_10929595 Ga0070676_109295952 68
103 3300005329 Ga0070683_100004824 Ga0070683_1000048245 68
104 3300005329 Ga0070683_100076221 Ga0070683_1000762212 68
105 3300005329 Ga0070683_100160879 Ga0070683_1001608793 68
106 3300005329 Ga0070683_100189937 Ga0070683_1001899373 68
107 3300005329 Ga0070683_100417999 Ga0070683_1004179992 68
108 3300005329 Ga0070683_100448989 Ga0070683_1004489892 68
109 3300005329 Ga0070683_100674353 Ga0070683_1006743532 68
110 3300005329 Ga0070683_101636196 Ga0070683_1016361962 68
111 3300005330 Ga0070690_100022321 Ga0070690_1000223212 68
112 3300005330 Ga0070690_100351938 Ga0070690_1003519382 68
113 3300005331 Ga0070670_100000263 Ga0070670_1000002633 68
114 3300005331 Ga0070670_100009174 Ga0070670_1000091743 68
115 3300005331 Ga0070670_100010639 Ga0070670_1000106395 68
116 3300005331 Ga0070670_100016978 Ga0070670_1000169783 68
117 3300005331 Ga0070670_100026934 Ga0070670_1000269343 68
118 3300005331 Ga0070670_100032051 Ga0070670_1000320514 68
119 3300005331 Ga0070670_100144613 Ga0070670_1001446134 68
120 3300005331 Ga0070670_100261042 Ga0070670_1002610422 68
121 3300005331 Ga0070670_100732624 Ga0070670_1007326241 68
122 3300005333 Ga0070677_10000586 Ga0070677_100005863 68
123 3300005333 Ga0070677_10068981 Ga0070677_100689812 68
124 3300005333 Ga0070677_10306094 Ga0070677_103060942 68
125 3300005333 Ga0070677_10679030 Ga0070677_106790302 68
126 3300005334 Ga0068869_100000003 Ga0068869_100000003125 68
127 3300005334 Ga0068869_100261267 Ga0068869_1002612673 68
128 3300005334 Ga0068869_100586210 Ga0068869_1005862102 68
129 3300005334 Ga0068869_100648812 Ga0068869_1006488122 68
130 3300005334 Ga0068869_101513092 Ga0068869_1015130922 68
131 3300005335 Ga0070666_10009768 Ga0070666_100097688 68
132 3300005335 Ga0070666_10010226 Ga0070666_100102268 68
133 3300005335 Ga0070666_10178263 Ga0070666_101782632 68
134 3300005335 Ga0070666_10342525 Ga0070666_103425253 68
135 3300005335 Ga0070666_10353917 Ga0070666_103539172 68
136 3300005335 Ga0070666_10600723 Ga0070666_106007232 68
137 3300005336 Ga0070680_100002719 Ga0070680_10000271914 68
138 3300005336 Ga0070680_100002845 Ga0070680_10000284515 68
139 3300005336 Ga0070680_100008547 Ga0070680_1000085478 68
140 3300005336 Ga0070680_100142605 Ga0070680_1001426053 68
141 3300005336 Ga0070680_100145355 Ga0070680_1001453552 68
142 3300005336 Ga0070680_100216908 Ga0070680_1002169082 68
143 3300005336 Ga0070680_100494262 Ga0070680_1004942622 68
144 3300005336 Ga0070680_100680324 Ga0070680_1006803242 68
145 3300005336 Ga0070680_100875704 Ga0070680_1008757042 68
146 3300005336 Ga0070680_100933204 Ga0070680_1009332042 68
147 3300005336 Ga0070680_101004332 Ga0070680_1010043322 68
148 3300005336 Ga0070680_101166480 Ga0070680_1011664802 68
149 3300005337 Ga0070682_100029813 Ga0070682_1000298133 68
150 3300005337 Ga0070682_100094887 Ga0070682_1000948873 68
151 3300005337 Ga0070682_100265612 Ga0070682_1002656122 68
152 3300005337 Ga0070682_101778609 Ga0070682_1017786092 68
153 3300005338 Ga0068868_100000379 Ga0068868_1000003794 68
154 3300005338 Ga0068868_100017468 Ga0068868_1000174686 68
155 3300005338 Ga0068868_100275005 Ga0068868_1002750052 68
156 3300005338 Ga0068868_101458972 Ga0068868_1014589722 68
157 3300005338 Ga0068868_101794130 Ga0068868_1017941302 68
158 3300005338 Ga0068868_101909218 Ga0068868_1019092182 68
159 3300005339 Ga0070660_100001061 Ga0070660_10000106123 68
160 3300005339 Ga0070660_100001636 Ga0070660_10000163616 68
161 3300005339 Ga0070660_100007164 Ga0070660_1000071644 68
162 3300005339 Ga0070660_100009593 Ga0070660_1000095937 68
163 3300005339 Ga0070660_100090568 Ga0070660_1000905682 68
164 3300005339 Ga0070660_100100916 Ga0070660_1001009164 68
165 3300005339 Ga0070660_100125575 Ga0070660_1001255753 68
166 3300005339 Ga0070660_100203923 Ga0070660_1002039232 68
167 3300005339 Ga0070660_100263342 Ga0070660_1002633422 68
168 3300005339 Ga0070660_100335832 Ga0070660_1003358322 68
169 3300005339 Ga0070660_100464480 Ga0070660_1004644802 68
170 3300005339 Ga0070660_100472031 Ga0070660_1004720312 68
171 3300005339 Ga0070660_100715541 Ga0070660_1007155412 68
172 3300005339 Ga0070660_100775950 Ga0070660_1007759502 68
173 3300005339 Ga0070660_100805439 Ga0070660_1008054392 68
174 3300005339 Ga0070660_101104212 Ga0070660_1011042122 68
175 3300005339 Ga0070660_101129677 Ga0070660_1011296771 68
176 3300005339 Ga0070660_101319466 Ga0070660_1013194661 68
177 3300005339 Ga0070660_101511181 Ga0070660_1015111812 68
178 3300005340 Ga0070689_100130255 Ga0070689_1001302553 68
179 3300005340 Ga0070689_100387268 Ga0070689_1003872682 68
180 3300005341 Ga0070691_10002720 Ga0070691_100027202 68
181 3300005344 Ga0070661_100016333 Ga0070661_1000163336 68
182 3300005344 Ga0070661_100026281 Ga0070661_1000262816 68
183 3300005344 Ga0070661_100039268 Ga0070661_1000392682 68
184 3300005344 Ga0070661_100062468 Ga0070661_1000624685 68
185 3300005344 Ga0070661_100073229 Ga0070661_1000732293 68
186 3300005344 Ga0070661_100149077 Ga0070661_1001490772 68
187 3300005344 Ga0070661_100152024 Ga0070661_1001520244 68
188 3300005344 Ga0070661_100166651 Ga0070661_1001666513 68
189 3300005344 Ga0070661_100396159 Ga0070661_1003961592 68
190 3300005344 Ga0070661_100396290 Ga0070661_1003962902 68
191 3300005344 Ga0070661_100451576 Ga0070661_1004515762 68
192 3300005344 Ga0070661_100468515 Ga0070661_1004685152 68
193 3300005344 Ga0070661_100493322 Ga0070661_1004933222 68
194 3300005344 Ga0070661_100511821 Ga0070661_1005118212 68
195 3300005344 Ga0070661_100551048 Ga0070661_1005510482 68
196 3300005344 Ga0070661_100861860 Ga0070661_1008618602 68
197 3300005344 Ga0070661_100950794 Ga0070661_1009507942 68
198 3300005344 Ga0070661_101310884 Ga0070661_1013108842 68
199 3300005344 Ga0070661_101476331 Ga0070661_1014763312 68
200 3300005345 Ga0070692_10018894 Ga0070692_100188942 68
201 3300005345 Ga0070692_10116136 Ga0070692_101161362 68
202 3300005345 Ga0070692_10252129 Ga0070692_102521292 68
203 3300005345 Ga0070692_10469879 Ga0070692_104698791 68
204 3300005345 Ga0070692_11026434 Ga0070692_110264342 68
205 3300005347 Ga0070668_100009629 Ga0070668_1000096298 68
206 3300005347 Ga0070668_100285158 Ga0070668_1002851583 68
207 3300005347 Ga0070668_100343817 Ga0070668_1003438172 68
208 3300005353 Ga0070669_100000138 Ga0070669_10000013834 68
209 3300005353 Ga0070669_100030323 Ga0070669_1000303233 68
210 3300005353 Ga0070669_100058539 Ga0070669_1000585393 68
211 3300005353 Ga0070669_100107436 Ga0070669_1001074363 68
212 3300005353 Ga0070669_100259161 Ga0070669_1002591612 68
213 3300005353 Ga0070669_100979325 Ga0070669_1009793251 68
214 3300005354 Ga0070675_100000118 Ga0070675_1000001183 68
215 3300005354 Ga0070675_100004728 Ga0070675_1000047289 68
216 3300005354 Ga0070675_100011372 Ga0070675_1000113723 68
217 3300005354 Ga0070675_100015241 Ga0070675_1000152413 68
218 3300005354 Ga0070675_100041832 Ga0070675_1000418324 68
219 3300005354 Ga0070675_100151915 Ga0070675_1001519153 68
220 3300005355 Ga0070671_100008614 Ga0070671_1000086149 68
221 3300005355 Ga0070671_100016142 Ga0070671_1000161426 68
222 3300005355 Ga0070671_100040667 Ga0070671_1000406672 68
223 3300005355 Ga0070671_100071905 Ga0070671_1000719054 68
224 3300005355 Ga0070671_100140133 Ga0070671_1001401332 68
225 3300005355 Ga0070671_100156688 Ga0070671_1001566882 68
226 3300005356 Ga0070674_100011429 Ga0070674_1000114297 68
227 3300005356 Ga0070674_100033900 Ga0070674_1000339002 68
228 3300005356 Ga0070674_100035287 Ga0070674_1000352874 68
229 3300005356 Ga0070674_100038702 Ga0070674_1000387024 68
230 3300005356 Ga0070674_100100532 Ga0070674_1001005322 68
231 3300005356 Ga0070674_100121041 Ga0070674_1001210412 68
232 3300005364 Ga0070673_100000154 Ga0070673_1000001547 68
233 3300005364 Ga0070673_100074228 Ga0070673_1000742283 68
234 3300005364 Ga0070673_100080781 Ga0070673_1000807812 68
235 3300005364 Ga0070673_100084327 Ga0070673_1000843272 68
236 3300005364 Ga0070673_100316901 Ga0070673_1003169011 68
237 3300005364 Ga0070673_100399022 Ga0070673_1003990222 68
238 3300005364 Ga0070673_100426591 Ga0070673_1004265913 68
239 3300005364 Ga0070673_100436389 Ga0070673_1004363892 68
240 3300005364 Ga0070673_100462840 Ga0070673_1004628402 68
241 3300005364 Ga0070673_101515390 Ga0070673_1015153902 68
242 3300005364 Ga0070673_101708165 Ga0070673_1017081652 68
243 3300005365 Ga0070688_100624316 Ga0070688_1006243162 68
244 3300005366 Ga0070659_100000360 Ga0070659_10000036030 68
245 3300005366 Ga0070659_100012198 Ga0070659_1000121983 68
246 3300005366 Ga0070659_100017244 Ga0070659_1000172442 68
247 3300005366 Ga0070659_100029747 Ga0070659_1000297473 68
248 3300005366 Ga0070659_100060923 Ga0070659_1000609232 68
249 3300005366 Ga0070659_100123730 Ga0070659_1001237304 68
250 3300005366 Ga0070659_100159693 Ga0070659_1001596932 68
251 3300005366 Ga0070659_100323498 Ga0070659_1003234982 68
252 3300005366 Ga0070659_100422054 Ga0070659_1004220542 68
253 3300005366 Ga0070659_100447113 Ga0070659_1004471131 68
254 3300005366 Ga0070659_100478413 Ga0070659_1004784132 68
255 3300005366 Ga0070659_100630693 Ga0070659_1006306931 68
256 3300005366 Ga0070659_100702479 Ga0070659_1007024792 68
257 3300005366 Ga0070659_101112505 Ga0070659_1011125052 68
258 3300005366 Ga0070659_101874318 Ga0070659_1018743182 68
259 3300005366 Ga0070659_101874483 Ga0070659_1018744832 68
260 3300005366 Ga0070659_102037586 Ga0070659_1020375861 68
261 3300005366 Ga0070659_102061611 Ga0070659_1020616112 68
262 3300005367 Ga0070667_100005484 Ga0070667_1000054843 68
263 3300005367 Ga0070667_100020394 Ga0070667_1000203942 68
264 3300005367 Ga0070667_100037919 Ga0070667_1000379194 68
265 3300005367 Ga0070667_100058193 Ga0070667_1000581934 68
266 3300005367 Ga0070667_100243039 Ga0070667_1002430393 68
267 3300005367 Ga0070667_100414726 Ga0070667_1004147263 68
268 3300005367 Ga0070667_100466095 Ga0070667_1004660952 68
269 3300005434 Ga0070709_10070774 Ga0070709_100707743 68
270 3300005435 Ga0070714_100048977 Ga0070714_1000489774 68
271 3300005435 Ga0070714_101735792 Ga0070714_1017357922 68
272 3300005436 Ga0070713_100081976 Ga0070713_1000819764 68
