F493658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1399 | 351 | 2798 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10762659|Ga0207695_107626592 |
| Length | 153 |
| Sequence | MSTPAAKPSSLPVLLIEDEPAVMSYVRAVLERSGYSVVCCDSGAEGLRQLETGEFLGVVSDMRTPGGVNGADVHDWISAHRPELVSRLVFITGDIANEDTASTLQRTGVPCVEKPKTPLLSAAPVVPTTPSSLGLSPFTWAMMRSFVVVQLKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 131 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 328 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 329 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 330 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 334 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 335 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 338 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 341 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.93 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.07 |
| Nodule | 0 |
| Rhizoplane | 5.22 |
| Rhizosphere | 93.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207695_10762659 | 3300025913 | Bacteria | 848 |
| 2 | MRS1b_contig_6134550 | 2162886011 | Bacteria | 2914 |
| 3 | MBSR1b_contig_12674636 | 2162886012 | Bacteria | 1011 |
| 4 | MBSR1b_contig_2772953 | 2162886012 | Bacteria | 1303 |
| 5 | JGI24752J21851_1003898 | 3300001976 | Bacteria | 1965 |
| 6 | JGI24751J29686_10001643 | 3300002459 | Bacteria | 4609 |
| 7 | rootL2_10044960 | 3300003322 | Unclassified | 1238 |
| 8 | rootL2_10120147 | 3300003322 | Bacteria | 2820 |
| 9 | Ga0065712_10106543 | 3300005290 | Bacteria | 1915 |
| 10 | Ga0065712_10163917 | 3300005290 | Bacteria | 1284 |
| 11 | Ga0065715_10002805 | 3300005293 | Bacteria | 4863 |
| 12 | Ga0065715_10096374 | 3300005293 | Bacteria | 3890 |
| 13 | Ga0065715_10096533 | 3300005293 | Bacteria | 3810 |
| 14 | Ga0065707_10326253 | 3300005295 | Bacteria | 957 |
| 15 | Ga0070658_10015673 | 3300005327 | Bacteria | 6062 |
| 16 | Ga0070658_11282360 | 3300005327 | Unclassified | 636 |
| 17 | Ga0070676_10247845 | 3300005328 | Bacteria | 1187 |
| 18 | Ga0070676_10358536 | 3300005328 | Bacteria | 1004 |
| 19 | Ga0070683_100014455 | 3300005329 | Bacteria | 6905 |
| 20 | Ga0070683_100041687 | 3300005329 | Bacteria | 4225 |
| 21 | Ga0070683_100075451 | 3300005329 | Bacteria | 3150 |
| 22 | Ga0070683_100356050 | 3300005329 | Bacteria | 1394 |
| 23 | Ga0070690_100017809 | 3300005330 | Bacteria | 4281 |
| 24 | Ga0070690_100061607 | 3300005330 | Bacteria | 2417 |
| 25 | Ga0070670_100010385 | 3300005331 | Bacteria | 7945 |
| 26 | Ga0070670_100083025 | 3300005331 | Bacteria | 2753 |
| 27 | Ga0070670_100196114 | 3300005331 | Bacteria | 1754 |
| 28 | Ga0070677_10036802 | 3300005333 | Bacteria | 1906 |
| 29 | Ga0068869_100000550 | 3300005334 | Bacteria | 20980 |
| 30 | Ga0068869_100034351 | 3300005334 | Bacteria | 3587 |
| 31 | Ga0068869_100627344 | 3300005334 | Bacteria | 910 |
| 32 | Ga0070666_10024078 | 3300005335 | Bacteria | 3964 |
| 33 | Ga0070666_10541298 | 3300005335 | Unclassified | 846 |
| 34 | Ga0070666_10656648 | 3300005335 | Bacteria | 767 |
| 35 | Ga0070680_100015909 | 3300005336 | Bacteria | 5907 |
| 36 | Ga0070680_100044409 | 3300005336 | Bacteria | 3611 |
| 37 | Ga0070680_100313656 | 3300005336 | Bacteria | 1331 |
| 38 | Ga0070682_100010415 | 3300005337 | Bacteria | 5276 |
| 39 | Ga0068868_100003943 | 3300005338 | Bacteria | 10363 |
| 40 | Ga0068868_100009681 | 3300005338 | Bacteria | 6953 |
| 41 | Ga0068868_100034367 | 3300005338 | Unclassified | 3914 |
| 42 | Ga0068868_100053324 | 3300005338 | Bacteria | 3186 |
| 43 | Ga0068868_100135625 | 3300005338 | Bacteria | 2017 |
| 44 | Ga0070660_100004316 | 3300005339 | Bacteria | 9820 |
| 45 | Ga0070660_100011820 | 3300005339 | Bacteria | 6219 |
| 46 | Ga0070660_100053314 | 3300005339 | Bacteria | 3119 |
| 47 | Ga0070689_100042634 | 3300005340 | Bacteria | 3484 |
| 48 | Ga0070687_100007241 | 3300005343 | Bacteria | 4609 |
| 49 | Ga0070661_100011241 | 3300005344 | Bacteria | 6237 |
| 50 | Ga0070661_100012801 | 3300005344 | Bacteria | 5875 |
| 51 | Ga0070661_100015105 | 3300005344 | Bacteria | 5448 |
| 52 | Ga0070661_100030051 | 3300005344 | Bacteria | 3924 |
| 53 | Ga0070661_100069047 | 3300005344 | Bacteria | 2598 |
| 54 | Ga0070692_10145265 | 3300005345 | Bacteria | 1346 |
| 55 | Ga0070692_11072468 | 3300005345 | Unclassified | 567 |
| 56 | Ga0070668_100002735 | 3300005347 | Bacteria | 12976 |
| 57 | Ga0070668_100024225 | 3300005347 | Bacteria | 4596 |
| 58 | Ga0070668_100862645 | 3300005347 | Bacteria | 807 |
| 59 | Ga0070669_100011554 | 3300005353 | Bacteria | 6266 |
| 60 | Ga0070669_100570349 | 3300005353 | Bacteria | 945 |
| 61 | Ga0070669_101447395 | 3300005353 | Unclassified | 597 |
| 62 | Ga0070675_100007612 | 3300005354 | Bacteria | 8379 |
| 63 | Ga0070675_100465790 | 3300005354 | Bacteria | 1135 |
| 64 | Ga0070671_100014648 | 3300005355 | Bacteria | 6338 |
| 65 | Ga0070671_101277177 | 3300005355 | Bacteria | 647 |
| 66 | Ga0070671_102016829 | 3300005355 | Unclassified | 514 |
| 67 | Ga0070673_100008691 | 3300005364 | Bacteria | 6772 |
| 68 | Ga0070673_100155066 | 3300005364 | Bacteria | 1943 |
| 69 | Ga0070673_101185853 | 3300005364 | Unclassified | 715 |
| 70 | Ga0070673_101488463 | 3300005364 | Unclassified | 638 |
| 71 | Ga0070688_100007204 | 3300005365 | Bacteria | 5989 |
| 72 | Ga0070688_100252055 | 3300005365 | Bacteria | 1257 |
| 73 | Ga0070688_100313026 | 3300005365 | Bacteria | 1138 |
| 74 | Ga0070659_100001922 | 3300005366 | Bacteria | 14842 |
| 75 | Ga0070659_100006129 | 3300005366 | Bacteria | 8678 |
| 76 | Ga0070659_100039236 | 3300005366 | Bacteria | 3696 |
| 77 | Ga0070659_100854978 | 3300005366 | Bacteria | 793 |
| 78 | Ga0070667_100009820 | 3300005367 | Bacteria | 7933 |
| 79 | Ga0070667_100386271 | 3300005367 | Bacteria | 1272 |
| 80 | Ga0070667_101014396 | 3300005367 | Bacteria | 774 |
| 81 | Ga0070709_10028242 | 3300005434 | Bacteria | 3344 |
| 82 | Ga0070709_10049599 | 3300005434 | Bacteria | 2626 |
| 83 | Ga0070709_10086997 | 3300005434 | Bacteria | 2053 |
| 84 | Ga0070709_10089106 | 3300005434 | Bacteria | 2031 |
| 85 | Ga0070709_10259874 | 3300005434 | Bacteria | 1254 |
| 86 | Ga0070709_10366360 | 3300005434 | Bacteria | 1068 |
| 87 | Ga0070709_10795488 | 3300005434 | Bacteria | 742 |
| 88 | Ga0070709_10848509 | 3300005434 | Unclassified | 720 |
| 89 | Ga0070709_11647796 | 3300005434 | Unclassified | 523 |
| 90 | Ga0070714_100009049 | 3300005435 | Bacteria | 7804 |
| 91 | Ga0070714_100025843 | 3300005435 | Bacteria | 4850 |
| 92 | Ga0070714_100031288 | 3300005435 | Bacteria | 4439 |
| 93 | Ga0070714_100036765 | 3300005435 | Bacteria | 4109 |
| 94 | Ga0070714_100102975 | 3300005435 | Unclassified | 2518 |
| 95 | Ga0070714_100124419 | 3300005435 | Bacteria | 2297 |
| 96 | Ga0070714_100133533 | 3300005435 | Bacteria | 2220 |
| 97 | Ga0070714_100171080 | 3300005435 | Bacteria | 1971 |
| 98 | Ga0070714_100195863 | 3300005435 | Bacteria | 1846 |
| 99 | Ga0070714_100226227 | 3300005435 | Bacteria | 1722 |
| 100 | Ga0070714_100281523 | 3300005435 | Bacteria | 1545 |
| 101 | Ga0070714_100466376 | 3300005435 | Bacteria | 1201 |
| 102 | Ga0070714_100559407 | 3300005435 | Bacteria | 1095 |
| 103 | Ga0070714_100727115 | 3300005435 | Bacteria | 959 |
| 104 | Ga0070714_101128171 | 3300005435 | Bacteria | 764 |
| 105 | Ga0070714_101136190 | 3300005435 | Unclassified | 762 |
| 106 | Ga0070713_100000342 | 3300005436 | Bacteria | 30393 |
| 107 | Ga0070713_100000449 | 3300005436 | Bacteria | 26293 |
| 108 | Ga0070713_100000510 | 3300005436 | Bacteria | 24756 |
| 109 | Ga0070713_100006751 | 3300005436 | Bacteria | 7997 |
| 110 | Ga0070713_100007164 | 3300005436 | Bacteria | 7804 |
| 111 | Ga0070713_100117524 | 3300005436 | Bacteria | 2327 |
| 112 | Ga0070713_100120784 | 3300005436 | Bacteria | 2298 |
| 113 | Ga0070713_100125991 | 3300005436 | Bacteria | 2253 |
| 114 | Ga0070713_100143012 | 3300005436 | Bacteria | 2121 |
| 115 | Ga0070713_100170845 | 3300005436 | Bacteria | 1947 |
| 116 | Ga0070713_100226221 | 3300005436 | Bacteria | 1699 |
| 117 | Ga0070713_100526522 | 3300005436 | Bacteria | 1117 |
| 118 | Ga0070713_100602633 | 3300005436 | Bacteria | 1044 |
| 119 | Ga0070713_100647877 | 3300005436 | Bacteria | 1006 |
| 120 | Ga0070713_100849201 | 3300005436 | Bacteria | 877 |
| 121 | Ga0070713_100937109 | 3300005436 | Bacteria | 834 |
| 122 | Ga0070713_100982851 | 3300005436 | Unclassified | 814 |
| 123 | Ga0070710_10003161 | 3300005437 | Bacteria | 7811 |
| 124 | Ga0070710_10008637 | 3300005437 | Bacteria | 4963 |
| 125 | Ga0070710_10050390 | 3300005437 | Bacteria | 2334 |
| 126 | Ga0070710_10066409 | 3300005437 | Bacteria | 2068 |
| 127 | Ga0070710_10087209 | 3300005437 | Bacteria | 1834 |
| 128 | Ga0070710_10102028 | 3300005437 | Bacteria | 1710 |
| 129 | Ga0070710_10102984 | 3300005437 | Bacteria | 1703 |
| 130 | Ga0070710_10226597 | 3300005437 | Bacteria | 1192 |
| 131 | Ga0070710_10281110 | 3300005437 | Bacteria | 1080 |
| 132 | Ga0070710_10341182 | 3300005437 | Bacteria | 989 |
| 133 | Ga0070711_100000442 | 3300005439 | Bacteria | 21552 |
| 134 | Ga0070711_100001861 | 3300005439 | Bacteria | 11790 |
| 135 | Ga0070711_100004128 | 3300005439 | Bacteria | 8537 |
| 136 | Ga0070711_100015933 | 3300005439 | Bacteria | 4763 |
| 137 | Ga0070711_100020744 | 3300005439 | Unclassified | 4240 |
| 138 | Ga0070711_100021709 | 3300005439 | Bacteria | 4154 |
| 139 | Ga0070711_100030425 | 3300005439 | Bacteria | 3573 |
| 140 | Ga0070711_100058991 | 3300005439 | Bacteria | 2663 |
| 141 | Ga0070711_100084396 | 3300005439 | Bacteria | 2272 |
| 142 | Ga0070711_100230865 | 3300005439 | Bacteria | 1442 |
| 143 | Ga0070711_100258832 | 3300005439 | Bacteria | 1368 |
| 144 | Ga0070711_100261769 | 3300005439 | Bacteria | 1361 |
| 145 | Ga0070711_100803118 | 3300005439 | Viruses | 798 |
| 146 | Ga0070711_100871277 | 3300005439 | Bacteria | 767 |
| 147 | Ga0070711_101190836 | 3300005439 | Bacteria | 659 |
| 148 | Ga0070705_100181212 | 3300005440 | Bacteria | 1427 |
| 149 | Ga0070700_100057144 | 3300005441 | Bacteria | 2448 |
| 150 | Ga0070700_100065656 | 3300005441 | Bacteria | 2301 |
| 151 | Ga0070694_100190002 | 3300005444 | Bacteria | 1524 |
| 152 | Ga0070708_100001221 | 3300005445 | Bacteria | 19765 |
| 153 | Ga0070708_100001401 | 3300005445 | Bacteria | 18432 |
| 154 | Ga0070708_100001766 | 3300005445 | Bacteria | 16598 |
| 155 | Ga0070708_100002020 | 3300005445 | Bacteria | 15621 |
| 156 | Ga0070708_100015287 | 3300005445 | Bacteria | 6334 |
| 157 | Ga0070708_100041536 | 3300005445 | Bacteria | 4032 |
| 158 | Ga0070708_100141295 | 3300005445 | Bacteria | 2233 |
| 159 | Ga0070708_100239549 | 3300005445 | Bacteria | 1703 |
| 160 | Ga0070708_100267103 | 3300005445 | Bacteria | 1609 |
| 161 | Ga0070708_100277146 | 3300005445 | Bacteria | 1578 |
| 162 | Ga0070708_100278362 | 3300005445 | Bacteria | 1575 |
| 163 | Ga0070708_100567037 | 3300005445 | Unclassified | 1071 |
| 164 | Ga0070708_101531594 | 3300005445 | Bacteria | 621 |
| 165 | Ga0070663_100016476 | 3300005455 | Bacteria | 4802 |
| 166 | Ga0070663_100024595 | 3300005455 | Bacteria | 4056 |
| 167 | Ga0070663_100346437 | 3300005455 | Bacteria | 1202 |
| 168 | Ga0070663_100819606 | 3300005455 | Unclassified | 799 |
| 169 | Ga0070678_100065037 | 3300005456 | Bacteria | 2706 |
| 170 | Ga0070662_100004700 | 3300005457 | Bacteria | 8657 |
| 171 | Ga0070662_100027940 | 3300005457 | Bacteria | 3922 |
| 172 | Ga0070662_100031533 | 3300005457 | Bacteria | 3720 |
| 173 | Ga0070662_100658530 | 3300005457 | Unclassified | 884 |
| 174 | Ga0070681_10000055 | 3300005458 | Bacteria | 80179 |
| 175 | Ga0070681_10013007 | 3300005458 | Bacteria | 8264 |
| 176 | Ga0070681_10040657 | 3300005458 | Bacteria | 4658 |
| 177 | Ga0070681_10050460 | 3300005458 | Bacteria | 4151 |
| 178 | Ga0070681_10067150 | 3300005458 | Bacteria | 3555 |
| 179 | Ga0070681_10079440 | 3300005458 | Bacteria | 3237 |
| 180 | Ga0070681_10349137 | 3300005458 | Unclassified | 1390 |
| 181 | Ga0070681_11035074 | 3300005458 | Bacteria | 741 |
| 182 | Ga0068867_100006586 | 3300005459 | Bacteria | 8210 |
| 183 | Ga0068867_100018246 | 3300005459 | Bacteria | 4986 |
| 184 | Ga0068867_100088181 | 3300005459 | Unclassified | 2351 |
| 185 | Ga0068867_100170473 | 3300005459 | Bacteria | 1723 |
| 186 | Ga0070685_10013905 | 3300005466 | Bacteria | 4258 |
| 187 | Ga0070685_10018810 | 3300005466 | Bacteria | 3721 |
| 188 | Ga0070685_10449102 | 3300005466 | Bacteria | 903 |
| 189 | Ga0070706_100000173 | 3300005467 | Bacteria | 81500 |
| 190 | Ga0070706_100001295 | 3300005467 | Bacteria | 26667 |
| 191 | Ga0070706_100001629 | 3300005467 | Bacteria | 23411 |
| 192 | Ga0070706_100012117 | 3300005467 | Bacteria | 8002 |
| 193 | Ga0070706_100066056 | 3300005467 | Bacteria | 3346 |
| 194 | Ga0070706_100330570 | 3300005467 | Bacteria | 1421 |
| 195 | Ga0070706_100373941 | 3300005467 | Bacteria | 1327 |
| 196 | Ga0070706_100417314 | 3300005467 | Bacteria | 1249 |
| 197 | Ga0070706_100516501 | 3300005467 | Bacteria | 1111 |
| 198 | Ga0070707_100000719 | 3300005468 | Bacteria | 33081 |
| 199 | Ga0070707_100002543 | 3300005468 | Bacteria | 17343 |
| 200 | Ga0070707_100006148 | 3300005468 | Bacteria | 11188 |
| 201 | Ga0070707_100017757 | 3300005468 | Bacteria | 6689 |
| 202 | Ga0070707_100074860 | 3300005468 | Bacteria | 3265 |
| 203 | Ga0070707_100086920 | 3300005468 | Bacteria | 3024 |
| 204 | Ga0070707_100090046 | 3300005468 | Bacteria | 2969 |
| 205 | Ga0070707_100324535 | 3300005468 | Bacteria | 1496 |
| 206 | Ga0070707_100374943 | 3300005468 | Bacteria | 1382 |
| 207 | Ga0070707_100463635 | 3300005468 | Bacteria | 1228 |
| 208 | Ga0070707_100683554 | 3300005468 | Bacteria | 989 |
| 209 | Ga0070707_100813554 | 3300005468 | Bacteria | 898 |
| 210 | Ga0070698_100000162 | 3300005471 | Bacteria | 61345 |
| 211 | Ga0070698_100005121 | 3300005471 | Bacteria | 14348 |
| 212 | Ga0070698_100046332 | 3300005471 | Bacteria | 4446 |
| 213 | Ga0070698_100284864 | 3300005471 | Bacteria | 1584 |
| 214 | Ga0070698_100489974 | 3300005471 | Bacteria | 1167 |
| 215 | Ga0070698_101218205 | 3300005471 | Unclassified | 702 |
| 216 | Ga0070699_100002067 | 3300005518 | Bacteria | 18161 |
| 217 | Ga0070699_100003692 | 3300005518 | Bacteria | 13537 |
| 218 | Ga0070699_100010658 | 3300005518 | Bacteria | 7956 |
| 219 | Ga0070699_100056787 | 3300005518 | Bacteria | 3390 |
| 220 | Ga0070699_100135777 | 3300005518 | Bacteria | 2170 |
| 221 | Ga0070699_100273308 | 3300005518 | Bacteria | 1513 |
| 222 | Ga0070699_100276146 | 3300005518 | Bacteria | 1505 |
| 223 | Ga0070699_101014370 | 3300005518 | Bacteria | 761 |
| 224 | Ga0070699_101539241 | 3300005518 | Bacteria | 609 |
| 225 | Ga0070679_100043594 | 3300005530 | Bacteria | 4468 |
| 226 | Ga0070679_100104117 | 3300005530 | Bacteria | 2824 |
| 227 | Ga0070679_100125511 | 3300005530 | Bacteria | 2549 |
| 228 | Ga0070679_100129486 | 3300005530 | Bacteria | 2505 |
| 229 | Ga0070679_100345679 | 3300005530 | Bacteria | 1435 |
| 230 | Ga0070679_100356677 | 3300005530 | Bacteria | 1410 |
| 231 | Ga0070679_100473412 | 3300005530 | Unclassified | 1197 |
| 232 | Ga0070679_101199890 | 3300005530 | Bacteria | 704 |
| 233 | Ga0070684_100002587 | 3300005535 | Bacteria | 13360 |
| 234 | Ga0070684_100006632 | 3300005535 | Bacteria | 8966 |
| 235 | Ga0070684_100011364 | 3300005535 | Bacteria | 7091 |
| 236 | Ga0070684_100065317 | 3300005535 | Bacteria | 3194 |
| 237 | Ga0070684_100100813 | 3300005535 | Unclassified | 2579 |
| 238 | Ga0070684_100451397 | 3300005535 | Bacteria | 1188 |
| 239 | Ga0070697_100000872 | 3300005536 | Bacteria | 22677 |
| 240 | Ga0070697_100001177 | 3300005536 | Bacteria | 19808 |
| 241 | Ga0070697_100001505 | 3300005536 | Bacteria | 17701 |
| 242 | Ga0070697_100002837 | 3300005536 | Bacteria | 13330 |
| 243 | Ga0070697_100004369 | 3300005536 | Bacteria | 10845 |
| 244 | Ga0070697_100030681 | 3300005536 | Bacteria | 4319 |
| 245 | Ga0070697_100085647 | 3300005536 | Bacteria | 2600 |
| 246 | Ga0070697_100127377 | 3300005536 | Bacteria | 2133 |
| 247 | Ga0070697_100427397 | 3300005536 | Unclassified | 1151 |
| 248 | Ga0070697_101300671 | 3300005536 | Unclassified | 649 |
| 249 | Ga0070697_101911273 | 3300005536 | Unclassified | 531 |
| 250 | Ga0068853_100006282 | 3300005539 | Bacteria | 9422 |
| 251 | Ga0068853_100024491 | 3300005539 | Bacteria | 5061 |
| 252 | Ga0068853_100026542 | 3300005539 | Bacteria | 4864 |
| 253 | Ga0068853_100087705 | 3300005539 | Bacteria | 2731 |
| 254 | Ga0068853_100132158 | 3300005539 | Bacteria | 2235 |
| 255 | Ga0068853_100201330 | 3300005539 | Unclassified | 1812 |
| 256 | Ga0070672_100034848 | 3300005543 | Bacteria | 3822 |
| 257 | Ga0070672_100262707 | 3300005543 | Bacteria | 1456 |
| 258 | Ga0070672_101357245 | 3300005543 | Unclassified | 635 |
| 259 | Ga0070686_100005128 | 3300005544 | Bacteria | 7230 |
| 260 | Ga0070686_100018382 | 3300005544 | Bacteria | 4101 |
| 261 | Ga0070695_100147601 | 3300005545 | Bacteria | 1638 |
