F493658

General Info

Members Datasets Scaffolds Average Seq Length
1399 351 2798 133

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10762659|Ga0207695_107626592
Length 153
Sequence MSTPAAKPSSLPVLLIEDEPAVMSYVRAVLERSGYSVVCCDSGAEGLRQLETGEFLGVVSDMRTPGGVNGADVHDWISAHRPELVSRLVFITGDIANEDTASTLQRTGVPCVEKPKTPLLSAAPVVPTTPSSLGLSPFTWAMMRSFVVVQLKT

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
131 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
228 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
328 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
329 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
330 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
331 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
334 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
335 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
336 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
337 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
338 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.07
Nodule 0
Rhizoplane 5.22
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 11.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10762659 3300025913 Bacteria 848
2 MRS1b_contig_6134550 2162886011 Bacteria 2914
3 MBSR1b_contig_12674636 2162886012 Bacteria 1011
4 MBSR1b_contig_2772953 2162886012 Bacteria 1303
5 JGI24752J21851_1003898 3300001976 Bacteria 1965
6 JGI24751J29686_10001643 3300002459 Bacteria 4609
7 rootL2_10044960 3300003322 Unclassified 1238
8 rootL2_10120147 3300003322 Bacteria 2820
9 Ga0065712_10106543 3300005290 Bacteria 1915
10 Ga0065712_10163917 3300005290 Bacteria 1284
11 Ga0065715_10002805 3300005293 Bacteria 4863
12 Ga0065715_10096374 3300005293 Bacteria 3890
13 Ga0065715_10096533 3300005293 Bacteria 3810
14 Ga0065707_10326253 3300005295 Bacteria 957
15 Ga0070658_10015673 3300005327 Bacteria 6062
16 Ga0070658_11282360 3300005327 Unclassified 636
17 Ga0070676_10247845 3300005328 Bacteria 1187
18 Ga0070676_10358536 3300005328 Bacteria 1004
19 Ga0070683_100014455 3300005329 Bacteria 6905
20 Ga0070683_100041687 3300005329 Bacteria 4225
21 Ga0070683_100075451 3300005329 Bacteria 3150
22 Ga0070683_100356050 3300005329 Bacteria 1394
23 Ga0070690_100017809 3300005330 Bacteria 4281
24 Ga0070690_100061607 3300005330 Bacteria 2417
25 Ga0070670_100010385 3300005331 Bacteria 7945
26 Ga0070670_100083025 3300005331 Bacteria 2753
27 Ga0070670_100196114 3300005331 Bacteria 1754
28 Ga0070677_10036802 3300005333 Bacteria 1906
29 Ga0068869_100000550 3300005334 Bacteria 20980
30 Ga0068869_100034351 3300005334 Bacteria 3587
31 Ga0068869_100627344 3300005334 Bacteria 910
32 Ga0070666_10024078 3300005335 Bacteria 3964
33 Ga0070666_10541298 3300005335 Unclassified 846
34 Ga0070666_10656648 3300005335 Bacteria 767
35 Ga0070680_100015909 3300005336 Bacteria 5907
36 Ga0070680_100044409 3300005336 Bacteria 3611
37 Ga0070680_100313656 3300005336 Bacteria 1331
38 Ga0070682_100010415 3300005337 Bacteria 5276
39 Ga0068868_100003943 3300005338 Bacteria 10363
40 Ga0068868_100009681 3300005338 Bacteria 6953
41 Ga0068868_100034367 3300005338 Unclassified 3914
42 Ga0068868_100053324 3300005338 Bacteria 3186
43 Ga0068868_100135625 3300005338 Bacteria 2017
44 Ga0070660_100004316 3300005339 Bacteria 9820
45 Ga0070660_100011820 3300005339 Bacteria 6219
46 Ga0070660_100053314 3300005339 Bacteria 3119
47 Ga0070689_100042634 3300005340 Bacteria 3484
48 Ga0070687_100007241 3300005343 Bacteria 4609
49 Ga0070661_100011241 3300005344 Bacteria 6237
50 Ga0070661_100012801 3300005344 Bacteria 5875
51 Ga0070661_100015105 3300005344 Bacteria 5448
52 Ga0070661_100030051 3300005344 Bacteria 3924
53 Ga0070661_100069047 3300005344 Bacteria 2598
54 Ga0070692_10145265 3300005345 Bacteria 1346
55 Ga0070692_11072468 3300005345 Unclassified 567
56 Ga0070668_100002735 3300005347 Bacteria 12976
57 Ga0070668_100024225 3300005347 Bacteria 4596
58 Ga0070668_100862645 3300005347 Bacteria 807
59 Ga0070669_100011554 3300005353 Bacteria 6266
60 Ga0070669_100570349 3300005353 Bacteria 945
61 Ga0070669_101447395 3300005353 Unclassified 597
62 Ga0070675_100007612 3300005354 Bacteria 8379
63 Ga0070675_100465790 3300005354 Bacteria 1135
64 Ga0070671_100014648 3300005355 Bacteria 6338
65 Ga0070671_101277177 3300005355 Bacteria 647
66 Ga0070671_102016829 3300005355 Unclassified 514
67 Ga0070673_100008691 3300005364 Bacteria 6772
68 Ga0070673_100155066 3300005364 Bacteria 1943
69 Ga0070673_101185853 3300005364 Unclassified 715
70 Ga0070673_101488463 3300005364 Unclassified 638