273 3300005436 Ga0070713_100776600 Ga0070713_1007766002 68
274 3300005436 Ga0070713_100814678 Ga0070713_1008146782 68
275 3300005439 Ga0070711_100567876 Ga0070711_1005678762 68
276 3300005455 Ga0070663_100006176 Ga0070663_1000061766 68
277 3300005455 Ga0070663_100011063 Ga0070663_1000110634 68
278 3300005455 Ga0070663_100033117 Ga0070663_1000331174 68
279 3300005455 Ga0070663_100070058 Ga0070663_1000700584 68
280 3300005455 Ga0070663_100135224 Ga0070663_1001352242 68
281 3300005455 Ga0070663_100209879 Ga0070663_1002098792 68
282 3300005455 Ga0070663_100241634 Ga0070663_1002416342 68
283 3300005455 Ga0070663_100242090 Ga0070663_1002420902 68
284 3300005455 Ga0070663_100268891 Ga0070663_1002688913 68
285 3300005455 Ga0070663_100398448 Ga0070663_1003984482 68
286 3300005455 Ga0070663_100444335 Ga0070663_1004443353 68
287 3300005455 Ga0070663_100582912 Ga0070663_1005829122 68
288 3300005455 Ga0070663_100655867 Ga0070663_1006558671 68
289 3300005455 Ga0070663_100841308 Ga0070663_1008413082 68
290 3300005455 Ga0070663_101289936 Ga0070663_1012899362 68
291 3300005455 Ga0070663_101893605 Ga0070663_1018936052 68
292 3300005456 Ga0070678_100039463 Ga0070678_1000394633 68
293 3300005456 Ga0070678_100047826 Ga0070678_1000478264 68
294 3300005456 Ga0070678_100527298 Ga0070678_1005272981 68
295 3300005456 Ga0070678_100839535 Ga0070678_1008395352 68
296 3300005456 Ga0070678_101690086 Ga0070678_1016900862 68
297 3300005457 Ga0070662_100000567 Ga0070662_10000056729 68
298 3300005457 Ga0070662_100006437 Ga0070662_1000064379 68
299 3300005457 Ga0070662_100018683 Ga0070662_1000186832 68
300 3300005457 Ga0070662_100031758 Ga0070662_1000317583 68
301 3300005457 Ga0070662_100045958 Ga0070662_1000459582 68
302 3300005457 Ga0070662_100067501 Ga0070662_1000675014 68
303 3300005457 Ga0070662_100092545 Ga0070662_1000925453 68
304 3300005457 Ga0070662_100113147 Ga0070662_1001131473 68
305 3300005457 Ga0070662_100822849 Ga0070662_1008228492 68
306 3300005457 Ga0070662_101103738 Ga0070662_1011037382 68
307 3300005457 Ga0070662_101790391 Ga0070662_1017903912 68
308 3300005457 Ga0070662_101934683 Ga0070662_1019346832 68
309 3300005457 Ga0070662_101986946 Ga0070662_1019869462 68
310 3300005458 Ga0070681_10030311 Ga0070681_100303111 68
311 3300005458 Ga0070681_10082296 Ga0070681_100822963 68
312 3300005458 Ga0070681_10371226 Ga0070681_103712262 68
313 3300005458 Ga0070681_10414541 Ga0070681_104145412 68
314 3300005458 Ga0070681_10659696 Ga0070681_106596962 68
315 3300005458 Ga0070681_10884339 Ga0070681_108843391 68
316 3300005459 Ga0068867_100000505 Ga0068867_10000050519 68
317 3300005459 Ga0068867_100165377 Ga0068867_1001653774 68
318 3300005459 Ga0068867_100185776 Ga0068867_1001857762 68
319 3300005459 Ga0068867_100878717 Ga0068867_1008787171 68
320 3300005466 Ga0070685_10656807 Ga0070685_106568072 68
321 3300005466 Ga0070685_11165929 Ga0070685_111659292 68
322 3300005466 Ga0070685_11532393 Ga0070685_115323932 68
323 3300005530 Ga0070679_100026734 Ga0070679_1000267343 68
324 3300005530 Ga0070679_100033833 Ga0070679_1000338332 68
325 3300005530 Ga0070679_100152034 Ga0070679_1001520343 68
326 3300005530 Ga0070679_100365090 Ga0070679_1003650903 68
327 3300005530 Ga0070679_100383250 Ga0070679_1003832502 68
328 3300005530 Ga0070679_100433395 Ga0070679_1004333952 68
329 3300005530 Ga0070679_100462374 Ga0070679_1004623742 68
330 3300005530 Ga0070679_100572064 Ga0070679_1005720642 68
331 3300005530 Ga0070679_100757173 Ga0070679_1007571732 68
332 3300005530 Ga0070679_100972669 Ga0070679_1009726692 68
333 3300005530 Ga0070679_101473881 Ga0070679_1014738812 68
334 3300005530 Ga0070679_101787528 Ga0070679_1017875282 68
335 3300005535 Ga0070684_100003373 Ga0070684_1000033733 68
336 3300005535 Ga0070684_100086596 Ga0070684_1000865962 68
337 3300005535 Ga0070684_100100955 Ga0070684_1001009552 68
338 3300005535 Ga0070684_100439739 Ga0070684_1004397392 68
339 3300005535 Ga0070684_100537406 Ga0070684_1005374063 68
340 3300005535 Ga0070684_100838523 Ga0070684_1008385231 68
341 3300005535 Ga0070684_101024890 Ga0070684_1010248902 68
342 3300005539 Ga0068853_100001049 Ga0068853_10000104919 68
343 3300005539 Ga0068853_100021524 Ga0068853_1000215245 68
344 3300005539 Ga0068853_100070165 Ga0068853_1000701652 68
345 3300005539 Ga0068853_100108230 Ga0068853_1001082302 68
346 3300005539 Ga0068853_100355567 Ga0068853_1003555672 68
347 3300005539 Ga0068853_100535140 Ga0068853_1005351402 68
348 3300005539 Ga0068853_100752237 Ga0068853_1007522371 68
349 3300005539 Ga0068853_101483553 Ga0068853_1014835532 68
350 3300005539 Ga0068853_102093891 Ga0068853_1020938912 68
351 3300005539 Ga0068853_102135275 Ga0068853_1021352751 68
352 3300005543 Ga0070672_100000498 Ga0070672_10000049821 68
353 3300005543 Ga0070672_100000731 Ga0070672_10000073115 68
354 3300005543 Ga0070672_100012992 Ga0070672_1000129922 68
355 3300005543 Ga0070672_100047548 Ga0070672_1000475486 68
356 3300005543 Ga0070672_100132428 Ga0070672_1001324282 68
357 3300005543 Ga0070672_100132765 Ga0070672_1001327652 68
358 3300005543 Ga0070672_100170812 Ga0070672_1001708123 68
359 3300005544 Ga0070686_100105592 Ga0070686_1001055922 68
360 3300005544 Ga0070686_100951254 Ga0070686_1009512542 68
361 3300005547 Ga0070693_100195344 Ga0070693_1001953442 68
362 3300005547 Ga0070693_100212240 Ga0070693_1002122403 68
363 3300005548 Ga0070665_100064946 Ga0070665_1000649462 68
364 3300005548 Ga0070665_100103428 Ga0070665_1001034284 68
365 3300005548 Ga0070665_100189945 Ga0070665_1001899452 68
366 3300005548 Ga0070665_100254044 Ga0070665_1002540443 68
367 3300005563 Ga0068855_100003323 Ga0068855_1000033233 68
368 3300005563 Ga0068855_100008372 Ga0068855_10000837214 68
369 3300005563 Ga0068855_100112389 Ga0068855_1001123894 68
370 3300005563 Ga0068855_100114855 Ga0068855_1001148552 68
371 3300005563 Ga0068855_100127128 Ga0068855_1001271285 68
372 3300005563 Ga0068855_100169179 Ga0068855_1001691795 68
373 3300005563 Ga0068855_100204355 Ga0068855_1002043552 68
374 3300005563 Ga0068855_100411057 Ga0068855_1004110572 68
375 3300005563 Ga0068855_100414559 Ga0068855_1004145592 68
376 3300005563 Ga0068855_100628525 Ga0068855_1006285252 68
377 3300005563 Ga0068855_101018541 Ga0068855_1010185412 68
378 3300005563 Ga0068855_102302592 Ga0068855_1023025922 68
379 3300005564 Ga0070664_100002238 Ga0070664_10000223813 68
380 3300005564 Ga0070664_100012015 Ga0070664_1000120152 68
381 3300005564 Ga0070664_100021606 Ga0070664_1000216063 68
382 3300005564 Ga0070664_100035241 Ga0070664_1000352412 68
383 3300005564 Ga0070664_100042127 Ga0070664_1000421273 68
384 3300005564 Ga0070664_100118419 Ga0070664_1001184193 68
385 3300005564 Ga0070664_100125434 Ga0070664_1001254343 68
386 3300005564 Ga0070664_100175917 Ga0070664_1001759172 68
387 3300005564 Ga0070664_100334043 Ga0070664_1003340433 68
388 3300005564 Ga0070664_100415221 Ga0070664_1004152213 68
389 3300005564 Ga0070664_101992924 Ga0070664_1019929242 68
390 3300005564 Ga0070664_102288939 Ga0070664_1022889392 68
391 3300005577 Ga0068857_100007857 Ga0068857_10000785711 68
392 3300005577 Ga0068857_100046023 Ga0068857_1000460233 68
393 3300005577 Ga0068857_100046977 Ga0068857_1000469774 68
394 3300005577 Ga0068857_100054882 Ga0068857_1000548825 68
395 3300005577 Ga0068857_100109221 Ga0068857_1001092212 68
396 3300005577 Ga0068857_100110810 Ga0068857_1001108102 68
397 3300005577 Ga0068857_100247207 Ga0068857_1002472072 68
398 3300005577 Ga0068857_101446135 Ga0068857_1014461352 68
399 3300005578 Ga0068854_100000358 Ga0068854_10000035812 68
400 3300005578 Ga0068854_100002217 Ga0068854_10000221713 68
401 3300005578 Ga0068854_100016747 Ga0068854_1000167477 68
402 3300005578 Ga0068854_100031767 Ga0068854_1000317674 68
403 3300005578 Ga0068854_100075978 Ga0068854_1000759783 68
404 3300005578 Ga0068854_100098669 Ga0068854_1000986693 68
405 3300005578 Ga0068854_100393482 Ga0068854_1003934822 68
406 3300005578 Ga0068854_100505896 Ga0068854_1005058961 68
407 3300005578 Ga0068854_100887250 Ga0068854_1008872502 68
408 3300005614 Ga0068856_100055418 Ga0068856_1000554184 68
409 3300005614 Ga0068856_100072426 Ga0068856_1000724264 68
410 3300005614 Ga0068856_100192923 Ga0068856_1001929232 68
411 3300005614 Ga0068856_100233659 Ga0068856_1002336593 68
412 3300005614 Ga0068856_100304629 Ga0068856_1003046292 68
413 3300005614 Ga0068856_100426159 Ga0068856_1004261593 68
414 3300005614 Ga0068856_100517496 Ga0068856_1005174962 68
415 3300005614 Ga0068856_100603474 Ga0068856_1006034742 68
416 3300005614 Ga0068856_100665506 Ga0068856_1006655062 68
417 3300005614 Ga0068856_100675095 Ga0068856_1006750952 68
418 3300005614 Ga0068856_101243593 Ga0068856_1012435932 68
419 3300005614 Ga0068856_101270072 Ga0068856_1012700722 68
420 3300005614 Ga0068856_101479160 Ga0068856_1014791602 68
421 3300005614 Ga0068856_102385391 Ga0068856_1023853912 68
422 3300005614 Ga0068856_102466728 Ga0068856_1024667282 68
423 3300005614 Ga0068856_102520540 Ga0068856_1025205402 68
424 3300005615 Ga0070702_100549163 Ga0070702_1005491632 68
425 3300005615 Ga0070702_101286006 Ga0070702_1012860062 68
426 3300005616 Ga0068852_100000496 Ga0068852_10000049626 68
427 3300005616 Ga0068852_100038865 Ga0068852_1000388656 68
428 3300005616 Ga0068852_100041765 Ga0068852_1000417657 68
429 3300005616 Ga0068852_100068787 Ga0068852_1000687875 68
430 3300005616 Ga0068852_100109029 Ga0068852_1001090293 68
431 3300005616 Ga0068852_100128588 Ga0068852_1001285883 68
432 3300005616 Ga0068852_100189965 Ga0068852_1001899652 68
433 3300005616 Ga0068852_100211311 Ga0068852_1002113112 68
434 3300005616 Ga0068852_100474944 Ga0068852_1004749442 68
435 3300005616 Ga0068852_100492396 Ga0068852_1004923962 68
436 3300005616 Ga0068852_100778530 Ga0068852_1007785302 68
437 3300005616 Ga0068852_100798951 Ga0068852_1007989512 68
438 3300005616 Ga0068852_101242805 Ga0068852_1012428052 68
439 3300005616 Ga0068852_101402594 Ga0068852_1014025942 68
440 3300005616 Ga0068852_101576241 Ga0068852_1015762412 68
441 3300005616 Ga0068852_102588727 Ga0068852_1025887271 68
442 3300005616 Ga0068852_102719997 Ga0068852_1027199972 68