| 262 | Ga0070695_100203508 | 3300005545 | Bacteria | 1416 |
| 263 | Ga0070695_100607884 | 3300005545 | Bacteria | 859 |
| 264 | Ga0070695_100811161 | 3300005545 | Bacteria | 750 |
| 265 | Ga0070696_100175780 | 3300005546 | Bacteria | 1586 |
| 266 | Ga0070696_100665759 | 3300005546 | Bacteria | 845 |
| 267 | Ga0070696_100674064 | 3300005546 | Unclassified | 840 |
| 268 | Ga0070696_101134960 | 3300005546 | Bacteria | 658 |
| 269 | Ga0070693_100052027 | 3300005547 | Bacteria | 2347 |
| 270 | Ga0070693_100098916 | 3300005547 | Bacteria | 1773 |
| 271 | Ga0070693_100150163 | 3300005547 | Bacteria | 1475 |
| 272 | Ga0070693_100232130 | 3300005547 | Bacteria | 1214 |
| 273 | Ga0070693_100255593 | 3300005547 | Bacteria | 1163 |
| 274 | Ga0070693_100283876 | 3300005547 | Unclassified | 1110 |
| 275 | Ga0070693_100920994 | 3300005547 | Unclassified | 656 |
| 276 | Ga0070693_100950713 | 3300005547 | Bacteria | 647 |
| 277 | Ga0070665_100036861 | 3300005548 | Bacteria | 4917 |
| 278 | Ga0070665_100133753 | 3300005548 | Bacteria | 2481 |
| 279 | Ga0070704_100596670 | 3300005549 | Bacteria | 970 |
| 280 | Ga0070704_101277702 | 3300005549 | Bacteria | 671 |
| 281 | Ga0070704_101386752 | 3300005549 | Bacteria | 644 |
| 282 | Ga0068855_100002871 | 3300005563 | Bacteria | 21140 |
| 283 | Ga0068855_100005054 | 3300005563 | Bacteria | 16100 |
| 284 | Ga0068855_100015407 | 3300005563 | Bacteria | 9203 |
| 285 | Ga0068855_100018256 | 3300005563 | Bacteria | 8426 |
| 286 | Ga0068855_100023648 | 3300005563 | Bacteria | 7358 |
| 287 | Ga0068855_100031434 | 3300005563 | Bacteria | 6339 |
| 288 | Ga0068855_101969389 | 3300005563 | Bacteria | 591 |
| 289 | Ga0070664_100001796 | 3300005564 | Bacteria | 17205 |
| 290 | Ga0070664_100007823 | 3300005564 | Bacteria | 8633 |
| 291 | Ga0070664_100008620 | 3300005564 | Bacteria | 8249 |
| 292 | Ga0070664_100091253 | 3300005564 | Bacteria | 2637 |
| 293 | Ga0070664_100247630 | 3300005564 | Unclassified | 1601 |
| 294 | Ga0070664_100359456 | 3300005564 | Unclassified | 1326 |
| 295 | Ga0070664_100568069 | 3300005564 | Bacteria | 1050 |
| 296 | Ga0068857_100000041 | 3300005577 | Bacteria | 70173 |
| 297 | Ga0068857_100002662 | 3300005577 | Bacteria | 14661 |
| 298 | Ga0068857_100247182 | 3300005577 | Bacteria | 1634 |
| 299 | Ga0068857_102444562 | 3300005577 | Bacteria | 513 |
| 300 | Ga0068854_100003861 | 3300005578 | Bacteria | 9393 |
| 301 | Ga0068854_100006005 | 3300005578 | Bacteria | 7692 |
| 302 | Ga0068854_100006817 | 3300005578 | Bacteria | 7284 |
| 303 | Ga0068854_100009154 | 3300005578 | Bacteria | 6387 |
| 304 | Ga0068854_100044808 | 3300005578 | Bacteria | 3142 |
| 305 | Ga0068854_101232071 | 3300005578 | Unclassified | 671 |
| 306 | Ga0068856_100000355 | 3300005614 | Bacteria | 49986 |
| 307 | Ga0068856_100001245 | 3300005614 | Bacteria | 26739 |
| 308 | Ga0068856_100001397 | 3300005614 | Bacteria | 25289 |
| 309 | Ga0068856_100004211 | 3300005614 | Bacteria | 14360 |
| 310 | Ga0068856_100004843 | 3300005614 | Bacteria | 13344 |
| 311 | Ga0068856_100026475 | 3300005614 | Bacteria | 5655 |
| 312 | Ga0068856_100032662 | 3300005614 | Bacteria | 5096 |
| 313 | Ga0068856_100053439 | 3300005614 | Bacteria | 3982 |
| 314 | Ga0068856_100104443 | 3300005614 | Bacteria | 2827 |
| 315 | Ga0068856_100273997 | 3300005614 | Bacteria | 1703 |
| 316 | Ga0068856_100671620 | 3300005614 | Bacteria | 1057 |
| 317 | Ga0070702_100017598 | 3300005615 | Bacteria | 3690 |
| 318 | Ga0068852_100021601 | 3300005616 | Bacteria | 5144 |
| 319 | Ga0068852_100022927 | 3300005616 | Bacteria | 5016 |
| 320 | Ga0068852_100054469 | 3300005616 | Bacteria | 3448 |
| 321 | Ga0068852_100342315 | 3300005616 | Bacteria | 1458 |
| 322 | Ga0068852_100422722 | 3300005616 | Bacteria | 1315 |
| 323 | Ga0068859_100002075 | 3300005617 | Bacteria | 20448 |
| 324 | Ga0068859_100022875 | 3300005617 | Bacteria | 6268 |
| 325 | Ga0068859_100124359 | 3300005617 | Bacteria | 2647 |
| 326 | Ga0068864_100002938 | 3300005618 | Bacteria | 14093 |
| 327 | Ga0068864_100036397 | 3300005618 | Bacteria | 4195 |
| 328 | Ga0068864_100070542 | 3300005618 | Bacteria | 3040 |
| 329 | Ga0068866_10012020 | 3300005718 | Bacteria | 3764 |
| 330 | Ga0068866_10012922 | 3300005718 | Bacteria | 3648 |
| 331 | Ga0068866_10023270 | 3300005718 | Bacteria | 2880 |
| 332 | Ga0068866_10067387 | 3300005718 | Unclassified | 1879 |
| 333 | Ga0068866_10650028 | 3300005718 | Unclassified | 718 |
| 334 | Ga0068861_100022258 | 3300005719 | Bacteria | 4565 |
| 335 | Ga0068861_100152261 | 3300005719 | Bacteria | 1899 |
| 336 | Ga0068861_100245419 | 3300005719 | Bacteria | 1525 |
| 337 | Ga0068851_10001990 | 3300005834 | Bacteria | 8995 |
| 338 | Ga0068851_10005815 | 3300005834 | Bacteria | 5618 |
| 339 | Ga0068870_10001819 | 3300005840 | Bacteria | 8758 |
| 340 | Ga0068870_10155454 | 3300005840 | Bacteria | 1351 |
| 341 | Ga0068863_100017215 | 3300005841 | Bacteria | 6931 |
| 342 | Ga0068863_100024499 | 3300005841 | Bacteria | 5756 |
| 343 | Ga0068863_100042876 | 3300005841 | Bacteria | 4298 |
| 344 | Ga0068863_100074990 | 3300005841 | Bacteria | 3201 |
| 345 | Ga0068863_100120258 | 3300005841 | Bacteria | 2504 |
| 346 | Ga0068863_100276668 | 3300005841 | Bacteria | 1626 |
| 347 | Ga0068863_100684329 | 3300005841 | Bacteria | 1019 |
| 348 | Ga0068863_101697625 | 3300005841 | Unclassified | 641 |
| 349 | Ga0068858_100002616 | 3300005842 | Bacteria | 18137 |
| 350 | Ga0068858_100007357 | 3300005842 | Bacteria | 10656 |
| 351 | Ga0068858_100025619 | 3300005842 | Bacteria | 5488 |
| 352 | Ga0068858_100026311 | 3300005842 | Bacteria | 5407 |
| 353 | Ga0068858_100076855 | 3300005842 | Bacteria | 3101 |
| 354 | Ga0068858_100115576 | 3300005842 | Bacteria | 2507 |
| 355 | Ga0068858_100456882 | 3300005842 | Bacteria | 1231 |
| 356 | Ga0068858_100657913 | 3300005842 | Bacteria | 1018 |
| 357 | Ga0068860_100007831 | 3300005843 | Bacteria | 10666 |
| 358 | Ga0068860_100060146 | 3300005843 | Bacteria | 3611 |
| 359 | Ga0068860_100098636 | 3300005843 | Bacteria | 2786 |
| 360 | Ga0068860_100102188 | 3300005843 | Bacteria | 2735 |
| 361 | Ga0068860_100182762 | 3300005843 | Bacteria | 2027 |
| 362 | Ga0068860_100406359 | 3300005843 | Bacteria | 1348 |
| 363 | Ga0068860_100584243 | 3300005843 | Bacteria | 1121 |
| 364 | Ga0068860_100650321 | 3300005843 | Unclassified | 1062 |
| 365 | Ga0068862_100011071 | 3300005844 | Bacteria | 7451 |
| 366 | Ga0068862_100043213 | 3300005844 | Bacteria | 3842 |
| 367 | Ga0068862_100256123 | 3300005844 | Bacteria | 1596 |
| 368 | Ga0081455_10786581 | 3300005937 | Unclassified | 598 |
| 369 | Ga0081540_1044237 | 3300005983 | Bacteria | 2275 |
| 370 | Ga0081540_1225570 | 3300005983 | Unclassified | 664 |
| 371 | Ga0070717_10000612 | 3300006028 | Bacteria | 22915 |
| 372 | Ga0070717_10000837 | 3300006028 | Bacteria | 20360 |
| 373 | Ga0070717_10002552 | 3300006028 | Bacteria | 12840 |
| 374 | Ga0070717_10010813 | 3300006028 | Bacteria | 6905 |
| 375 | Ga0070717_10017807 | 3300006028 | Bacteria | 5536 |
| 376 | Ga0070717_10018682 | 3300006028 | Bacteria | 5421 |
| 377 | Ga0070717_10019341 | 3300006028 | Bacteria | 5340 |
| 378 | Ga0070717_10022103 | 3300006028 | Bacteria | 5023 |
| 379 | Ga0070717_10033939 | 3300006028 | Bacteria | 4120 |
| 380 | Ga0070717_10039607 | 3300006028 | Bacteria | 3835 |
| 381 | Ga0070717_10070032 | 3300006028 | Bacteria | 2922 |
| 382 | Ga0070717_10071148 | 3300006028 | Unclassified | 2901 |
| 383 | Ga0070717_10107426 | 3300006028 | Bacteria | 2377 |
| 384 | Ga0070717_10116686 | 3300006028 | Bacteria | 2283 |
| 385 | Ga0070717_10127189 | 3300006028 | Bacteria | 2188 |
| 386 | Ga0070717_10158352 | 3300006028 | Bacteria | 1963 |
| 387 | Ga0070717_10279005 | 3300006028 | Bacteria | 1482 |
| 388 | Ga0070717_10310993 | 3300006028 | Bacteria | 1402 |
| 389 | Ga0070717_10934544 | 3300006028 | Bacteria | 790 |
| 390 | Ga0070715_10036633 | 3300006163 | Bacteria | 2025 |
| 391 | Ga0070715_10173929 | 3300006163 | Unclassified | 1075 |
| 392 | Ga0070715_10425755 | 3300006163 | Bacteria | 744 |
| 393 | Ga0070716_100000315 | 3300006173 | Bacteria | 19472 |
| 394 | Ga0070716_100002728 | 3300006173 | Bacteria | 8186 |
| 395 | Ga0070716_100022367 | 3300006173 | Bacteria | 3341 |
| 396 | Ga0070716_100045706 | 3300006173 | Bacteria | 2460 |
| 397 | Ga0070716_100057722 | 3300006173 | Bacteria | 2231 |
| 398 | Ga0070716_100181762 | 3300006173 | Bacteria | 1381 |
| 399 | Ga0070716_100192049 | 3300006173 | Unclassified | 1350 |
| 400 | Ga0070716_100299177 | 3300006173 | Bacteria | 1118 |
| 401 | Ga0070716_100382842 | 3300006173 | Bacteria | 1006 |
| 402 | Ga0070716_100478900 | 3300006173 | Bacteria | 914 |
| 403 | Ga0070716_100566176 | 3300006173 | Bacteria | 850 |
| 404 | Ga0070716_100600345 | 3300006173 | Unclassified | 828 |
| 405 | Ga0070716_100618362 | 3300006173 | Unclassified | 817 |
| 406 | Ga0070712_100000957 | 3300006175 | Bacteria | 17360 |
| 407 | Ga0070712_100002811 | 3300006175 | Bacteria | 10767 |
| 408 | Ga0070712_100005172 | 3300006175 | Bacteria | 8070 |
| 409 | Ga0070712_100008543 | 3300006175 | Bacteria | 6442 |
| 410 | Ga0070712_100009656 | 3300006175 | Bacteria | 6081 |
| 411 | Ga0070712_100021898 | 3300006175 | Bacteria | 4203 |
| 412 | Ga0070712_100028726 | 3300006175 | Bacteria | 3722 |
| 413 | Ga0070712_100062307 | 3300006175 | Bacteria | 2637 |
| 414 | Ga0070712_100104060 | 3300006175 | Bacteria | 2106 |
| 415 | Ga0070712_100205175 | 3300006175 | Bacteria | 1551 |
| 416 | Ga0070712_100357420 | 3300006175 | Bacteria | 1197 |
| 417 | Ga0070712_100376734 | 3300006175 | Unclassified | 1167 |
| 418 | Ga0070712_100480477 | 3300006175 | Bacteria | 1039 |
| 419 | Ga0070712_100480809 | 3300006175 | Bacteria | 1038 |
| 420 | Ga0070712_101070604 | 3300006175 | Unclassified | 699 |
| 421 | Ga0070712_101076198 | 3300006175 | Bacteria | 697 |
| 422 | Ga0070712_101372494 | 3300006175 | Bacteria | 616 |
| 423 | Ga0070712_101937193 | 3300006175 | Unclassified | 516 |
| 424 | Ga0097621_100000533 | 3300006237 | Bacteria | 26715 |
| 425 | Ga0097621_100000581 | 3300006237 | Bacteria | 25739 |
| 426 | Ga0097621_100002510 | 3300006237 | Bacteria | 12564 |
| 427 | Ga0097621_100144578 | 3300006237 | Bacteria | 2035 |
| 428 | Ga0097621_100262211 | 3300006237 | Bacteria | 1516 |
| 429 | Ga0097621_100300200 | 3300006237 | Bacteria | 1418 |
| 430 | Ga0097621_100564685 | 3300006237 | Bacteria | 1037 |
| 431 | Ga0097621_100717551 | 3300006237 | Bacteria | 921 |
| 432 | Ga0097621_101038986 | 3300006237 | Bacteria | 767 |
| 433 | Ga0068871_100000664 | 3300006358 | Bacteria | 23618 |
| 434 | Ga0068871_100014943 | 3300006358 | Bacteria | 5803 |
| 435 | Ga0068871_100015369 | 3300006358 | Bacteria | 5726 |
| 436 | Ga0068871_100031751 | 3300006358 | Bacteria | 4167 |
| 437 | Ga0068871_100049053 | 3300006358 | Bacteria | 3411 |
| 438 | Ga0068871_100060236 | 3300006358 | Bacteria | 3096 |
| 439 | Ga0068871_100167412 | 3300006358 | Bacteria | 1882 |
| 440 | Ga0068871_100241076 | 3300006358 | Bacteria | 1572 |
| 441 | Ga0068871_100743332 | 3300006358 | Unclassified | 901 |
| 442 | Ga0068871_100754639 | 3300006358 | Unclassified | 894 |
| 443 | Ga0068871_101789899 | 3300006358 | Unclassified | 583 |
| 444 | Ga0075434_100002766 | 3300006871 | Bacteria | 15521 |
| 445 | Ga0075434_100281638 | 3300006871 | Bacteria | 1682 |
| 446 | Ga0068865_100003096 | 3300006881 | Bacteria | 9955 |
| 447 | Ga0068865_100023261 | 3300006881 | Bacteria | 4056 |
| 448 | Ga0068865_100528660 | 3300006881 | Unclassified | 987 |
| 449 | Ga0068865_100708932 | 3300006881 | Unclassified | 861 |
| 450 | Ga0068865_100930424 | 3300006881 | Bacteria | 757 |
| 451 | Ga0075436_100000526 | 3300006914 | Bacteria | 24961 |
| 452 | Ga0075436_100000572 | 3300006914 | Bacteria | 24071 |
| 453 | Ga0075436_100001967 | 3300006914 | Bacteria | 14161 |
| 454 | Ga0075436_100168229 | 3300006914 | Bacteria | 1547 |
| 455 | Ga0075436_100500103 | 3300006914 | Bacteria | 889 |
| 456 | Ga0097620_100002075 | 3300006931 | Bacteria | 20448 |
| 457 | Ga0097620_100022875 | 3300006931 | Bacteria | 6268 |
| 458 | Ga0097620_100124361 | 3300006931 | Bacteria | 2647 |
| 459 | Ga0075435_100000105 | 3300007076 | Bacteria | 45736 |
| 460 | Ga0075435_100010275 | 3300007076 | Bacteria | 6842 |
| 461 | Ga0075435_100076906 | 3300007076 | Bacteria | 2736 |
| 462 | Ga0075435_100099110 | 3300007076 | Bacteria | 2413 |
| 463 | Ga0075435_100544363 | 3300007076 | Bacteria | 1005 |
| 464 | Ga0075435_100547156 | 3300007076 | Bacteria | 1002 |
| 465 | Ga0099794_10194192 | 3300007265 | Bacteria | 1039 |
| 466 | Ga0099795_10043645 | 3300007788 | Bacteria | 1605 |
| 467 | Ga0105250_10055205 | 3300009092 | Bacteria | 1594 |
| 468 | Ga0105250_10120417 | 3300009092 | Bacteria | 1078 |
| 469 | Ga0105250_10141585 | 3300009092 | Bacteria | 997 |
| 470 | Ga0105240_10007621 | 3300009093 | Bacteria | 15676 |
| 471 | Ga0105240_10013860 | 3300009093 | Bacteria | 11039 |
| 472 | Ga0105240_10021427 | 3300009093 | Bacteria | 8594 |
| 473 | Ga0105240_10022551 | 3300009093 | Bacteria | 8343 |
| 474 | Ga0105240_10025047 | 3300009093 | Bacteria | 7854 |
| 475 | Ga0105240_10027526 | 3300009093 | Bacteria | 7440 |
| 476 | Ga0105240_10104584 | 3300009093 | Bacteria | 3438 |
| 477 | Ga0105240_10113356 | 3300009093 | Bacteria | 3276 |
| 478 | Ga0105240_10175573 | 3300009093 | Bacteria | 2533 |
| 479 | Ga0105240_10254282 | 3300009093 | Bacteria | 2030 |
| 480 | Ga0105240_10715243 | 3300009093 | Unclassified | 1092 |
| 481 | Ga0105240_11774798 | 3300009093 | Unclassified | 643 |
| 482 | Ga0105240_11868822 | 3300009093 | Unclassified | 625 |
| 483 | Ga0111539_11130271 | 3300009094 | Bacteria | 910 |
| 484 | Ga0105245_10006495 | 3300009098 | Bacteria | 10277 |
| 485 | Ga0105245_10014743 | 3300009098 | Bacteria | 6807 |
| 486 | Ga0105245_10063179 | 3300009098 | Bacteria | 3343 |
| 487 | Ga0105245_10064487 | 3300009098 | Bacteria | 3310 |
| 488 | Ga0105245_10378492 | 3300009098 | Bacteria | 1409 |
| 489 | Ga0105247_10001928 | 3300009101 | Bacteria | 14455 |
| 490 | Ga0105247_10070177 | 3300009101 | Bacteria | 2188 |
| 491 | Ga0105247_10079259 | 3300009101 | Bacteria | 2067 |
| 492 | Ga0105247_10339017 | 3300009101 | Bacteria | 1054 |
| 493 | Ga0105247_10458712 | 3300009101 | Bacteria | 920 |
| 494 | Ga0105241_10000916 | 3300009174 | Bacteria | 22311 |
| 495 | Ga0105241_10003223 | 3300009174 | Bacteria | 12142 |
| 496 | Ga0105241_10022387 | 3300009174 | Bacteria | 4681 |
| 497 | Ga0105241_10031221 | 3300009174 | Bacteria | 3988 |
| 498 | Ga0105241_10323336 | 3300009174 | Bacteria | 1331 |
| 499 | Ga0105242_10045809 | 3300009176 | Bacteria | 3545 |
| 500 | Ga0105242_10184738 | 3300009176 | Bacteria | 1842 |
| 501 | Ga0105242_10254945 | 3300009176 | Bacteria | 1582 |
| 502 | Ga0105242_11074846 | 3300009176 | Unclassified | 817 |
| 503 | Ga0105242_13171759 | 3300009176 | Unclassified | 510 |
| 504 | Ga0105248_10095292 | 3300009177 | Bacteria | 3351 |
| 505 | Ga0105248_10316778 | 3300009177 | Bacteria | 1757 |
| 506 | Ga0105248_10334484 | 3300009177 | Bacteria | 1705 |
| 507 | Ga0105248_10371816 | 3300009177 | Bacteria | 1609 |
| 508 | Ga0105237_10010811 | 3300009545 | Bacteria | 9685 |
| 509 | Ga0105237_10047409 | 3300009545 | Bacteria | 4320 |
| 510 | Ga0105237_10061462 | 3300009545 | Bacteria | 3755 |
| 511 | Ga0105237_10065472 | 3300009545 | Bacteria | 3631 |
| 512 | Ga0105237_10160607 | 3300009545 | Bacteria | 2246 |
| 513 | Ga0105237_10200670 | 3300009545 | Unclassified | 1994 |
| 514 | Ga0105237_10213745 | 3300009545 | Bacteria | 1928 |
| 515 | Ga0105237_10572746 | 3300009545 | Unclassified | 1136 |
| 516 | Ga0105237_10601658 | 3300009545 | Unclassified | 1107 |
| 517 | Ga0105237_10637221 | 3300009545 | Bacteria | 1073 |
| 518 | Ga0105238_10000533 | 3300009551 | Bacteria | 39822 |
| 519 | Ga0105238_10005181 | 3300009551 | Bacteria | 12883 |
| 520 | Ga0105238_10018190 | 3300009551 | Bacteria | 7146 |
| 521 | Ga0105238_10345765 | 3300009551 | Bacteria | 1476 |
| 522 | Ga0105238_10622744 | 3300009551 | Bacteria | 1088 |
| 523 | Ga0105238_10623030 | 3300009551 | Unclassified | 1088 |
| 524 | Ga0105238_10647210 | 3300009551 | Bacteria | 1067 |
| 525 | Ga0105249_10002069 | 3300009553 | Bacteria | 17385 |
| 526 | Ga0105249_10006862 | 3300009553 | Bacteria | 9931 |
| 527 | Ga0105249_10021522 | 3300009553 | Bacteria | 5773 |
| 528 | Ga0105249_10217668 | 3300009553 | Bacteria | 1878 |
| 529 | Ga0099796_10065184 | 3300010159 | Bacteria | 1302 |
| 530 | Ga0105239_10006785 | 3300010375 | Bacteria | 13217 |
| 531 | Ga0105239_10007480 | 3300010375 | Bacteria | 12537 |
| 532 | Ga0105239_10050561 | 3300010375 | Bacteria | 4558 |
| 533 | Ga0105239_10096517 | 3300010375 | Bacteria | 3266 |
| 534 | Ga0105239_10112070 | 3300010375 | Bacteria | 3024 |
| 535 | Ga0105239_10446777 | 3300010375 | Bacteria | 1466 |
| 536 | Ga0105246_10001260 | 3300011119 | Bacteria | 14866 |
| 537 | Ga0105246_10016393 | 3300011119 | Bacteria | 4692 |
| 538 | Ga0105246_10056385 | 3300011119 | Bacteria | 2716 |