71 Ga0070688_100007204 3300005365 Bacteria 5989
72 Ga0070688_100252055 3300005365 Bacteria 1257
73 Ga0070688_100313026 3300005365 Bacteria 1138
74 Ga0070659_100001922 3300005366 Bacteria 14842
75 Ga0070659_100006129 3300005366 Bacteria 8678
76 Ga0070659_100039236 3300005366 Bacteria 3696
77 Ga0070659_100854978 3300005366 Bacteria 793
78 Ga0070667_100009820 3300005367 Bacteria 7933
79 Ga0070667_100386271 3300005367 Bacteria 1272
80 Ga0070667_101014396 3300005367 Bacteria 774
81 Ga0070709_10028242 3300005434 Bacteria 3344
82 Ga0070709_10049599 3300005434 Bacteria 2626
83 Ga0070709_10086997 3300005434 Bacteria 2053
84 Ga0070709_10089106 3300005434 Bacteria 2031
85 Ga0070709_10259874 3300005434 Bacteria 1254
86 Ga0070709_10366360 3300005434 Bacteria 1068
87 Ga0070709_10795488 3300005434 Bacteria 742
88 Ga0070709_10848509 3300005434 Unclassified 720
89 Ga0070709_11647796 3300005434 Unclassified 523
90 Ga0070714_100009049 3300005435 Bacteria 7804
91 Ga0070714_100025843 3300005435 Bacteria 4850
92 Ga0070714_100031288 3300005435 Bacteria 4439
93 Ga0070714_100036765 3300005435 Bacteria 4109
94 Ga0070714_100102975 3300005435 Unclassified 2518
95 Ga0070714_100124419 3300005435 Bacteria 2297
96 Ga0070714_100133533 3300005435 Bacteria 2220
97 Ga0070714_100171080 3300005435 Bacteria 1971
98 Ga0070714_100195863 3300005435 Bacteria 1846
99 Ga0070714_100226227 3300005435 Bacteria 1722
100 Ga0070714_100281523 3300005435 Bacteria 1545
101 Ga0070714_100466376 3300005435 Bacteria 1201
102 Ga0070714_100559407 3300005435 Bacteria 1095
103 Ga0070714_100727115 3300005435 Bacteria 959
104 Ga0070714_101128171 3300005435 Bacteria 764
105 Ga0070714_101136190 3300005435 Unclassified 762
106 Ga0070713_100000342 3300005436 Bacteria 30393
107 Ga0070713_100000449 3300005436 Bacteria 26293
108 Ga0070713_100000510 3300005436 Bacteria 24756
109 Ga0070713_100006751 3300005436 Bacteria 7997
110 Ga0070713_100007164 3300005436 Bacteria 7804
111 Ga0070713_100117524 3300005436 Bacteria 2327
112 Ga0070713_100120784 3300005436 Bacteria 2298
113 Ga0070713_100125991 3300005436 Bacteria 2253
114 Ga0070713_100143012 3300005436 Bacteria 2121
115 Ga0070713_100170845 3300005436 Bacteria 1947
116 Ga0070713_100226221 3300005436 Bacteria 1699
117 Ga0070713_100526522 3300005436 Bacteria 1117
118 Ga0070713_100602633 3300005436 Bacteria 1044
119 Ga0070713_100647877 3300005436 Bacteria 1006
120 Ga0070713_100849201 3300005436 Bacteria 877
121 Ga0070713_100937109 3300005436 Bacteria 834
122 Ga0070713_100982851 3300005436 Unclassified 814
123 Ga0070710_10003161 3300005437 Bacteria 7811
124 Ga0070710_10008637 3300005437 Bacteria 4963
125 Ga0070710_10050390 3300005437 Bacteria 2334
126 Ga0070710_10066409 3300005437 Bacteria 2068
127 Ga0070710_10087209 3300005437 Bacteria 1834
128 Ga0070710_10102028 3300005437 Bacteria 1710
129 Ga0070710_10102984 3300005437 Bacteria 1703
130 Ga0070710_10226597 3300005437 Bacteria 1192
131 Ga0070710_10281110 3300005437 Bacteria 1080
132 Ga0070710_10341182 3300005437 Bacteria 989
133 Ga0070711_100000442 3300005439 Bacteria 21552
134 Ga0070711_100001861 3300005439 Bacteria 11790
135 Ga0070711_100004128 3300005439 Bacteria 8537
136 Ga0070711_100015933 3300005439 Bacteria 4763
137 Ga0070711_100020744 3300005439 Unclassified 4240
138 Ga0070711_100021709 3300005439 Bacteria 4154
139 Ga0070711_100030425 3300005439 Bacteria 3573
140 Ga0070711_100058991 3300005439 Bacteria 2663
141 Ga0070711_100084396 3300005439 Bacteria 2272
142 Ga0070711_100230865 3300005439 Bacteria 1442
143 Ga0070711_100258832 3300005439 Bacteria 1368
144 Ga0070711_100261769 3300005439 Bacteria 1361
145 Ga0070711_100803118 3300005439 Viruses 798
146 Ga0070711_100871277 3300005439 Bacteria 767
147 Ga0070711_101190836 3300005439 Bacteria 659
148 Ga0070705_100181212 3300005440 Bacteria 1427
149 Ga0070700_100057144 3300005441 Bacteria 2448
150 Ga0070700_100065656 3300005441 Bacteria 2301
151 Ga0070694_100190002 3300005444 Bacteria 1524
152 Ga0070708_100001221 3300005445 Bacteria 19765
153 Ga0070708_100001401 3300005445 Bacteria 18432
154 Ga0070708_100001766 3300005445 Bacteria 16598
155 Ga0070708_100002020 3300005445 Bacteria 15621
156 Ga0070708_100015287 3300005445 Bacteria 6334
157 Ga0070708_100041536 3300005445 Bacteria 4032
158 Ga0070708_100141295 3300005445 Bacteria 2233
159 Ga0070708_100239549 3300005445 Bacteria 1703
160 Ga0070708_100267103 3300005445 Bacteria 1609
161 Ga0070708_100277146 3300005445 Bacteria 1578
162 Ga0070708_100278362 3300005445 Bacteria 1575