443 3300005617 Ga0068859_100000550 Ga0068859_1000005503 68
444 3300005617 Ga0068859_100039867 Ga0068859_1000398672 68
445 3300005617 Ga0068859_100044603 Ga0068859_1000446033 68
446 3300005617 Ga0068859_102455429 Ga0068859_1024554291 68
447 3300005618 Ga0068864_100000047 Ga0068864_100000047138 68
448 3300005618 Ga0068864_100055187 Ga0068864_1000551873 68
449 3300005618 Ga0068864_100065886 Ga0068864_1000658865 68
450 3300005618 Ga0068864_100086744 Ga0068864_1000867442 68
451 3300005618 Ga0068864_100239980 Ga0068864_1002399803 68
452 3300005618 Ga0068864_101229383 Ga0068864_1012293832 68
453 3300005718 Ga0068866_10029895 Ga0068866_100298952 68
454 3300005718 Ga0068866_10057527 Ga0068866_100575273 68
455 3300005718 Ga0068866_10555978 Ga0068866_105559782 68
456 3300005719 Ga0068861_100071312 Ga0068861_1000713124 68
457 3300005719 Ga0068861_100213101 Ga0068861_1002131013 68
458 3300005719 Ga0068861_100412977 Ga0068861_1004129771 68
459 3300005719 Ga0068861_100507693 Ga0068861_1005076932 68
460 3300005719 Ga0068861_101265587 Ga0068861_1012655871 68
461 3300005834 Ga0068851_10036294 Ga0068851_100362941 68
462 3300005834 Ga0068851_10043937 Ga0068851_100439372 68
463 3300005834 Ga0068851_10072335 Ga0068851_100723352 68
464 3300005834 Ga0068851_10152028 Ga0068851_101520282 68
465 3300005834 Ga0068851_10192218 Ga0068851_101922182 68
466 3300005834 Ga0068851_10206011 Ga0068851_102060113 68
467 3300005834 Ga0068851_10352825 Ga0068851_103528252 68
468 3300005834 Ga0068851_10425204 Ga0068851_104252042 68
469 3300005840 Ga0068870_10012871 Ga0068870_100128713 68
470 3300005840 Ga0068870_10154938 Ga0068870_101549382 68
471 3300005841 Ga0068863_100000468 Ga0068863_10000046834 68
472 3300005841 Ga0068863_100009582 Ga0068863_10000958212 68
473 3300005841 Ga0068863_100046726 Ga0068863_1000467264 68
474 3300005841 Ga0068863_100107539 Ga0068863_1001075393 68
475 3300005842 Ga0068858_100007156 Ga0068858_10000715612 68
476 3300005842 Ga0068858_100012571 Ga0068858_1000125719 68
477 3300005842 Ga0068858_102369644 Ga0068858_1023696442 68
478 3300005843 Ga0068860_100003459 Ga0068860_10000345920 68
479 3300005843 Ga0068860_100034551 Ga0068860_1000345516 68
480 3300005843 Ga0068860_100089688 Ga0068860_1000896884 68
481 3300005843 Ga0068860_100330415 Ga0068860_1003304153 68
482 3300005843 Ga0068860_100384389 Ga0068860_1003843892 68
483 3300005843 Ga0068860_100612844 Ga0068860_1006128443 68
484 3300005844 Ga0068862_100021026 Ga0068862_1000210264 68
485 3300005844 Ga0068862_100040694 Ga0068862_1000406942 68
486 3300005844 Ga0068862_100126872 Ga0068862_1001268722 68
487 3300005844 Ga0068862_100172536 Ga0068862_1001725363 68
488 3300005844 Ga0068862_101168695 Ga0068862_1011686952 68
489 3300005985 Ga0081539_10006545 Ga0081539_100065456 68
490 3300006028 Ga0070717_10032089 Ga0070717_100320894 68
491 3300006173 Ga0070716_100053318 Ga0070716_1000533184 68
492 3300006175 Ga0070712_100028025 Ga0070712_1000280256 68
493 3300006237 Ga0097621_100145236 Ga0097621_1001452363 68
494 3300006237 Ga0097621_100209194 Ga0097621_1002091943 68
495 3300006237 Ga0097621_100236400 Ga0097621_1002364004 68
496 3300006237 Ga0097621_100299332 Ga0097621_1002993322 68
497 3300006237 Ga0097621_100435882 Ga0097621_1004358822 68
498 3300006237 Ga0097621_100622251 Ga0097621_1006222512 68
499 3300006358 Ga0068871_100085855 Ga0068871_1000858552 68
500 3300006358 Ga0068871_100159753 Ga0068871_1001597534 68
501 3300006358 Ga0068871_100495078 Ga0068871_1004950783 68
502 3300006881 Ga0068865_100018542 Ga0068865_1000185427 68
503 3300006881 Ga0068865_100043326 Ga0068865_1000433264 68
504 3300006881 Ga0068865_100068518 Ga0068865_1000685182 68
505 3300006931 Ga0097620_100000550 Ga0097620_1000005503 68
506 3300006931 Ga0097620_100039868 Ga0097620_1000398682 68
507 3300006931 Ga0097620_100044604 Ga0097620_1000446043 68
508 3300006931 Ga0097620_102454858 Ga0097620_1024548582 68
509 3300009093 Ga0105240_10019167 Ga0105240_100191679 68
510 3300009093 Ga0105240_10106651 Ga0105240_101066514 68
511 3300009093 Ga0105240_10122417 Ga0105240_101224172 68
512 3300009093 Ga0105240_10161790 Ga0105240_101617902 68
513 3300009093 Ga0105240_10231615 Ga0105240_102316153 68
514 3300009093 Ga0105240_10273875 Ga0105240_102738752 68
515 3300009093 Ga0105240_10367007 Ga0105240_103670072 68
516 3300009093 Ga0105240_11255323 Ga0105240_112553232 68
517 3300009093 Ga0105240_12422114 Ga0105240_124221142 68
518 3300009098 Ga0105245_10000198 Ga0105245_1000019826 68
519 3300009098 Ga0105245_10079466 Ga0105245_100794664 68
520 3300009098 Ga0105245_10155381 Ga0105245_101553812 68
521 3300009098 Ga0105245_11976277 Ga0105245_119762772 68
522 3300009101 Ga0105247_11008162 Ga0105247_110081622 68
523 3300009148 Ga0105243_10039697 Ga0105243_100396973 68
524 3300009148 Ga0105243_10146495 Ga0105243_101464952 68
525 3300009148 Ga0105243_10297602 Ga0105243_102976024 68
526 3300009148 Ga0105243_10302300 Ga0105243_103023002 68
527 3300009148 Ga0105243_10661620 Ga0105243_106616202 68
528 3300009174 Ga0105241_10030104 Ga0105241_100301043 68
529 3300009174 Ga0105241_10034765 Ga0105241_100347657 68
530 3300009174 Ga0105241_10072236 Ga0105241_100722364 68
531 3300009174 Ga0105241_10179696 Ga0105241_101796963 68
532 3300009174 Ga0105241_11437224 Ga0105241_114372242 68
533 3300009174 Ga0105241_11969700 Ga0105241_119697002 68
534 3300009176 Ga0105242_10296953 Ga0105242_102969533 68
535 3300009176 Ga0105242_11852826 Ga0105242_118528262 68
536 3300009177 Ga0105248_10000391 Ga0105248_1000039144 68
537 3300009177 Ga0105248_10014868 Ga0105248_100148683 68
538 3300009177 Ga0105248_10141487 Ga0105248_101414872 68
539 3300009177 Ga0105248_10154872 Ga0105248_101548722 68
540 3300009177 Ga0105248_10602647 Ga0105248_106026472 68
541 3300009177 Ga0105248_10829552 Ga0105248_108295522 68
542 3300009177 Ga0105248_11090266 Ga0105248_110902661 68
543 3300009177 Ga0105248_11826339 Ga0105248_118263392 68
544 3300009177 Ga0105248_11954204 Ga0105248_119542042 68
545 3300009545 Ga0105237_10088050 Ga0105237_100880504 68
546 3300009545 Ga0105237_11036430 Ga0105237_110364302 68
547 3300009551 Ga0105238_10023266 Ga0105238_100232663 68
548 3300009551 Ga0105238_10031600 Ga0105238_100316005 68
549 3300009551 Ga0105238_10142251 Ga0105238_101422512 68
550 3300009551 Ga0105238_10200398 Ga0105238_102003982 68
551 3300009551 Ga0105238_10273306 Ga0105238_102733061 68
552 3300009553 Ga0105249_10011394 Ga0105249_100113943 68
553 3300009553 Ga0105249_10962081 Ga0105249_109620812 68
554 3300009553 Ga0105249_11246791 Ga0105249_112467912 68
555 3300010375 Ga0105239_10089870 Ga0105239_100898705 68
556 3300010375 Ga0105239_10849595 Ga0105239_108495953 68
557 3300010375 Ga0105239_12095442 Ga0105239_120954421 68
558 3300010375 Ga0105239_13213179 Ga0105239_132131792 68
559 3300011119 Ga0105246_10016356 Ga0105246_100163564 68
560 3300011119 Ga0105246_12368084 Ga0105246_123680842 68
561 3300013100 Ga0157373_10028706 Ga0157373_100287063 68
562 3300013100 Ga0157373_10032369 Ga0157373_100323694 68
563 3300013100 Ga0157373_10044171 Ga0157373_100441712 68
564 3300013100 Ga0157373_10068331 Ga0157373_100683314 68
565 3300013100 Ga0157373_10086710 Ga0157373_100867103 68
566 3300013100 Ga0157373_10112051 Ga0157373_101120514 68
567 3300013100 Ga0157373_10161672 Ga0157373_101616722 68
568 3300013100 Ga0157373_10185291 Ga0157373_101852912 68
569 3300013100 Ga0157373_10194672 Ga0157373_101946722 68
570 3300013100 Ga0157373_10242273 Ga0157373_102422733 68
571 3300013100 Ga0157373_10259218 Ga0157373_102592182 68
572 3300013100 Ga0157373_10374540 Ga0157373_103745401 68
573 3300013100 Ga0157373_10419234 Ga0157373_104192342 68
574 3300013100 Ga0157373_10535696 Ga0157373_105356962 68
575 3300013100 Ga0157373_10539798 Ga0157373_105397981 68
576 3300013100 Ga0157373_10634079 Ga0157373_106340792 68
577 3300013100 Ga0157373_10657996 Ga0157373_106579961 68
578 3300013100 Ga0157373_10722558 Ga0157373_107225581 68
579 3300013100 Ga0157373_10938124 Ga0157373_109381242 68
580 3300013100 Ga0157373_11410633 Ga0157373_114106332 68
581 3300013102 Ga0157371_10001384 Ga0157371_1000138413 68
582 3300013102 Ga0157371_10019626 Ga0157371_100196264 68
583 3300013102 Ga0157371_10034456 Ga0157371_100344563 68
584 3300013102 Ga0157371_10046702 Ga0157371_100467023 68
585 3300013102 Ga0157371_10061265 Ga0157371_100612652 68
586 3300013102 Ga0157371_10064294 Ga0157371_100642942 68
587 3300013102 Ga0157371_10070770 Ga0157371_100707704 68
588 3300013102 Ga0157371_10171841 Ga0157371_101718412 68
589 3300013102 Ga0157371_10174093 Ga0157371_101740933 68
590 3300013102 Ga0157371_10311446 Ga0157371_103114462 68
591 3300013102 Ga0157371_10674543 Ga0157371_106745432 68
592 3300013102 Ga0157371_10800777 Ga0157371_108007772 68
593 3300013102 Ga0157371_10808434 Ga0157371_108084341 68
594 3300013102 Ga0157371_11050852 Ga0157371_110508522 68
595 3300013102 Ga0157371_11192518 Ga0157371_111925182 68
596 3300013102 Ga0157371_11289300 Ga0157371_112893001 68
597 3300013104 Ga0157370_10021414 Ga0157370_100214147 68
598 3300013104 Ga0157370_10032144 Ga0157370_100321442 68
599 3300013104 Ga0157370_10051504 Ga0157370_100515047 68
600 3300013104 Ga0157370_10079198 Ga0157370_100791982 68
601 3300013104 Ga0157370_10147717 Ga0157370_101477172 68
602 3300013104 Ga0157370_10200372 Ga0157370_102003724 68
603 3300013104 Ga0157370_10205399 Ga0157370_102053992 68
604 3300013104 Ga0157370_10263914 Ga0157370_102639143 68
605 3300013104 Ga0157370_10273815 Ga0157370_102738152 68
606 3300013104 Ga0157370_10470761 Ga0157370_104707613 68
607 3300013104 Ga0157370_10488140 Ga0157370_104881402 68
608 3300013104 Ga0157370_11114083 Ga0157370_111140831 68
609 3300013104 Ga0157370_12149892 Ga0157370_121498922 68
610 3300013105 Ga0157369_10019055 Ga0157369_100190557 68
611 3300013105 Ga0157369_10032749 Ga0157369_100327496 68
612 3300013105 Ga0157369_10067002 Ga0157369_100670025 68
613 3300013105 Ga0157369_10105734 Ga0157369_101057344 68
614 3300013105 Ga0157369_10229147 Ga0157369_102291472 68
615 3300013105 Ga0157369_10303514 Ga0157369_103035142 68
616 3300013105 Ga0157369_10303726 Ga0157369_103037262 68
617 3300013105 Ga0157369_10781008 Ga0157369_107810082 68