| 539 | Ga0105246_10320392 | 3300011119 | Bacteria | 1259 |
| 540 | Ga0157373_10000288 | 3300013100 | Bacteria | 40421 |
| 541 | Ga0157373_10025303 | 3300013100 | Bacteria | 4295 |
| 542 | Ga0157373_10039846 | 3300013100 | Bacteria | 3362 |
| 543 | Ga0157373_10057653 | 3300013100 | Bacteria | 2755 |
| 544 | Ga0157373_10252112 | 3300013100 | Bacteria | 1248 |
| 545 | Ga0157373_11324032 | 3300013100 | Unclassified | 546 |
| 546 | Ga0157371_10004724 | 3300013102 | Bacteria | 11769 |
| 547 | Ga0157371_10008279 | 3300013102 | Bacteria | 8303 |
| 548 | Ga0157371_10074331 | 3300013102 | Bacteria | 2407 |
| 549 | Ga0157370_10010473 | 3300013104 | Bacteria | 9764 |
| 550 | Ga0157370_10253785 | 3300013104 | Unclassified | 1626 |
| 551 | Ga0157370_10278282 | 3300013104 | Bacteria | 1546 |
| 552 | Ga0157370_10884554 | 3300013104 | Bacteria | 811 |
| 553 | Ga0157370_10989186 | 3300013104 | Unclassified | 762 |
| 554 | Ga0157369_10000170 | 3300013105 | Bacteria | 91583 |
| 555 | Ga0157369_10012417 | 3300013105 | Bacteria | 9668 |
| 556 | Ga0157369_10030994 | 3300013105 | Bacteria | 5893 |
| 557 | Ga0157369_10089041 | 3300013105 | Bacteria | 3295 |
| 558 | Ga0157369_10100163 | 3300013105 | Bacteria | 3089 |
| 559 | Ga0157369_10142571 | 3300013105 | Bacteria | 2534 |
| 560 | Ga0157369_10751932 | 3300013105 | Bacteria | 1003 |
| 561 | Ga0157369_12368184 | 3300013105 | Unclassified | 538 |
| 562 | Ga0157374_10000316 | 3300013296 | Bacteria | 44946 |
| 563 | Ga0157374_10000330 | 3300013296 | Bacteria | 43615 |
| 564 | Ga0157374_10000533 | 3300013296 | Bacteria | 34093 |
| 565 | Ga0157374_10003747 | 3300013296 | Bacteria | 12773 |
| 566 | Ga0157374_10044724 | 3300013296 | Unclassified | 4093 |
| 567 | Ga0157374_10093741 | 3300013296 | Bacteria | 2868 |
| 568 | Ga0157374_10108158 | 3300013296 | Bacteria | 2672 |
| 569 | Ga0157374_10111176 | 3300013296 | Bacteria | 2635 |
| 570 | Ga0157374_10895945 | 3300013296 | Bacteria | 905 |
| 571 | Ga0157374_11707748 | 3300013296 | Unclassified | 654 |
| 572 | Ga0157374_12246990 | 3300013296 | Unclassified | 573 |
| 573 | Ga0157378_10000085 | 3300013297 | Bacteria | 87651 |
| 574 | Ga0157378_10000182 | 3300013297 | Bacteria | 60024 |
| 575 | Ga0157378_10000924 | 3300013297 | Bacteria | 27038 |
| 576 | Ga0157378_10025170 | 3300013297 | Bacteria | 5244 |
| 577 | Ga0157378_10093762 | 3300013297 | Bacteria | 2734 |
| 578 | Ga0157378_10203910 | 3300013297 | Bacteria | 1872 |
| 579 | Ga0157378_10229872 | 3300013297 | Bacteria | 1767 |
| 580 | Ga0157378_10342086 | 3300013297 | Unclassified | 1459 |
| 581 | Ga0157378_10556177 | 3300013297 | Bacteria | 1153 |
| 582 | Ga0157378_11295854 | 3300013297 | Bacteria | 770 |
| 583 | Ga0163162_10001077 | 3300013306 | Bacteria | 25415 |
| 584 | Ga0163162_10016811 | 3300013306 | Bacteria | 7150 |
| 585 | Ga0163162_10051295 | 3300013306 | Bacteria | 4139 |
| 586 | Ga0163162_10147284 | 3300013306 | Bacteria | 2471 |
| 587 | Ga0163162_10970233 | 3300013306 | Bacteria | 960 |
| 588 | Ga0157372_10000504 | 3300013307 | Bacteria | 42933 |
| 589 | Ga0157372_10000620 | 3300013307 | Bacteria | 38778 |
| 590 | Ga0157372_10001563 | 3300013307 | Bacteria | 24933 |
| 591 | Ga0157372_10002374 | 3300013307 | Bacteria | 20377 |
| 592 | Ga0157372_10003529 | 3300013307 | Bacteria | 16848 |
| 593 | Ga0157372_10005602 | 3300013307 | Bacteria | 13352 |
| 594 | Ga0157372_10006002 | 3300013307 | Bacteria | 12905 |
| 595 | Ga0157372_10012821 | 3300013307 | Bacteria | 8933 |
| 596 | Ga0157372_10019856 | 3300013307 | Bacteria | 7241 |
| 597 | Ga0157372_10027371 | 3300013307 | Bacteria | 6207 |
| 598 | Ga0157372_10057292 | 3300013307 | Bacteria | 4355 |
| 599 | Ga0157372_10116652 | 3300013307 | Bacteria | 3061 |
| 600 | Ga0157372_10131676 | 3300013307 | Bacteria | 2877 |
| 601 | Ga0157372_10210955 | 3300013307 | Bacteria | 2251 |
| 602 | Ga0157372_10426370 | 3300013307 | Bacteria | 1546 |
| 603 | Ga0157372_11316169 | 3300013307 | Bacteria | 834 |
| 604 | Ga0157375_12202760 | 3300013308 | Unclassified | 656 |
| 605 | Ga0157375_13069503 | 3300013308 | Unclassified | 557 |
| 606 | Ga0157375_13605409 | 3300013308 | Unclassified | 515 |
| 607 | Ga0163163_10010337 | 3300014325 | Bacteria | 8384 |
| 608 | Ga0163163_10026579 | 3300014325 | Bacteria | 5535 |
| 609 | Ga0163163_10097597 | 3300014325 | Bacteria | 2959 |
| 610 | Ga0163163_10102847 | 3300014325 | Bacteria | 2881 |
| 611 | Ga0163163_10324039 | 3300014325 | Bacteria | 1594 |
| 612 | Ga0163163_10414850 | 3300014325 | Bacteria | 1405 |
| 613 | Ga0182008_10003217 | 3300014497 | Bacteria | 9975 |
| 614 | Ga0182008_10023722 | 3300014497 | Bacteria | 3128 |
| 615 | Ga0157377_10003658 | 3300014745 | Bacteria | 6973 |
| 616 | Ga0157377_10172352 | 3300014745 | Bacteria | 1354 |
| 617 | Ga0157379_10000791 | 3300014968 | Bacteria | 25671 |
| 618 | Ga0157379_10023673 | 3300014968 | Bacteria | 5451 |
| 619 | Ga0157379_10038649 | 3300014968 | Bacteria | 4257 |
| 620 | Ga0157379_10066305 | 3300014968 | Bacteria | 3227 |
| 621 | Ga0157379_10255717 | 3300014968 | Bacteria | 1591 |
| 622 | Ga0157379_10432937 | 3300014968 | Bacteria | 1212 |
| 623 | Ga0157376_10009674 | 3300014969 | Bacteria | 7015 |
| 624 | Ga0157376_10064429 | 3300014969 | Bacteria | 3091 |
| 625 | Ga0157376_10088762 | 3300014969 | Bacteria | 2672 |
| 626 | Ga0157376_10129801 | 3300014969 | Bacteria | 2247 |
| 627 | Ga0157376_10538200 | 3300014969 | Bacteria | 1154 |
| 628 | Ga0157376_10650055 | 3300014969 | Viruses | 1055 |
| 629 | Ga0157376_10864868 | 3300014969 | Bacteria | 920 |
| 630 | Ga0157376_11936142 | 3300014969 | Unclassified | 627 |
| 631 | Ga0182006_1019129 | 3300015261 | Bacteria | 2887 |
| 632 | Ga0182007_10001556 | 3300015262 | Bacteria | 12230 |
| 633 | Ga0182007_10022074 | 3300015262 | Bacteria | 2252 |
| 634 | Ga0182005_1016896 | 3300015265 | Bacteria | 2023 |
| 635 | Ga0163161_10058965 | 3300017792 | Bacteria | 2791 |
| 636 | Ga0163161_10494140 | 3300017792 | Bacteria | 995 |
| 637 | Ga0213874_10166228 | 3300021377 | Bacteria | 778 |
| 638 | Ga0213871_10034000 | 3300021441 | Bacteria | 1342 |
| 639 | Ga0224570_100090 | 3300022730 | Bacteria | 5398 |
| 640 | Ga0224569_102128 | 3300022732 | Bacteria | 1637 |
| 641 | Ga0224572_1001260 | 3300024225 | Bacteria | 3645 |
| 642 | Ga0224572_1006373 | 3300024225 | Bacteria | 2133 |
| 643 | Ga0224572_1050959 | 3300024225 | Bacteria | 771 |
| 644 | Ga0228598_1001197 | 3300024227 | Bacteria | 5732 |
| 645 | Ga0228598_1001295 | 3300024227 | Bacteria | 5502 |
| 646 | Ga0228598_1003153 | 3300024227 | Bacteria | 3568 |
| 647 | Ga0228598_1010611 | 3300024227 | Unclassified | 1833 |
| 648 | Ga0207697_10007399 | 3300025315 | Bacteria | 4901 |
| 649 | Ga0207656_10270253 | 3300025321 | Bacteria | 836 |
| 650 | Ga0207656_10346402 | 3300025321 | Bacteria | 741 |
| 651 | Ga0207692_10014791 | 3300025898 | Bacteria | 3417 |
| 652 | Ga0207692_10021671 | 3300025898 | Bacteria | 2943 |
| 653 | Ga0207692_10041283 | 3300025898 | Bacteria | 2283 |
| 654 | Ga0207692_10043923 | 3300025898 | Bacteria | 2227 |
| 655 | Ga0207692_10044990 | 3300025898 | Bacteria | 2206 |
| 656 | Ga0207692_10061411 | 3300025898 | Bacteria | 1947 |
| 657 | Ga0207692_10081692 | 3300025898 | Bacteria | 1730 |
| 658 | Ga0207692_10527302 | 3300025898 | Bacteria | 752 |
| 659 | Ga0207692_10665267 | 3300025898 | Bacteria | 674 |
| 660 | Ga0207692_10716580 | 3300025898 | Unclassified | 650 |
| 661 | Ga0207642_10009113 | 3300025899 | Bacteria | 3438 |
| 662 | Ga0207642_10013622 | 3300025899 | Bacteria | 2973 |
| 663 | Ga0207642_10318506 | 3300025899 | Unclassified | 907 |
| 664 | Ga0207710_10002674 | 3300025900 | Bacteria | 8195 |
| 665 | Ga0207710_10324250 | 3300025900 | Bacteria | 781 |
| 666 | Ga0207688_10007680 | 3300025901 | Bacteria | 5872 |
| 667 | Ga0207680_10094289 | 3300025903 | Bacteria | 1911 |
| 668 | Ga0207680_10120604 | 3300025903 | Bacteria | 1714 |
| 669 | Ga0207680_10155328 | 3300025903 | Bacteria | 1529 |
| 670 | Ga0207647_10006395 | 3300025904 | Bacteria | 8567 |
| 671 | Ga0207647_10021548 | 3300025904 | Unclassified | 4301 |
| 672 | Ga0207647_10026162 | 3300025904 | Bacteria | 3821 |
| 673 | Ga0207647_10038205 | 3300025904 | Bacteria | 3037 |
| 674 | Ga0207685_10005599 | 3300025905 | Bacteria | 3335 |
| 675 | Ga0207685_10015359 | 3300025905 | Bacteria | 2424 |
| 676 | Ga0207685_10047595 | 3300025905 | Bacteria | 1638 |
| 677 | Ga0207685_10091752 | 3300025905 | Bacteria | 1280 |
| 678 | Ga0207685_10368683 | 3300025905 | Bacteria | 728 |
| 679 | Ga0207685_10374503 | 3300025905 | Bacteria | 724 |
| 680 | Ga0207699_10006949 | 3300025906 | Bacteria | 5512 |
| 681 | Ga0207699_10011142 | 3300025906 | Bacteria | 4531 |
| 682 | Ga0207699_10014789 | 3300025906 | Bacteria | 4036 |
| 683 | Ga0207699_10050376 | 3300025906 | Bacteria | 2455 |
| 684 | Ga0207699_10071036 | 3300025906 | Bacteria | 2127 |
| 685 | Ga0207699_10092829 | 3300025906 | Bacteria | 1898 |
| 686 | Ga0207699_10098615 | 3300025906 | Bacteria | 1849 |
| 687 | Ga0207699_10102345 | 3300025906 | Bacteria | 1820 |
| 688 | Ga0207699_10123868 | 3300025906 | Bacteria | 1676 |
| 689 | Ga0207699_10259783 | 3300025906 | Bacteria | 1200 |
| 690 | Ga0207699_10262814 | 3300025906 | Bacteria | 1193 |
| 691 | Ga0207699_10474242 | 3300025906 | Bacteria | 900 |
| 692 | Ga0207699_10737767 | 3300025906 | Bacteria | 722 |
| 693 | Ga0207699_11035511 | 3300025906 | Unclassified | 607 |
| 694 | Ga0207699_11057704 | 3300025906 | Bacteria | 600 |
| 695 | Ga0207645_10000181 | 3300025907 | Bacteria | 50200 |
| 696 | Ga0207645_10239939 | 3300025907 | Bacteria | 1197 |
| 697 | Ga0207643_10000474 | 3300025908 | Bacteria | 25980 |
| 698 | Ga0207643_10193945 | 3300025908 | Bacteria | 1234 |
| 699 | Ga0207705_10846676 | 3300025909 | Bacteria | 709 |
| 700 | Ga0207705_11029136 | 3300025909 | Unclassified | 636 |
| 701 | Ga0207684_10000217 | 3300025910 | Bacteria | 88691 |
| 702 | Ga0207684_10000267 | 3300025910 | Bacteria | 77172 |
| 703 | Ga0207684_10006270 | 3300025910 | Bacteria | 10851 |
| 704 | Ga0207684_10029324 | 3300025910 | Bacteria | 4687 |
| 705 | Ga0207684_10282610 | 3300025910 | Bacteria | 1431 |
| 706 | Ga0207684_10322565 | 3300025910 | Bacteria | 1331 |
| 707 | Ga0207684_10643037 | 3300025910 | Bacteria | 904 |
| 708 | Ga0207654_10006558 | 3300025911 | Bacteria | 5852 |
| 709 | Ga0207654_10007076 | 3300025911 | Bacteria | 5654 |
| 710 | Ga0207654_10030891 | 3300025911 | Bacteria | 2945 |
| 711 | Ga0207654_10128336 | 3300025911 | Bacteria | 1602 |
| 712 | Ga0207654_10147974 | 3300025911 | Bacteria | 1504 |
| 713 | Ga0207654_10159214 | 3300025911 | Bacteria | 1457 |
| 714 | Ga0207707_10000739 | 3300025912 | Bacteria | 32307 |
| 715 | Ga0207707_10093271 | 3300025912 | Bacteria | 2630 |
| 716 | Ga0207707_10098070 | 3300025912 | Bacteria | 2562 |
| 717 | Ga0207707_10116639 | 3300025912 | Bacteria | 2333 |
| 718 | Ga0207707_10125156 | 3300025912 | Bacteria | 2248 |
| 719 | Ga0207707_10910238 | 3300025912 | Bacteria | 727 |
| 720 | Ga0207695_10007408 | 3300025913 | Bacteria | 13981 |
| 721 | Ga0207695_10022440 | 3300025913 | Bacteria | 7163 |
| 722 | Ga0207695_10037646 | 3300025913 | Bacteria | 5218 |
| 723 | Ga0207695_10072134 | 3300025913 | Bacteria | 3525 |
| 724 | Ga0207695_10075457 | 3300025913 | Bacteria | 3430 |
| 725 | Ga0207695_10109531 | 3300025913 | Bacteria | 2743 |
| 726 | Ga0207695_10123755 | 3300025913 | Bacteria | 2551 |
| 727 | Ga0207695_10372110 | 3300025913 | Bacteria | 1315 |
| 728 | Ga0207695_10960423 | 3300025913 | Unclassified | 734 |
| 729 | Ga0207671_10024462 | 3300025914 | Bacteria | 4542 |
| 730 | Ga0207671_10030939 | 3300025914 | Bacteria | 3991 |
| 731 | Ga0207671_10032741 | 3300025914 | Bacteria | 3867 |
| 732 | Ga0207671_10099930 | 3300025914 | Bacteria | 2196 |
| 733 | Ga0207671_10138047 | 3300025914 | Unclassified | 1876 |
| 734 | Ga0207671_10611092 | 3300025914 | Bacteria | 869 |
| 735 | Ga0207671_11000955 | 3300025914 | Unclassified | 659 |
| 736 | Ga0207693_10000089 | 3300025915 | Bacteria | 81143 |
| 737 | Ga0207693_10000106 | 3300025915 | Bacteria | 75776 |
| 738 | Ga0207693_10000478 | 3300025915 | Bacteria | 36490 |
| 739 | Ga0207693_10002945 | 3300025915 | Bacteria | 14737 |
| 740 | Ga0207693_10007165 | 3300025915 | Bacteria | 9190 |
| 741 | Ga0207693_10013816 | 3300025915 | Bacteria | 6501 |
| 742 | Ga0207693_10026924 | 3300025915 | Bacteria | 4548 |
| 743 | Ga0207693_10046217 | 3300025915 | Bacteria | 3420 |
| 744 | Ga0207693_10128351 | 3300025915 | Bacteria | 1993 |
| 745 | Ga0207693_10133114 | 3300025915 | Bacteria | 1954 |
| 746 | Ga0207693_10178348 | 3300025915 | Bacteria | 1671 |
| 747 | Ga0207693_10289648 | 3300025915 | Bacteria | 1283 |
| 748 | Ga0207693_10834232 | 3300025915 | Bacteria | 709 |
| 749 | Ga0207693_11119766 | 3300025915 | Bacteria | 597 |
| 750 | Ga0207663_10001049 | 3300025916 | Bacteria | 12676 |
| 751 | Ga0207663_10005124 | 3300025916 | Bacteria | 6588 |
| 752 | Ga0207663_10036016 | 3300025916 | Bacteria | 2974 |
| 753 | Ga0207663_10045885 | 3300025916 | Bacteria | 2690 |
| 754 | Ga0207663_10050065 | 3300025916 | Bacteria | 2594 |
| 755 | Ga0207663_10067326 | 3300025916 | Bacteria | 2296 |
| 756 | Ga0207663_10083265 | 3300025916 | Bacteria | 2101 |
| 757 | Ga0207663_10101173 | 3300025916 | Bacteria | 1936 |
| 758 | Ga0207663_10111144 | 3300025916 | Bacteria | 1859 |
| 759 | Ga0207663_10172153 | 3300025916 | Bacteria | 1539 |
| 760 | Ga0207663_10307978 | 3300025916 | Bacteria | 1186 |
| 761 | Ga0207663_10330244 | 3300025916 | Bacteria | 1148 |
| 762 | Ga0207663_10531406 | 3300025916 | Bacteria | 917 |
| 763 | Ga0207663_10767062 | 3300025916 | Bacteria | 767 |
| 764 | Ga0207663_10784502 | 3300025916 | Bacteria | 758 |
| 765 | Ga0207663_10961387 | 3300025916 | Bacteria | 684 |
| 766 | Ga0207663_11166378 | 3300025916 | Bacteria | 620 |
| 767 | Ga0207663_11604146 | 3300025916 | Unclassified | 524 |
| 768 | Ga0207660_10073963 | 3300025917 | Bacteria | 2486 |
| 769 | Ga0207660_10080008 | 3300025917 | Bacteria | 2398 |
| 770 | Ga0207660_10274268 | 3300025917 | Bacteria | 1337 |
| 771 | Ga0207660_10486656 | 3300025917 | Bacteria | 1000 |
| 772 | Ga0207662_10005327 | 3300025918 | Bacteria | 6843 |
| 773 | Ga0207657_10000535 | 3300025919 | Bacteria | 40427 |
| 774 | Ga0207657_10001828 | 3300025919 | Bacteria | 22959 |
| 775 | Ga0207657_10002724 | 3300025919 | Bacteria | 19022 |
| 776 | Ga0207649_10001639 | 3300025920 | Bacteria | 12996 |
| 777 | Ga0207649_10005022 | 3300025920 | Bacteria | 7155 |
| 778 | Ga0207649_10008845 | 3300025920 | Bacteria | 5499 |
| 779 | Ga0207649_10063863 | 3300025920 | Bacteria | 2326 |
| 780 | Ga0207649_10158581 | 3300025920 | Bacteria | 1566 |
| 781 | Ga0207652_10052293 | 3300025921 | Bacteria | 3505 |
| 782 | Ga0207652_10139606 | 3300025921 | Bacteria | 2166 |
| 783 | Ga0207652_10276842 | 3300025921 | Bacteria | 1514 |
| 784 | Ga0207652_10402529 | 3300025921 | Unclassified | 1235 |
| 785 | Ga0207652_10737636 | 3300025921 | Bacteria | 877 |
| 786 | Ga0207646_10000296 | 3300025922 | Bacteria | 67683 |
| 787 | Ga0207646_10001311 | 3300025922 | Bacteria | 30882 |
| 788 | Ga0207646_10010514 | 3300025922 | Bacteria | 9032 |
| 789 | Ga0207646_10028179 | 3300025922 | Bacteria | 5115 |
| 790 | Ga0207646_10046246 | 3300025922 | Bacteria | 3905 |
| 791 | Ga0207646_10046789 | 3300025922 | Bacteria | 3881 |
| 792 | Ga0207646_10077906 | 3300025922 | Bacteria | 2962 |
| 793 | Ga0207646_10231800 | 3300025922 | Bacteria | 1668 |
| 794 | Ga0207646_10365106 | 3300025922 | Bacteria | 1304 |
| 795 | Ga0207646_10385148 | 3300025922 | Bacteria | 1267 |
| 796 | Ga0207646_10667664 | 3300025922 | Bacteria | 930 |
| 797 | Ga0207646_11296974 | 3300025922 | Unclassified | 636 |
| 798 | Ga0207681_10038573 | 3300025923 | Bacteria | 3166 |
| 799 | Ga0207681_10076422 | 3300025923 | Bacteria | 2352 |
| 800 | Ga0207681_10197599 | 3300025923 | Bacteria | 1542 |
| 801 | Ga0207694_10001172 | 3300025924 | Bacteria | 22716 |
| 802 | Ga0207694_10029940 | 3300025924 | Bacteria | 4157 |
| 803 | Ga0207694_10030975 | 3300025924 | Bacteria | 4085 |
| 804 | Ga0207694_10113628 | 3300025924 | Bacteria | 2156 |
| 805 | Ga0207650_10000223 | 3300025925 | Bacteria | 64087 |
| 806 | Ga0207650_10121450 | 3300025925 | Bacteria | 2035 |
| 807 | Ga0207659_10433888 | 3300025926 | Bacteria | 1104 |
| 808 | Ga0207687_10003198 | 3300025927 | Bacteria | 11100 |
| 809 | Ga0207687_10016635 | 3300025927 | Bacteria | 4832 |
| 810 | Ga0207687_10064399 | 3300025927 | Bacteria | 2599 |
| 811 | Ga0207687_10252179 | 3300025927 | Bacteria | 1403 |
| 812 | Ga0207700_10000289 | 3300025928 | Bacteria | 29760 |
| 813 | Ga0207700_10000888 | 3300025928 | Bacteria | 17211 |
| 814 | Ga0207700_10001971 | 3300025928 | Bacteria | 11690 |
| 815 | Ga0207700_10038958 | 3300025928 | Bacteria | 3455 |
| 816 | Ga0207700_10041701 | 3300025928 | Bacteria | 3360 |
| 817 | Ga0207700_10064554 | 3300025928 | Bacteria | 2789 |
| 818 | Ga0207700_10093084 | 3300025928 | Bacteria | 2384 |