163 Ga0070708_100567037 3300005445 Unclassified 1071
164 Ga0070708_101531594 3300005445 Bacteria 621
165 Ga0070663_100016476 3300005455 Bacteria 4802
166 Ga0070663_100024595 3300005455 Bacteria 4056
167 Ga0070663_100346437 3300005455 Bacteria 1202
168 Ga0070663_100819606 3300005455 Unclassified 799
169 Ga0070678_100065037 3300005456 Bacteria 2706
170 Ga0070662_100004700 3300005457 Bacteria 8657
171 Ga0070662_100027940 3300005457 Bacteria 3922
172 Ga0070662_100031533 3300005457 Bacteria 3720
173 Ga0070662_100658530 3300005457 Unclassified 884
174 Ga0070681_10000055 3300005458 Bacteria 80179
175 Ga0070681_10013007 3300005458 Bacteria 8264
176 Ga0070681_10040657 3300005458 Bacteria 4658
177 Ga0070681_10050460 3300005458 Bacteria 4151
178 Ga0070681_10067150 3300005458 Bacteria 3555
179 Ga0070681_10079440 3300005458 Bacteria 3237
180 Ga0070681_10349137 3300005458 Unclassified 1390
181 Ga0070681_11035074 3300005458 Bacteria 741
182 Ga0068867_100006586 3300005459 Bacteria 8210
183 Ga0068867_100018246 3300005459 Bacteria 4986
184 Ga0068867_100088181 3300005459 Unclassified 2351
185 Ga0068867_100170473 3300005459 Bacteria 1723
186 Ga0070685_10013905 3300005466 Bacteria 4258
187 Ga0070685_10018810 3300005466 Bacteria 3721
188 Ga0070685_10449102 3300005466 Bacteria 903
189 Ga0070706_100000173 3300005467 Bacteria 81500
190 Ga0070706_100001295 3300005467 Bacteria 26667
191 Ga0070706_100001629 3300005467 Bacteria 23411
192 Ga0070706_100012117 3300005467 Bacteria 8002
193 Ga0070706_100066056 3300005467 Bacteria 3346
194 Ga0070706_100330570 3300005467 Bacteria 1421
195 Ga0070706_100373941 3300005467 Bacteria 1327
196 Ga0070706_100417314 3300005467 Bacteria 1249
197 Ga0070706_100516501 3300005467 Bacteria 1111
198 Ga0070707_100000719 3300005468 Bacteria 33081
199 Ga0070707_100002543 3300005468 Bacteria 17343
200 Ga0070707_100006148 3300005468 Bacteria 11188
201 Ga0070707_100017757 3300005468 Bacteria 6689
202 Ga0070707_100074860 3300005468 Bacteria 3265
203 Ga0070707_100086920 3300005468 Bacteria 3024
204 Ga0070707_100090046 3300005468 Bacteria 2969
205 Ga0070707_100324535 3300005468 Bacteria 1496
206 Ga0070707_100374943 3300005468 Bacteria 1382
207 Ga0070707_100463635 3300005468 Bacteria 1228
208 Ga0070707_100683554 3300005468 Bacteria 989
209 Ga0070707_100813554 3300005468 Bacteria 898
210 Ga0070698_100000162 3300005471 Bacteria 61345
211 Ga0070698_100005121 3300005471 Bacteria 14348
212 Ga0070698_100046332 3300005471 Bacteria 4446
213 Ga0070698_100284864 3300005471 Bacteria 1584
214 Ga0070698_100489974 3300005471 Bacteria 1167
215 Ga0070698_101218205 3300005471 Unclassified 702
216 Ga0070699_100002067 3300005518 Bacteria 18161
217 Ga0070699_100003692 3300005518 Bacteria 13537
218 Ga0070699_100010658 3300005518 Bacteria 7956
219 Ga0070699_100056787 3300005518 Bacteria 3390
220 Ga0070699_100135777 3300005518 Bacteria 2170
221 Ga0070699_100273308 3300005518 Bacteria 1513
222 Ga0070699_100276146 3300005518 Bacteria 1505
223 Ga0070699_101014370 3300005518 Bacteria 761
224 Ga0070699_101539241 3300005518 Bacteria 609
225 Ga0070679_100043594 3300005530 Bacteria 4468
226 Ga0070679_100104117 3300005530 Bacteria 2824
227 Ga0070679_100125511 3300005530 Bacteria 2549
228 Ga0070679_100129486 3300005530 Bacteria 2505
229 Ga0070679_100345679 3300005530 Bacteria 1435
230 Ga0070679_100356677 3300005530 Bacteria 1410
231 Ga0070679_100473412 3300005530 Unclassified 1197
232 Ga0070679_101199890 3300005530 Bacteria 704
233 Ga0070684_100002587 3300005535 Bacteria 13360
234 Ga0070684_100006632 3300005535 Bacteria 8966
235 Ga0070684_100011364 3300005535 Bacteria 7091
236 Ga0070684_100065317 3300005535 Bacteria 3194
237 Ga0070684_100100813 3300005535 Unclassified 2579
238 Ga0070684_100451397 3300005535 Bacteria 1188
239 Ga0070697_100000872 3300005536 Bacteria 22677
240 Ga0070697_100001177 3300005536 Bacteria 19808
241 Ga0070697_100001505 3300005536 Bacteria 17701
242 Ga0070697_100002837 3300005536 Bacteria 13330
243 Ga0070697_100004369 3300005536 Bacteria 10845
244 Ga0070697_100030681 3300005536 Bacteria 4319
245 Ga0070697_100085647 3300005536 Bacteria 2600
246 Ga0070697_100127377 3300005536 Bacteria 2133
247 Ga0070697_100427397 3300005536 Unclassified 1151
248 Ga0070697_101300671 3300005536 Unclassified 649
249 Ga0070697_101911273 3300005536 Unclassified 531
250 Ga0068853_100006282 3300005539 Bacteria 9422
251 Ga0068853_100024491 3300005539 Bacteria 5061
252 Ga0068853_100026542 3300005539 Bacteria 4864
253 Ga0068853_100087705 3300005539 Bacteria 2731