618 3300013105 Ga0157369_10857238 Ga0157369_108572382 68
619 3300013105 Ga0157369_11141838 Ga0157369_111418382 68
620 3300013105 Ga0157369_11523978 Ga0157369_115239782 68
621 3300013105 Ga0157369_11650521 Ga0157369_116505212 68
622 3300013105 Ga0157369_11887339 Ga0157369_118873392 68
623 3300013105 Ga0157369_12080536 Ga0157369_120805362 68
624 3300013105 Ga0157369_12553075 Ga0157369_125530752 68
625 3300013296 Ga0157374_10075095 Ga0157374_100750952 68
626 3300013296 Ga0157374_10406267 Ga0157374_104062672 68
627 3300013296 Ga0157374_10920629 Ga0157374_109206292 68
628 3300013297 Ga0157378_10001767 Ga0157378_1000176713 68
629 3300013297 Ga0157378_10175752 Ga0157378_101757522 68
630 3300013297 Ga0157378_10247860 Ga0157378_102478604 68
631 3300013297 Ga0157378_10761982 Ga0157378_107619822 68
632 3300013306 Ga0163162_10120587 Ga0163162_101205874 68
633 3300013306 Ga0163162_10307563 Ga0163162_103075634 68
634 3300013306 Ga0163162_10354401 Ga0163162_103544012 68
635 3300013306 Ga0163162_11161948 Ga0163162_111619482 68
636 3300013306 Ga0163162_11715661 Ga0163162_117156612 68
637 3300013306 Ga0163162_12519021 Ga0163162_125190211 68
638 3300013307 Ga0157372_10052507 Ga0157372_100525072 68
639 3300013307 Ga0157372_10062188 Ga0157372_100621886 68
640 3300013307 Ga0157372_10101800 Ga0157372_101018003 68
641 3300013307 Ga0157372_10144860 Ga0157372_101448602 68
642 3300013307 Ga0157372_10322632 Ga0157372_103226323 68
643 3300013307 Ga0157372_10328105 Ga0157372_103281051 68
644 3300013307 Ga0157372_10474418 Ga0157372_104744183 68
645 3300013307 Ga0157372_10552540 Ga0157372_105525403 68
646 3300013307 Ga0157372_10568960 Ga0157372_105689602 68
647 3300013307 Ga0157372_10745192 Ga0157372_107451922 68
648 3300013307 Ga0157372_11936517 Ga0157372_119365171 68
649 3300013307 Ga0157372_12304218 Ga0157372_123042182 68
650 3300013307 Ga0157372_12454728 Ga0157372_124547282 68
651 3300013307 Ga0157372_12555701 Ga0157372_125557011 68
652 3300013308 Ga0157375_10058173 Ga0157375_100581736 68
653 3300013308 Ga0157375_10344508 Ga0157375_103445082 68
654 3300013308 Ga0157375_10487404 Ga0157375_104874042 68
655 3300013308 Ga0157375_12076720 Ga0157375_120767202 68
656 3300013308 Ga0157375_12184544 Ga0157375_121845442 68
657 3300014325 Ga0163163_10557890 Ga0163163_105578902 68
658 3300014326 Ga0157380_10064584 Ga0157380_100645842 68
659 3300014326 Ga0157380_10149248 Ga0157380_101492482 68
660 3300014745 Ga0157377_10056508 Ga0157377_100565083 68
661 3300014745 Ga0157377_10405324 Ga0157377_104053242 68
662 3300014745 Ga0157377_10816922 Ga0157377_108169222 68
663 3300014968 Ga0157379_10129204 Ga0157379_101292044 68
664 3300014969 Ga0157376_11469670 Ga0157376_114696702 68
665 3300017792 Ga0163161_10030131 Ga0163161_100301316 68
666 3300017792 Ga0163161_10076271 Ga0163161_100762712 68
667 3300020070 Ga0206356_10011518 Ga0206356_100115182 68
668 3300020082 Ga0206353_10269691 Ga0206353_102696911 68
669 3300020082 Ga0206353_10298511 Ga0206353_102985112 68
670 3300020082 Ga0206353_11511563 Ga0206353_115115632 68
671 3300021388 Ga0213875_10003976 Ga0213875_1000397610 68
672 3300025315 Ga0207697_10000033 Ga0207697_1000003342 68
673 3300025315 Ga0207697_10014398 Ga0207697_100143984 68
674 3300025315 Ga0207697_10185492 Ga0207697_101854922 68
675 3300025315 Ga0207697_10432545 Ga0207697_104325452 68
676 3300025321 Ga0207656_10044421 Ga0207656_100444213 68
677 3300025321 Ga0207656_10095796 Ga0207656_100957962 68
678 3300025321 Ga0207656_10135141 Ga0207656_101351412 68
679 3300025321 Ga0207656_10208577 Ga0207656_102085772 68
680 3300025321 Ga0207656_10266460 Ga0207656_102664602 68
681 3300025321 Ga0207656_10343519 Ga0207656_103435192 68
682 3300025893 Ga0207682_10000575 Ga0207682_100005754 68
683 3300025893 Ga0207682_10040195 Ga0207682_100401952 68
684 3300025893 Ga0207682_10290537 Ga0207682_102905372 68
685 3300025899 Ga0207642_10020218 Ga0207642_100202184 68
686 3300025899 Ga0207642_10237516 Ga0207642_102375162 68
687 3300025899 Ga0207642_10263634 Ga0207642_102636342 68
688 3300025899 Ga0207642_10408861 Ga0207642_104088613 68
689 3300025901 Ga0207688_10000292 Ga0207688_1000029215 68
690 3300025901 Ga0207688_10031108 Ga0207688_100311082 68
691 3300025901 Ga0207688_10127052 Ga0207688_101270523 68
692 3300025901 Ga0207688_10307086 Ga0207688_103070862 68
693 3300025903 Ga0207680_10005396 Ga0207680_100053962 68
694 3300025903 Ga0207680_10194997 Ga0207680_101949972 68
695 3300025903 Ga0207680_10341396 Ga0207680_103413962 68
696 3300025903 Ga0207680_11184865 Ga0207680_111848652 68
697 3300025904 Ga0207647_10000843 Ga0207647_1000084315 68
698 3300025904 Ga0207647_10009032 Ga0207647_100090327 68
699 3300025904 Ga0207647_10009075 Ga0207647_1000907510 68
700 3300025904 Ga0207647_10029199 Ga0207647_100291992 68
701 3300025904 Ga0207647_10054571 Ga0207647_100545714 68
702 3300025904 Ga0207647_10087615 Ga0207647_100876152 68
703 3300025904 Ga0207647_10089954 Ga0207647_100899542 68
704 3300025904 Ga0207647_10092125 Ga0207647_100921254 68
705 3300025904 Ga0207647_10110564 Ga0207647_101105642 68
706 3300025904 Ga0207647_10160887 Ga0207647_101608873 68
707 3300025904 Ga0207647_10271821 Ga0207647_102718212 68
708 3300025904 Ga0207647_10274131 Ga0207647_102741312 68
709 3300025904 Ga0207647_10278426 Ga0207647_102784262 68
710 3300025906 Ga0207699_10267710 Ga0207699_102677102 68
711 3300025907 Ga0207645_10004494 Ga0207645_1000449411 68
712 3300025907 Ga0207645_10043782 Ga0207645_100437824 68
713 3300025907 Ga0207645_10228746 Ga0207645_102287462 68
714 3300025907 Ga0207645_10884751 Ga0207645_108847512 68
715 3300025907 Ga0207645_10951513 Ga0207645_109515132 68
716 3300025908 Ga0207643_10088789 Ga0207643_100887893 68
717 3300025908 Ga0207643_10099738 Ga0207643_100997382 68
718 3300025909 Ga0207705_10000003 Ga0207705_1000000360 68
719 3300025909 Ga0207705_10000123 Ga0207705_1000012328 68
720 3300025909 Ga0207705_10003112 Ga0207705_100031123 68
721 3300025909 Ga0207705_10023003 Ga0207705_100230037 68
722 3300025909 Ga0207705_10045814 Ga0207705_100458143 68
723 3300025909 Ga0207705_10051181 Ga0207705_100511815 68
724 3300025909 Ga0207705_10059993 Ga0207705_100599932 68
725 3300025909 Ga0207705_10100688 Ga0207705_101006884 68
726 3300025909 Ga0207705_10103068 Ga0207705_101030682 68
727 3300025909 Ga0207705_10103175 Ga0207705_101031752 68
728 3300025909 Ga0207705_10105238 Ga0207705_101052382 68
729 3300025909 Ga0207705_10128276 Ga0207705_101282762 68
730 3300025909 Ga0207705_10143706 Ga0207705_101437062 68
731 3300025909 Ga0207705_10161920 Ga0207705_101619202 68
732 3300025909 Ga0207705_10366958 Ga0207705_103669583 68
733 3300025909 Ga0207705_10375253 Ga0207705_103752533 68
734 3300025909 Ga0207705_10420009 Ga0207705_104200092 68
735 3300025909 Ga0207705_10500114 Ga0207705_105001142 68
736 3300025909 Ga0207705_10518533 Ga0207705_105185332 68
737 3300025909 Ga0207705_10620608 Ga0207705_106206082 68
738 3300025909 Ga0207705_10713230 Ga0207705_107132302 68
739 3300025909 Ga0207705_11377258 Ga0207705_113772581 68
740 3300025911 Ga0207654_10080823 Ga0207654_100808232 68
741 3300025911 Ga0207654_10135449 Ga0207654_101354494 68
742 3300025912 Ga0207707_10020792 Ga0207707_100207928 68
743 3300025912 Ga0207707_10165812 Ga0207707_101658124 68
744 3300025912 Ga0207707_10174381 Ga0207707_101743813 68
745 3300025912 Ga0207707_10313568 Ga0207707_103135682 68
746 3300025912 Ga0207707_10421980 Ga0207707_104219801 68
747 3300025912 Ga0207707_10467163 Ga0207707_104671632 68
748 3300025912 Ga0207707_10738394 Ga0207707_107383941 68
749 3300025912 Ga0207707_11434592 Ga0207707_114345922 68
750 3300025913 Ga0207695_10018744 Ga0207695_1001874410 68
751 3300025913 Ga0207695_10019756 Ga0207695_100197569 68
752 3300025913 Ga0207695_10056492 Ga0207695_100564923 68
753 3300025913 Ga0207695_10195684 Ga0207695_101956842 68
754 3300025913 Ga0207695_10322810 Ga0207695_103228102 68
755 3300025913 Ga0207695_10331207 Ga0207695_103312072 68
756 3300025914 Ga0207671_10407280 Ga0207671_104072802 68
757 3300025914 Ga0207671_11361407 Ga0207671_113614072 68
758 3300025915 Ga0207693_10006527 Ga0207693_100065279 68
759 3300025917 Ga0207660_10000052 Ga0207660_1000005229 68
760 3300025917 Ga0207660_10003718 Ga0207660_1000371812 68
761 3300025917 Ga0207660_10004906 Ga0207660_1000490611 68
762 3300025917 Ga0207660_10056549 Ga0207660_100565494 68
763 3300025917 Ga0207660_10114244 Ga0207660_101142443 68
764 3300025917 Ga0207660_10143740 Ga0207660_101437402 68
765 3300025917 Ga0207660_10154765 Ga0207660_101547652 68
766 3300025917 Ga0207660_10260533 Ga0207660_102605332 68
767 3300025917 Ga0207660_10731663 Ga0207660_107316632 68
768 3300025918 Ga0207662_10190823 Ga0207662_101908232 68
769 3300025918 Ga0207662_10263760 Ga0207662_102637602 68
770 3300025919 Ga0207657_10000650 Ga0207657_1000065020 68
771 3300025919 Ga0207657_10000737 Ga0207657_1000073716 68
772 3300025919 Ga0207657_10010867 Ga0207657_100108676 68
773 3300025919 Ga0207657_10015919 Ga0207657_100159197 68
774 3300025919 Ga0207657_10021597 Ga0207657_100215973 68
775 3300025919 Ga0207657_10023431 Ga0207657_100234318 68
776 3300025919 Ga0207657_10036095 Ga0207657_100360957 68
777 3300025919 Ga0207657_10048860 Ga0207657_100488605 68
778 3300025919 Ga0207657_10063602 Ga0207657_100636024 68
779 3300025919 Ga0207657_10121776 Ga0207657_101217762 68
780 3300025919 Ga0207657_10188947 Ga0207657_101889472 68
781 3300025919 Ga0207657_10260269 Ga0207657_102602692 68
782 3300025919 Ga0207657_10467583 Ga0207657_104675832 68
783 3300025919 Ga0207657_10499226 Ga0207657_104992262 68
784 3300025919 Ga0207657_10525912 Ga0207657_105259122 68
785 3300025919 Ga0207657_10553418 Ga0207657_105534182 68
786 3300025919 Ga0207657_11206700 Ga0207657_112067002 68
787 3300025920 Ga0207649_10001784 Ga0207649_100017847 68
788 3300025920 Ga0207649_10006365 Ga0207649_100063655 68
789 3300025920 Ga0207649_10011578 Ga0207649_100115782 68
790 3300025920 Ga0207649_10012717 Ga0207649_100127172 68
791 3300025920 Ga0207649_10015696 Ga0207649_100156963 68
792 3300025920 Ga0207649_10034711 Ga0207649_100347112 68
793 3300025920 Ga0207649_10070495 Ga0207649_100704953 68