| 819 | Ga0207700_10103713 | 3300025928 | Bacteria | 2274 |
| 820 | Ga0207700_10136066 | 3300025928 | Bacteria | 2013 |
| 821 | Ga0207700_10138557 | 3300025928 | Bacteria | 1996 |
| 822 | Ga0207700_10154392 | 3300025928 | Bacteria | 1900 |
| 823 | Ga0207700_10188701 | 3300025928 | Bacteria | 1731 |
| 824 | Ga0207700_10244351 | 3300025928 | Bacteria | 1531 |
| 825 | Ga0207700_10324223 | 3300025928 | Bacteria | 1335 |
| 826 | Ga0207700_10353459 | 3300025928 | Bacteria | 1280 |
| 827 | Ga0207700_10378154 | 3300025928 | Bacteria | 1238 |
| 828 | Ga0207700_10503373 | 3300025928 | Bacteria | 1072 |
| 829 | Ga0207700_10616269 | 3300025928 | Bacteria | 966 |
| 830 | Ga0207700_10958648 | 3300025928 | Bacteria | 766 |
| 831 | Ga0207700_11826428 | 3300025928 | Unclassified | 534 |
| 832 | Ga0207664_10000118 | 3300025929 | Bacteria | 69258 |
| 833 | Ga0207664_10003882 | 3300025929 | Bacteria | 10040 |
| 834 | Ga0207664_10033923 | 3300025929 | Bacteria | 3927 |
| 835 | Ga0207664_10041140 | 3300025929 | Bacteria | 3599 |
| 836 | Ga0207664_10073025 | 3300025929 | Bacteria | 2767 |
| 837 | Ga0207664_10093195 | 3300025929 | Bacteria | 2473 |
| 838 | Ga0207664_10136743 | 3300025929 | Bacteria | 2068 |
| 839 | Ga0207664_10138640 | 3300025929 | Bacteria | 2055 |
| 840 | Ga0207664_10166224 | 3300025929 | Bacteria | 1885 |
| 841 | Ga0207664_10177089 | 3300025929 | Bacteria | 1829 |
| 842 | Ga0207664_10263335 | 3300025929 | Bacteria | 1508 |
| 843 | Ga0207664_10298559 | 3300025929 | Bacteria | 1417 |
| 844 | Ga0207664_10367275 | 3300025929 | Bacteria | 1276 |
| 845 | Ga0207664_10392115 | 3300025929 | Bacteria | 1234 |
| 846 | Ga0207664_10660827 | 3300025929 | Bacteria | 939 |
| 847 | Ga0207664_11027098 | 3300025929 | Bacteria | 738 |
| 848 | Ga0207664_11149802 | 3300025929 | Bacteria | 693 |
| 849 | Ga0207664_11450318 | 3300025929 | Unclassified | 607 |
| 850 | Ga0207664_11509216 | 3300025929 | Unclassified | 594 |
| 851 | Ga0207644_10050252 | 3300025931 | Bacteria | 2988 |
| 852 | Ga0207644_10053693 | 3300025931 | Bacteria | 2900 |
| 853 | Ga0207644_11608850 | 3300025931 | Unclassified | 545 |
| 854 | Ga0207690_10004009 | 3300025932 | Bacteria | 8694 |
| 855 | Ga0207690_10018828 | 3300025932 | Bacteria | 4240 |
| 856 | Ga0207690_10047080 | 3300025932 | Bacteria | 2859 |
| 857 | Ga0207690_10140491 | 3300025932 | Bacteria | 1779 |
| 858 | Ga0207706_10000613 | 3300025933 | Bacteria | 37863 |
| 859 | Ga0207706_10000670 | 3300025933 | Bacteria | 35982 |
| 860 | Ga0207706_10010049 | 3300025933 | Bacteria | 8671 |
| 861 | Ga0207706_10762621 | 3300025933 | Bacteria | 824 |
| 862 | Ga0207686_10038694 | 3300025934 | Bacteria | 2888 |
| 863 | Ga0207686_10133109 | 3300025934 | Bacteria | 1708 |
| 864 | Ga0207686_10169668 | 3300025934 | Bacteria | 1538 |
| 865 | Ga0207686_10180694 | 3300025934 | Bacteria | 1496 |
| 866 | Ga0207709_10018165 | 3300025935 | Bacteria | 3934 |
| 867 | Ga0207670_10019581 | 3300025936 | Bacteria | 4136 |
| 868 | Ga0207670_10291076 | 3300025936 | Bacteria | 1276 |
| 869 | Ga0207669_10042896 | 3300025937 | Bacteria | 2645 |
| 870 | Ga0207669_10375173 | 3300025937 | Bacteria | 1107 |
| 871 | Ga0207704_10047312 | 3300025938 | Bacteria | 2570 |
| 872 | Ga0207704_10097235 | 3300025938 | Bacteria | 1952 |
| 873 | Ga0207704_10205401 | 3300025938 | Bacteria | 1445 |
| 874 | Ga0207665_10001184 | 3300025939 | Bacteria | 17548 |
| 875 | Ga0207665_10001526 | 3300025939 | Bacteria | 15570 |
| 876 | Ga0207665_10001917 | 3300025939 | Bacteria | 14012 |
| 877 | Ga0207665_10007063 | 3300025939 | Bacteria | 7434 |
| 878 | Ga0207665_10018476 | 3300025939 | Bacteria | 4581 |
| 879 | Ga0207665_10036854 | 3300025939 | Bacteria | 3254 |
| 880 | Ga0207665_10051007 | 3300025939 | Bacteria | 2784 |
| 881 | Ga0207665_10068713 | 3300025939 | Bacteria | 2415 |
| 882 | Ga0207665_10163525 | 3300025939 | Bacteria | 1603 |
| 883 | Ga0207665_10187819 | 3300025939 | Bacteria | 1500 |
| 884 | Ga0207665_10323754 | 3300025939 | Bacteria | 1157 |
| 885 | Ga0207665_10371240 | 3300025939 | Bacteria | 1084 |
| 886 | Ga0207665_10512677 | 3300025939 | Unclassified | 928 |
| 887 | Ga0207665_10515676 | 3300025939 | Bacteria | 925 |
| 888 | Ga0207665_10560930 | 3300025939 | Unclassified | 888 |
| 889 | Ga0207665_11054793 | 3300025939 | Unclassified | 647 |
| 890 | Ga0207665_11103812 | 3300025939 | Unclassified | 632 |
| 891 | Ga0207691_10000345 | 3300025940 | Bacteria | 46775 |
| 892 | Ga0207691_10206787 | 3300025940 | Bacteria | 1707 |
| 893 | Ga0207691_10686022 | 3300025940 | Unclassified | 864 |
| 894 | Ga0207711_10024220 | 3300025941 | Bacteria | 5080 |
| 895 | Ga0207711_10031511 | 3300025941 | Bacteria | 4476 |
| 896 | Ga0207711_10210624 | 3300025941 | Bacteria | 1775 |
| 897 | Ga0207711_10282130 | 3300025941 | Bacteria | 1530 |
| 898 | Ga0207689_10000499 | 3300025942 | Bacteria | 37043 |
| 899 | Ga0207689_10004722 | 3300025942 | Bacteria | 12297 |
| 900 | Ga0207689_10034521 | 3300025942 | Bacteria | 4201 |
| 901 | Ga0207689_10056056 | 3300025942 | Bacteria | 3243 |
| 902 | Ga0207661_10001212 | 3300025944 | Bacteria | 17237 |
| 903 | Ga0207661_10014609 | 3300025944 | Bacteria | 5759 |
| 904 | Ga0207661_10246278 | 3300025944 | Bacteria | 1587 |
| 905 | Ga0207661_10387609 | 3300025944 | Bacteria | 1265 |
| 906 | Ga0207661_10414098 | 3300025944 | Bacteria | 1223 |
| 907 | Ga0207679_10000115 | 3300025945 | Bacteria | 64466 |
| 908 | Ga0207679_10004660 | 3300025945 | Bacteria | 8540 |
| 909 | Ga0207679_10036871 | 3300025945 | Bacteria | 3471 |
| 910 | Ga0207679_10043935 | 3300025945 | Bacteria | 3221 |
| 911 | Ga0207679_11058595 | 3300025945 | Unclassified | 744 |
| 912 | Ga0207667_10000785 | 3300025949 | Bacteria | 41249 |
| 913 | Ga0207667_10003707 | 3300025949 | Bacteria | 18846 |
| 914 | Ga0207667_10012312 | 3300025949 | Bacteria | 9868 |
| 915 | Ga0207667_10041063 | 3300025949 | Bacteria | 4921 |
| 916 | Ga0207667_10057513 | 3300025949 | Bacteria | 4082 |
| 917 | Ga0207667_10083773 | 3300025949 | Bacteria | 3302 |
| 918 | Ga0207651_10028184 | 3300025960 | Bacteria | 3539 |
| 919 | Ga0207651_10043996 | 3300025960 | Bacteria | 2984 |
| 920 | Ga0207651_11150338 | 3300025960 | Unclassified | 696 |
| 921 | Ga0207712_10012010 | 3300025961 | Bacteria | 5527 |
| 922 | Ga0207712_10064748 | 3300025961 | Bacteria | 2607 |
| 923 | Ga0207668_10091740 | 3300025972 | Bacteria | 2233 |
| 924 | Ga0207668_10107238 | 3300025972 | Bacteria | 2088 |
| 925 | Ga0207640_10004082 | 3300025981 | Bacteria | 7892 |
| 926 | Ga0207640_10018685 | 3300025981 | Bacteria | 4079 |
| 927 | Ga0207640_10024613 | 3300025981 | Bacteria | 3634 |
| 928 | Ga0207640_10025664 | 3300025981 | Bacteria | 3570 |
| 929 | Ga0207640_10092094 | 3300025981 | Bacteria | 2102 |
| 930 | Ga0207640_10394309 | 3300025981 | Bacteria | 1125 |
| 931 | Ga0207640_11103811 | 3300025981 | Unclassified | 702 |
| 932 | Ga0207640_12025149 | 3300025981 | Unclassified | 522 |
| 933 | Ga0207658_10039444 | 3300025986 | Bacteria | 3407 |
| 934 | Ga0207677_10002530 | 3300026023 | Bacteria | 9583 |
| 935 | Ga0207677_10003252 | 3300026023 | Bacteria | 8581 |
| 936 | Ga0207677_10007719 | 3300026023 | Bacteria | 5972 |
| 937 | Ga0207677_10019421 | 3300026023 | Bacteria | 4104 |
| 938 | Ga0207677_10026550 | 3300026023 | Bacteria | 3635 |
| 939 | Ga0207677_10096354 | 3300026023 | Bacteria | 2165 |
| 940 | Ga0207703_10004647 | 3300026035 | Bacteria | 11216 |
| 941 | Ga0207703_10007943 | 3300026035 | Bacteria | 8385 |
| 942 | Ga0207703_10027824 | 3300026035 | Bacteria | 4453 |
| 943 | Ga0207703_10119007 | 3300026035 | Bacteria | 2265 |
| 944 | Ga0207703_10126739 | 3300026035 | Bacteria | 2199 |
| 945 | Ga0207703_10273360 | 3300026035 | Bacteria | 1532 |
| 946 | Ga0207639_10015221 | 3300026041 | Bacteria | 5420 |
| 947 | Ga0207639_10070409 | 3300026041 | Bacteria | 2732 |
| 948 | Ga0207639_10107358 | 3300026041 | Unclassified | 2268 |
| 949 | Ga0207639_10320961 | 3300026041 | Bacteria | 1375 |
| 950 | Ga0207639_10716238 | 3300026041 | Bacteria | 929 |
| 951 | Ga0207678_10000130 | 3300026067 | Bacteria | 63279 |
| 952 | Ga0207678_10001418 | 3300026067 | Bacteria | 21972 |
| 953 | Ga0207678_10387169 | 3300026067 | Bacteria | 1209 |
| 954 | Ga0207708_10025729 | 3300026075 | Bacteria | 4453 |
| 955 | Ga0207702_10000089 | 3300026078 | Bacteria | 105440 |
| 956 | Ga0207702_10001792 | 3300026078 | Bacteria | 21146 |
| 957 | Ga0207702_10002571 | 3300026078 | Bacteria | 17059 |
| 958 | Ga0207702_10011696 | 3300026078 | Bacteria | 7309 |
| 959 | Ga0207702_10021538 | 3300026078 | Bacteria | 5338 |
| 960 | Ga0207702_10138350 | 3300026078 | Bacteria | 2200 |
| 961 | Ga0207702_10150683 | 3300026078 | Bacteria | 2115 |
| 962 | Ga0207702_10629975 | 3300026078 | Bacteria | 1054 |
| 963 | Ga0207702_10861300 | 3300026078 | Bacteria | 897 |
| 964 | Ga0207641_10000287 | 3300026088 | Bacteria | 63251 |
| 965 | Ga0207641_10017583 | 3300026088 | Bacteria | 5853 |
| 966 | Ga0207641_10032145 | 3300026088 | Bacteria | 4357 |
| 967 | Ga0207641_10083345 | 3300026088 | Bacteria | 2781 |
| 968 | Ga0207641_10144071 | 3300026088 | Bacteria | 2153 |
| 969 | Ga0207641_10178140 | 3300026088 | Bacteria | 1945 |
| 970 | Ga0207641_10260168 | 3300026088 | Bacteria | 1624 |
| 971 | Ga0207641_11132900 | 3300026088 | Viruses | 781 |
| 972 | Ga0207648_10001253 | 3300026089 | Bacteria | 28381 |
| 973 | Ga0207648_10007469 | 3300026089 | Bacteria | 10743 |
| 974 | Ga0207648_10009512 | 3300026089 | Bacteria | 9300 |
| 975 | Ga0207648_10104312 | 3300026089 | Bacteria | 2486 |
| 976 | Ga0207676_10000115 | 3300026095 | Bacteria | 71633 |
| 977 | Ga0207676_10001385 | 3300026095 | Bacteria | 18052 |
| 978 | Ga0207676_10022329 | 3300026095 | Bacteria | 4654 |
| 979 | Ga0207676_10098239 | 3300026095 | Bacteria | 2420 |
| 980 | Ga0207674_10000309 | 3300026116 | Bacteria | 62067 |
| 981 | Ga0207674_10001340 | 3300026116 | Bacteria | 31912 |
| 982 | Ga0207674_10005897 | 3300026116 | Bacteria | 14522 |
| 983 | Ga0207674_10027037 | 3300026116 | Bacteria | 6079 |
| 984 | Ga0207674_10067233 | 3300026116 | Bacteria | 3608 |
| 985 | Ga0207674_10411029 | 3300026116 | Bacteria | 1308 |
| 986 | Ga0207675_100179691 | 3300026118 | Bacteria | 2026 |
| 987 | Ga0207675_101612506 | 3300026118 | Unclassified | 669 |
| 988 | Ga0207683_10000217 | 3300026121 | Bacteria | 50192 |
| 989 | Ga0207683_10047570 | 3300026121 | Bacteria | 3757 |
| 990 | Ga0207683_10220024 | 3300026121 | Bacteria | 1730 |
| 991 | Ga0207683_10460220 | 3300026121 | Bacteria | 1173 |
| 992 | Ga0207698_10005557 | 3300026142 | Bacteria | 7793 |
| 993 | Ga0207698_10034675 | 3300026142 | Bacteria | 3682 |
| 994 | Ga0207698_10086948 | 3300026142 | Bacteria | 2544 |
| 995 | Ga0207698_10122828 | 3300026142 | Bacteria | 2201 |
| 996 | Ga0207698_10544204 | 3300026142 | Bacteria | 1137 |
| 997 | Ga0265356_1000460 | 3300028017 | Bacteria | 7375 |
| 998 | Ga0268266_10000761 | 3300028379 | Bacteria | 43122 |
| 999 | Ga0268266_10208361 | 3300028379 | Bacteria | 1792 |
| 1000 | Ga0268265_10040417 | 3300028380 | Bacteria | 3444 |
| 1001 | Ga0268265_10054561 | 3300028380 | Bacteria | 3033 |
| 1002 | Ga0268265_10079055 | 3300028380 | Bacteria | 2589 |
| 1003 | Ga0268265_10271720 | 3300028380 | Bacteria | 1512 |
| 1004 | Ga0268264_10081808 | 3300028381 | Bacteria | 2761 |
| 1005 | Ga0268264_10128399 | 3300028381 | Bacteria | 2244 |
| 1006 | Ga0268264_10185595 | 3300028381 | Bacteria | 1892 |
| 1007 | Ga0268264_10190056 | 3300028381 | Bacteria | 1871 |
| 1008 | Ga0268264_10280871 | 3300028381 | Bacteria | 1560 |
| 1009 | Ga0268264_10371132 | 3300028381 | Bacteria | 1368 |
| 1010 | Ga0268264_10950407 | 3300028381 | Unclassified | 864 |
| 1011 | Ga0268264_11035657 | 3300028381 | Unclassified | 828 |
| 1012 | Ga0265338_10006709 | 3300028800 | Bacteria | 14542 |
| 1013 | Ga0265338_10023713 | 3300028800 | Bacteria | 6294 |
| 1014 | Ga0265338_10085823 | 3300028800 | Bacteria | 2622 |
| 1015 | Ga0265338_10099173 | 3300028800 | Bacteria | 2380 |
| 1016 | Ga0265338_10141362 | 3300028800 | Bacteria | 1885 |
| 1017 | Ga0265338_10332241 | 3300028800 | Bacteria | 1097 |
| 1018 | Ga0265338_11009597 | 3300028800 | Unclassified | 563 |
| 1019 | Ga0265762_1000555 | 3300030760 | Bacteria | 6533 |
| 1020 | Ga0265762_1001369 | 3300030760 | Bacteria | 4425 |
| 1021 | Ga0265762_1001687 | 3300030760 | Bacteria | 4019 |
| 1022 | Ga0265770_1007389 | 3300030878 | Bacteria | 1546 |
| 1023 | Ga0265770_1040770 | 3300030878 | Bacteria | 812 |
| 1024 | Ga0265770_1066978 | 3300030878 | Bacteria | 678 |
| 1025 | Ga0265760_10002193 | 3300031090 | Bacteria | 5707 |
| 1026 | Ga0265760_10008888 | 3300031090 | Bacteria | 2870 |
| 1027 | Ga0265760_10018621 | 3300031090 | Bacteria | 2000 |
| 1028 | Ga0265760_10054506 | 3300031090 | Bacteria | 1207 |
| 1029 | Ga0265760_10118488 | 3300031090 | Unclassified | 848 |
| 1030 | Ga0265760_10141911 | 3300031090 | Bacteria | 783 |
| 1031 | Ga0265760_10160093 | 3300031090 | Bacteria | 743 |
| 1032 | Ga0265332_10124037 | 3300031238 | Bacteria | 1085 |
| 1033 | Ga0265328_10010953 | 3300031239 | Bacteria | 3637 |
| 1034 | Ga0265325_10173829 | 3300031241 | Bacteria | 1007 |
| 1035 | Ga0265340_10030035 | 3300031247 | Bacteria | 2726 |
| 1036 | Ga0265340_10039248 | 3300031247 | Bacteria | 2337 |
| 1037 | Ga0265340_10064085 | 3300031247 | Unclassified | 1753 |
| 1038 | Ga0265340_10072102 | 3300031247 | Bacteria | 1636 |
| 1039 | Ga0265340_10079574 | 3300031247 | Bacteria | 1545 |
| 1040 | Ga0265339_10005007 | 3300031249 | Bacteria | 8914 |
| 1041 | Ga0265339_10005406 | 3300031249 | Bacteria | 8511 |
| 1042 | Ga0265339_10057224 | 3300031249 | Bacteria | 2108 |
| 1043 | Ga0265339_10110504 | 3300031249 | Bacteria | 1422 |
| 1044 | Ga0265339_10171582 | 3300031249 | Bacteria | 1085 |
| 1045 | Ga0265316_10002496 | 3300031344 | Bacteria | 19052 |
| 1046 | Ga0265316_10026402 | 3300031344 | Bacteria | 4831 |
| 1047 | Ga0265316_10071116 | 3300031344 | Bacteria | 2682 |
| 1048 | Ga0265316_10505109 | 3300031344 | Bacteria | 863 |
| 1049 | Ga0265316_11192118 | 3300031344 | Bacteria | 527 |
| 1050 | Ga0307408_100818075 | 3300031548 | Bacteria | 847 |
| 1051 | Ga0265314_10002671 | 3300031711 | Bacteria | 17879 |
| 1052 | Ga0265314_10010032 | 3300031711 | Bacteria | 7940 |
| 1053 | Ga0265314_10033779 | 3300031711 | Bacteria | 3744 |
| 1054 | Ga0265342_10040359 | 3300031712 | Bacteria | 2831 |
| 1055 | Ga0307405_10110461 | 3300031731 | Bacteria | 1862 |
| 1056 | Ga0307410_10006635 | 3300031852 | Bacteria | 6264 |
| 1057 | Ga0307410_10291128 | 3300031852 | Bacteria | 1285 |
| 1058 | Ga0307406_10887178 | 3300031901 | Bacteria | 758 |
| 1059 | Ga0307407_10148674 | 3300031903 | Bacteria | 1520 |
| 1060 | Ga0307412_10044143 | 3300031911 | Bacteria | 2908 |
| 1061 | Ga0307412_10464530 | 3300031911 | Bacteria | 1046 |
| 1062 | Ga0307412_10773190 | 3300031911 | Unclassified | 831 |
| 1063 | Ga0307412_10866646 | 3300031911 | Bacteria | 789 |
| 1064 | Ga0307409_100040606 | 3300031995 | Bacteria | 3466 |
| 1065 | Ga0307416_100091640 | 3300032002 | Bacteria | 2611 |
| 1066 | Ga0307414_10384718 | 3300032004 | Bacteria | 1214 |
| 1067 | Ga0307411_10010176 | 3300032005 | Bacteria | 4998 |
| 1068 | Ga0307411_11330951 | 3300032005 | Unclassified | 655 |
| 1069 | Ga0316212_1008681 | 3300033547 | Bacteria | 1460 |
| 1070 | Ga0373930_0060732 | 3300034816 | Bacteria | 843 |
| 1071 | Ga0373958_0035222 | 3300034819 | Unclassified | 1001 |
| 1072 | Ga0373938_0013461 | 3300034957 | Bacteria | 1553 |
| 1073 | Ga0373926_0002011 | 3300035083 | Bacteria | 6389 |
| 1074 | Ga0373926_0130968 | 3300035083 | Bacteria | 950 |
| 1075 | Ga0373926_0230632 | 3300035083 | Unclassified | 716 |
| 1076 | Ga0373929_0016269 | 3300035085 | Unclassified | 1456 |
| 1077 | Ga0373934_0148320 | 3300035086 | Bacteria | 960 |
| 1078 | Ga0373940_0169494 | 3300035088 | Unclassified | 705 |
| 1079 | Ga0373944_0104907 | 3300035089 | Bacteria | 959 |
| 1080 | Ga0373944_0303312 | 3300035089 | Unclassified | 600 |
| 1081 | Ga0373952_0010030 | 3300035092 | Bacteria | 1824 |
| 1082 | Ga0373923_0092910 | 3300035111 | Bacteria | 1322 |
| 1083 | Ga0373923_0108092 | 3300035111 | Bacteria | 1233 |
| 1084 | Ga0373923_0372602 | 3300035111 | Unclassified | 684 |
| 1085 | Ga0373932_0183595 | 3300035112 | Bacteria | 735 |
| 1086 | Ga0373932_0340592 | 3300035112 | Unclassified | 568 |
| 1087 | Ga0373932_0364845 | 3300035112 | Unclassified | 552 |
| 1088 | Ga0373936_0010711 | 3300035113 | Bacteria | 3463 |
| 1089 | Ga0373936_0069620 | 3300035113 | Bacteria | 1448 |
| 1090 | Ga0373936_0084887 | 3300035113 | Bacteria | 1322 |
| 1091 | Ga0373936_0100838 | 3300035113 | Bacteria | 1218 |
| 1092 | Ga0373936_0112569 | 3300035113 | Bacteria | 1157 |
| 1093 | Ga0373936_0126371 | 3300035113 | Bacteria | 1096 |
| 1094 | Ga0373936_0263468 | 3300035113 | Unclassified | 772 |
| 1095 | Ga0373939_0007117 | 3300035114 | Bacteria | 2712 |
| 1096 | Ga0373939_0079980 | 3300035114 | Unclassified | 1083 |