254 Ga0068853_100132158 3300005539 Bacteria 2235
255 Ga0068853_100201330 3300005539 Unclassified 1812
256 Ga0070672_100034848 3300005543 Bacteria 3822
257 Ga0070672_100262707 3300005543 Bacteria 1456
258 Ga0070672_101357245 3300005543 Unclassified 635
259 Ga0070686_100005128 3300005544 Bacteria 7230
260 Ga0070686_100018382 3300005544 Bacteria 4101
261 Ga0070695_100147601 3300005545 Bacteria 1638
262 Ga0070695_100203508 3300005545 Bacteria 1416
263 Ga0070695_100607884 3300005545 Bacteria 859
264 Ga0070695_100811161 3300005545 Bacteria 750
265 Ga0070696_100175780 3300005546 Bacteria 1586
266 Ga0070696_100665759 3300005546 Bacteria 845
267 Ga0070696_100674064 3300005546 Unclassified 840
268 Ga0070696_101134960 3300005546 Bacteria 658
269 Ga0070693_100052027 3300005547 Bacteria 2347
270 Ga0070693_100098916 3300005547 Bacteria 1773
271 Ga0070693_100150163 3300005547 Bacteria 1475
272 Ga0070693_100232130 3300005547 Bacteria 1214
273 Ga0070693_100255593 3300005547 Bacteria 1163
274 Ga0070693_100283876 3300005547 Unclassified 1110
275 Ga0070693_100920994 3300005547 Unclassified 656
276 Ga0070693_100950713 3300005547 Bacteria 647
277 Ga0070665_100036861 3300005548 Bacteria 4917
278 Ga0070665_100133753 3300005548 Bacteria 2481
279 Ga0070704_100596670 3300005549 Bacteria 970
280 Ga0070704_101277702 3300005549 Bacteria 671
281 Ga0070704_101386752 3300005549 Bacteria 644
282 Ga0068855_100002871 3300005563 Bacteria 21140
283 Ga0068855_100005054 3300005563 Bacteria 16100
284 Ga0068855_100015407 3300005563 Bacteria 9203
285 Ga0068855_100018256 3300005563 Bacteria 8426
286 Ga0068855_100023648 3300005563 Bacteria 7358
287 Ga0068855_100031434 3300005563 Bacteria 6339
288 Ga0068855_101969389 3300005563 Bacteria 591
289 Ga0070664_100001796 3300005564 Bacteria 17205
290 Ga0070664_100007823 3300005564 Bacteria 8633
291 Ga0070664_100008620 3300005564 Bacteria 8249
292 Ga0070664_100091253 3300005564 Bacteria 2637
293 Ga0070664_100247630 3300005564 Unclassified 1601
294 Ga0070664_100359456 3300005564 Unclassified 1326
295 Ga0070664_100568069 3300005564 Bacteria 1050
296 Ga0068857_100000041 3300005577 Bacteria 70173
297 Ga0068857_100002662 3300005577 Bacteria 14661
298 Ga0068857_100247182 3300005577 Bacteria 1634
299 Ga0068857_102444562 3300005577 Bacteria 513
300 Ga0068854_100003861 3300005578 Bacteria 9393
301 Ga0068854_100006005 3300005578 Bacteria 7692
302 Ga0068854_100006817 3300005578 Bacteria 7284
303 Ga0068854_100009154 3300005578 Bacteria 6387
304 Ga0068854_100044808 3300005578 Bacteria 3142
305 Ga0068854_101232071 3300005578 Unclassified 671
306 Ga0068856_100000355 3300005614 Bacteria 49986
307 Ga0068856_100001245 3300005614 Bacteria 26739
308 Ga0068856_100001397 3300005614 Bacteria 25289
309 Ga0068856_100004211 3300005614 Bacteria 14360
310 Ga0068856_100004843 3300005614 Bacteria 13344
311 Ga0068856_100026475 3300005614 Bacteria 5655
312 Ga0068856_100032662 3300005614 Bacteria 5096
313 Ga0068856_100053439 3300005614 Bacteria 3982
314 Ga0068856_100104443 3300005614 Bacteria 2827
315 Ga0068856_100273997 3300005614 Bacteria 1703
316 Ga0068856_100671620 3300005614 Bacteria 1057
317 Ga0070702_100017598 3300005615 Bacteria 3690
318 Ga0068852_100021601 3300005616 Bacteria 5144
319 Ga0068852_100022927 3300005616 Bacteria 5016
320 Ga0068852_100054469 3300005616 Bacteria 3448
321 Ga0068852_100342315 3300005616 Bacteria 1458
322 Ga0068852_100422722 3300005616 Bacteria 1315
323 Ga0068859_100002075 3300005617 Bacteria 20448
324 Ga0068859_100022875 3300005617 Bacteria 6268
325 Ga0068859_100124359 3300005617 Bacteria 2647
326 Ga0068864_100002938 3300005618 Bacteria 14093
327 Ga0068864_100036397 3300005618 Bacteria 4195
328 Ga0068864_100070542 3300005618 Bacteria 3040
329 Ga0068866_10012020 3300005718 Bacteria 3764
330 Ga0068866_10012922 3300005718 Bacteria 3648
331 Ga0068866_10023270 3300005718 Bacteria 2880
332 Ga0068866_10067387 3300005718 Unclassified 1879
333 Ga0068866_10650028 3300005718 Unclassified 718
334 Ga0068861_100022258 3300005719 Bacteria 4565
335 Ga0068861_100152261 3300005719 Bacteria 1899
336 Ga0068861_100245419 3300005719 Bacteria 1525
337 Ga0068851_10001990 3300005834 Bacteria 8995
338 Ga0068851_10005815 3300005834 Bacteria 5618
339 Ga0068870_10001819 3300005840 Bacteria 8758
340 Ga0068870_10155454 3300005840 Bacteria 1351
341 Ga0068863_100017215 3300005841 Bacteria 6931
342 Ga0068863_100024499 3300005841 Bacteria 5756
343 Ga0068863_100042876 3300005841 Bacteria 4298
344 Ga0068863_100074990 3300005841 Bacteria 3201
345 Ga0068863_100120258 3300005841 Bacteria 2504