794 3300025920 Ga0207649_10074022 Ga0207649_100740224 68
795 3300025920 Ga0207649_10124307 Ga0207649_101243071 68
796 3300025920 Ga0207649_10172187 Ga0207649_101721873 68
797 3300025920 Ga0207649_10295594 Ga0207649_102955941 68
798 3300025920 Ga0207649_10390995 Ga0207649_103909953 68
799 3300025920 Ga0207649_10468911 Ga0207649_104689112 68
800 3300025920 Ga0207649_10517557 Ga0207649_105175572 68
801 3300025920 Ga0207649_10674434 Ga0207649_106744342 68
802 3300025920 Ga0207649_10983925 Ga0207649_109839252 68
803 3300025920 Ga0207649_11689175 Ga0207649_116891752 68
804 3300025921 Ga0207652_10000034 Ga0207652_1000003486 68
805 3300025921 Ga0207652_10017239 Ga0207652_100172393 68
806 3300025921 Ga0207652_10110971 Ga0207652_101109713 68
807 3300025921 Ga0207652_10146778 Ga0207652_101467784 68
808 3300025921 Ga0207652_10197200 Ga0207652_101972004 68
809 3300025921 Ga0207652_10339560 Ga0207652_103395603 68
810 3300025921 Ga0207652_10386634 Ga0207652_103866342 68
811 3300025921 Ga0207652_10758607 Ga0207652_107586072 68
812 3300025921 Ga0207652_11227242 Ga0207652_112272422 68
813 3300025921 Ga0207652_11456424 Ga0207652_114564242 68
814 3300025921 Ga0207652_11475586 Ga0207652_114755862 68
815 3300025923 Ga0207681_10000693 Ga0207681_1000069330 68
816 3300025923 Ga0207681_10096542 Ga0207681_100965424 68
817 3300025923 Ga0207681_10117195 Ga0207681_101171952 68
818 3300025923 Ga0207681_10205588 Ga0207681_102055882 68
819 3300025923 Ga0207681_10328899 Ga0207681_103288992 68
820 3300025923 Ga0207681_11553352 Ga0207681_115533522 68
821 3300025924 Ga0207694_10045276 Ga0207694_100452765 68
822 3300025924 Ga0207694_10069953 Ga0207694_100699532 68
823 3300025924 Ga0207694_10077885 Ga0207694_100778852 68
824 3300025924 Ga0207694_10102002 Ga0207694_101020022 68
825 3300025924 Ga0207694_10231938 Ga0207694_102319382 68
826 3300025924 Ga0207694_10248661 Ga0207694_102486611 68
827 3300025925 Ga0207650_10007652 Ga0207650_100076521 68
828 3300025925 Ga0207650_10015288 Ga0207650_100152884 68
829 3300025925 Ga0207650_10086473 Ga0207650_100864732 68
830 3300025925 Ga0207650_10096781 Ga0207650_100967814 68
831 3300025925 Ga0207650_10214435 Ga0207650_102144352 68
832 3300025925 Ga0207650_10246335 Ga0207650_102463352 68
833 3300025925 Ga0207650_10267193 Ga0207650_102671932 68
834 3300025925 Ga0207650_10871499 Ga0207650_108714992 68
835 3300025926 Ga0207659_10004364 Ga0207659_100043648 68
836 3300025926 Ga0207659_10018156 Ga0207659_100181565 68
837 3300025926 Ga0207659_10030264 Ga0207659_100302642 68
838 3300025926 Ga0207659_10040014 Ga0207659_100400143 68
839 3300025926 Ga0207659_10045616 Ga0207659_100456164 68
840 3300025926 Ga0207659_10159329 Ga0207659_101593292 68
841 3300025927 Ga0207687_10002290 Ga0207687_1000229014 68
842 3300025927 Ga0207687_10018919 Ga0207687_100189194 68
843 3300025928 Ga0207700_11953438 Ga0207700_119534382 68
844 3300025929 Ga0207664_10145875 Ga0207664_101458754 68
845 3300025929 Ga0207664_10176010 Ga0207664_101760102 68
846 3300025929 Ga0207664_10230215 Ga0207664_102302152 68
847 3300025929 Ga0207664_10230415 Ga0207664_102304152 68
848 3300025929 Ga0207664_10476919 Ga0207664_104769192 68
849 3300025931 Ga0207644_10017928 Ga0207644_100179282 68
850 3300025931 Ga0207644_10036809 Ga0207644_100368093 68
851 3300025931 Ga0207644_10058859 Ga0207644_100588594 68
852 3300025931 Ga0207644_10125093 Ga0207644_101250934 68
853 3300025931 Ga0207644_10554971 Ga0207644_105549712 68
854 3300025932 Ga0207690_10000402 Ga0207690_1000040226 68
855 3300025932 Ga0207690_10011654 Ga0207690_100116547 68
856 3300025932 Ga0207690_10012929 Ga0207690_100129293 68
857 3300025932 Ga0207690_10019112 Ga0207690_100191124 68
858 3300025932 Ga0207690_10066676 Ga0207690_100666762 68
859 3300025932 Ga0207690_10073038 Ga0207690_100730382 68
860 3300025932 Ga0207690_10143075 Ga0207690_101430752 68
861 3300025932 Ga0207690_10478430 Ga0207690_104784302 68
862 3300025932 Ga0207690_10525871 Ga0207690_105258712 68
863 3300025932 Ga0207690_10612079 Ga0207690_106120792 68
864 3300025932 Ga0207690_10756612 Ga0207690_107566121 68
865 3300025932 Ga0207690_11612052 Ga0207690_116120522 68
866 3300025933 Ga0207706_10000020 Ga0207706_1000002033 68
867 3300025933 Ga0207706_10003262 Ga0207706_1000326215 68
868 3300025933 Ga0207706_10004173 Ga0207706_100041737 68
869 3300025933 Ga0207706_10005171 Ga0207706_1000517114 68
870 3300025933 Ga0207706_10006593 Ga0207706_1000659310 68
871 3300025933 Ga0207706_10019845 Ga0207706_100198454 68
872 3300025933 Ga0207706_10035503 Ga0207706_100355032 68
873 3300025933 Ga0207706_10040853 Ga0207706_100408534 68
874 3300025933 Ga0207706_10047951 Ga0207706_100479517 68
875 3300025933 Ga0207706_10065947 Ga0207706_100659474 68
876 3300025933 Ga0207706_10077672 Ga0207706_100776723 68
877 3300025933 Ga0207706_10216315 Ga0207706_102163153 68
878 3300025935 Ga0207709_10080339 Ga0207709_100803394 68
879 3300025936 Ga0207670_10454597 Ga0207670_104545972 68
880 3300025937 Ga0207669_10010218 Ga0207669_100102182 68
881 3300025937 Ga0207669_10040544 Ga0207669_100405443 68
882 3300025937 Ga0207669_10139706 Ga0207669_101397062 68
883 3300025937 Ga0207669_10237695 Ga0207669_102376952 68
884 3300025937 Ga0207669_11563119 Ga0207669_115631192 68
885 3300025938 Ga0207704_10021933 Ga0207704_100219332 68
886 3300025938 Ga0207704_10033801 Ga0207704_100338012 68
887 3300025938 Ga0207704_10091814 Ga0207704_100918143 68
888 3300025938 Ga0207704_10617810 Ga0207704_106178102 68
889 3300025938 Ga0207704_11725713 Ga0207704_117257131 68
890 3300025939 Ga0207665_10021532 Ga0207665_100215326 68
891 3300025940 Ga0207691_10000047 Ga0207691_1000004746 68
892 3300025940 Ga0207691_10000965 Ga0207691_1000096531 68
893 3300025940 Ga0207691_10007401 Ga0207691_1000740113 68
894 3300025940 Ga0207691_10050490 Ga0207691_100504906 68
895 3300025940 Ga0207691_10121692 Ga0207691_101216924 68
896 3300025940 Ga0207691_10315452 Ga0207691_103154522 68
897 3300025940 Ga0207691_10748873 Ga0207691_107488732 68
898 3300025941 Ga0207711_10004299 Ga0207711_1000429913 68
899 3300025941 Ga0207711_10009547 Ga0207711_100095473 68
900 3300025941 Ga0207711_10024125 Ga0207711_100241255 68
901 3300025941 Ga0207711_10058616 Ga0207711_100586164 68
902 3300025941 Ga0207711_10089717 Ga0207711_100897172 68
903 3300025941 Ga0207711_10533751 Ga0207711_105337512 68
904 3300025941 Ga0207711_10615309 Ga0207711_106153092 68
905 3300025941 Ga0207711_11524579 Ga0207711_115245792 68
906 3300025941 Ga0207711_11813059 Ga0207711_118130592 68
907 3300025942 Ga0207689_10000002 Ga0207689_1000000246 68
908 3300025942 Ga0207689_10266223 Ga0207689_102662232 68
909 3300025942 Ga0207689_10640332 Ga0207689_106403322 68
910 3300025942 Ga0207689_10829421 Ga0207689_108294212 68
911 3300025942 Ga0207689_11170274 Ga0207689_111702742 68
912 3300025942 Ga0207689_11309656 Ga0207689_113096562 68
913 3300025944 Ga0207661_10056868 Ga0207661_100568684 68
914 3300025944 Ga0207661_10127539 Ga0207661_101275393 68
915 3300025944 Ga0207661_10287861 Ga0207661_102878612 68
916 3300025944 Ga0207661_10354801 Ga0207661_103548012 68
917 3300025944 Ga0207661_10598913 Ga0207661_105989131 68
918 3300025944 Ga0207661_10763771 Ga0207661_107637712 68
919 3300025944 Ga0207661_10859131 Ga0207661_108591312 68
920 3300025944 Ga0207661_11622786 Ga0207661_116227862 68
921 3300025945 Ga0207679_10007873 Ga0207679_100078733 68
922 3300025945 Ga0207679_10037931 Ga0207679_100379313 68
923 3300025945 Ga0207679_10039475 Ga0207679_100394752 68
924 3300025945 Ga0207679_10059816 Ga0207679_100598165 68
925 3300025945 Ga0207679_10179243 Ga0207679_101792432 68
926 3300025945 Ga0207679_10395067 Ga0207679_103950673 68
927 3300025945 Ga0207679_10757377 Ga0207679_107573772 68
928 3300025945 Ga0207679_11207700 Ga0207679_112077002 68
929 3300025945 Ga0207679_11930932 Ga0207679_119309322 68
930 3300025949 Ga0207667_10007119 Ga0207667_100071193 68
931 3300025949 Ga0207667_10036894 Ga0207667_100368943 68
932 3300025949 Ga0207667_10059513 Ga0207667_100595132 68
933 3300025949 Ga0207667_10133092 Ga0207667_101330922 68
934 3300025949 Ga0207667_10150781 Ga0207667_101507812 68
935 3300025949 Ga0207667_10160072 Ga0207667_101600722 68
936 3300025949 Ga0207667_10207978 Ga0207667_102079782 68
937 3300025949 Ga0207667_10255147 Ga0207667_102551473 68
938 3300025949 Ga0207667_10309922 Ga0207667_103099223 68
939 3300025949 Ga0207667_10522891 Ga0207667_105228912 68
940 3300025949 Ga0207667_10574209 Ga0207667_105742091 68
941 3300025949 Ga0207667_10632866 Ga0207667_106328662 68
942 3300025960 Ga0207651_10000445 Ga0207651_1000044517 68
943 3300025960 Ga0207651_10019452 Ga0207651_100194522 68
944 3300025960 Ga0207651_10090358 Ga0207651_100903582 68
945 3300025960 Ga0207651_10416778 Ga0207651_104167782 68
946 3300025960 Ga0207651_10597363 Ga0207651_105973632 68
947 3300025961 Ga0207712_10037848 Ga0207712_100378484 68
948 3300025972 Ga0207668_10070640 Ga0207668_100706402 68
949 3300025972 Ga0207668_10092459 Ga0207668_100924592 68
950 3300025972 Ga0207668_11450801 Ga0207668_114508012 68
951 3300025972 Ga0207668_11592117 Ga0207668_115921172 68
952 3300025972 Ga0207668_11806805 Ga0207668_118068052 68
953 3300025981 Ga0207640_10005047 Ga0207640_100050477 68
954 3300025981 Ga0207640_10020329 Ga0207640_100203294 68
955 3300025981 Ga0207640_10054024 Ga0207640_100540243 68
956 3300025981 Ga0207640_10134820 Ga0207640_101348204 68
957 3300025981 Ga0207640_10163431 Ga0207640_101634312 68
958 3300025981 Ga0207640_10175525 Ga0207640_101755252 68
959 3300025981 Ga0207640_10195826 Ga0207640_101958262 68
960 3300025981 Ga0207640_10489324 Ga0207640_104893242 68
961 3300025981 Ga0207640_11014866 Ga0207640_110148662 68
962 3300025981 Ga0207640_11369056 Ga0207640_113690562 68
963 3300025981 Ga0207640_11770060 Ga0207640_117700601 68
964 3300025986 Ga0207658_10002153 Ga0207658_100021533 68
965 3300025986 Ga0207658_10017290 Ga0207658_100172902 68
966 3300025986 Ga0207658_10056442 Ga0207658_100564423 68
967 3300025986 Ga0207658_10057665 Ga0207658_100576653 68
968 3300025986 Ga0207658_10110800 Ga0207658_101108002 68
969 3300025986 Ga0207658_10245601 Ga0207658_102456012 68