| 1097 | Ga0373941_0030121 | 3300035115 | Bacteria | 1606 |
| 1098 | Ga0373945_0193149 | 3300035116 | Bacteria | 842 |
| 1099 | Ga0373945_0279639 | 3300035116 | Bacteria | 711 |
| 1100 | Ga0373945_0412959 | 3300035116 | Bacteria | 593 |
| 1101 | Ga0373953_0074673 | 3300035117 | Bacteria | 1403 |
| 1102 | Ga0373954_0187440 | 3300035118 | Bacteria | 1015 |
| 1103 | Ga0373956_0287152 | 3300035119 | Bacteria | 783 |
| 1104 | Ga0373943_0036935 | 3300035170 | Bacteria | 2342 |
| 1105 | Ga0373943_0064816 | 3300035170 | Bacteria | 1835 |
| 1106 | Ga0373943_0113914 | 3300035170 | Bacteria | 1430 |
| 1107 | Ga0373943_0158163 | 3300035170 | Bacteria | 1232 |
| 1108 | Ga0373943_0158321 | 3300035170 | Bacteria | 1231 |
| 1109 | Ga0373943_0717124 | 3300035170 | Bacteria | 593 |
| 1110 | Ga0373946_0072145 | 3300035171 | Bacteria | 1494 |
| 1111 | Ga0373946_0095391 | 3300035171 | Bacteria | 1325 |
| 1112 | Ga0373946_0118343 | 3300035171 | Bacteria | 1207 |
| 1113 | Ga0373946_0316002 | 3300035171 | Bacteria | 775 |
| 1114 | Ga0373955_0039567 | 3300035172 | Bacteria | 2518 |
| 1115 | Ga0373955_0111391 | 3300035172 | Bacteria | 1583 |
| 1116 | Ga0373955_0162616 | 3300035172 | Bacteria | 1318 |
| 1117 | Ga0373955_0262071 | 3300035172 | Bacteria | 1038 |
| 1118 | Ga0373955_0515418 | 3300035172 | Bacteria | 731 |
| 1119 | Ga0373942_0027742 | 3300035207 | Bacteria | 1475 |
| 1120 | Ga0373962_0316974 | 3300035242 | Unclassified | 556 |
| 1121 | Ga0373924_0044436 | 3300035410 | Bacteria | 1826 |
| 1122 | Ga0373931_0004545 | 3300035691 | Bacteria | 6346 |
| 1123 | Ga0373931_0041928 | 3300035691 | Bacteria | 2405 |
| 1124 | Ga0373931_0079597 | 3300035691 | Bacteria | 1805 |
| 1125 | Ga0373931_0573114 | 3300035691 | Unclassified | 735 |
| 1126 | Ga0373931_1076048 | 3300035691 | Unclassified | 547 |
| 1127 | Ga0373935_0083839 | 3300035692 | Bacteria | 2075 |
| 1128 | Ga0373935_0256813 | 3300035692 | Bacteria | 1224 |
| 1129 | Ga0373935_0285663 | 3300035692 | Bacteria | 1162 |
| 1130 | Ga0373935_0355477 | 3300035692 | Bacteria | 1045 |
| 1131 | Ga0373935_0456900 | 3300035692 | Bacteria | 923 |
| 1132 | Ga0373935_1316233 | 3300035692 | Unclassified | 539 |
| 1133 | Ga0373927_0037883 | 3300035695 | Bacteria | 3133 |
| 1134 | Ga0373927_0062914 | 3300035695 | Bacteria | 2400 |
| 1135 | Ga0373927_0100844 | 3300035695 | Bacteria | 1877 |
| 1136 | Ga0373927_0121129 | 3300035695 | Bacteria | 1707 |
| 1137 | Ga0373927_0176315 | 3300035695 | Bacteria | 1402 |
| 1138 | Ga0373927_0235474 | 3300035695 | Bacteria | 1203 |
| 1139 | Ga0373927_0341556 | 3300035695 | Bacteria | 986 |
| 1140 | Ga0373933_0050319 | 3300035724 | Bacteria | 2487 |
| 1141 | Ga0373933_0136851 | 3300035724 | Bacteria | 1544 |
| 1142 | Ga0373933_0229637 | 3300035724 | Bacteria | 1192 |
| 1143 | Ga0373933_0437550 | 3300035724 | Bacteria | 855 |
| 1144 | Ga0373933_0872130 | 3300035724 | Unclassified | 593 |
| 1145 | Ga0373947_0003282 | 3300035725 | Bacteria | 9589 |
| 1146 | Ga0373947_0016844 | 3300035725 | Bacteria | 4198 |
| 1147 | Ga0373947_0066081 | 3300035725 | Bacteria | 2207 |
| 1148 | Ga0373947_0283724 | 3300035725 | Unclassified | 1101 |
| 1149 | Ga0373947_0329156 | 3300035725 | Bacteria | 1023 |
| 1150 | Ga0373947_0363894 | 3300035725 | Unclassified | 972 |
| 1151 | Ga0373937_0022486 | 3300036401 | Bacteria | 5670 |
| 1152 | Ga0373937_0075249 | 3300036401 | Bacteria | 3117 |
| 1153 | Ga0373937_0075367 | 3300036401 | Bacteria | 3114 |
| 1154 | Ga0373937_0136990 | 3300036401 | Bacteria | 2289 |
| 1155 | Ga0373937_0257177 | 3300036401 | Bacteria | 1646 |
| 1156 | Ga0373937_0384876 | 3300036401 | Bacteria | 1330 |
| 1157 | Ga0373925_0022151 | 3300037068 | Unclassified | 4633 |
| 1158 | Ga0373925_0064821 | 3300037068 | Bacteria | 2751 |
| 1159 | Ga0373925_0160860 | 3300037068 | Bacteria | 1768 |
| 1160 | Ga0373925_0248800 | 3300037068 | Bacteria | 1425 |
| 1161 | Ga0373925_0299562 | 3300037068 | Bacteria | 1298 |
| 1162 | Ga0373925_0434075 | 3300037068 | Unclassified | 1074 |
| 1163 | Ga0373925_0865301 | 3300037068 | Unclassified | 745 |
| 1164 | Ga0373925_1353700 | 3300037068 | Unclassified | 584 |
| 1165 | Ga0395900_1021777 | 3300037418 | Unclassified | 746 |
| 1166 | Ga0395898_1391984 | 3300037466 | Unclassified | 629 |
| 1167 | Ga0395905_0245982 | 3300037471 | Bacteria | 1671 |
| 1168 | Ga0395905_0318132 | 3300037471 | Bacteria | 1446 |
| 1169 | Ga0395905_0467630 | 3300037471 | Bacteria | 1160 |
| 1170 | Ga0436364_0298147 | 3300037853 | Bacteria | 2748 |
| 1171 | Ga0395901_0538954 | 3300038443 | Bacteria | 1184 |
| 1172 | Ga0436365_0833051 | 3300039437 | Bacteria | 1316 |
| 1173 | Ga0436360_0673425 | 3300039438 | Bacteria | 710 |
| 1174 | Ga0436360_0967961 | 3300039438 | Bacteria | 1543 |
| 1175 | Ga0436363_0009640 | 3300039450 | Bacteria | 1177 |
| 1176 | Ga0436363_0209267 | 3300039450 | Bacteria | 5921 |
| 1177 | Ga0436363_0284783 | 3300039450 | Bacteria | 2301 |
| 1178 | Ga0436363_0808254 | 3300039450 | Bacteria | 897 |
| 1179 | Ga0436363_0845898 | 3300039450 | Bacteria | 904 |
| 1180 | Ga0436362_0381178 | 3300039453 | Bacteria | 570 |
| 1181 | Ga0451839_0843721 | 3300041496 | Bacteria | 2089 |
| 1182 | Ga0451577_1156179 | 3300042876 | Bacteria | 691 |
| 1183 | Ga0466961_0319338 | 3300044693 | Bacteria | 947 |
| 1184 | Ga0466963_0019363 | 3300044694 | Bacteria | 4267 |
| 1185 | Ga0466963_0311414 | 3300044694 | Bacteria | 1108 |
| 1186 | Ga0466964_0139691 | 3300044706 | Bacteria | 1112 |
| 1187 | Ga0466964_0175058 | 3300044706 | Bacteria | 1013 |
| 1188 | Ga0453684_0757408 | 3300044712 | Bacteria | 1051 |
| 1189 | Ga0466968_0207311 | 3300044735 | Bacteria | 920 |
| 1190 | Ga0466968_0449759 | 3300044735 | Bacteria | 637 |
| 1191 | Ga0466959_0326706 | 3300045049 | Bacteria | 1048 |
| 1192 | Ga0466959_0406429 | 3300045049 | Unclassified | 925 |
| 1193 | Ga0466959_0758399 | 3300045049 | Bacteria | 649 |
| 1194 | Ga0466959_0804752 | 3300045049 | Unclassified | 628 |
| 1195 | Ga0451576_0095439 | 3300045051 | Bacteria | 3093 |
| 1196 | Ga0451576_0532981 | 3300045051 | Bacteria | 1234 |
| 1197 | Ga0451576_1638010 | 3300045051 | Unclassified | 667 |
| 1198 | Ga0466967_0006951 | 3300045976 | Bacteria | 8095 |
| 1199 | Ga0466967_0032212 | 3300045976 | Bacteria | 4423 |
| 1200 | Ga0466967_0055087 | 3300045976 | Bacteria | 3502 |
| 1201 | Ga0466967_0241580 | 3300045976 | Bacteria | 1723 |
| 1202 | Ga0466967_1618604 | 3300045976 | Bacteria | 645 |
| 1203 | Ga0466967_2462982 | 3300045976 | Unclassified | 515 |
| 1204 | Ga0495603_0113431 | 3300046455 | Bacteria | 1580 |
| 1205 | Ga0495629_0013250 | 3300046459 | Bacteria | 5952 |
| 1206 | Ga0495653_0508547 | 3300046463 | Bacteria | 750 |
| 1207 | Ga0495653_0605907 | 3300046463 | Unclassified | 673 |
| 1208 | Ga0495580_0000031 | 3300046472 | Bacteria | 76248 |
| 1209 | Ga0495580_0002510 | 3300046472 | Bacteria | 16008 |
| 1210 | Ga0495580_0003785 | 3300046472 | Bacteria | 12813 |
| 1211 | Ga0495580_0008038 | 3300046472 | Bacteria | 8423 |
| 1212 | Ga0495580_0011952 | 3300046472 | Bacteria | 6691 |
| 1213 | Ga0495580_0012257 | 3300046472 | Bacteria | 6584 |
| 1214 | Ga0495580_0013423 | 3300046472 | Bacteria | 6250 |
| 1215 | Ga0495580_0019954 | 3300046472 | Bacteria | 4969 |
| 1216 | Ga0495580_0042560 | 3300046472 | Bacteria | 3236 |
| 1217 | Ga0495580_0060755 | 3300046472 | Bacteria | 2654 |
| 1218 | Ga0495580_0074308 | 3300046472 | Bacteria | 2372 |
| 1219 | Ga0495580_0121783 | 3300046472 | Bacteria | 1811 |
| 1220 | Ga0495580_0269184 | 3300046472 | Bacteria | 1164 |
| 1221 | Ga0495580_0396984 | 3300046472 | Unclassified | 930 |
| 1222 | Ga0495580_0438370 | 3300046472 | Bacteria | 877 |
| 1223 | Ga0495580_0516691 | 3300046472 | Bacteria | 796 |
| 1224 | Ga0495580_0545248 | 3300046472 | Unclassified | 771 |
| 1225 | Ga0495580_0603181 | 3300046472 | Bacteria | 725 |
| 1226 | Ga0495580_0750577 | 3300046472 | Unclassified | 636 |
| 1227 | Ga0495582_0001059 | 3300046473 | Bacteria | 15471 |
| 1228 | Ga0495582_0010750 | 3300046473 | Bacteria | 5036 |
| 1229 | Ga0495582_0159874 | 3300046473 | Bacteria | 1281 |
| 1230 | Ga0495582_0255001 | 3300046473 | Bacteria | 1006 |
| 1231 | Ga0495639_0062931 | 3300046475 | Bacteria | 1703 |
| 1232 | Ga0495639_0069115 | 3300046475 | Bacteria | 1629 |
| 1233 | Ga0495639_0367620 | 3300046475 | Bacteria | 724 |
| 1234 | Ga0495662_0172779 | 3300046476 | Bacteria | 1065 |
| 1235 | Ga0495584_0685658 | 3300046491 | Unclassified | 522 |
| 1236 | Ga0495618_0600598 | 3300046514 | Unclassified | 655 |
| 1237 | Ga0495630_0273481 | 3300046517 | Bacteria | 1290 |
| 1238 | Ga0495630_0386677 | 3300046517 | Bacteria | 1072 |
| 1239 | Ga0495666_0063034 | 3300046526 | Bacteria | 1770 |
| 1240 | Ga0495666_0204804 | 3300046526 | Bacteria | 906 |
| 1241 | Ga0495666_0385087 | 3300046526 | Bacteria | 631 |
| 1242 | Ga0495652_0579790 | 3300046529 | Bacteria | 768 |
| 1243 | Ga0495665_0025755 | 3300046531 | Bacteria | 3158 |
| 1244 | Ga0495665_0064771 | 3300046531 | Bacteria | 1929 |
| 1245 | Ga0495640_0214361 | 3300046533 | Bacteria | 1216 |
| 1246 | Ga0495640_0245433 | 3300046533 | Bacteria | 1123 |
| 1247 | Ga0495586_0828540 | 3300046535 | Unclassified | 533 |
| 1248 | Ga0495587_0108369 | 3300046536 | Unclassified | 1597 |
| 1249 | Ga0495645_0153799 | 3300046543 | Bacteria | 1596 |
| 1250 | Ga0495667_0478810 | 3300046559 | Unclassified | 781 |
| 1251 | Ga0495659_0029097 | 3300046664 | Bacteria | 1916 |
| 1252 | Ga0495657_0692047 | 3300046675 | Unclassified | 586 |
| 1253 | Ga0495623_0023471 | 3300046679 | Bacteria | 3981 |
| 1254 | Ga0495623_0703022 | 3300046679 | Unclassified | 518 |
| 1255 | Ga0495658_0744781 | 3300046683 | Unclassified | 628 |
| 1256 | Ga0495669_0054259 | 3300046684 | Bacteria | 1804 |
| 1257 | Ga0495669_0058045 | 3300046684 | Bacteria | 1747 |
| 1258 | Ga0495613_0126079 | 3300046689 | Bacteria | 1836 |
| 1259 | Ga0495624_0448279 | 3300046690 | Bacteria | 773 |
| 1260 | Ga0495624_0458877 | 3300046690 | Bacteria | 763 |
| 1261 | Ga0495624_0535561 | 3300046690 | Bacteria | 700 |
| 1262 | Ga0495624_0740002 | 3300046690 | Bacteria | 583 |
| 1263 | Ga0495670_0166420 | 3300046691 | Bacteria | 1160 |
| 1264 | Ga0495649_0352483 | 3300046694 | Bacteria | 744 |
| 1265 | Ga0495600_0900233 | 3300046809 | Unclassified | 522 |
| 1266 | Ga0495604_0109922 | 3300047317 | Unclassified | 2012 |
| 1267 | Ga0495604_0437500 | 3300047317 | Bacteria | 856 |
| 1268 | Ga0495674_0075852 | 3300047319 | Bacteria | 2893 |
| 1269 | Ga0495674_0135485 | 3300047319 | Bacteria | 2073 |
| 1270 | Ga0495674_0137641 | 3300047319 | Bacteria | 2054 |
| 1271 | Ga0495675_0041145 | 3300047444 | Bacteria | 2945 |
| 1272 | Ga0495675_0332838 | 3300047444 | Bacteria | 896 |
| 1273 | Ga0495684_0216793 | 3300047471 | Bacteria | 1405 |
| 1274 | Ga0495684_0875416 | 3300047471 | Bacteria | 581 |
| 1275 | Ga0495593_0287981 | 3300047673 | Bacteria | 821 |
| 1276 | Ga0495602_0043932 | 3300048088 | Bacteria | 4057 |
| 1277 | Ga0495602_0166686 | 3300048088 | Bacteria | 1714 |
| 1278 | Ga0495602_0329407 | 3300048088 | Bacteria | 1108 |
| 1279 | Ga0495602_0820984 | 3300048088 | Bacteria | 623 |
| 1280 | Ga0496100_0033637 | 3300048903 | Bacteria | 3209 |
| 1281 | Ga0496100_0086547 | 3300048903 | Bacteria | 2129 |
| 1282 | Ga0496100_0101346 | 3300048903 | Bacteria | 1985 |
| 1283 | Ga0496100_0102743 | 3300048903 | Bacteria | 1973 |
| 1284 | Ga0496100_0382645 | 3300048903 | Bacteria | 1069 |
| 1285 | Ga0496101_0175686 | 3300048904 | Bacteria | 1647 |
| 1286 | Ga0496101_0323270 | 3300048904 | Bacteria | 1210 |
| 1287 | Ga0496101_1496540 | 3300048904 | Unclassified | 525 |
| 1288 | Ga0496102_0001424 | 3300048905 | Bacteria | 21214 |
| 1289 | Ga0496102_0021406 | 3300048905 | Bacteria | 5718 |
| 1290 | Ga0496102_0052423 | 3300048905 | Bacteria | 3717 |
| 1291 | Ga0496102_0078474 | 3300048905 | Bacteria | 3040 |
| 1292 | Ga0496102_0149569 | 3300048905 | Bacteria | 2193 |
| 1293 | Ga0496102_0153471 | 3300048905 | Bacteria | 2165 |
| 1294 | Ga0496102_0183631 | 3300048905 | Bacteria | 1971 |
| 1295 | Ga0496102_0185835 | 3300048905 | Bacteria | 1959 |
| 1296 | Ga0496102_0257323 | 3300048905 | Bacteria | 1646 |
| 1297 | Ga0496102_0280180 | 3300048905 | Bacteria | 1572 |
| 1298 | Ga0496103_0003887 | 3300048906 | Bacteria | 9090 |
| 1299 | Ga0496103_0005029 | 3300048906 | Bacteria | 7974 |
| 1300 | Ga0496103_0048205 | 3300048906 | Bacteria | 2632 |
| 1301 | Ga0496104_0018664 | 3300048907 | Bacteria | 6331 |
| 1302 | Ga0496104_0031354 | 3300048907 | Bacteria | 4943 |
| 1303 | Ga0496104_0075482 | 3300048907 | Bacteria | 3210 |
| 1304 | Ga0496104_0105810 | 3300048907 | Bacteria | 2696 |
| 1305 | Ga0496104_0328056 | 3300048907 | Bacteria | 1443 |
| 1306 | Ga0496104_0336874 | 3300048907 | Bacteria | 1421 |
| 1307 | Ga0496104_0362288 | 3300048907 | Bacteria | 1362 |
| 1308 | Ga0496104_0365399 | 3300048907 | Bacteria | 1355 |
| 1309 | Ga0496104_1143113 | 3300048907 | Bacteria | 682 |
| 1310 | Ga0496105_0060287 | 3300048908 | Bacteria | 3131 |
| 1311 | Ga0496105_0560915 | 3300048908 | Bacteria | 890 |
| 1312 | Ga0496106_0014952 | 3300048909 | Bacteria | 5742 |
| 1313 | Ga0496106_0041788 | 3300048909 | Bacteria | 3437 |
| 1314 | Ga0496106_0093211 | 3300048909 | Bacteria | 2327 |
| 1315 | Ga0496106_0332237 | 3300048909 | Bacteria | 1220 |
| 1316 | Ga0496107_0016408 | 3300048910 | Bacteria | 5200 |
| 1317 | Ga0496107_0094872 | 3300048910 | Bacteria | 2182 |
| 1318 | Ga0496107_1174746 | 3300048910 | Unclassified | 552 |
| 1319 | Ga0496108_0000325 | 3300048911 | Bacteria | 40507 |
| 1320 | Ga0496108_0040500 | 3300048911 | Bacteria | 3884 |
| 1321 | Ga0496108_0322918 | 3300048911 | Bacteria | 1346 |
| 1322 | Ga0496108_0549062 | 3300048911 | Bacteria | 1008 |
| 1323 | Ga0496108_0554139 | 3300048911 | Bacteria | 1003 |
| 1324 | Ga0496109_0000117 | 3300048912 | Bacteria | 82245 |
| 1325 | Ga0496109_0096787 | 3300048912 | Bacteria | 2735 |
| 1326 | Ga0496109_0426308 | 3300048912 | Bacteria | 1253 |
| 1327 | Ga0496109_1053736 | 3300048912 | Bacteria | 750 |
| 1328 | Ga0496109_1749891 | 3300048912 | Unclassified | 555 |
| 1329 | Ga0496110_0006359 | 3300048913 | Bacteria | 9337 |
| 1330 | Ga0496110_0025595 | 3300048913 | Bacteria | 5044 |
| 1331 | Ga0496111_0094258 | 3300048914 | Bacteria | 2195 |
| 1332 | Ga0496111_0724057 | 3300048914 | Unclassified | 723 |
| 1333 | Ga0496112_0000283 | 3300048915 | Bacteria | 32864 |
| 1334 | Ga0496112_0014557 | 3300048915 | Bacteria | 7307 |
| 1335 | Ga0496112_0016004 | 3300048915 | Bacteria | 7013 |
| 1336 | Ga0496112_0021267 | 3300048915 | Bacteria | 6167 |
| 1337 | Ga0496112_0024757 | 3300048915 | Bacteria | 5755 |
| 1338 | Ga0496112_0047441 | 3300048915 | Bacteria | 4214 |
| 1339 | Ga0496112_0050645 | 3300048915 | Bacteria | 4073 |
| 1340 | Ga0496112_0056839 | 3300048915 | Bacteria | 3851 |
| 1341 | Ga0496112_0099290 | 3300048915 | Bacteria | 2881 |
| 1342 | Ga0496112_0119918 | 3300048915 | Bacteria | 2600 |
| 1343 | Ga0496112_0238847 | 3300048915 | Bacteria | 1770 |
| 1344 | Ga0496112_0476740 | 3300048915 | Bacteria | 1185 |
| 1345 | Ga0496113_0007994 | 3300048916 | Bacteria | 6854 |
| 1346 | Ga0496113_0109867 | 3300048916 | Bacteria | 2145 |
| 1347 | Ga0496113_0383886 | 3300048916 | Bacteria | 1127 |
| 1348 | Ga0496113_1315066 | 3300048916 | Unclassified | 562 |
| 1349 | Ga0496114_0033551 | 3300048917 | Bacteria | 4230 |
| 1350 | Ga0496115_0012224 | 3300048918 | Bacteria | 6455 |
| 1351 | Ga0496115_0031114 | 3300048918 | Bacteria | 4202 |
| 1352 | Ga0496115_0112581 | 3300048918 | Bacteria | 2236 |
| 1353 | Ga0496126_0539047 | 3300048929 | Unclassified | 928 |
| 1354 | Ga0501290_024838 | 3300049513 | Bacteria | 836 |
| 1355 | Ga0501292_045035 | 3300049515 | Unclassified | 770 |
| 1356 | Ga0501295_095458 | 3300049518 | Unclassified | 692 |
| 1357 | Ga0501297_024373 | 3300049520 | Bacteria | 773 |
| 1358 | Ga0501298_002596 | 3300049521 | Bacteria | 2748 |
| 1359 | Ga0501298_137844 | 3300049521 | Bacteria | 588 |
| 1360 | Ga0501299_062524 | 3300049522 | Unclassified | 791 |
| 1361 | Ga0501299_125162 | 3300049522 | Unclassified | 624 |
| 1362 | Ga0501216_084325 | 3300049660 | Unclassified | 677 |
| 1363 | Ga0501222_026356 | 3300049662 | Bacteria | 789 |
| 1364 | Ga0501227_200439 | 3300049665 | Unclassified | 565 |
| 1365 | Ga0501239_015045 | 3300049672 | Unclassified | 901 |
| 1366 | Ga0501247_035382 | 3300049677 | Bacteria | 697 |
| 1367 | Ga0501250_008377 | 3300049680 | Bacteria | 1139 |
| 1368 | Ga0501225_0095308 | 3300049705 | Unclassified | 865 |
| 1369 | Ga0501245_138972 | 3300049708 | Unclassified | 527 |
| 1370 | Ga0501083_0072867 | 3300049744 | Bacteria | 2283 |
| 1371 | Ga0501083_0145012 | 3300049744 | Bacteria | 1554 |
| 1372 | nmdc:mga0n895_102873_c1 | 3300050512 | Bacteria | 2867 |
| 1373 | nmdc:mga0n895_27328_c1 | 3300050512 | Bacteria | 5419 |
| 1374 | nmdc:mga0n895_273663_c1 | 3300050512 | Bacteria | 1713 |
| 1375 | nmdc:mga0rr50_224426_c1 | 3300050513 | Bacteria | 1552 |
| 1376 | nmdc:mga0rr50_284_c1 | 3300050513 | Bacteria | 27442 |