346 Ga0068863_100276668 3300005841 Bacteria 1626
347 Ga0068863_100684329 3300005841 Bacteria 1019
348 Ga0068863_101697625 3300005841 Unclassified 641
349 Ga0068858_100002616 3300005842 Bacteria 18137
350 Ga0068858_100007357 3300005842 Bacteria 10656
351 Ga0068858_100025619 3300005842 Bacteria 5488
352 Ga0068858_100026311 3300005842 Bacteria 5407
353 Ga0068858_100076855 3300005842 Bacteria 3101
354 Ga0068858_100115576 3300005842 Bacteria 2507
355 Ga0068858_100456882 3300005842 Bacteria 1231
356 Ga0068858_100657913 3300005842 Bacteria 1018
357 Ga0068860_100007831 3300005843 Bacteria 10666
358 Ga0068860_100060146 3300005843 Bacteria 3611
359 Ga0068860_100098636 3300005843 Bacteria 2786
360 Ga0068860_100102188 3300005843 Bacteria 2735
361 Ga0068860_100182762 3300005843 Bacteria 2027
362 Ga0068860_100406359 3300005843 Bacteria 1348
363 Ga0068860_100584243 3300005843 Bacteria 1121
364 Ga0068860_100650321 3300005843 Unclassified 1062
365 Ga0068862_100011071 3300005844 Bacteria 7451
366 Ga0068862_100043213 3300005844 Bacteria 3842
367 Ga0068862_100256123 3300005844 Bacteria 1596
368 Ga0081455_10786581 3300005937 Unclassified 598
369 Ga0081540_1044237 3300005983 Bacteria 2275
370 Ga0081540_1225570 3300005983 Unclassified 664
371 Ga0070717_10000612 3300006028 Bacteria 22915
372 Ga0070717_10000837 3300006028 Bacteria 20360
373 Ga0070717_10002552 3300006028 Bacteria 12840
374 Ga0070717_10010813 3300006028 Bacteria 6905
375 Ga0070717_10017807 3300006028 Bacteria 5536
376 Ga0070717_10018682 3300006028 Bacteria 5421
377 Ga0070717_10019341 3300006028 Bacteria 5340
378 Ga0070717_10022103 3300006028 Bacteria 5023
379 Ga0070717_10033939 3300006028 Bacteria 4120
380 Ga0070717_10039607 3300006028 Bacteria 3835
381 Ga0070717_10070032 3300006028 Bacteria 2922
382 Ga0070717_10071148 3300006028 Unclassified 2901
383 Ga0070717_10107426 3300006028 Bacteria 2377
384 Ga0070717_10116686 3300006028 Bacteria 2283
385 Ga0070717_10127189 3300006028 Bacteria 2188
386 Ga0070717_10158352 3300006028 Bacteria 1963
387 Ga0070717_10279005 3300006028 Bacteria 1482
388 Ga0070717_10310993 3300006028 Bacteria 1402
389 Ga0070717_10934544 3300006028 Bacteria 790
390 Ga0070715_10036633 3300006163 Bacteria 2025
391 Ga0070715_10173929 3300006163 Unclassified 1075
392 Ga0070715_10425755 3300006163 Bacteria 744
393 Ga0070716_100000315 3300006173 Bacteria 19472
394 Ga0070716_100002728 3300006173 Bacteria 8186
395 Ga0070716_100022367 3300006173 Bacteria 3341
396 Ga0070716_100045706 3300006173 Bacteria 2460
397 Ga0070716_100057722 3300006173 Bacteria 2231
398 Ga0070716_100181762 3300006173 Bacteria 1381
399 Ga0070716_100192049 3300006173 Unclassified 1350
400 Ga0070716_100299177 3300006173 Bacteria 1118
401 Ga0070716_100382842 3300006173 Bacteria 1006
402 Ga0070716_100478900 3300006173 Bacteria 914
403 Ga0070716_100566176 3300006173 Bacteria 850
404 Ga0070716_100600345 3300006173 Unclassified 828
405 Ga0070716_100618362 3300006173 Unclassified 817
406 Ga0070712_100000957 3300006175 Bacteria 17360
407 Ga0070712_100002811 3300006175 Bacteria 10767
408 Ga0070712_100005172 3300006175 Bacteria 8070
409 Ga0070712_100008543 3300006175 Bacteria 6442
410 Ga0070712_100009656 3300006175 Bacteria 6081
411 Ga0070712_100021898 3300006175 Bacteria 4203
412 Ga0070712_100028726 3300006175 Bacteria 3722
413 Ga0070712_100062307 3300006175 Bacteria 2637
414 Ga0070712_100104060 3300006175 Bacteria 2106
415 Ga0070712_100205175 3300006175 Bacteria 1551
416 Ga0070712_100357420 3300006175 Bacteria 1197
417 Ga0070712_100376734 3300006175 Unclassified 1167
418 Ga0070712_100480477 3300006175 Bacteria 1039
419 Ga0070712_100480809 3300006175 Bacteria 1038
420 Ga0070712_101070604 3300006175 Unclassified 699
421 Ga0070712_101076198 3300006175 Bacteria 697
422 Ga0070712_101372494 3300006175 Bacteria 616
423 Ga0070712_101937193 3300006175 Unclassified 516
424 Ga0097621_100000533 3300006237 Bacteria 26715
425 Ga0097621_100000581 3300006237 Bacteria 25739
426 Ga0097621_100002510 3300006237 Bacteria 12564
427 Ga0097621_100144578 3300006237 Bacteria 2035
428 Ga0097621_100262211 3300006237 Bacteria 1516
429 Ga0097621_100300200 3300006237 Bacteria 1418
430 Ga0097621_100564685 3300006237 Bacteria 1037
431 Ga0097621_100717551 3300006237 Bacteria 921
432 Ga0097621_101038986 3300006237 Bacteria 767
433 Ga0068871_100000664 3300006358 Bacteria 23618
434 Ga0068871_100014943 3300006358 Bacteria 5803
435 Ga0068871_100015369 3300006358 Bacteria 5726
436 Ga0068871_100031751 3300006358 Bacteria 4167