970 3300025986 Ga0207658_10537699 Ga0207658_105376993 68
971 3300026023 Ga0207677_10005621 Ga0207677_100056215 68
972 3300026023 Ga0207677_10027302 Ga0207677_100273024 68
973 3300026023 Ga0207677_11230725 Ga0207677_112307251 68
974 3300026023 Ga0207677_11403487 Ga0207677_114034872 68
975 3300026023 Ga0207677_11497746 Ga0207677_114977462 68
976 3300026023 Ga0207677_12142454 Ga0207677_121424542 68
977 3300026035 Ga0207703_10001138 Ga0207703_1000113817 68
978 3300026035 Ga0207703_10022187 Ga0207703_100221874 68
979 3300026035 Ga0207703_10549067 Ga0207703_105490673 68
980 3300026041 Ga0207639_10001353 Ga0207639_100013537 68
981 3300026041 Ga0207639_10017111 Ga0207639_100171118 68
982 3300026041 Ga0207639_10052213 Ga0207639_100522133 68
983 3300026041 Ga0207639_10090932 Ga0207639_100909323 68
984 3300026041 Ga0207639_10146302 Ga0207639_101463022 68
985 3300026041 Ga0207639_10165382 Ga0207639_101653822 68
986 3300026041 Ga0207639_10246791 Ga0207639_102467912 68
987 3300026041 Ga0207639_10334140 Ga0207639_103341402 68
988 3300026041 Ga0207639_10615287 Ga0207639_106152872 68
989 3300026041 Ga0207639_11633023 Ga0207639_116330232 68
990 3300026041 Ga0207639_11762236 Ga0207639_117622362 68
991 3300026041 Ga0207639_11912090 Ga0207639_119120902 68
992 3300026067 Ga0207678_10006540 Ga0207678_100065406 68
993 3300026067 Ga0207678_10015579 Ga0207678_100155793 68
994 3300026067 Ga0207678_10018913 Ga0207678_100189133 68
995 3300026067 Ga0207678_10025008 Ga0207678_100250086 68
996 3300026067 Ga0207678_10043209 Ga0207678_100432096 68
997 3300026067 Ga0207678_10065020 Ga0207678_100650202 68
998 3300026067 Ga0207678_10076845 Ga0207678_100768455 68
999 3300026067 Ga0207678_10110051 Ga0207678_101100513 68
1000 3300026067 Ga0207678_10121721 Ga0207678_101217212 68
1001 3300026067 Ga0207678_10207561 Ga0207678_102075613 68
1002 3300026067 Ga0207678_10208293 Ga0207678_102082932 68
1003 3300026067 Ga0207678_10228961 Ga0207678_102289612 68
1004 3300026067 Ga0207678_10515292 Ga0207678_105152921 68
1005 3300026067 Ga0207678_11133765 Ga0207678_111337652 68
1006 3300026067 Ga0207678_11560445 Ga0207678_115604452 68
1007 3300026067 Ga0207678_11797961 Ga0207678_117979612 68
1008 3300026067 Ga0207678_11897897 Ga0207678_118978972 68
1009 3300026078 Ga0207702_10018250 Ga0207702_100182508 68
1010 3300026078 Ga0207702_10022150 Ga0207702_100221502 68
1011 3300026078 Ga0207702_10059466 Ga0207702_100594663 68
1012 3300026078 Ga0207702_10094209 Ga0207702_100942092 68
1013 3300026078 Ga0207702_10100608 Ga0207702_101006084 68
1014 3300026078 Ga0207702_10115283 Ga0207702_101152832 68
1015 3300026078 Ga0207702_10364673 Ga0207702_103646732 68
1016 3300026078 Ga0207702_10420486 Ga0207702_104204863 68
1017 3300026078 Ga0207702_10606993 Ga0207702_106069932 68
1018 3300026078 Ga0207702_11026899 Ga0207702_110268992 68
1019 3300026078 Ga0207702_11775955 Ga0207702_117759552 68
1020 3300026078 Ga0207702_11781218 Ga0207702_117812182 68
1021 3300026078 Ga0207702_11999711 Ga0207702_119997112 68
1022 3300026088 Ga0207641_10029908 Ga0207641_100299082 68
1023 3300026088 Ga0207641_10035960 Ga0207641_100359607 68
1024 3300026088 Ga0207641_10038273 Ga0207641_100382734 68
1025 3300026088 Ga0207641_10038977 Ga0207641_100389772 68
1026 3300026089 Ga0207648_10001030 Ga0207648_1000103020 68
1027 3300026089 Ga0207648_10008589 Ga0207648_100085892 68
1028 3300026089 Ga0207648_10017417 Ga0207648_100174177 68
1029 3300026089 Ga0207648_10306920 Ga0207648_103069202 68
1030 3300026089 Ga0207648_11858697 Ga0207648_118586971 68
1031 3300026095 Ga0207676_10002452 Ga0207676_1000245214 68
1032 3300026095 Ga0207676_10020947 Ga0207676_100209475 68
1033 3300026095 Ga0207676_10103568 Ga0207676_101035684 68
1034 3300026095 Ga0207676_10201084 Ga0207676_102010842 68
1035 3300026095 Ga0207676_11153597 Ga0207676_111535972 68
1036 3300026095 Ga0207676_11407193 Ga0207676_114071932 68
1037 3300026116 Ga0207674_10000881 Ga0207674_1000088134 68
1038 3300026116 Ga0207674_10003695 Ga0207674_1000369515 68
1039 3300026116 Ga0207674_10003858 Ga0207674_1000385820 68
1040 3300026116 Ga0207674_10009133 Ga0207674_100091333 68
1041 3300026116 Ga0207674_10024503 Ga0207674_100245033 68
1042 3300026116 Ga0207674_10025828 Ga0207674_100258287 68
1043 3300026116 Ga0207674_10076856 Ga0207674_100768565 68
1044 3300026116 Ga0207674_10087743 Ga0207674_100877435 68
1045 3300026116 Ga0207674_10609263 Ga0207674_106092632 68
1046 3300026118 Ga0207675_100076555 Ga0207675_1000765552 68
1047 3300026118 Ga0207675_100090656 Ga0207675_1000906564 68
1048 3300026118 Ga0207675_100151741 Ga0207675_1001517412 68
1049 3300026118 Ga0207675_100183861 Ga0207675_1001838613 68
1050 3300026118 Ga0207675_100587450 Ga0207675_1005874502 68
1051 3300026121 Ga0207683_10025482 Ga0207683_100254827 68
1052 3300026121 Ga0207683_10047168 Ga0207683_100471685 68
1053 3300026121 Ga0207683_10070129 Ga0207683_100701293 68
1054 3300026121 Ga0207683_10147378 Ga0207683_101473782 68
1055 3300026121 Ga0207683_10172218 Ga0207683_101722183 68
1056 3300026121 Ga0207683_10200667 Ga0207683_102006672 68
1057 3300026121 Ga0207683_10479691 Ga0207683_104796913 68
1058 3300026121 Ga0207683_10710280 Ga0207683_107102802 68
1059 3300026121 Ga0207683_11406516 Ga0207683_114065162 68
1060 3300026121 Ga0207683_11957699 Ga0207683_119576992 68
1061 3300026142 Ga0207698_10000833 Ga0207698_100008339 68
1062 3300026142 Ga0207698_10012259 Ga0207698_100122595 68
1063 3300026142 Ga0207698_10027421 Ga0207698_100274212 68
1064 3300026142 Ga0207698_10037677 Ga0207698_100376772 68
1065 3300026142 Ga0207698_10052935 Ga0207698_100529352 68
1066 3300026142 Ga0207698_10098688 Ga0207698_100986882 68
1067 3300026142 Ga0207698_10122962 Ga0207698_101229622 68
1068 3300026142 Ga0207698_10129172 Ga0207698_101291722 68
1069 3300026142 Ga0207698_10157462 Ga0207698_101574622 68
1070 3300026142 Ga0207698_10198863 Ga0207698_101988632 68
1071 3300026142 Ga0207698_10204929 Ga0207698_102049293 68
1072 3300026142 Ga0207698_10257494 Ga0207698_102574943 68
1073 3300026142 Ga0207698_10827717 Ga0207698_108277172 68
1074 3300026142 Ga0207698_10898072 Ga0207698_108980722 68
1075 3300026142 Ga0207698_10999026 Ga0207698_109990262 68
1076 3300026142 Ga0207698_11126819 Ga0207698_111268192 68
1077 3300026142 Ga0207698_11367799 Ga0207698_113677992 68
1078 3300026142 Ga0207698_11629675 Ga0207698_116296752 68
1079 3300027312 Ga0209371_1093876 Ga0209371_10938762 68
1080 3300028379 Ga0268266_10077396 Ga0268266_100773964 68
1081 3300028379 Ga0268266_10171699 Ga0268266_101716992 68
1082 3300028379 Ga0268266_11502150 Ga0268266_115021502 68
1083 3300028380 Ga0268265_10011171 Ga0268265_100111714 68
1084 3300028380 Ga0268265_10017415 Ga0268265_100174153 68
1085 3300028380 Ga0268265_10039949 Ga0268265_100399492 68
1086 3300028380 Ga0268265_10082933 Ga0268265_100829332 68
1087 3300028380 Ga0268265_11972104 Ga0268265_119721042 68
1088 3300028380 Ga0268265_12247413 Ga0268265_122474132 68
1089 3300028381 Ga0268264_10005212 Ga0268264_100052122 68
1090 3300028381 Ga0268264_10015885 Ga0268264_100158854 68
1091 3300028381 Ga0268264_10098845 Ga0268264_100988453 68
1092 3300028381 Ga0268264_10121527 Ga0268264_101215274 68
1093 3300028381 Ga0268264_11130262 Ga0268264_111302622 68
1094 3300028794 Ga0307515_10140586 Ga0307515_101405864 68
1095 3300028794 Ga0307515_10312331 Ga0307515_103123313 68
1096 3300030500 Ga0268256_1083929 Ga0268256_10839292 68
1097 3300031548 Ga0307408_100013973 Ga0307408_1000139733 68
1098 3300031548 Ga0307408_100324725 Ga0307408_1003247252 68
1099 3300031548 Ga0307408_100875038 Ga0307408_1008750382 68
1100 3300031548 Ga0307408_101199459 Ga0307408_1011994592 68
1101 3300031731 Ga0307405_10016561 Ga0307405_100165613 68
1102 3300031731 Ga0307405_10148264 Ga0307405_101482644 68
1103 3300031824 Ga0307413_10002065 Ga0307413_100020658 68
1104 3300031824 Ga0307413_10024423 Ga0307413_100244233 68
1105 3300031824 Ga0307413_10102172 Ga0307413_101021722 68
1106 3300031824 Ga0307413_11089268 Ga0307413_110892681 68
1107 3300031824 Ga0307413_11732783 Ga0307413_117327832 68
1108 3300031852 Ga0307410_10000580 Ga0307410_1000058014 68
1109 3300031852 Ga0307410_10002208 Ga0307410_1000220812 68
1110 3300031852 Ga0307410_10034043 Ga0307410_100340433 68
1111 3300031852 Ga0307410_10143394 Ga0307410_101433942 68
1112 3300031852 Ga0307410_10154655 Ga0307410_101546553 68
1113 3300031852 Ga0307410_10765496 Ga0307410_107654962 68
1114 3300031852 Ga0307410_11925874 Ga0307410_119258742 68
1115 3300031901 Ga0307406_10056629 Ga0307406_100566293 68
1116 3300031901 Ga0307406_10135147 Ga0307406_101351472 68
1117 3300031901 Ga0307406_10383679 Ga0307406_103836792 68
1118 3300031901 Ga0307406_10879751 Ga0307406_108797512 68
1119 3300031901 Ga0307406_11482701 Ga0307406_114827012 68
1120 3300031903 Ga0307407_10034308 Ga0307407_100343082 68
1121 3300031903 Ga0307407_10036229 Ga0307407_100362292 68
1122 3300031903 Ga0307407_10161882 Ga0307407_101618823 68
1123 3300031903 Ga0307407_10225264 Ga0307407_102252642 68
1124 3300031911 Ga0307412_10010321 Ga0307412_100103218 68
1125 3300031911 Ga0307412_10025110 Ga0307412_100251103 68
1126 3300031911 Ga0307412_10038238 Ga0307412_100382383 68
1127 3300031911 Ga0307412_10287486 Ga0307412_102874862 68
1128 3300031995 Ga0307409_100006675 Ga0307409_1000066756 68
1129 3300031995 Ga0307409_100024957 Ga0307409_1000249572 68
1130 3300031995 Ga0307409_100038094 Ga0307409_1000380942 68
1131 3300031995 Ga0307409_100043042 Ga0307409_1000430422 68
1132 3300031995 Ga0307409_100571644 Ga0307409_1005716442 68
1133 3300031995 Ga0307409_100677867 Ga0307409_1006778672 68
1134 3300032002 Ga0307416_100016562 Ga0307416_1000165624 68
1135 3300032002 Ga0307416_100073987 Ga0307416_1000739872 68
1136 3300032002 Ga0307416_100106830 Ga0307416_1001068303 68
1137 3300032002 Ga0307416_100117962 Ga0307416_1001179622 68
1138 3300032002 Ga0307416_100257309 Ga0307416_1002573093 68
1139 3300032002 Ga0307416_102253554 Ga0307416_1022535542 68
1140 3300032002 Ga0307416_102593870 Ga0307416_1025938702 68
1141 3300032004 Ga0307414_10011823 Ga0307414_100118235 68