| 1377 | nmdc:mga0rr50_292441_c1 | 3300050513 | Bacteria | 1361 |
| 1378 | nmdc:mga0rr50_542920_c1 | 3300050513 | Bacteria | 990 |
| 1379 | nmdc:mga0rr50_84483_c1 | 3300050513 | Bacteria | 2458 |
| 1380 | nmdc:mga0rr50_8721_c1 | 3300050513 | Bacteria | 6325 |
| 1381 | nmdc:mga0rr50_91738_c1 | 3300050513 | Bacteria | 2367 |
| 1382 | nmdc:mga0rr50_995542_c1 | 3300050513 | Bacteria | 714 |
| 1383 | nmdc:mga08x19_21264_c1 | 3300050514 | Bacteria | 4003 |
| 1384 | nmdc:mga08x19_24287_c1 | 3300050514 | Bacteria | 3766 |
| 1385 | nmdc:mga08x19_448477_c1 | 3300050514 | Bacteria | 908 |
| 1386 | nmdc:mga08x19_4593_c1 | 3300050514 | Bacteria | 8199 |
| 1387 | nmdc:mga08x19_5882_c1 | 3300050514 | Bacteria | 7254 |
| 1388 | nmdc:mga08x19_83365_c1 | 3300050514 | Bacteria | 2102 |
| 1389 | nmdc:mga08x19_88067_c1 | 3300050514 | Bacteria | 2046 |
| 1390 | nmdc:mga0a205_378_c1 | 3300050515 | Bacteria | 33792 |
| 1391 | Ga0495601_0078108 | 3300053077 | Bacteria | 2121 |
| 1392 | Ga0495612_0516633 | 3300053078 | Unclassified | 549 |
| 1393 | Ga0495612_0572909 | 3300053078 | Unclassified | 521 |
| 1394 | Ga0495595_0093703 | 3300053084 | Bacteria | 1443 |
| 1395 | Ga0495619_0147079 | 3300053085 | Bacteria | 1625 |
| 1396 | Ga0495619_0220997 | 3300053085 | Bacteria | 1312 |
| 1397 | Ga0495619_0284660 | 3300053085 | Bacteria | 1145 |
| 1398 | Ga0500590_254941 | 3300053148 | Bacteria | 694 |
| 1399 | Ga0501084_1112720 | 3300054114 | Unclassified | 663 |
| 1400 | Ga0207695_10762659 | |||
| 1401 | MRS1b_contig_6134550 | |||
| 1402 | MBSR1b_contig_12674636 | |||
| 1403 | MBSR1b_contig_2772953 | |||
| 1404 | JGI24752J21851_1003898 | |||
| 1405 | JGI24751J29686_10001643 | |||
| 1406 | rootL2_10044960 | |||
| 1407 | rootL2_10120147 | |||
| 1408 | Ga0065712_10106543 | |||
| 1409 | Ga0065712_10163917 | |||
| 1410 | Ga0065715_10002805 | |||
| 1411 | Ga0065715_10096374 | |||
| 1412 | Ga0065715_10096533 | |||
| 1413 | Ga0065707_10326253 | |||
| 1414 | Ga0070658_10015673 | |||
| 1415 | Ga0070658_11282360 | |||
| 1416 | Ga0070676_10247845 | |||
| 1417 | Ga0070676_10358536 | |||
| 1418 | Ga0070683_100014455 | |||
| 1419 | Ga0070683_100041687 | |||
| 1420 | Ga0070683_100075451 | |||
| 1421 | Ga0070683_100356050 | |||
| 1422 | Ga0070690_100017809 | |||
| 1423 | Ga0070690_100061607 | |||
| 1424 | Ga0070670_100010385 | |||
| 1425 | Ga0070670_100083025 | |||
| 1426 | Ga0070670_100196114 | |||
| 1427 | Ga0070677_10036802 | |||
| 1428 | Ga0068869_100000550 | |||
| 1429 | Ga0068869_100034351 | |||
| 1430 | Ga0068869_100627344 | |||
| 1431 | Ga0070666_10024078 | |||
| 1432 | Ga0070666_10541298 | |||
| 1433 | Ga0070666_10656648 | |||
| 1434 | Ga0070680_100015909 | |||
| 1435 | Ga0070680_100044409 | |||
| 1436 | Ga0070680_100313656 | |||
| 1437 | Ga0070682_100010415 | |||
| 1438 | Ga0068868_100003943 | |||
| 1439 | Ga0068868_100009681 | |||
| 1440 | Ga0068868_100034367 | |||
| 1441 | Ga0068868_100053324 | |||
| 1442 | Ga0068868_100135625 | |||
| 1443 | Ga0070660_100004316 | |||
| 1444 | Ga0070660_100011820 | |||
| 1445 | Ga0070660_100053314 | |||
| 1446 | Ga0070689_100042634 | |||
| 1447 | Ga0070687_100007241 | |||
| 1448 | Ga0070661_100011241 | |||
| 1449 | Ga0070661_100012801 | |||
| 1450 | Ga0070661_100015105 | |||
| 1451 | Ga0070661_100030051 | |||
| 1452 | Ga0070661_100069047 | |||
| 1453 | Ga0070692_10145265 | |||
| 1454 | Ga0070692_11072468 | |||
| 1455 | Ga0070668_100002735 | |||
| 1456 | Ga0070668_100024225 | |||
| 1457 | Ga0070668_100862645 | |||
| 1458 | Ga0070669_100011554 | |||
| 1459 | Ga0070669_100570349 | |||
| 1460 | Ga0070669_101447395 | |||
| 1461 | Ga0070675_100007612 | |||
| 1462 | Ga0070675_100465790 | |||
| 1463 | Ga0070671_100014648 | |||
| 1464 | Ga0070671_101277177 | |||
| 1465 | Ga0070671_102016829 | |||
| 1466 | Ga0070673_100008691 | |||
| 1467 | Ga0070673_100155066 | |||
| 1468 | Ga0070673_101185853 | |||
| 1469 | Ga0070673_101488463 | |||
| 1470 | Ga0070688_100007204 | |||
| 1471 | Ga0070688_100252055 | |||
| 1472 | Ga0070688_100313026 | |||
| 1473 | Ga0070659_100001922 | |||
| 1474 | Ga0070659_100006129 | |||
| 1475 | Ga0070659_100039236 | |||
| 1476 | Ga0070659_100854978 | |||
| 1477 | Ga0070667_100009820 | |||
| 1478 | Ga0070667_100386271 | |||
| 1479 | Ga0070667_101014396 | |||
| 1480 | Ga0070709_10028242 | |||
| 1481 | Ga0070709_10049599 | |||
| 1482 | Ga0070709_10086997 | |||
| 1483 | Ga0070709_10089106 | |||
| 1484 | Ga0070709_10259874 | |||
| 1485 | Ga0070709_10366360 | |||
| 1486 | Ga0070709_10795488 | |||
| 1487 | Ga0070709_10848509 | |||
| 1488 | Ga0070709_11647796 | |||
| 1489 | Ga0070714_100009049 | |||
| 1490 | Ga0070714_100025843 | |||
| 1491 | Ga0070714_100031288 | |||
| 1492 | Ga0070714_100036765 | |||
| 1493 | Ga0070714_100102975 | |||
| 1494 | Ga0070714_100124419 | |||
| 1495 | Ga0070714_100133533 | |||
| 1496 | Ga0070714_100171080 | |||
| 1497 | Ga0070714_100195863 | |||
| 1498 | Ga0070714_100226227 | |||
| 1499 | Ga0070714_100281523 | |||
| 1500 | Ga0070714_100466376 | |||
| 1501 | Ga0070714_100559407 | |||
| 1502 | Ga0070714_100727115 | |||
| 1503 | Ga0070714_101128171 | |||
| 1504 | Ga0070714_101136190 | |||
| 1505 | Ga0070713_100000342 | |||
| 1506 | Ga0070713_100000449 | |||
| 1507 | Ga0070713_100000510 | |||
| 1508 | Ga0070713_100006751 | |||
| 1509 | Ga0070713_100007164 | |||
| 1510 | Ga0070713_100117524 | |||
| 1511 | Ga0070713_100120784 | |||
| 1512 | Ga0070713_100125991 | |||
| 1513 | Ga0070713_100143012 | |||
| 1514 | Ga0070713_100170845 | |||
| 1515 | Ga0070713_100226221 | |||
| 1516 | Ga0070713_100526522 | |||
| 1517 | Ga0070713_100602633 | |||
| 1518 | Ga0070713_100647877 | |||
| 1519 | Ga0070713_100849201 | |||
| 1520 | Ga0070713_100937109 | |||
| 1521 | Ga0070713_100982851 | |||
| 1522 | Ga0070710_10003161 | |||
| 1523 | Ga0070710_10008637 | |||
| 1524 | Ga0070710_10050390 | |||
| 1525 | Ga0070710_10066409 | |||
| 1526 | Ga0070710_10087209 | |||
| 1527 | Ga0070710_10102028 | |||
| 1528 | Ga0070710_10102984 | |||
| 1529 | Ga0070710_10226597 | |||
| 1530 | Ga0070710_10281110 | |||
| 1531 | Ga0070710_10341182 | |||
| 1532 | Ga0070711_100000442 | |||
| 1533 | Ga0070711_100001861 | |||
| 1534 | Ga0070711_100004128 | |||
| 1535 | Ga0070711_100015933 | |||
| 1536 | Ga0070711_100020744 | |||
| 1537 | Ga0070711_100021709 | |||
| 1538 | Ga0070711_100030425 | |||
| 1539 | Ga0070711_100058991 | |||
| 1540 | Ga0070711_100084396 | |||
| 1541 | Ga0070711_100230865 | |||
| 1542 | Ga0070711_100258832 | |||
| 1543 | Ga0070711_100261769 | |||
| 1544 | Ga0070711_100803118 | |||
| 1545 | Ga0070711_100871277 | |||
| 1546 | Ga0070711_101190836 | |||
| 1547 | Ga0070705_100181212 | |||
| 1548 | Ga0070700_100057144 | |||
| 1549 | Ga0070700_100065656 | |||
| 1550 | Ga0070694_100190002 | |||
| 1551 | Ga0070708_100001221 | |||
| 1552 | Ga0070708_100001401 | |||
| 1553 | Ga0070708_100001766 | |||
| 1554 | Ga0070708_100002020 | |||
| 1555 | Ga0070708_100015287 | |||
| 1556 | Ga0070708_100041536 | |||
| 1557 | Ga0070708_100141295 | |||
| 1558 | Ga0070708_100239549 | |||
| 1559 | Ga0070708_100267103 | |||
| 1560 | Ga0070708_100277146 | |||
| 1561 | Ga0070708_100278362 | |||
| 1562 | Ga0070708_100567037 | |||
| 1563 | Ga0070708_101531594 | |||
| 1564 | Ga0070663_100016476 | |||
| 1565 | Ga0070663_100024595 | |||
| 1566 | Ga0070663_100346437 | |||
| 1567 | Ga0070663_100819606 | |||
| 1568 | Ga0070678_100065037 | |||
| 1569 | Ga0070662_100004700 | |||
| 1570 | Ga0070662_100027940 | |||
| 1571 | Ga0070662_100031533 | |||
| 1572 | Ga0070662_100658530 | |||
| 1573 | Ga0070681_10000055 | |||
| 1574 | Ga0070681_10013007 | |||
| 1575 | Ga0070681_10040657 | |||
| 1576 | Ga0070681_10050460 | |||
| 1577 | Ga0070681_10067150 | |||
| 1578 | Ga0070681_10079440 | |||
| 1579 | Ga0070681_10349137 | |||
| 1580 | Ga0070681_11035074 | |||
| 1581 | Ga0068867_100006586 | |||
| 1582 | Ga0068867_100018246 | |||
| 1583 | Ga0068867_100088181 | |||
| 1584 | Ga0068867_100170473 | |||
| 1585 | Ga0070685_10013905 | |||
| 1586 | Ga0070685_10018810 | |||
| 1587 | Ga0070685_10449102 | |||
| 1588 | Ga0070706_100000173 | |||
| 1589 | Ga0070706_100001295 | |||
| 1590 | Ga0070706_100001629 | |||
| 1591 | Ga0070706_100012117 | |||
| 1592 | Ga0070706_100066056 | |||
| 1593 | Ga0070706_100330570 | |||
| 1594 | Ga0070706_100373941 | |||
| 1595 | Ga0070706_100417314 | |||
| 1596 | Ga0070706_100516501 | |||
| 1597 | Ga0070707_100000719 | |||
| 1598 | Ga0070707_100002543 | |||
| 1599 | Ga0070707_100006148 | |||
| 1600 | Ga0070707_100017757 | |||
| 1601 | Ga0070707_100074860 | |||
| 1602 | Ga0070707_100086920 | |||
| 1603 | Ga0070707_100090046 | |||
| 1604 | Ga0070707_100324535 | |||
| 1605 | Ga0070707_100374943 | |||
| 1606 | Ga0070707_100463635 | |||
| 1607 | Ga0070707_100683554 | |||
| 1608 | Ga0070707_100813554 | |||
| 1609 | Ga0070698_100000162 | |||
| 1610 | Ga0070698_100005121 | |||
| 1611 | Ga0070698_100046332 | |||
| 1612 | Ga0070698_100284864 | |||
| 1613 | Ga0070698_100489974 | |||
| 1614 | Ga0070698_101218205 | |||
| 1615 | Ga0070699_100002067 | |||
| 1616 | Ga0070699_100003692 | |||
| 1617 | Ga0070699_100010658 | |||
| 1618 | Ga0070699_100056787 | |||
| 1619 | Ga0070699_100135777 | |||
| 1620 | Ga0070699_100273308 | |||
| 1621 | Ga0070699_100276146 | |||
| 1622 | Ga0070699_101014370 | |||
| 1623 | Ga0070699_101539241 | |||
| 1624 | Ga0070679_100043594 | |||
| 1625 | Ga0070679_100104117 | |||
| 1626 | Ga0070679_100125511 | |||
| 1627 | Ga0070679_100129486 | |||
| 1628 | Ga0070679_100345679 | |||
| 1629 | Ga0070679_100356677 | |||
| 1630 | Ga0070679_100473412 | |||
| 1631 | Ga0070679_101199890 | |||
| 1632 | Ga0070684_100002587 | |||
| 1633 | Ga0070684_100006632 | |||
| 1634 | Ga0070684_100011364 | |||
| 1635 | Ga0070684_100065317 | |||
| 1636 | Ga0070684_100100813 | |||
| 1637 | Ga0070684_100451397 | |||
| 1638 | Ga0070697_100000872 | |||
| 1639 | Ga0070697_100001177 | |||
| 1640 | Ga0070697_100001505 | |||
| 1641 | Ga0070697_100002837 | |||
| 1642 | Ga0070697_100004369 | |||
| 1643 | Ga0070697_100030681 | |||
| 1644 | Ga0070697_100085647 | |||
| 1645 | Ga0070697_100127377 | |||
| 1646 | Ga0070697_100427397 | |||
| 1647 | Ga0070697_101300671 | |||
| 1648 | Ga0070697_101911273 | |||
| 1649 | Ga0068853_100006282 | |||
| 1650 | Ga0068853_100024491 | |||
| 1651 | Ga0068853_100026542 | |||
| 1652 | Ga0068853_100087705 | |||
| 1653 | Ga0068853_100132158 | |||
| 1654 | Ga0068853_100201330 | |||
| 1655 | Ga0070672_100034848 | |||
| 1656 | Ga0070672_100262707 | |||
| 1657 | Ga0070672_101357245 | |||
| 1658 | Ga0070686_100005128 | |||
| 1659 | Ga0070686_100018382 | |||
| 1660 | Ga0070695_100147601 | |||
| 1661 | Ga0070695_100203508 | |||
| 1662 | Ga0070695_100607884 | |||
| 1663 | Ga0070695_100811161 | |||
| 1664 | Ga0070696_100175780 | |||
| 1665 | Ga0070696_100665759 | |||
| 1666 | Ga0070696_100674064 | |||
| 1667 | Ga0070696_101134960 | |||
| 1668 | Ga0070693_100052027 | |||
| 1669 | Ga0070693_100098916 | |||
| 1670 | Ga0070693_100150163 | |||
| 1671 | Ga0070693_100232130 | |||
| 1672 | Ga0070693_100255593 | |||
| 1673 | Ga0070693_100283876 | |||
| 1674 | Ga0070693_100920994 | |||
| 1675 | Ga0070693_100950713 | |||
| 1676 | Ga0070665_100036861 | |||
| 1677 | Ga0070665_100133753 | |||
| 1678 | Ga0070704_100596670 | |||
| 1679 | Ga0070704_101277702 | |||
| 1680 | Ga0070704_101386752 | |||
| 1681 | Ga0068855_100002871 | |||
| 1682 | Ga0068855_100005054 | |||
| 1683 | Ga0068855_100015407 | |||
| 1684 | Ga0068855_100018256 | |||
| 1685 | Ga0068855_100023648 | |||
| 1686 | Ga0068855_100031434 | |||
| 1687 | Ga0068855_101969389 | |||
| 1688 | Ga0070664_100001796 | |||
| 1689 | Ga0070664_100007823 | |||
| 1690 | Ga0070664_100008620 | |||
| 1691 | Ga0070664_100091253 | |||
| 1692 | Ga0070664_100247630 | |||
| 1693 | Ga0070664_100359456 | |||
| 1694 | Ga0070664_100568069 | |||
| 1695 | Ga0068857_100000041 | |||
| 1696 | Ga0068857_100002662 | |||
| 1697 | Ga0068857_100247182 | |||
| 1698 | Ga0068857_102444562 | |||
| 1699 | Ga0068854_100003861 | |||
| 1700 | Ga0068854_100006005 | |||
| 1701 | Ga0068854_100006817 | |||
| 1702 | Ga0068854_100009154 | |||
| 1703 | Ga0068854_100044808 | |||
| 1704 | Ga0068854_101232071 | |||
| 1705 | Ga0068856_100000355 | |||
| 1706 | Ga0068856_100001245 | |||
| 1707 | Ga0068856_100001397 | |||
| 1708 | Ga0068856_100004211 | |||
| 1709 | Ga0068856_100004843 | |||
| 1710 | Ga0068856_100026475 | |||
| 1711 | Ga0068856_100032662 | |||
| 1712 | Ga0068856_100053439 | |||
| 1713 | Ga0068856_100104443 | |||
| 1714 | Ga0068856_100273997 | |||
| 1715 | Ga0068856_100671620 | |||
| 1716 | Ga0070702_100017598 | |||
| 1717 | Ga0068852_100021601 | |||
| 1718 | Ga0068852_100022927 | |||
| 1719 | Ga0068852_100054469 | |||
| 1720 | Ga0068852_100342315 | |||
| 1721 | Ga0068852_100422722 | |||
| 1722 | Ga0068859_100002075 | |||
| 1723 | Ga0068859_100022875 | |||
| 1724 | Ga0068859_100124359 | |||
| 1725 | Ga0068864_100002938 | |||
| 1726 | Ga0068864_100036397 | |||
| 1727 | Ga0068864_100070542 | |||
| 1728 | Ga0068866_10012020 | |||
| 1729 | Ga0068866_10012922 | |||
| 1730 | Ga0068866_10023270 | |||
| 1731 | Ga0068866_10067387 | |||
| 1732 | Ga0068866_10650028 | |||
| 1733 | Ga0068861_100022258 | |||
| 1734 | Ga0068861_100152261 | |||
| 1735 | Ga0068861_100245419 | |||
| 1736 | Ga0068851_10001990 | |||
| 1737 | Ga0068851_10005815 | |||
| 1738 | Ga0068870_10001819 | |||
| 1739 | Ga0068870_10155454 | |||
| 1740 | Ga0068863_100017215 | |||
| 1741 | Ga0068863_100024499 | |||
| 1742 | Ga0068863_100042876 | |||
| 1743 | Ga0068863_100074990 | |||
| 1744 | Ga0068863_100120258 | |||
| 1745 | Ga0068863_100276668 | |||
| 1746 | Ga0068863_100684329 | |||
| 1747 | Ga0068863_101697625 | |||
| 1748 | Ga0068858_100002616 | |||
| 1749 | Ga0068858_100007357 | |||
| 1750 | Ga0068858_100025619 | |||
| 1751 | Ga0068858_100026311 | |||
| 1752 | Ga0068858_100076855 | |||
| 1753 | Ga0068858_100115576 | |||
| 1754 | Ga0068858_100456882 | |||
| 1755 | Ga0068858_100657913 | |||
| 1756 | Ga0068860_100007831 | |||
| 1757 | Ga0068860_100060146 | |||
| 1758 | Ga0068860_100098636 | |||
| 1759 | Ga0068860_100102188 | |||
| 1760 | Ga0068860_100182762 | |||
| 1761 | Ga0068860_100406359 | |||
| 1762 | Ga0068860_100584243 | |||
| 1763 | Ga0068860_100650321 | |||
| 1764 | Ga0068862_100011071 | |||
| 1765 | Ga0068862_100043213 | |||
| 1766 | Ga0068862_100256123 | |||
| 1767 | Ga0081455_10786581 | |||
| 1768 | Ga0081540_1044237 | |||
| 1769 | Ga0081540_1225570 | |||
| 1770 | Ga0070717_10000612 | |||
| 1771 | Ga0070717_10000837 | |||
| 1772 | Ga0070717_10002552 | |||
| 1773 | Ga0070717_10010813 | |||
| 1774 | Ga0070717_10017807 | |||
| 1775 | Ga0070717_10018682 | |||
| 1776 | Ga0070717_10019341 | |||
| 1777 | Ga0070717_10022103 | |||
| 1778 | Ga0070717_10033939 | |||
| 1779 | Ga0070717_10039607 | |||
| 1780 | Ga0070717_10070032 | |||
| 1781 | Ga0070717_10071148 | |||
| 1782 | Ga0070717_10107426 | |||
| 1783 | Ga0070717_10116686 | |||
| 1784 | Ga0070717_10127189 | |||
| 1785 | Ga0070717_10158352 | |||
| 1786 | Ga0070717_10279005 | |||
| 1787 | Ga0070717_10310993 | |||
| 1788 | Ga0070717_10934544 | |||
| 1789 | Ga0070715_10036633 | |||
| 1790 | Ga0070715_10173929 | |||
| 1791 | Ga0070715_10425755 | |||
| 1792 | Ga0070716_100000315 | |||
| 1793 | Ga0070716_100002728 | |||
| 1794 | Ga0070716_100022367 | |||
| 1795 | Ga0070716_100045706 | |||
| 1796 | Ga0070716_100057722 | |||
| 1797 | Ga0070716_100181762 | |||
| 1798 | Ga0070716_100192049 | |||
| 1799 | Ga0070716_100299177 | |||
| 1800 | Ga0070716_100382842 | |||
| 1801 | Ga0070716_100478900 | |||
| 1802 | Ga0070716_100566176 | |||
| 1803 | Ga0070716_100600345 | |||
| 1804 | Ga0070716_100618362 | |||
| 1805 | Ga0070712_100000957 | |||
| 1806 | Ga0070712_100002811 | |||
| 1807 | Ga0070712_100005172 | |||
| 1808 | Ga0070712_100008543 | |||
| 1809 | Ga0070712_100009656 | |||
| 1810 | Ga0070712_100021898 | |||
| 1811 | Ga0070712_100028726 | |||
| 1812 | Ga0070712_100062307 | |||
| 1813 | Ga0070712_100104060 | |||
| 1814 | Ga0070712_100205175 | |||
| 1815 | Ga0070712_100357420 | |||
| 1816 | Ga0070712_100376734 | |||
| 1817 | Ga0070712_100480477 | |||
| 1818 | Ga0070712_100480809 | |||
| 1819 | Ga0070712_101070604 | |||
| 1820 | Ga0070712_101076198 | |||
| 1821 | Ga0070712_101372494 | |||
| 1822 | Ga0070712_101937193 | |||
| 1823 | Ga0097621_100000533 | |||
| 1824 | Ga0097621_100000581 | |||
| 1825 | Ga0097621_100002510 | |||
| 1826 | Ga0097621_100144578 | |||
| 1827 | Ga0097621_100262211 | |||
| 1828 | Ga0097621_100300200 | |||
| 1829 | Ga0097621_100564685 | |||
| 1830 | Ga0097621_100717551 | |||
| 1831 | Ga0097621_101038986 | |||
| 1832 | Ga0068871_100000664 | |||
| 1833 | Ga0068871_100014943 | |||
| 1834 | Ga0068871_100015369 | |||
| 1835 | Ga0068871_100031751 | |||
| 1836 | Ga0068871_100049053 | |||
| 1837 | Ga0068871_100060236 | |||
| 1838 | Ga0068871_100167412 | |||
| 1839 | Ga0068871_100241076 | |||
| 1840 | Ga0068871_100743332 | |||
| 1841 | Ga0068871_100754639 | |||
| 1842 | Ga0068871_101789899 | |||