437 Ga0068871_100049053 3300006358 Bacteria 3411
438 Ga0068871_100060236 3300006358 Bacteria 3096
439 Ga0068871_100167412 3300006358 Bacteria 1882
440 Ga0068871_100241076 3300006358 Bacteria 1572
441 Ga0068871_100743332 3300006358 Unclassified 901
442 Ga0068871_100754639 3300006358 Unclassified 894
443 Ga0068871_101789899 3300006358 Unclassified 583
444 Ga0075434_100002766 3300006871 Bacteria 15521
445 Ga0075434_100281638 3300006871 Bacteria 1682
446 Ga0068865_100003096 3300006881 Bacteria 9955
447 Ga0068865_100023261 3300006881 Bacteria 4056
448 Ga0068865_100528660 3300006881 Unclassified 987
449 Ga0068865_100708932 3300006881 Unclassified 861
450 Ga0068865_100930424 3300006881 Bacteria 757
451 Ga0075436_100000526 3300006914 Bacteria 24961
452 Ga0075436_100000572 3300006914 Bacteria 24071
453 Ga0075436_100001967 3300006914 Bacteria 14161
454 Ga0075436_100168229 3300006914 Bacteria 1547
455 Ga0075436_100500103 3300006914 Bacteria 889
456 Ga0097620_100002075 3300006931 Bacteria 20448
457 Ga0097620_100022875 3300006931 Bacteria 6268
458 Ga0097620_100124361 3300006931 Bacteria 2647
459 Ga0075435_100000105 3300007076 Bacteria 45736
460 Ga0075435_100010275 3300007076 Bacteria 6842
461 Ga0075435_100076906 3300007076 Bacteria 2736
462 Ga0075435_100099110 3300007076 Bacteria 2413
463 Ga0075435_100544363 3300007076 Bacteria 1005
464 Ga0075435_100547156 3300007076 Bacteria 1002
465 Ga0099794_10194192 3300007265 Bacteria 1039
466 Ga0099795_10043645 3300007788 Bacteria 1605
467 Ga0105250_10055205 3300009092 Bacteria 1594
468 Ga0105250_10120417 3300009092 Bacteria 1078
469 Ga0105250_10141585 3300009092 Bacteria 997
470 Ga0105240_10007621 3300009093 Bacteria 15676
471 Ga0105240_10013860 3300009093 Bacteria 11039
472 Ga0105240_10021427 3300009093 Bacteria 8594
473 Ga0105240_10022551 3300009093 Bacteria 8343
474 Ga0105240_10025047 3300009093 Bacteria 7854
475 Ga0105240_10027526 3300009093 Bacteria 7440
476 Ga0105240_10104584 3300009093 Bacteria 3438
477 Ga0105240_10113356 3300009093 Bacteria 3276
478 Ga0105240_10175573 3300009093 Bacteria 2533
479 Ga0105240_10254282 3300009093 Bacteria 2030
480 Ga0105240_10715243 3300009093 Unclassified 1092
481 Ga0105240_11774798 3300009093 Unclassified 643
482 Ga0105240_11868822 3300009093 Unclassified 625
483 Ga0111539_11130271 3300009094 Bacteria 910
484 Ga0105245_10006495 3300009098 Bacteria 10277
485 Ga0105245_10014743 3300009098 Bacteria 6807
486 Ga0105245_10063179 3300009098 Bacteria 3343
487 Ga0105245_10064487 3300009098 Bacteria 3310
488 Ga0105245_10378492 3300009098 Bacteria 1409
489 Ga0105247_10001928 3300009101 Bacteria 14455
490 Ga0105247_10070177 3300009101 Bacteria 2188
491 Ga0105247_10079259 3300009101 Bacteria 2067
492 Ga0105247_10339017 3300009101 Bacteria 1054
493 Ga0105247_10458712 3300009101 Bacteria 920
494 Ga0105241_10000916 3300009174 Bacteria 22311
495 Ga0105241_10003223 3300009174 Bacteria 12142
496 Ga0105241_10022387 3300009174 Bacteria 4681
497 Ga0105241_10031221 3300009174 Bacteria 3988
498 Ga0105241_10323336 3300009174 Bacteria 1331
499 Ga0105242_10045809 3300009176 Bacteria 3545
500 Ga0105242_10184738 3300009176 Bacteria 1842
501 Ga0105242_10254945 3300009176 Bacteria 1582
502 Ga0105242_11074846 3300009176 Unclassified 817
503 Ga0105242_13171759 3300009176 Unclassified 510
504 Ga0105248_10095292 3300009177 Bacteria 3351
505 Ga0105248_10316778 3300009177 Bacteria 1757
506 Ga0105248_10334484 3300009177 Bacteria 1705
507 Ga0105248_10371816 3300009177 Bacteria 1609
508 Ga0105237_10010811 3300009545 Bacteria 9685
509 Ga0105237_10047409 3300009545 Bacteria 4320
510 Ga0105237_10061462 3300009545 Bacteria 3755
511 Ga0105237_10065472 3300009545 Bacteria 3631
512 Ga0105237_10160607 3300009545 Bacteria 2246
513 Ga0105237_10200670 3300009545 Unclassified 1994
514 Ga0105237_10213745 3300009545 Bacteria 1928
515 Ga0105237_10572746 3300009545 Unclassified 1136
516 Ga0105237_10601658 3300009545 Unclassified 1107
517 Ga0105237_10637221 3300009545 Bacteria 1073
518 Ga0105238_10000533 3300009551 Bacteria 39822
519 Ga0105238_10005181 3300009551 Bacteria 12883
520 Ga0105238_10018190 3300009551 Bacteria 7146
521 Ga0105238_10345765 3300009551 Bacteria 1476
522 Ga0105238_10622744 3300009551 Bacteria 1088
523 Ga0105238_10623030 3300009551 Unclassified 1088
524 Ga0105238_10647210 3300009551 Bacteria 1067
525 Ga0105249_10002069 3300009553 Bacteria 17385
526 Ga0105249_10006862 3300009553 Bacteria 9931
527 Ga0105249_10021522 3300009553 Bacteria 5773
528 Ga0105249_10217668 3300009553 Bacteria 1878