1142 3300032004 Ga0307414_10023874 Ga0307414_100238745 68
1143 3300032004 Ga0307414_10039342 Ga0307414_100393423 68
1144 3300032004 Ga0307414_10053155 Ga0307414_100531553 68
1145 3300032004 Ga0307414_10226292 Ga0307414_102262922 68
1146 3300032004 Ga0307414_10337975 Ga0307414_103379752 68
1147 3300032004 Ga0307414_11366985 Ga0307414_113669852 68
1148 3300032004 Ga0307414_11961619 Ga0307414_119616192 68
1149 3300032005 Ga0307411_10000482 Ga0307411_1000048215 68
1150 3300032005 Ga0307411_10001715 Ga0307411_100017159 68
1151 3300032005 Ga0307411_10007015 Ga0307411_100070156 68
1152 3300032005 Ga0307411_10015233 Ga0307411_100152333 68
1153 3300032005 Ga0307411_10077491 Ga0307411_100774912 68
1154 3300032005 Ga0307411_11075664 Ga0307411_110756642 68
1155 3300032005 Ga0307411_11697157 Ga0307411_116971572 68
1156 3300032126 Ga0307415_100001134 Ga0307415_10000113415 68
1157 3300032126 Ga0307415_100004978 Ga0307415_1000049789 68
1158 3300032126 Ga0307415_100032435 Ga0307415_1000324354 68
1159 3300032126 Ga0307415_101401858 Ga0307415_1014018582 68
1160 3300032126 Ga0307415_101641355 Ga0307415_1016413552 68
1161 3300032126 Ga0307415_101867823 Ga0307415_1018678232 68
1162 3300035089 Ga0373944_0134228 Ga0373944_0134228_420_647 68
1163 3300035112 Ga0373932_0072569 Ga0373932_0072569_538_744 68
1164 3300035116 Ga0373945_0134531 Ga0373945_0134531_462_713 68
1165 3300035120 Ga0373957_0371018 Ga0373957_0371018_189_395 68
1166 3300035170 Ga0373943_0016633 Ga0373943_0016633_1898_2104 68
1167 3300035170 Ga0373943_0308219 Ga0373943_0308219_525_731 68
1168 3300035171 Ga0373946_0789629 Ga0373946_0789629_40_267 68
1169 3300035207 Ga0373942_0071322 Ga0373942_0071322_740_946 68
1170 3300035242 Ga0373962_0134947 Ga0373962_0134947_267_473 68
1171 3300035691 Ga0373931_0117483 Ga0373931_0117483_792_998 68
1172 3300035692 Ga0373935_0018990 Ga0373935_0018990_1267_1518 68
1173 3300035692 Ga0373935_0026138 Ga0373935_0026138_1740_1946 68
1174 3300035692 Ga0373935_0068973 Ga0373935_0068973_1009_1236 68
1175 3300035695 Ga0373927_0017611 Ga0373927_0017611_2234_2485 68
1176 3300035724 Ga0373933_1097538 Ga0373933_1097538_97_303 68
1177 3300035725 Ga0373947_0011601 Ga0373947_0011601_2692_2943 68
1178 3300035725 Ga0373947_0126153 Ga0373947_0126153_593_799 68
1179 3300037068 Ga0373925_0191628 Ga0373925_0191628_143_394 68
1180 3300037068 Ga0373925_0402698 Ga0373925_0402698_614_820 68
1181 3300037068 Ga0373925_1772837 Ga0373925_1772837_31_258 68
1182 3300037312 Ga0395899_0001745 Ga0395899_0001745_17717_17923 68
1183 3300037312 Ga0395899_0009558 Ga0395899_0009558_4559_4765 68
1184 3300037312 Ga0395899_0042541 Ga0395899_0042541_128_334 68
1185 3300037312 Ga0395899_0063041 Ga0395899_0063041_655_861 68
1186 3300037312 Ga0395899_0130854 Ga0395899_0130854_868_1074 68
1187 3300037312 Ga0395899_0196785 Ga0395899_0196785_981_1187 68
1188 3300037312 Ga0395899_0257759 Ga0395899_0257759_810_1016 68
1189 3300037312 Ga0395899_0367681 Ga0395899_0367681_581_787 68
1190 3300037312 Ga0395899_0492470 Ga0395899_0492470_298_504 68
1191 3300037312 Ga0395899_0660639 Ga0395899_0660639_228_434 68
1192 3300037418 Ga0395900_0012634 Ga0395900_0012634_3195_3401 68
1193 3300037418 Ga0395900_0019379 Ga0395900_0019379_3252_3458 68
1194 3300037418 Ga0395900_0020642 Ga0395900_0020642_1933_2139 68
1195 3300037418 Ga0395900_0027008 Ga0395900_0027008_1176_1382 68
1196 3300037418 Ga0395900_0046034 Ga0395900_0046034_928_1134 68
1197 3300037418 Ga0395900_0068019 Ga0395900_0068019_1954_2160 68
1198 3300037418 Ga0395900_0099185 Ga0395900_0099185_1575_1781 68
1199 3300037418 Ga0395900_0225531 Ga0395900_0225531_1442_1648 68
1200 3300037418 Ga0395900_0255127 Ga0395900_0255127_41_247 68
1201 3300037418 Ga0395900_0280515 Ga0395900_0280515_703_912 68
1202 3300037418 Ga0395900_0312396 Ga0395900_0312396_221_427 68
1203 3300037418 Ga0395900_0360817 Ga0395900_0360817_1160_1366 68
1204 3300037418 Ga0395900_0368505 Ga0395900_0368505_676_882 68
1205 3300037418 Ga0395900_0496319 Ga0395900_0496319_267_473 68
1206 3300037418 Ga0395900_0610455 Ga0395900_0610455_729_935 68
1207 3300037418 Ga0395900_0796822 Ga0395900_0796822_21_227 68
1208 3300037418 Ga0395900_0868959 Ga0395900_0868959_441_647 68
1209 3300037418 Ga0395900_0966330 Ga0395900_0966330_439_645 68
1210 3300037418 Ga0395900_0972796 Ga0395900_0972796_325_531 68
1211 3300037418 Ga0395900_0993656 Ga0395900_0993656_423_629 68
1212 3300037418 Ga0395900_1286540 Ga0395900_1286540_59_265 68
1213 3300037418 Ga0395900_1301148 Ga0395900_1301148_312_518 68
1214 3300037418 Ga0395900_1717124 Ga0395900_1717124_105_311 68
1215 3300037418 Ga0395900_1902304 Ga0395900_1902304_178_384 68
1216 3300037466 Ga0395898_0039260 Ga0395898_0039260_2906_3112 68
1217 3300037466 Ga0395898_0061721 Ga0395898_0061721_2342_2548 68
1218 3300037466 Ga0395898_0061937 Ga0395898_0061937_1272_1478 68
1219 3300037466 Ga0395898_0096170 Ga0395898_0096170_2147_2353 68
1220 3300037466 Ga0395898_0110545 Ga0395898_0110545_1822_2028 68
1221 3300037466 Ga0395898_0117940 Ga0395898_0117940_180_386 68
1222 3300037466 Ga0395898_0300800 Ga0395898_0300800_535_741 68
1223 3300037466 Ga0395898_0452083 Ga0395898_0452083_168_374 68
1224 3300037466 Ga0395898_0667705 Ga0395898_0667705_555_761 68
1225 3300037471 Ga0395905_0016433 Ga0395905_0016433_2720_2926 68
1226 3300037471 Ga0395905_0019802 Ga0395905_0019802_2701_2907 68
1227 3300037471 Ga0395905_0026664 Ga0395905_0026664_4189_4395 68
1228 3300037471 Ga0395905_0049125 Ga0395905_0049125_149_355 68
1229 3300037471 Ga0395905_0051022 Ga0395905_0051022_1525_1731 68
1230 3300037471 Ga0395905_0051704 Ga0395905_0051704_3481_3687 68
1231 3300037471 Ga0395905_0059745 Ga0395905_0059745_1530_1736 68
1232 3300037471 Ga0395905_0103166 Ga0395905_0103166_1229_1435 68
1233 3300037471 Ga0395905_0129480 Ga0395905_0129480_1231_1437 68
1234 3300037471 Ga0395905_0144055 Ga0395905_0144055_1822_2031 68
1235 3300037471 Ga0395905_0213687 Ga0395905_0213687_1359_1565 68
1236 3300037471 Ga0395905_0220794 Ga0395905_0220794_851_1057 68
1237 3300037471 Ga0395905_0237534 Ga0395905_0237534_490_696 68
1238 3300037471 Ga0395905_0348032 Ga0395905_0348032_775_981 68
1239 3300037471 Ga0395905_0353964 Ga0395905_0353964_926_1132 68
1240 3300037471 Ga0395905_0477055 Ga0395905_0477055_750_956 68
1241 3300037471 Ga0395905_0489164 Ga0395905_0489164_55_261 68
1242 3300037471 Ga0395905_0598449 Ga0395905_0598449_622_828 68
1243 3300037471 Ga0395905_0621161 Ga0395905_0621161_208_414 68
1244 3300037471 Ga0395905_0674005 Ga0395905_0674005_719_925 68
1245 3300037471 Ga0395905_0712316 Ga0395905_0712316_247_453 68
1246 3300037471 Ga0395905_0806486 Ga0395905_0806486_488_694 68
1247 3300037471 Ga0395905_0824629 Ga0395905_0824629_437_643 68
1248 3300037471 Ga0395905_1334890 Ga0395905_1334890_95_301 68
1249 3300037471 Ga0395905_1728328 Ga0395905_1728328_20_229 68
1250 3300037853 Ga0436364_1351497 Ga0436364_1351497_23710_23916 68
1251 3300038443 Ga0395901_0000375 Ga0395901_0000375_8307_8513 68
1252 3300038443 Ga0395901_0017695 Ga0395901_0017695_719_925 68
1253 3300038443 Ga0395901_0022105 Ga0395901_0022105_4413_4619 68
1254 3300038443 Ga0395901_0036955 Ga0395901_0036955_113_319 68
1255 3300038443 Ga0395901_0055408 Ga0395901_0055408_2343_2549 68
1256 3300038443 Ga0395901_0076377 Ga0395901_0076377_981_1187 68
1257 3300038443 Ga0395901_0112392 Ga0395901_0112392_1434_1640 68
1258 3300038443 Ga0395901_0268024 Ga0395901_0268024_730_936 68
1259 3300038443 Ga0395901_0385748 Ga0395901_0385748_713_919 68
1260 3300038443 Ga0395901_0388812 Ga0395901_0388812_222_428 68
1261 3300038443 Ga0395901_0409918 Ga0395901_0409918_15_221 68
1262 3300038443 Ga0395901_0782891 Ga0395901_0782891_46_252 68
1263 3300038443 Ga0395901_1323482 Ga0395901_1323482_201_407 68
1264 3300038443 Ga0395901_1431553 Ga0395901_1431553_176_385 68
1265 3300038443 Ga0395901_1628543 Ga0395901_1628543_161_367 68
1266 3300039450 Ga0436363_1013070 Ga0436363_1013070_200_406 68
1267 3300041413 Ga0439465_0091778 Ga0439465_0091778_82_288 68
1268 3300041512 Ga0451853_0383103 Ga0451853_0383103_379_585 68
1269 3300042007 Ga0439449_0027027 Ga0439449_0027027_519_725 68
1270 3300044656 Ga0466969_0013700 Ga0466969_0013700_2584_2790 68
1271 3300044656 Ga0466969_0590723 Ga0466969_0590723_90_296 68
1272 3300044658 Ga0466972_0020043 Ga0466972_0020043_918_1124 68
1273 3300044658 Ga0466972_0477893 Ga0466972_0477893_158_364 68
1274 3300044658 Ga0466972_0515566 Ga0466972_0515566_185_391 68
1275 3300044683 Ga0466965_0199342 Ga0466965_0199342_34_240 68
1276 3300044683 Ga0466965_0268301 Ga0466965_0268301_448_654 68
1277 3300044683 Ga0466965_0895379 Ga0466965_0895379_79_285 68
1278 3300044684 Ga0466966_0010189 Ga0466966_0010189_1052_1258 68
1279 3300044684 Ga0466966_0351396 Ga0466966_0351396_400_606 68
1280 3300044684 Ga0466966_0398877 Ga0466966_0398877_608_814 68
1281 3300044684 Ga0466966_0620870 Ga0466966_0620870_155_361 68
1282 3300044693 Ga0466961_0014580 Ga0466961_0014580_3404_3610 68
1283 3300044693 Ga0466961_0117941 Ga0466961_0117941_222_428 68
1284 3300044693 Ga0466961_0158077 Ga0466961_0158077_82_288 68
1285 3300044694 Ga0466963_0015497 Ga0466963_0015497_709_915 68
1286 3300044694 Ga0466963_0021350 Ga0466963_0021350_1788_1994 68
1287 3300044694 Ga0466963_0026403 Ga0466963_0026403_389_595 68
1288 3300044694 Ga0466963_0063142 Ga0466963_0063142_2016_2222 68
1289 3300044694 Ga0466963_0065040 Ga0466963_0065040_1534_1740 68
1290 3300044694 Ga0466963_0143758 Ga0466963_0143758_605_811 68
1291 3300044694 Ga0466963_0225817 Ga0466963_0225817_101_307 68
1292 3300044694 Ga0466963_0390564 Ga0466963_0390564_551_757 68
1293 3300044706 Ga0466964_0304607 Ga0466964_0304607_239_445 68
1294 3300044706 Ga0466964_0611761 Ga0466964_0611761_90_296 68
1295 3300044706 Ga0466964_0672212 Ga0466964_0672212_207_413 68
1296 3300044719 Ga0466971_0033337 Ga0466971_0033337_1441_1647 68
1297 3300044719 Ga0466971_0245297 Ga0466971_0245297_13_219 68
1298 3300044735 Ga0466968_0055251 Ga0466968_0055251_33_239 68
1299 3300044765 Ga0466970_0033484 Ga0466970_0033484_2378_2584 68
1300 3300044765 Ga0466970_0058687 Ga0466970_0058687_1276_1482 68
1301 3300044842 Ga0466957_0017877 Ga0466957_0017877_1696_1902 68