| 1843 | Ga0075434_100002766 | |||
| 1844 | Ga0075434_100281638 | |||
| 1845 | Ga0068865_100003096 | |||
| 1846 | Ga0068865_100023261 | |||
| 1847 | Ga0068865_100528660 | |||
| 1848 | Ga0068865_100708932 | |||
| 1849 | Ga0068865_100930424 | |||
| 1850 | Ga0075436_100000526 | |||
| 1851 | Ga0075436_100000572 | |||
| 1852 | Ga0075436_100001967 | |||
| 1853 | Ga0075436_100168229 | |||
| 1854 | Ga0075436_100500103 | |||
| 1855 | Ga0097620_100002075 | |||
| 1856 | Ga0097620_100022875 | |||
| 1857 | Ga0097620_100124361 | |||
| 1858 | Ga0075435_100000105 | |||
| 1859 | Ga0075435_100010275 | |||
| 1860 | Ga0075435_100076906 | |||
| 1861 | Ga0075435_100099110 | |||
| 1862 | Ga0075435_100544363 | |||
| 1863 | Ga0075435_100547156 | |||
| 1864 | Ga0099794_10194192 | |||
| 1865 | Ga0099795_10043645 | |||
| 1866 | Ga0105250_10055205 | |||
| 1867 | Ga0105250_10120417 | |||
| 1868 | Ga0105250_10141585 | |||
| 1869 | Ga0105240_10007621 | |||
| 1870 | Ga0105240_10013860 | |||
| 1871 | Ga0105240_10021427 | |||
| 1872 | Ga0105240_10022551 | |||
| 1873 | Ga0105240_10025047 | |||
| 1874 | Ga0105240_10027526 | |||
| 1875 | Ga0105240_10104584 | |||
| 1876 | Ga0105240_10113356 | |||
| 1877 | Ga0105240_10175573 | |||
| 1878 | Ga0105240_10254282 | |||
| 1879 | Ga0105240_10715243 | |||
| 1880 | Ga0105240_11774798 | |||
| 1881 | Ga0105240_11868822 | |||
| 1882 | Ga0111539_11130271 | |||
| 1883 | Ga0105245_10006495 | |||
| 1884 | Ga0105245_10014743 | |||
| 1885 | Ga0105245_10063179 | |||
| 1886 | Ga0105245_10064487 | |||
| 1887 | Ga0105245_10378492 | |||
| 1888 | Ga0105247_10001928 | |||
| 1889 | Ga0105247_10070177 | |||
| 1890 | Ga0105247_10079259 | |||
| 1891 | Ga0105247_10339017 | |||
| 1892 | Ga0105247_10458712 | |||
| 1893 | Ga0105241_10000916 | |||
| 1894 | Ga0105241_10003223 | |||
| 1895 | Ga0105241_10022387 | |||
| 1896 | Ga0105241_10031221 | |||
| 1897 | Ga0105241_10323336 | |||
| 1898 | Ga0105242_10045809 | |||
| 1899 | Ga0105242_10184738 | |||
| 1900 | Ga0105242_10254945 | |||
| 1901 | Ga0105242_11074846 | |||
| 1902 | Ga0105242_13171759 | |||
| 1903 | Ga0105248_10095292 | |||
| 1904 | Ga0105248_10316778 | |||
| 1905 | Ga0105248_10334484 | |||
| 1906 | Ga0105248_10371816 | |||
| 1907 | Ga0105237_10010811 | |||
| 1908 | Ga0105237_10047409 | |||
| 1909 | Ga0105237_10061462 | |||
| 1910 | Ga0105237_10065472 | |||
| 1911 | Ga0105237_10160607 | |||
| 1912 | Ga0105237_10200670 | |||
| 1913 | Ga0105237_10213745 | |||
| 1914 | Ga0105237_10572746 | |||
| 1915 | Ga0105237_10601658 | |||
| 1916 | Ga0105237_10637221 | |||
| 1917 | Ga0105238_10000533 | |||
| 1918 | Ga0105238_10005181 | |||
| 1919 | Ga0105238_10018190 | |||
| 1920 | Ga0105238_10345765 | |||
| 1921 | Ga0105238_10622744 | |||
| 1922 | Ga0105238_10623030 | |||
| 1923 | Ga0105238_10647210 | |||
| 1924 | Ga0105249_10002069 | |||
| 1925 | Ga0105249_10006862 | |||
| 1926 | Ga0105249_10021522 | |||
| 1927 | Ga0105249_10217668 | |||
| 1928 | Ga0099796_10065184 | |||
| 1929 | Ga0105239_10006785 | |||
| 1930 | Ga0105239_10007480 | |||
| 1931 | Ga0105239_10050561 | |||
| 1932 | Ga0105239_10096517 | |||
| 1933 | Ga0105239_10112070 | |||
| 1934 | Ga0105239_10446777 | |||
| 1935 | Ga0105246_10001260 | |||
| 1936 | Ga0105246_10016393 | |||
| 1937 | Ga0105246_10056385 | |||
| 1938 | Ga0105246_10320392 | |||
| 1939 | Ga0157373_10000288 | |||
| 1940 | Ga0157373_10025303 | |||
| 1941 | Ga0157373_10039846 | |||
| 1942 | Ga0157373_10057653 | |||
| 1943 | Ga0157373_10252112 | |||
| 1944 | Ga0157373_11324032 | |||
| 1945 | Ga0157371_10004724 | |||
| 1946 | Ga0157371_10008279 | |||
| 1947 | Ga0157371_10074331 | |||
| 1948 | Ga0157370_10010473 | |||
| 1949 | Ga0157370_10253785 | |||
| 1950 | Ga0157370_10278282 | |||
| 1951 | Ga0157370_10884554 | |||
| 1952 | Ga0157370_10989186 | |||
| 1953 | Ga0157369_10000170 | |||
| 1954 | Ga0157369_10012417 | |||
| 1955 | Ga0157369_10030994 | |||
| 1956 | Ga0157369_10089041 | |||
| 1957 | Ga0157369_10100163 | |||
| 1958 | Ga0157369_10142571 | |||
| 1959 | Ga0157369_10751932 | |||
| 1960 | Ga0157369_12368184 | |||
| 1961 | Ga0157374_10000316 | |||
| 1962 | Ga0157374_10000330 | |||
| 1963 | Ga0157374_10000533 | |||
| 1964 | Ga0157374_10003747 | |||
| 1965 | Ga0157374_10044724 | |||
| 1966 | Ga0157374_10093741 | |||
| 1967 | Ga0157374_10108158 | |||
| 1968 | Ga0157374_10111176 | |||
| 1969 | Ga0157374_10895945 | |||
| 1970 | Ga0157374_11707748 | |||
| 1971 | Ga0157374_12246990 | |||
| 1972 | Ga0157378_10000085 | |||
| 1973 | Ga0157378_10000182 | |||
| 1974 | Ga0157378_10000924 | |||
| 1975 | Ga0157378_10025170 | |||
| 1976 | Ga0157378_10093762 | |||
| 1977 | Ga0157378_10203910 | |||
| 1978 | Ga0157378_10229872 | |||
| 1979 | Ga0157378_10342086 | |||
| 1980 | Ga0157378_10556177 | |||
| 1981 | Ga0157378_11295854 | |||
| 1982 | Ga0163162_10001077 | |||
| 1983 | Ga0163162_10016811 | |||
| 1984 | Ga0163162_10051295 | |||
| 1985 | Ga0163162_10147284 | |||
| 1986 | Ga0163162_10970233 | |||
| 1987 | Ga0157372_10000504 | |||
| 1988 | Ga0157372_10000620 | |||
| 1989 | Ga0157372_10001563 | |||
| 1990 | Ga0157372_10002374 | |||
| 1991 | Ga0157372_10003529 | |||
| 1992 | Ga0157372_10005602 | |||
| 1993 | Ga0157372_10006002 | |||
| 1994 | Ga0157372_10012821 | |||
| 1995 | Ga0157372_10019856 | |||
| 1996 | Ga0157372_10027371 | |||
| 1997 | Ga0157372_10057292 | |||
| 1998 | Ga0157372_10116652 | |||
| 1999 | Ga0157372_10131676 | |||
| 2000 | Ga0157372_10210955 | |||
| 2001 | Ga0157372_10426370 | |||
| 2002 | Ga0157372_11316169 | |||
| 2003 | Ga0157375_12202760 | |||
| 2004 | Ga0157375_13069503 | |||
| 2005 | Ga0157375_13605409 | |||
| 2006 | Ga0163163_10010337 | |||
| 2007 | Ga0163163_10026579 | |||
| 2008 | Ga0163163_10097597 | |||
| 2009 | Ga0163163_10102847 | |||
| 2010 | Ga0163163_10324039 | |||
| 2011 | Ga0163163_10414850 | |||
| 2012 | Ga0182008_10003217 | |||
| 2013 | Ga0182008_10023722 | |||
| 2014 | Ga0157377_10003658 | |||
| 2015 | Ga0157377_10172352 | |||
| 2016 | Ga0157379_10000791 | |||
| 2017 | Ga0157379_10023673 | |||
| 2018 | Ga0157379_10038649 | |||
| 2019 | Ga0157379_10066305 | |||
| 2020 | Ga0157379_10255717 | |||
| 2021 | Ga0157379_10432937 | |||
| 2022 | Ga0157376_10009674 | |||
| 2023 | Ga0157376_10064429 | |||
| 2024 | Ga0157376_10088762 | |||
| 2025 | Ga0157376_10129801 | |||
| 2026 | Ga0157376_10538200 | |||
| 2027 | Ga0157376_10650055 | |||
| 2028 | Ga0157376_10864868 | |||
| 2029 | Ga0157376_11936142 | |||
| 2030 | Ga0182006_1019129 | |||
| 2031 | Ga0182007_10001556 | |||
| 2032 | Ga0182007_10022074 | |||
| 2033 | Ga0182005_1016896 | |||
| 2034 | Ga0163161_10058965 | |||
| 2035 | Ga0163161_10494140 | |||
| 2036 | Ga0213874_10166228 | |||
| 2037 | Ga0213871_10034000 | |||
| 2038 | Ga0224570_100090 | |||
| 2039 | Ga0224569_102128 | |||
| 2040 | Ga0224572_1001260 | |||
| 2041 | Ga0224572_1006373 | |||
| 2042 | Ga0224572_1050959 | |||
| 2043 | Ga0228598_1001197 | |||
| 2044 | Ga0228598_1001295 | |||
| 2045 | Ga0228598_1003153 | |||
| 2046 | Ga0228598_1010611 | |||
| 2047 | Ga0207697_10007399 | |||
| 2048 | Ga0207656_10270253 | |||
| 2049 | Ga0207656_10346402 | |||
| 2050 | Ga0207692_10014791 | |||
| 2051 | Ga0207692_10021671 | |||
| 2052 | Ga0207692_10041283 | |||
| 2053 | Ga0207692_10043923 | |||
| 2054 | Ga0207692_10044990 | |||
| 2055 | Ga0207692_10061411 | |||
| 2056 | Ga0207692_10081692 | |||
| 2057 | Ga0207692_10527302 | |||
| 2058 | Ga0207692_10665267 | |||
| 2059 | Ga0207692_10716580 | |||
| 2060 | Ga0207642_10009113 | |||
| 2061 | Ga0207642_10013622 | |||
| 2062 | Ga0207642_10318506 | |||
| 2063 | Ga0207710_10002674 | |||
| 2064 | Ga0207710_10324250 | |||
| 2065 | Ga0207688_10007680 | |||
| 2066 | Ga0207680_10094289 | |||
| 2067 | Ga0207680_10120604 | |||
| 2068 | Ga0207680_10155328 | |||
| 2069 | Ga0207647_10006395 | |||
| 2070 | Ga0207647_10021548 | |||
| 2071 | Ga0207647_10026162 | |||
| 2072 | Ga0207647_10038205 | |||
| 2073 | Ga0207685_10005599 | |||
| 2074 | Ga0207685_10015359 | |||
| 2075 | Ga0207685_10047595 | |||
| 2076 | Ga0207685_10091752 | |||
| 2077 | Ga0207685_10368683 | |||
| 2078 | Ga0207685_10374503 | |||
| 2079 | Ga0207699_10006949 | |||
| 2080 | Ga0207699_10011142 | |||
| 2081 | Ga0207699_10014789 | |||
| 2082 | Ga0207699_10050376 | |||
| 2083 | Ga0207699_10071036 | |||
| 2084 | Ga0207699_10092829 | |||
| 2085 | Ga0207699_10098615 | |||
| 2086 | Ga0207699_10102345 | |||
| 2087 | Ga0207699_10123868 | |||
| 2088 | Ga0207699_10259783 | |||
| 2089 | Ga0207699_10262814 | |||
| 2090 | Ga0207699_10474242 | |||
| 2091 | Ga0207699_10737767 | |||
| 2092 | Ga0207699_11035511 | |||
| 2093 | Ga0207699_11057704 | |||
| 2094 | Ga0207645_10000181 | |||
| 2095 | Ga0207645_10239939 | |||
| 2096 | Ga0207643_10000474 | |||
| 2097 | Ga0207643_10193945 | |||
| 2098 | Ga0207705_10846676 | |||
| 2099 | Ga0207705_11029136 | |||
| 2100 | Ga0207684_10000217 | |||
| 2101 | Ga0207684_10000267 | |||
| 2102 | Ga0207684_10006270 | |||
| 2103 | Ga0207684_10029324 | |||
| 2104 | Ga0207684_10282610 | |||
| 2105 | Ga0207684_10322565 | |||
| 2106 | Ga0207684_10643037 | |||
| 2107 | Ga0207654_10006558 | |||
| 2108 | Ga0207654_10007076 | |||
| 2109 | Ga0207654_10030891 | |||
| 2110 | Ga0207654_10128336 | |||
| 2111 | Ga0207654_10147974 | |||
| 2112 | Ga0207654_10159214 | |||
| 2113 | Ga0207707_10000739 | |||
| 2114 | Ga0207707_10093271 | |||
| 2115 | Ga0207707_10098070 | |||
| 2116 | Ga0207707_10116639 | |||
| 2117 | Ga0207707_10125156 | |||
| 2118 | Ga0207707_10910238 | |||
| 2119 | Ga0207695_10007408 | |||
| 2120 | Ga0207695_10022440 | |||
| 2121 | Ga0207695_10037646 | |||
| 2122 | Ga0207695_10072134 | |||
| 2123 | Ga0207695_10075457 | |||
| 2124 | Ga0207695_10109531 | |||
| 2125 | Ga0207695_10123755 | |||
| 2126 | Ga0207695_10372110 | |||
| 2127 | Ga0207695_10960423 | |||
| 2128 | Ga0207671_10024462 | |||
| 2129 | Ga0207671_10030939 | |||
| 2130 | Ga0207671_10032741 | |||
| 2131 | Ga0207671_10099930 | |||
| 2132 | Ga0207671_10138047 | |||
| 2133 | Ga0207671_10611092 | |||
| 2134 | Ga0207671_11000955 | |||
| 2135 | Ga0207693_10000089 | |||
| 2136 | Ga0207693_10000106 | |||
| 2137 | Ga0207693_10000478 | |||
| 2138 | Ga0207693_10002945 | |||
| 2139 | Ga0207693_10007165 | |||
| 2140 | Ga0207693_10013816 | |||
| 2141 | Ga0207693_10026924 | |||
| 2142 | Ga0207693_10046217 | |||
| 2143 | Ga0207693_10128351 | |||
| 2144 | Ga0207693_10133114 | |||
| 2145 | Ga0207693_10178348 | |||
| 2146 | Ga0207693_10289648 | |||
| 2147 | Ga0207693_10834232 | |||
| 2148 | Ga0207693_11119766 | |||
| 2149 | Ga0207663_10001049 | |||
| 2150 | Ga0207663_10005124 | |||
| 2151 | Ga0207663_10036016 | |||
| 2152 | Ga0207663_10045885 | |||
| 2153 | Ga0207663_10050065 | |||
| 2154 | Ga0207663_10067326 | |||
| 2155 | Ga0207663_10083265 | |||
| 2156 | Ga0207663_10101173 | |||
| 2157 | Ga0207663_10111144 | |||
| 2158 | Ga0207663_10172153 | |||
| 2159 | Ga0207663_10307978 | |||
| 2160 | Ga0207663_10330244 | |||
| 2161 | Ga0207663_10531406 | |||
| 2162 | Ga0207663_10767062 | |||
| 2163 | Ga0207663_10784502 | |||
| 2164 | Ga0207663_10961387 | |||
| 2165 | Ga0207663_11166378 | |||
| 2166 | Ga0207663_11604146 | |||
| 2167 | Ga0207660_10073963 | |||
| 2168 | Ga0207660_10080008 | |||
| 2169 | Ga0207660_10274268 | |||
| 2170 | Ga0207660_10486656 | |||
| 2171 | Ga0207662_10005327 | |||
| 2172 | Ga0207657_10000535 | |||
| 2173 | Ga0207657_10001828 | |||
| 2174 | Ga0207657_10002724 | |||
| 2175 | Ga0207649_10001639 | |||
| 2176 | Ga0207649_10005022 | |||
| 2177 | Ga0207649_10008845 | |||
| 2178 | Ga0207649_10063863 | |||
| 2179 | Ga0207649_10158581 | |||
| 2180 | Ga0207652_10052293 | |||
| 2181 | Ga0207652_10139606 | |||
| 2182 | Ga0207652_10276842 | |||
| 2183 | Ga0207652_10402529 | |||
| 2184 | Ga0207652_10737636 | |||
| 2185 | Ga0207646_10000296 | |||
| 2186 | Ga0207646_10001311 | |||
| 2187 | Ga0207646_10010514 | |||
| 2188 | Ga0207646_10028179 | |||
| 2189 | Ga0207646_10046246 | |||
| 2190 | Ga0207646_10046789 | |||
| 2191 | Ga0207646_10077906 | |||
| 2192 | Ga0207646_10231800 | |||
| 2193 | Ga0207646_10365106 | |||
| 2194 | Ga0207646_10385148 | |||
| 2195 | Ga0207646_10667664 | |||
| 2196 | Ga0207646_11296974 | |||
| 2197 | Ga0207681_10038573 | |||
| 2198 | Ga0207681_10076422 | |||
| 2199 | Ga0207681_10197599 | |||
| 2200 | Ga0207694_10001172 | |||
| 2201 | Ga0207694_10029940 | |||
| 2202 | Ga0207694_10030975 | |||
| 2203 | Ga0207694_10113628 | |||
| 2204 | Ga0207650_10000223 | |||
| 2205 | Ga0207650_10121450 | |||
| 2206 | Ga0207659_10433888 | |||
| 2207 | Ga0207687_10003198 | |||
| 2208 | Ga0207687_10016635 | |||
| 2209 | Ga0207687_10064399 | |||
| 2210 | Ga0207687_10252179 | |||
| 2211 | Ga0207700_10000289 | |||
| 2212 | Ga0207700_10000888 | |||
| 2213 | Ga0207700_10001971 | |||
| 2214 | Ga0207700_10038958 | |||
| 2215 | Ga0207700_10041701 | |||
| 2216 | Ga0207700_10064554 | |||
| 2217 | Ga0207700_10093084 | |||
| 2218 | Ga0207700_10103713 | |||
| 2219 | Ga0207700_10136066 | |||
| 2220 | Ga0207700_10138557 | |||
| 2221 | Ga0207700_10154392 | |||
| 2222 | Ga0207700_10188701 | |||
| 2223 | Ga0207700_10244351 | |||
| 2224 | Ga0207700_10324223 | |||
| 2225 | Ga0207700_10353459 | |||
| 2226 | Ga0207700_10378154 | |||
| 2227 | Ga0207700_10503373 | |||
| 2228 | Ga0207700_10616269 | |||
| 2229 | Ga0207700_10958648 | |||
| 2230 | Ga0207700_11826428 | |||
| 2231 | Ga0207664_10000118 | |||
| 2232 | Ga0207664_10003882 | |||
| 2233 | Ga0207664_10033923 | |||
| 2234 | Ga0207664_10041140 | |||
| 2235 | Ga0207664_10073025 | |||
| 2236 | Ga0207664_10093195 | |||
| 2237 | Ga0207664_10136743 | |||
| 2238 | Ga0207664_10138640 | |||
| 2239 | Ga0207664_10166224 | |||
| 2240 | Ga0207664_10177089 | |||
| 2241 | Ga0207664_10263335 | |||
| 2242 | Ga0207664_10298559 | |||
| 2243 | Ga0207664_10367275 | |||
| 2244 | Ga0207664_10392115 | |||
| 2245 | Ga0207664_10660827 | |||
| 2246 | Ga0207664_11027098 | |||
| 2247 | Ga0207664_11149802 | |||
| 2248 | Ga0207664_11450318 | |||
| 2249 | Ga0207664_11509216 | |||
| 2250 | Ga0207644_10050252 | |||
| 2251 | Ga0207644_10053693 | |||
| 2252 | Ga0207644_11608850 | |||
| 2253 | Ga0207690_10004009 | |||
| 2254 | Ga0207690_10018828 | |||
| 2255 | Ga0207690_10047080 | |||
| 2256 | Ga0207690_10140491 | |||
| 2257 | Ga0207706_10000613 | |||
| 2258 | Ga0207706_10000670 | |||
| 2259 | Ga0207706_10010049 | |||
| 2260 | Ga0207706_10762621 | |||
| 2261 | Ga0207686_10038694 | |||
| 2262 | Ga0207686_10133109 | |||
| 2263 | Ga0207686_10169668 | |||
| 2264 | Ga0207686_10180694 | |||
| 2265 | Ga0207709_10018165 | |||
| 2266 | Ga0207670_10019581 | |||
| 2267 | Ga0207670_10291076 | |||
| 2268 | Ga0207669_10042896 | |||
| 2269 | Ga0207669_10375173 | |||
| 2270 | Ga0207704_10047312 | |||
| 2271 | Ga0207704_10097235 | |||
| 2272 | Ga0207704_10205401 | |||
| 2273 | Ga0207665_10001184 | |||
| 2274 | Ga0207665_10001526 | |||
| 2275 | Ga0207665_10001917 | |||
| 2276 | Ga0207665_10007063 | |||
| 2277 | Ga0207665_10018476 | |||
| 2278 | Ga0207665_10036854 | |||
| 2279 | Ga0207665_10051007 | |||
| 2280 | Ga0207665_10068713 | |||
| 2281 | Ga0207665_10163525 | |||
| 2282 | Ga0207665_10187819 | |||
| 2283 | Ga0207665_10323754 | |||
| 2284 | Ga0207665_10371240 | |||
| 2285 | Ga0207665_10512677 | |||
| 2286 | Ga0207665_10515676 | |||
| 2287 | Ga0207665_10560930 | |||
| 2288 | Ga0207665_11054793 | |||
| 2289 | Ga0207665_11103812 | |||
| 2290 | Ga0207691_10000345 | |||
| 2291 | Ga0207691_10206787 | |||
| 2292 | Ga0207691_10686022 | |||
| 2293 | Ga0207711_10024220 | |||
| 2294 | Ga0207711_10031511 | |||
| 2295 | Ga0207711_10210624 | |||
| 2296 | Ga0207711_10282130 | |||
| 2297 | Ga0207689_10000499 | |||
| 2298 | Ga0207689_10004722 | |||
| 2299 | Ga0207689_10034521 | |||
| 2300 | Ga0207689_10056056 | |||
| 2301 | Ga0207661_10001212 | |||
| 2302 | Ga0207661_10014609 | |||
| 2303 | Ga0207661_10246278 | |||
| 2304 | Ga0207661_10387609 | |||
| 2305 | Ga0207661_10414098 | |||
| 2306 | Ga0207679_10000115 | |||
| 2307 | Ga0207679_10004660 | |||
| 2308 | Ga0207679_10036871 | |||
| 2309 | Ga0207679_10043935 | |||
| 2310 | Ga0207679_11058595 | |||
| 2311 | Ga0207667_10000785 | |||
| 2312 | Ga0207667_10003707 | |||
| 2313 | Ga0207667_10012312 | |||
| 2314 | Ga0207667_10041063 | |||
| 2315 | Ga0207667_10057513 | |||
| 2316 | Ga0207667_10083773 | |||
| 2317 | Ga0207651_10028184 | |||
| 2318 | Ga0207651_10043996 | |||
| 2319 | Ga0207651_11150338 | |||
| 2320 | Ga0207712_10012010 | |||
| 2321 | Ga0207712_10064748 | |||
| 2322 | Ga0207668_10091740 | |||
| 2323 | Ga0207668_10107238 | |||
| 2324 | Ga0207640_10004082 | |||
| 2325 | Ga0207640_10018685 | |||
| 2326 | Ga0207640_10024613 | |||
| 2327 | Ga0207640_10025664 | |||
| 2328 | Ga0207640_10092094 | |||
| 2329 | Ga0207640_10394309 | |||
| 2330 | Ga0207640_11103811 | |||
| 2331 | Ga0207640_12025149 | |||
| 2332 | Ga0207658_10039444 | |||
| 2333 | Ga0207677_10002530 | |||
| 2334 | Ga0207677_10003252 | |||
| 2335 | Ga0207677_10007719 | |||
| 2336 | Ga0207677_10019421 | |||
| 2337 | Ga0207677_10026550 | |||
| 2338 | Ga0207677_10096354 | |||
| 2339 | Ga0207703_10004647 | |||