529 Ga0099796_10065184 3300010159 Bacteria 1302
530 Ga0105239_10006785 3300010375 Bacteria 13217
531 Ga0105239_10007480 3300010375 Bacteria 12537
532 Ga0105239_10050561 3300010375 Bacteria 4558
533 Ga0105239_10096517 3300010375 Bacteria 3266
534 Ga0105239_10112070 3300010375 Bacteria 3024
535 Ga0105239_10446777 3300010375 Bacteria 1466
536 Ga0105246_10001260 3300011119 Bacteria 14866
537 Ga0105246_10016393 3300011119 Bacteria 4692
538 Ga0105246_10056385 3300011119 Bacteria 2716
539 Ga0105246_10320392 3300011119 Bacteria 1259
540 Ga0157373_10000288 3300013100 Bacteria 40421
541 Ga0157373_10025303 3300013100 Bacteria 4295
542 Ga0157373_10039846 3300013100 Bacteria 3362
543 Ga0157373_10057653 3300013100 Bacteria 2755
544 Ga0157373_10252112 3300013100 Bacteria 1248
545 Ga0157373_11324032 3300013100 Unclassified 546
546 Ga0157371_10004724 3300013102 Bacteria 11769
547 Ga0157371_10008279 3300013102 Bacteria 8303
548 Ga0157371_10074331 3300013102 Bacteria 2407
549 Ga0157370_10010473 3300013104 Bacteria 9764
550 Ga0157370_10253785 3300013104 Unclassified 1626
551 Ga0157370_10278282 3300013104 Bacteria 1546
552 Ga0157370_10884554 3300013104 Bacteria 811
553 Ga0157370_10989186 3300013104 Unclassified 762
554 Ga0157369_10000170 3300013105 Bacteria 91583
555 Ga0157369_10012417 3300013105 Bacteria 9668
556 Ga0157369_10030994 3300013105 Bacteria 5893
557 Ga0157369_10089041 3300013105 Bacteria 3295
558 Ga0157369_10100163 3300013105 Bacteria 3089
559 Ga0157369_10142571 3300013105 Bacteria 2534
560 Ga0157369_10751932 3300013105 Bacteria 1003
561 Ga0157369_12368184 3300013105 Unclassified 538
562 Ga0157374_10000316 3300013296 Bacteria 44946
563 Ga0157374_10000330 3300013296 Bacteria 43615
564 Ga0157374_10000533 3300013296 Bacteria 34093
565 Ga0157374_10003747 3300013296 Bacteria 12773
566 Ga0157374_10044724 3300013296 Unclassified 4093
567 Ga0157374_10093741 3300013296 Bacteria 2868
568 Ga0157374_10108158 3300013296 Bacteria 2672
569 Ga0157374_10111176 3300013296 Bacteria 2635
570 Ga0157374_10895945 3300013296 Bacteria 905
571 Ga0157374_11707748 3300013296 Unclassified 654
572 Ga0157374_12246990 3300013296 Unclassified 573
573 Ga0157378_10000085 3300013297 Bacteria 87651
574 Ga0157378_10000182 3300013297 Bacteria 60024
575 Ga0157378_10000924 3300013297 Bacteria 27038
576 Ga0157378_10025170 3300013297 Bacteria 5244
577 Ga0157378_10093762 3300013297 Bacteria 2734
578 Ga0157378_10203910 3300013297 Bacteria 1872
579 Ga0157378_10229872 3300013297 Bacteria 1767
580 Ga0157378_10342086 3300013297 Unclassified 1459
581 Ga0157378_10556177 3300013297 Bacteria 1153
582 Ga0157378_11295854 3300013297 Bacteria 770
583 Ga0163162_10001077 3300013306 Bacteria 25415
584 Ga0163162_10016811 3300013306 Bacteria 7150
585 Ga0163162_10051295 3300013306 Bacteria 4139
586 Ga0163162_10147284 3300013306 Bacteria 2471
587 Ga0163162_10970233 3300013306 Bacteria 960
588 Ga0157372_10000504 3300013307 Bacteria 42933
589 Ga0157372_10000620 3300013307 Bacteria 38778
590 Ga0157372_10001563 3300013307 Bacteria 24933
591 Ga0157372_10002374 3300013307 Bacteria 20377
592 Ga0157372_10003529 3300013307 Bacteria 16848
593 Ga0157372_10005602 3300013307 Bacteria 13352
594 Ga0157372_10006002 3300013307 Bacteria 12905
595 Ga0157372_10012821 3300013307 Bacteria 8933
596 Ga0157372_10019856 3300013307 Bacteria 7241
597 Ga0157372_10027371 3300013307 Bacteria 6207
598 Ga0157372_10057292 3300013307 Bacteria 4355
599 Ga0157372_10116652 3300013307 Bacteria 3061
600 Ga0157372_10131676 3300013307 Bacteria 2877
601 Ga0157372_10210955 3300013307 Bacteria 2251
602 Ga0157372_10426370 3300013307 Bacteria 1546
603 Ga0157372_11316169 3300013307 Bacteria 834
604 Ga0157375_12202760 3300013308 Unclassified 656
605 Ga0157375_13069503 3300013308 Unclassified 557
606 Ga0157375_13605409 3300013308 Unclassified 515
607 Ga0163163_10010337 3300014325 Bacteria 8384
608 Ga0163163_10026579 3300014325 Bacteria 5535
609 Ga0163163_10097597 3300014325 Bacteria 2959
610 Ga0163163_10102847 3300014325 Bacteria 2881
611 Ga0163163_10324039 3300014325 Bacteria 1594
612 Ga0163163_10414850 3300014325 Bacteria 1405
613 Ga0182008_10003217 3300014497 Bacteria 9975
614 Ga0182008_10023722 3300014497 Bacteria 3128
615 Ga0157377_10003658 3300014745 Bacteria 6973
616 Ga0157377_10172352 3300014745 Bacteria 1354
617 Ga0157379_10000791 3300014968 Bacteria 25671
618 Ga0157379_10023673 3300014968 Bacteria 5451
619 Ga0157379_10038649 3300014968 Bacteria 4257
620 Ga0157379_10066305 3300014968 Bacteria 3227
621 Ga0157379_10255717 3300014968 Bacteria 1591