1302 3300044842 Ga0466957_0018414 Ga0466957_0018414_3692_3898 68
1303 3300044842 Ga0466957_0084033 Ga0466957_0084033_1203_1409 68
1304 3300044842 Ga0466957_0767563 Ga0466957_0767563_139_345 68
1305 3300044901 Ga0466960_0010721 Ga0466960_0010721_1375_1581 68
1306 3300044901 Ga0466960_0759332 Ga0466960_0759332_229_435 68
1307 3300045049 Ga0466959_0122416 Ga0466959_0122416_1376_1582 68
1308 3300045049 Ga0466959_0134007 Ga0466959_0134007_1516_1722 68
1309 3300045049 Ga0466959_0376247 Ga0466959_0376247_653_859 68
1310 3300045049 Ga0466959_0652243 Ga0466959_0652243_410_616 68
1311 3300045051 Ga0451576_2075681 Ga0451576_2075681_150_356 68
1312 3300045836 Ga0466958_0011303 Ga0466958_0011303_3248_3454 68
1313 3300045836 Ga0466958_0081518 Ga0466958_0081518_1570_1776 68
1314 3300045836 Ga0466958_0085266 Ga0466958_0085266_800_1006 68
1315 3300045836 Ga0466958_0899515 Ga0466958_0899515_187_393 68
1316 3300045976 Ga0466967_0003504 Ga0466967_0003504_2251_2457 68
1317 3300045976 Ga0466967_0027967 Ga0466967_0027967_2617_2823 68
1318 3300045976 Ga0466967_0033683 Ga0466967_0033683_886_1092 68
1319 3300045976 Ga0466967_0055209 Ga0466967_0055209_2556_2762 68
1320 3300045976 Ga0466967_0091459 Ga0466967_0091459_371_577 68
1321 3300045976 Ga0466967_0107292 Ga0466967_0107292_2055_2261 68
1322 3300045976 Ga0466967_0201514 Ga0466967_0201514_397_603 68
1323 3300045976 Ga0466967_0381907 Ga0466967_0381907_273_479 68
1324 3300045976 Ga0466967_0808309 Ga0466967_0808309_393_599 68
1325 3300045976 Ga0466967_0829056 Ga0466967_0829056_226_432 68
1326 3300045976 Ga0466967_0950919 Ga0466967_0950919_497_703 68
1327 3300045976 Ga0466967_1284461 Ga0466967_1284461_412_618 68
1328 3300045976 Ga0466967_1297479 Ga0466967_1297479_346_552 68
1329 3300046492 Ga0495585_0022540 Ga0495585_0022540_1282_1488 68
1330 3300046518 Ga0495631_0501333 Ga0495631_0501333_20_226 68
1331 3300046523 Ga0495644_0388211 Ga0495644_0388211_160_366 68
1332 3300046525 Ga0495663_0089084 Ga0495663_0089084_157_363 68
1333 3300046525 Ga0495663_0169371 Ga0495663_0169371_433_639 68
1334 3300046525 Ga0495663_0292274 Ga0495663_0292274_31_237 68
1335 3300046530 Ga0495654_0322447 Ga0495654_0322447_15_221 68
1336 3300046531 Ga0495665_0367064 Ga0495665_0367064_361_567 68
1337 3300046537 Ga0495598_0000245 Ga0495598_0000245_5153_5359 68
1338 3300046539 Ga0495621_0003228 Ga0495621_0003228_3899_4105 68
1339 3300046539 Ga0495621_0235492 Ga0495621_0235492_312_518 68
1340 3300046558 Ga0495633_0054203 Ga0495633_0054203_1552_1758 68
1341 3300046616 Ga0495668_0034707 Ga0495668_0034707_2052_2258 68
1342 3300046616 Ga0495668_0165693 Ga0495668_0165693_108_314 68
1343 3300046660 Ga0495625_0413474 Ga0495625_0413474_619_825 68
1344 3300046663 Ga0495635_0409225 Ga0495635_0409225_169_375 68
1345 3300046665 Ga0495661_0242034 Ga0495661_0242034_701_907 68
1346 3300046684 Ga0495669_0000810 Ga0495669_0000810_5960_6166 68
1347 3300046684 Ga0495669_0006559 Ga0495669_0006559_2277_2483 68
1348 3300046684 Ga0495669_0015703 Ga0495669_0015703_795_1001 68
1349 3300046684 Ga0495669_0069829 Ga0495669_0069829_278_484 68
1350 3300046684 Ga0495669_0089109 Ga0495669_0089109_249_455 68
1351 3300046691 Ga0495670_0005629 Ga0495670_0005629_3944_4150 68
1352 3300047445 Ga0495677_0004420 Ga0495677_0004420_2324_2530 68
1353 3300047445 Ga0495677_0011290 Ga0495677_0011290_2270_2476 68
1354 3300047469 Ga0495673_0291843 Ga0495673_0291843_199_405 68
1355 3300048903 Ga0496100_0011309 Ga0496100_0011309_4296_4502 68
1356 3300048903 Ga0496100_0090808 Ga0496100_0090808_507_713 68
1357 3300048903 Ga0496100_0665044 Ga0496100_0665044_157_363 68
1358 3300048903 Ga0496100_1153442 Ga0496100_1153442_130_336 68
1359 3300048904 Ga0496101_0103118 Ga0496101_0103118_1053_1259 68
1360 3300048904 Ga0496101_0401726 Ga0496101_0401726_598_804 68
1361 3300048904 Ga0496101_0590951 Ga0496101_0590951_159_365 68
1362 3300048905 Ga0496102_0174800 Ga0496102_0174800_1642_1848 68
1363 3300048905 Ga0496102_0417453 Ga0496102_0417453_81_287 68
1364 3300048905 Ga0496102_1121063 Ga0496102_1121063_184_390 68
1365 3300048906 Ga0496103_0016593 Ga0496103_0016593_1310_1516 68
1366 3300048906 Ga0496103_0554720 Ga0496103_0554720_449_655 68
1367 3300048906 Ga0496103_0723868 Ga0496103_0723868_275_481 68
1368 3300048908 Ga0496105_0111978 Ga0496105_0111978_906_1112 68
1369 3300048909 Ga0496106_0114498 Ga0496106_0114498_414_620 68
1370 3300048909 Ga0496106_0119511 Ga0496106_0119511_1069_1275 68
1371 3300048909 Ga0496106_0467618 Ga0496106_0467618_331_537 68
1372 3300048909 Ga0496106_0887514 Ga0496106_0887514_290_496 68
1373 3300048910 Ga0496107_0055863 Ga0496107_0055863_1928_2134 68
1374 3300048910 Ga0496107_0234322 Ga0496107_0234322_224_430 68
1375 3300048910 Ga0496107_0492007 Ga0496107_0492007_531_737 68
1376 3300048910 Ga0496107_1216271 Ga0496107_1216271_20_226 68
1377 3300048910 Ga0496107_1263327 Ga0496107_1263327_81_287 68
1378 3300048911 Ga0496108_0002538 Ga0496108_0002538_10874_11080 68
1379 3300048911 Ga0496108_0682993 Ga0496108_0682993_587_793 68
1380 3300048912 Ga0496109_0062972 Ga0496109_0062972_83_289 68
1381 3300048912 Ga0496109_0110353 Ga0496109_0110353_793_999 68
1382 3300048912 Ga0496109_0262677 Ga0496109_0262677_886_1092 68
1383 3300048912 Ga0496109_0263341 Ga0496109_0263341_661_867 68
1384 3300048912 Ga0496109_0594627 Ga0496109_0594627_793_999 68
1385 3300048913 Ga0496110_0013487 Ga0496110_0013487_2227_2433 68
1386 3300048913 Ga0496110_0113127 Ga0496110_0113127_583_789 68
1387 3300048913 Ga0496110_0836686 Ga0496110_0836686_149_355 68
1388 3300048914 Ga0496111_0008887 Ga0496111_0008887_3205_3411 68
1389 3300048914 Ga0496111_0020076 Ga0496111_0020076_2522_2728 68
1390 3300048915 Ga0496112_0015503 Ga0496112_0015503_2218_2424 68
1391 3300048915 Ga0496112_0138208 Ga0496112_0138208_1649_1855 68
1392 3300048915 Ga0496112_0208212 Ga0496112_0208212_62_268 68
1393 3300048915 Ga0496112_1868353 Ga0496112_1868353_148_354 68
1394 3300048916 Ga0496113_0009435 Ga0496113_0009435_2020_2226 68
1395 3300048916 Ga0496113_0132654 Ga0496113_0132654_647_853 68
1396 3300048916 Ga0496113_0519110 Ga0496113_0519110_619_825 68
1397 3300048917 Ga0496114_0056118 Ga0496114_0056118_3041_3247 68
1398 3300048917 Ga0496114_0642338 Ga0496114_0642338_96_302 68
1399 3300048918 Ga0496115_0581588 Ga0496115_0581588_505_711 68
1400 3300049583 Ga0501067_0176854 Ga0501067_0176854_756_962 68
1401 3300049584 Ga0501068_0128974 Ga0501068_0128974_911_1117 68
1402 3300049585 Ga0501069_0422469 Ga0501069_0422469_315_521 68
1403 3300049587 Ga0501071_1306210 Ga0501071_1306210_168_374 68
1404 3300049590 Ga0501074_0469947 Ga0501074_0469947_334_540 68
1405 3300049650 Ga0501199_005511 Ga0501199_005511_350_556 68
1406 3300049652 Ga0501202_004051 Ga0501202_004051_1996_2202 68
1407 3300049656 Ga0501209_109454 Ga0501209_109454_321_527 68
1408 3300049657 Ga0501210_028551 Ga0501210_028551_115_321 68
1409 3300049659 Ga0501214_092115 Ga0501214_092115_295_501 68
1410 3300049661 Ga0501217_060816 Ga0501217_060816_266_472 68
1411 3300049663 Ga0501223_032069 Ga0501223_032069_646_852 68
1412 3300049663 Ga0501223_069596 Ga0501223_069596_294_500 68
1413 3300049664 Ga0501224_023317 Ga0501224_023317_219_425 68
1414 3300049665 Ga0501227_086556 Ga0501227_086556_110_316 68
1415 3300049669 Ga0501235_233810 Ga0501235_233810_169_375 68
1416 3300049672 Ga0501239_006043 Ga0501239_006043_753_959 68
1417 3300049677 Ga0501247_005158 Ga0501247_005158_279_485 68
1418 3300049679 Ga0501249_020066 Ga0501249_020066_983_1189 68
1419 3300049686 Ga0501257_078140 Ga0501257_078140_508_714 68
1420 3300049687 Ga0501258_001706 Ga0501258_001706_21_227 68
1421 3300049705 Ga0501225_0028003 Ga0501225_0028003_358_564 68
1422 3300049705 Ga0501225_0134213 Ga0501225_0134213_456_662 68
1423 3300049708 Ga0501245_051310 Ga0501245_051310_262_468 68
1424 3300049742 Ga0501080_0328096 Ga0501080_0328096_97_303 68
1425 3300049760 Ga0501263_087914 Ga0501263_087914_44_250 68
1426 3300049764 Ga0501267_012987 Ga0501267_012987_410_616 68
1427 3300049765 Ga0501268_000552 Ga0501268_000552_264_470 68
1428 3300049767 Ga0501270_103247 Ga0501270_103247_348_554 68
1429 3300049770 Ga0501273_005489 Ga0501273_005489_870_1076 68
1430 3300049775 Ga0501279_007452 Ga0501279_007452_1025_1231 68
1431 3300049851 Ga0501212_041599 Ga0501212_041599_411_617 68
1432 3300049851 Ga0501212_063489 Ga0501212_063489_254_460 68
1433 3300053083 Ga0495655_0330809 Ga0495655_0330809_112_318 68
1434 3300053134 Ga0500658_0000247 Ga0500658_0000247_762_968 68
1435 3300061719 Ga0466962_0014679 Ga0466962_0014679_3527_3733 68
1436 3300061719 Ga0466962_0037107 Ga0466962_0037107_1611_1817 68
1437 3300061719 Ga0466962_0341252 Ga0466962_0341252_523_729 68
1438 3300061734 Ga0530510_1002198 Ga0530510_1002198_137_343 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

24

78

0.95

PF13560

HTH_31

Helix-turn-helix domain

19

78

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9711 9 58
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9701 9 61
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9657 9 60
1adr-assembly1.cif.gz_A determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor 0.9592 9 61
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9577 7 68
ID Description Score Start End Superfamily
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9711 9 58 1.10.260.40
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9657 9 60 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9607 9 60 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9592 9 61 1.10.260.40
1x57A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9554 9 56 1.10.260.40
ID Description Score Start End GO Terms
AF-R3WFC0-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9992 5 65 GO:0003677
AF-A0A254NTU2-F1-model_v4 Transcriptional regulator 0.9984 7 64 GO:0003677
AF-A0A847GBY6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9983 3 67 GO:0003677
AF-C0W191-F1-model_v4 DNA-binding helix-turn-helix protein 0.9978 4 65 GO:0003677
AF-A0A2A4BAA9-F1-model_v4 deleted 0.9972 5 67

Feature Viewer

pLDDT pTM Quality
95.89 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map