| 2340 | Ga0207703_10007943 | |||
| 2341 | Ga0207703_10027824 | |||
| 2342 | Ga0207703_10119007 | |||
| 2343 | Ga0207703_10126739 | |||
| 2344 | Ga0207703_10273360 | |||
| 2345 | Ga0207639_10015221 | |||
| 2346 | Ga0207639_10070409 | |||
| 2347 | Ga0207639_10107358 | |||
| 2348 | Ga0207639_10320961 | |||
| 2349 | Ga0207639_10716238 | |||
| 2350 | Ga0207678_10000130 | |||
| 2351 | Ga0207678_10001418 | |||
| 2352 | Ga0207678_10387169 | |||
| 2353 | Ga0207708_10025729 | |||
| 2354 | Ga0207702_10000089 | |||
| 2355 | Ga0207702_10001792 | |||
| 2356 | Ga0207702_10002571 | |||
| 2357 | Ga0207702_10011696 | |||
| 2358 | Ga0207702_10021538 | |||
| 2359 | Ga0207702_10138350 | |||
| 2360 | Ga0207702_10150683 | |||
| 2361 | Ga0207702_10629975 | |||
| 2362 | Ga0207702_10861300 | |||
| 2363 | Ga0207641_10000287 | |||
| 2364 | Ga0207641_10017583 | |||
| 2365 | Ga0207641_10032145 | |||
| 2366 | Ga0207641_10083345 | |||
| 2367 | Ga0207641_10144071 | |||
| 2368 | Ga0207641_10178140 | |||
| 2369 | Ga0207641_10260168 | |||
| 2370 | Ga0207641_11132900 | |||
| 2371 | Ga0207648_10001253 | |||
| 2372 | Ga0207648_10007469 | |||
| 2373 | Ga0207648_10009512 | |||
| 2374 | Ga0207648_10104312 | |||
| 2375 | Ga0207676_10000115 | |||
| 2376 | Ga0207676_10001385 | |||
| 2377 | Ga0207676_10022329 | |||
| 2378 | Ga0207676_10098239 | |||
| 2379 | Ga0207674_10000309 | |||
| 2380 | Ga0207674_10001340 | |||
| 2381 | Ga0207674_10005897 | |||
| 2382 | Ga0207674_10027037 | |||
| 2383 | Ga0207674_10067233 | |||
| 2384 | Ga0207674_10411029 | |||
| 2385 | Ga0207675_100179691 | |||
| 2386 | Ga0207675_101612506 | |||
| 2387 | Ga0207683_10000217 | |||
| 2388 | Ga0207683_10047570 | |||
| 2389 | Ga0207683_10220024 | |||
| 2390 | Ga0207683_10460220 | |||
| 2391 | Ga0207698_10005557 | |||
| 2392 | Ga0207698_10034675 | |||
| 2393 | Ga0207698_10086948 | |||
| 2394 | Ga0207698_10122828 | |||
| 2395 | Ga0207698_10544204 | |||
| 2396 | Ga0265356_1000460 | |||
| 2397 | Ga0268266_10000761 | |||
| 2398 | Ga0268266_10208361 | |||
| 2399 | Ga0268265_10040417 | |||
| 2400 | Ga0268265_10054561 | |||
| 2401 | Ga0268265_10079055 | |||
| 2402 | Ga0268265_10271720 | |||
| 2403 | Ga0268264_10081808 | |||
| 2404 | Ga0268264_10128399 | |||
| 2405 | Ga0268264_10185595 | |||
| 2406 | Ga0268264_10190056 | |||
| 2407 | Ga0268264_10280871 | |||
| 2408 | Ga0268264_10371132 | |||
| 2409 | Ga0268264_10950407 | |||
| 2410 | Ga0268264_11035657 | |||
| 2411 | Ga0265338_10006709 | |||
| 2412 | Ga0265338_10023713 | |||
| 2413 | Ga0265338_10085823 | |||
| 2414 | Ga0265338_10099173 | |||
| 2415 | Ga0265338_10141362 | |||
| 2416 | Ga0265338_10332241 | |||
| 2417 | Ga0265338_11009597 | |||
| 2418 | Ga0265762_1000555 | |||
| 2419 | Ga0265762_1001369 | |||
| 2420 | Ga0265762_1001687 | |||
| 2421 | Ga0265770_1007389 | |||
| 2422 | Ga0265770_1040770 | |||
| 2423 | Ga0265770_1066978 | |||
| 2424 | Ga0265760_10002193 | |||
| 2425 | Ga0265760_10008888 | |||
| 2426 | Ga0265760_10018621 | |||
| 2427 | Ga0265760_10054506 | |||
| 2428 | Ga0265760_10118488 | |||
| 2429 | Ga0265760_10141911 | |||
| 2430 | Ga0265760_10160093 | |||
| 2431 | Ga0265332_10124037 | |||
| 2432 | Ga0265328_10010953 | |||
| 2433 | Ga0265325_10173829 | |||
| 2434 | Ga0265340_10030035 | |||
| 2435 | Ga0265340_10039248 | |||
| 2436 | Ga0265340_10064085 | |||
| 2437 | Ga0265340_10072102 | |||
| 2438 | Ga0265340_10079574 | |||
| 2439 | Ga0265339_10005007 | |||
| 2440 | Ga0265339_10005406 | |||
| 2441 | Ga0265339_10057224 | |||
| 2442 | Ga0265339_10110504 | |||
| 2443 | Ga0265339_10171582 | |||
| 2444 | Ga0265316_10002496 | |||
| 2445 | Ga0265316_10026402 | |||
| 2446 | Ga0265316_10071116 | |||
| 2447 | Ga0265316_10505109 | |||
| 2448 | Ga0265316_11192118 | |||
| 2449 | Ga0307408_100818075 | |||
| 2450 | Ga0265314_10002671 | |||
| 2451 | Ga0265314_10010032 | |||
| 2452 | Ga0265314_10033779 | |||
| 2453 | Ga0265342_10040359 | |||
| 2454 | Ga0307405_10110461 | |||
| 2455 | Ga0307410_10006635 | |||
| 2456 | Ga0307410_10291128 | |||
| 2457 | Ga0307406_10887178 | |||
| 2458 | Ga0307407_10148674 | |||
| 2459 | Ga0307412_10044143 | |||
| 2460 | Ga0307412_10464530 | |||
| 2461 | Ga0307412_10773190 | |||
| 2462 | Ga0307412_10866646 | |||
| 2463 | Ga0307409_100040606 | |||
| 2464 | Ga0307416_100091640 | |||
| 2465 | Ga0307414_10384718 | |||
| 2466 | Ga0307411_10010176 | |||
| 2467 | Ga0307411_11330951 | |||
| 2468 | Ga0316212_1008681 | |||
| 2469 | Ga0373930_0060732 | |||
| 2470 | Ga0373958_0035222 | |||
| 2471 | Ga0373938_0013461 | |||
| 2472 | Ga0373926_0002011 | |||
| 2473 | Ga0373926_0130968 | |||
| 2474 | Ga0373926_0230632 | |||
| 2475 | Ga0373929_0016269 | |||
| 2476 | Ga0373934_0148320 | |||
| 2477 | Ga0373940_0169494 | |||
| 2478 | Ga0373944_0104907 | |||
| 2479 | Ga0373944_0303312 | |||
| 2480 | Ga0373952_0010030 | |||
| 2481 | Ga0373923_0092910 | |||
| 2482 | Ga0373923_0108092 | |||
| 2483 | Ga0373923_0372602 | |||
| 2484 | Ga0373932_0183595 | |||
| 2485 | Ga0373932_0340592 | |||
| 2486 | Ga0373932_0364845 | |||
| 2487 | Ga0373936_0010711 | |||
| 2488 | Ga0373936_0069620 | |||
| 2489 | Ga0373936_0084887 | |||
| 2490 | Ga0373936_0100838 | |||
| 2491 | Ga0373936_0112569 | |||
| 2492 | Ga0373936_0126371 | |||
| 2493 | Ga0373936_0263468 | |||
| 2494 | Ga0373939_0007117 | |||
| 2495 | Ga0373939_0079980 | |||
| 2496 | Ga0373941_0030121 | |||
| 2497 | Ga0373945_0193149 | |||
| 2498 | Ga0373945_0279639 | |||
| 2499 | Ga0373945_0412959 | |||
| 2500 | Ga0373953_0074673 | |||
| 2501 | Ga0373954_0187440 | |||
| 2502 | Ga0373956_0287152 | |||
| 2503 | Ga0373943_0036935 | |||
| 2504 | Ga0373943_0064816 | |||
| 2505 | Ga0373943_0113914 | |||
| 2506 | Ga0373943_0158163 | |||
| 2507 | Ga0373943_0158321 | |||
| 2508 | Ga0373943_0717124 | |||
| 2509 | Ga0373946_0072145 | |||
| 2510 | Ga0373946_0095391 | |||
| 2511 | Ga0373946_0118343 | |||
| 2512 | Ga0373946_0316002 | |||
| 2513 | Ga0373955_0039567 | |||
| 2514 | Ga0373955_0111391 | |||
| 2515 | Ga0373955_0162616 | |||
| 2516 | Ga0373955_0262071 | |||
| 2517 | Ga0373955_0515418 | |||
| 2518 | Ga0373942_0027742 | |||
| 2519 | Ga0373962_0316974 | |||
| 2520 | Ga0373924_0044436 | |||
| 2521 | Ga0373931_0004545 | |||
| 2522 | Ga0373931_0041928 | |||
| 2523 | Ga0373931_0079597 | |||
| 2524 | Ga0373931_0573114 | |||
| 2525 | Ga0373931_1076048 | |||
| 2526 | Ga0373935_0083839 | |||
| 2527 | Ga0373935_0256813 | |||
| 2528 | Ga0373935_0285663 | |||
| 2529 | Ga0373935_0355477 | |||
| 2530 | Ga0373935_0456900 | |||
| 2531 | Ga0373935_1316233 | |||
| 2532 | Ga0373927_0037883 | |||
| 2533 | Ga0373927_0062914 | |||
| 2534 | Ga0373927_0100844 | |||
| 2535 | Ga0373927_0121129 | |||
| 2536 | Ga0373927_0176315 | |||
| 2537 | Ga0373927_0235474 | |||
| 2538 | Ga0373927_0341556 | |||
| 2539 | Ga0373933_0050319 | |||
| 2540 | Ga0373933_0136851 | |||
| 2541 | Ga0373933_0229637 | |||
| 2542 | Ga0373933_0437550 | |||
| 2543 | Ga0373933_0872130 | |||
| 2544 | Ga0373947_0003282 | |||
| 2545 | Ga0373947_0016844 | |||
| 2546 | Ga0373947_0066081 | |||
| 2547 | Ga0373947_0283724 | |||
| 2548 | Ga0373947_0329156 | |||
| 2549 | Ga0373947_0363894 | |||
| 2550 | Ga0373937_0022486 | |||
| 2551 | Ga0373937_0075249 | |||
| 2552 | Ga0373937_0075367 | |||
| 2553 | Ga0373937_0136990 | |||
| 2554 | Ga0373937_0257177 | |||
| 2555 | Ga0373937_0384876 | |||
| 2556 | Ga0373925_0022151 | |||
| 2557 | Ga0373925_0064821 | |||
| 2558 | Ga0373925_0160860 | |||
| 2559 | Ga0373925_0248800 | |||
| 2560 | Ga0373925_0299562 | |||
| 2561 | Ga0373925_0434075 | |||
| 2562 | Ga0373925_0865301 | |||
| 2563 | Ga0373925_1353700 | |||
| 2564 | Ga0395900_1021777 | |||
| 2565 | Ga0395898_1391984 | |||
| 2566 | Ga0395905_0245982 | |||
| 2567 | Ga0395905_0318132 | |||
| 2568 | Ga0395905_0467630 | |||
| 2569 | Ga0436364_0298147 | |||
| 2570 | Ga0395901_0538954 | |||
| 2571 | Ga0436365_0833051 | |||
| 2572 | Ga0436360_0673425 | |||
| 2573 | Ga0436360_0967961 | |||
| 2574 | Ga0436363_0009640 | |||
| 2575 | Ga0436363_0209267 | |||
| 2576 | Ga0436363_0284783 | |||
| 2577 | Ga0436363_0808254 | |||
| 2578 | Ga0436363_0845898 | |||
| 2579 | Ga0436362_0381178 | |||
| 2580 | Ga0451839_0843721 | |||
| 2581 | Ga0451577_1156179 | |||
| 2582 | Ga0466961_0319338 | |||
| 2583 | Ga0466963_0019363 | |||
| 2584 | Ga0466963_0311414 | |||
| 2585 | Ga0466964_0139691 | |||
| 2586 | Ga0466964_0175058 | |||
| 2587 | Ga0453684_0757408 | |||
| 2588 | Ga0466968_0207311 | |||
| 2589 | Ga0466968_0449759 | |||
| 2590 | Ga0466959_0326706 | |||
| 2591 | Ga0466959_0406429 | |||
| 2592 | Ga0466959_0758399 | |||
| 2593 | Ga0466959_0804752 | |||
| 2594 | Ga0451576_0095439 | |||
| 2595 | Ga0451576_0532981 | |||
| 2596 | Ga0451576_1638010 | |||
| 2597 | Ga0466967_0006951 | |||
| 2598 | Ga0466967_0032212 | |||
| 2599 | Ga0466967_0055087 | |||
| 2600 | Ga0466967_0241580 | |||
| 2601 | Ga0466967_1618604 | |||
| 2602 | Ga0466967_2462982 | |||
| 2603 | Ga0495603_0113431 | |||
| 2604 | Ga0495629_0013250 | |||
| 2605 | Ga0495653_0508547 | |||
| 2606 | Ga0495653_0605907 | |||
| 2607 | Ga0495580_0000031 | |||
| 2608 | Ga0495580_0002510 | |||
| 2609 | Ga0495580_0003785 | |||
| 2610 | Ga0495580_0008038 | |||
| 2611 | Ga0495580_0011952 | |||
| 2612 | Ga0495580_0012257 | |||
| 2613 | Ga0495580_0013423 | |||
| 2614 | Ga0495580_0019954 | |||
| 2615 | Ga0495580_0042560 | |||
| 2616 | Ga0495580_0060755 | |||
| 2617 | Ga0495580_0074308 | |||
| 2618 | Ga0495580_0121783 | |||
| 2619 | Ga0495580_0269184 | |||
| 2620 | Ga0495580_0396984 | |||
| 2621 | Ga0495580_0438370 | |||
| 2622 | Ga0495580_0516691 | |||
| 2623 | Ga0495580_0545248 | |||
| 2624 | Ga0495580_0603181 | |||
| 2625 | Ga0495580_0750577 | |||
| 2626 | Ga0495582_0001059 | |||
| 2627 | Ga0495582_0010750 | |||
| 2628 | Ga0495582_0159874 | |||
| 2629 | Ga0495582_0255001 | |||
| 2630 | Ga0495639_0062931 | |||
| 2631 | Ga0495639_0069115 | |||
| 2632 | Ga0495639_0367620 | |||
| 2633 | Ga0495662_0172779 | |||
| 2634 | Ga0495584_0685658 | |||
| 2635 | Ga0495618_0600598 | |||
| 2636 | Ga0495630_0273481 | |||
| 2637 | Ga0495630_0386677 | |||
| 2638 | Ga0495666_0063034 | |||
| 2639 | Ga0495666_0204804 | |||
| 2640 | Ga0495666_0385087 | |||
| 2641 | Ga0495652_0579790 | |||
| 2642 | Ga0495665_0025755 | |||
| 2643 | Ga0495665_0064771 | |||
| 2644 | Ga0495640_0214361 | |||
| 2645 | Ga0495640_0245433 | |||
| 2646 | Ga0495586_0828540 | |||
| 2647 | Ga0495587_0108369 | |||
| 2648 | Ga0495645_0153799 | |||
| 2649 | Ga0495667_0478810 | |||
| 2650 | Ga0495659_0029097 | |||
| 2651 | Ga0495657_0692047 | |||
| 2652 | Ga0495623_0023471 | |||
| 2653 | Ga0495623_0703022 | |||
| 2654 | Ga0495658_0744781 | |||
| 2655 | Ga0495669_0054259 | |||
| 2656 | Ga0495669_0058045 | |||
| 2657 | Ga0495613_0126079 | |||
| 2658 | Ga0495624_0448279 | |||
| 2659 | Ga0495624_0458877 | |||
| 2660 | Ga0495624_0535561 | |||
| 2661 | Ga0495624_0740002 | |||
| 2662 | Ga0495670_0166420 | |||
| 2663 | Ga0495649_0352483 | |||
| 2664 | Ga0495600_0900233 | |||
| 2665 | Ga0495604_0109922 | |||
| 2666 | Ga0495604_0437500 | |||
| 2667 | Ga0495674_0075852 | |||
| 2668 | Ga0495674_0135485 | |||
| 2669 | Ga0495674_0137641 | |||
| 2670 | Ga0495675_0041145 | |||
| 2671 | Ga0495675_0332838 | |||
| 2672 | Ga0495684_0216793 | |||
| 2673 | Ga0495684_0875416 | |||
| 2674 | Ga0495593_0287981 | |||
| 2675 | Ga0495602_0043932 | |||
| 2676 | Ga0495602_0166686 | |||
| 2677 | Ga0495602_0329407 | |||
| 2678 | Ga0495602_0820984 | |||
| 2679 | Ga0496100_0033637 | |||
| 2680 | Ga0496100_0086547 | |||
| 2681 | Ga0496100_0101346 | |||
| 2682 | Ga0496100_0102743 | |||
| 2683 | Ga0496100_0382645 | |||
| 2684 | Ga0496101_0175686 | |||
| 2685 | Ga0496101_0323270 | |||
| 2686 | Ga0496101_1496540 | |||
| 2687 | Ga0496102_0001424 | |||
| 2688 | Ga0496102_0021406 | |||
| 2689 | Ga0496102_0052423 | |||
| 2690 | Ga0496102_0078474 | |||
| 2691 | Ga0496102_0149569 | |||
| 2692 | Ga0496102_0153471 | |||
| 2693 | Ga0496102_0183631 | |||
| 2694 | Ga0496102_0185835 | |||
| 2695 | Ga0496102_0257323 | |||
| 2696 | Ga0496102_0280180 | |||
| 2697 | Ga0496103_0003887 | |||
| 2698 | Ga0496103_0005029 | |||
| 2699 | Ga0496103_0048205 | |||
| 2700 | Ga0496104_0018664 | |||
| 2701 | Ga0496104_0031354 | |||
| 2702 | Ga0496104_0075482 | |||
| 2703 | Ga0496104_0105810 | |||
| 2704 | Ga0496104_0328056 | |||
| 2705 | Ga0496104_0336874 | |||
| 2706 | Ga0496104_0362288 | |||
| 2707 | Ga0496104_0365399 | |||
| 2708 | Ga0496104_1143113 | |||
| 2709 | Ga0496105_0060287 | |||
| 2710 | Ga0496105_0560915 | |||
| 2711 | Ga0496106_0014952 | |||
| 2712 | Ga0496106_0041788 | |||
| 2713 | Ga0496106_0093211 | |||
| 2714 | Ga0496106_0332237 | |||
| 2715 | Ga0496107_0016408 | |||
| 2716 | Ga0496107_0094872 | |||
| 2717 | Ga0496107_1174746 | |||
| 2718 | Ga0496108_0000325 | |||
| 2719 | Ga0496108_0040500 | |||
| 2720 | Ga0496108_0322918 | |||
| 2721 | Ga0496108_0549062 | |||
| 2722 | Ga0496108_0554139 | |||
| 2723 | Ga0496109_0000117 | |||
| 2724 | Ga0496109_0096787 | |||
| 2725 | Ga0496109_0426308 | |||
| 2726 | Ga0496109_1053736 | |||
| 2727 | Ga0496109_1749891 | |||
| 2728 | Ga0496110_0006359 | |||
| 2729 | Ga0496110_0025595 | |||
| 2730 | Ga0496111_0094258 | |||
| 2731 | Ga0496111_0724057 | |||
| 2732 | Ga0496112_0000283 | |||
| 2733 | Ga0496112_0014557 | |||
| 2734 | Ga0496112_0016004 | |||
| 2735 | Ga0496112_0021267 | |||
| 2736 | Ga0496112_0024757 | |||
| 2737 | Ga0496112_0047441 | |||
| 2738 | Ga0496112_0050645 | |||
| 2739 | Ga0496112_0056839 | |||
| 2740 | Ga0496112_0099290 | |||
| 2741 | Ga0496112_0119918 | |||
| 2742 | Ga0496112_0238847 | |||
| 2743 | Ga0496112_0476740 | |||
| 2744 | Ga0496113_0007994 | |||
| 2745 | Ga0496113_0109867 | |||
| 2746 | Ga0496113_0383886 | |||
| 2747 | Ga0496113_1315066 | |||
| 2748 | Ga0496114_0033551 | |||
| 2749 | Ga0496115_0012224 | |||
| 2750 | Ga0496115_0031114 | |||
| 2751 | Ga0496115_0112581 | |||
| 2752 | Ga0496126_0539047 | |||
| 2753 | Ga0501290_024838 | |||
| 2754 | Ga0501292_045035 | |||
| 2755 | Ga0501295_095458 | |||
| 2756 | Ga0501297_024373 | |||
| 2757 | Ga0501298_002596 | |||
| 2758 | Ga0501298_137844 | |||
| 2759 | Ga0501299_062524 | |||
| 2760 | Ga0501299_125162 | |||
| 2761 | Ga0501216_084325 | |||
| 2762 | Ga0501222_026356 | |||
| 2763 | Ga0501227_200439 | |||
| 2764 | Ga0501239_015045 | |||
| 2765 | Ga0501247_035382 | |||
| 2766 | Ga0501250_008377 | |||
| 2767 | Ga0501225_0095308 | |||
| 2768 | Ga0501245_138972 | |||
| 2769 | Ga0501083_0072867 | |||
| 2770 | Ga0501083_0145012 | |||
| 2771 | nmdc:mga0n895_102873_c1 | |||
| 2772 | nmdc:mga0n895_27328_c1 | |||
| 2773 | nmdc:mga0n895_273663_c1 | |||
| 2774 | nmdc:mga0rr50_224426_c1 | |||
| 2775 | nmdc:mga0rr50_284_c1 | |||
| 2776 | nmdc:mga0rr50_292441_c1 | |||
| 2777 | nmdc:mga0rr50_542920_c1 | |||
| 2778 | nmdc:mga0rr50_84483_c1 | |||
| 2779 | nmdc:mga0rr50_8721_c1 | |||
| 2780 | nmdc:mga0rr50_91738_c1 | |||
| 2781 | nmdc:mga0rr50_995542_c1 | |||
| 2782 | nmdc:mga08x19_21264_c1 | |||
| 2783 | nmdc:mga08x19_24287_c1 | |||
| 2784 | nmdc:mga08x19_448477_c1 | |||
| 2785 | nmdc:mga08x19_4593_c1 | |||
| 2786 | nmdc:mga08x19_5882_c1 | |||
| 2787 | nmdc:mga08x19_83365_c1 | |||
| 2788 | nmdc:mga08x19_88067_c1 | |||
| 2789 | nmdc:mga0a205_378_c1 | |||
| 2790 | Ga0495601_0078108 | |||
| 2791 | Ga0495612_0516633 | |||
| 2792 | Ga0495612_0572909 | |||
| 2793 | Ga0495595_0093703 | |||
| 2794 | Ga0495619_0147079 | |||
| 2795 | Ga0495619_0220997 | |||
| 2796 | Ga0495619_0284660 | |||
| 2797 | Ga0500590_254941 | |||
| 2798 | Ga0501084_1112720 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9218 | 11 | 129 |
| 7lz9-assembly1.cif.gz_A | inactive form of vanr from s. coelicolor | 0.917 | 11 | 128 |
| 6oec-assembly2.cif.gz_F | yeast spc42 trimeric coiled-coil amino acids 181-211 fused to pdb: 3h5i | 0.9153 | 11 | 129 |
| 6oec-assembly2.cif.gz_D | yeast spc42 trimeric coiled-coil amino acids 181-211 fused to pdb: 3h5i | 0.9143 | 11 | 129 |
| 6oec-assembly3.cif.gz_H | yeast spc42 trimeric coiled-coil amino acids 181-211 fused to pdb: 3h5i | 0.9133 | 11 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FY79_1_81_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9519 | 12 | 92 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9508 | 11 | 92 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9449 | 12 | 92 | 3.40.50.2300 |
| af_P08368_2_83_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9439 | 9 | 92 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.942 | 11 | 92 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8WKD9-F1-model_v4 | Response regulatory domain-containing protein | 0.9737 | 12 | 132 |
GO:0000160
|
| AF-A0A321LGX1-F1-model_v4 | Response regulatory domain-containing protein | 0.9694 | 11 | 133 |
GO:0000160
|
| AF-A0A2V9FQ96-F1-model_v4 | Response regulatory domain-containing protein | 0.9673 | 37 | 132 |
GO:0000160
|
| AF-A0A2V9VWX1-F1-model_v4 | Response regulatory domain-containing protein | 0.9604 | 1 | 134 |
GO:0000160
|
| AF-A0A2V9YK45-F1-model_v4 | Response regulatory domain-containing protein | 0.9447 | 1 | 133 |
GO:0000160
|