622 Ga0157379_10432937 3300014968 Bacteria 1212
623 Ga0157376_10009674 3300014969 Bacteria 7015
624 Ga0157376_10064429 3300014969 Bacteria 3091
625 Ga0157376_10088762 3300014969 Bacteria 2672
626 Ga0157376_10129801 3300014969 Bacteria 2247
627 Ga0157376_10538200 3300014969 Bacteria 1154
628 Ga0157376_10650055 3300014969 Viruses 1055
629 Ga0157376_10864868 3300014969 Bacteria 920
630 Ga0157376_11936142 3300014969 Unclassified 627
631 Ga0182006_1019129 3300015261 Bacteria 2887
632 Ga0182007_10001556 3300015262 Bacteria 12230
633 Ga0182007_10022074 3300015262 Bacteria 2252
634 Ga0182005_1016896 3300015265 Bacteria 2023
635 Ga0163161_10058965 3300017792 Bacteria 2791
636 Ga0163161_10494140 3300017792 Bacteria 995
637 Ga0213874_10166228 3300021377 Bacteria 778
638 Ga0213871_10034000 3300021441 Bacteria 1342
639 Ga0224570_100090 3300022730 Bacteria 5398
640 Ga0224569_102128 3300022732 Bacteria 1637
641 Ga0224572_1001260 3300024225 Bacteria 3645
642 Ga0224572_1006373 3300024225 Bacteria 2133
643 Ga0224572_1050959 3300024225 Bacteria 771
644 Ga0228598_1001197 3300024227 Bacteria 5732
645 Ga0228598_1001295 3300024227 Bacteria 5502
646 Ga0228598_1003153 3300024227 Bacteria 3568
647 Ga0228598_1010611 3300024227 Unclassified 1833
648 Ga0207697_10007399 3300025315 Bacteria 4901
649 Ga0207656_10270253 3300025321 Bacteria 836
650 Ga0207656_10346402 3300025321 Bacteria 741
651 Ga0207692_10014791 3300025898 Bacteria 3417
652 Ga0207692_10021671 3300025898 Bacteria 2943
653 Ga0207692_10041283 3300025898 Bacteria 2283
654 Ga0207692_10043923 3300025898 Bacteria 2227
655 Ga0207692_10044990 3300025898 Bacteria 2206
656 Ga0207692_10061411 3300025898 Bacteria 1947
657 Ga0207692_10081692 3300025898 Bacteria 1730
658 Ga0207692_10527302 3300025898 Bacteria 752
659 Ga0207692_10665267 3300025898 Bacteria 674
660 Ga0207692_10716580 3300025898 Unclassified 650
661 Ga0207642_10009113 3300025899 Bacteria 3438
662 Ga0207642_10013622 3300025899 Bacteria 2973
663 Ga0207642_10318506 3300025899 Unclassified 907
664 Ga0207710_10002674 3300025900 Bacteria 8195
665 Ga0207710_10324250 3300025900 Bacteria 781
666 Ga0207688_10007680 3300025901 Bacteria 5872
667 Ga0207680_10094289 3300025903 Bacteria 1911
668 Ga0207680_10120604 3300025903 Bacteria 1714
669 Ga0207680_10155328 3300025903 Bacteria 1529
670 Ga0207647_10006395 3300025904 Bacteria 8567
671 Ga0207647_10021548 3300025904 Unclassified 4301
672 Ga0207647_10026162 3300025904 Bacteria 3821
673 Ga0207647_10038205 3300025904 Bacteria 3037
674 Ga0207685_10005599 3300025905 Bacteria 3335
675 Ga0207685_10015359 3300025905 Bacteria 2424
676 Ga0207685_10047595 3300025905 Bacteria 1638
677 Ga0207685_10091752 3300025905 Bacteria 1280
678 Ga0207685_10368683 3300025905 Bacteria 728
679 Ga0207685_10374503 3300025905 Bacteria 724
680 Ga0207699_10006949 3300025906 Bacteria 5512
681 Ga0207699_10011142 3300025906 Bacteria 4531
682 Ga0207699_10014789 3300025906 Bacteria 4036
683 Ga0207699_10050376 3300025906 Bacteria 2455
684 Ga0207699_10071036 3300025906 Bacteria 2127
685 Ga0207699_10092829 3300025906 Bacteria 1898
686 Ga0207699_10098615 3300025906 Bacteria 1849
687 Ga0207699_10102345 3300025906 Bacteria 1820
688 Ga0207699_10123868 3300025906 Bacteria 1676
689 Ga0207699_10259783 3300025906 Bacteria 1200
690 Ga0207699_10262814 3300025906 Bacteria 1193
691 Ga0207699_10474242 3300025906 Bacteria 900
692 Ga0207699_10737767 3300025906 Bacteria 722
693 Ga0207699_11035511 3300025906 Unclassified 607
694 Ga0207699_11057704 3300025906 Bacteria 600
695 Ga0207645_10000181 3300025907 Bacteria 50200
696 Ga0207645_10239939 3300025907 Bacteria 1197
697 Ga0207643_10000474 3300025908 Bacteria 25980
698 Ga0207643_10193945 3300025908 Bacteria 1234
699 Ga0207705_10846676 3300025909 Bacteria 709
700 Ga0207705_11029136 3300025909 Unclassified 636
701 Ga0207684_10000217 3300025910 Bacteria 88691
702 Ga0207684_10000267 3300025910 Bacteria 77172
703 Ga0207684_10006270 3300025910 Bacteria 10851
704 Ga0207684_10029324 3300025910 Bacteria 4687
705 Ga0207684_10282610 3300025910 Bacteria 1431
706 Ga0207684_10322565 3300025910 Bacteria 1331
707 Ga0207684_10643037 3300025910 Bacteria 904
708 Ga0207654_10006558 3300025911 Bacteria 5852
709 Ga0207654_10007076 3300025911 Bacteria 5654
710 Ga0207654_10030891 3300025911 Bacteria 2945
711 Ga0207654_10128336 3300025911 Bacteria 1602
712 Ga0207654_10147974 3300025911 Bacteria 1504
713 Ga0207654_10159214 3300025911 Bacteria 1457
714 Ga0207707_10000739 3300025912 Bacteria 32307
715 Ga0207707_10093271 3300025912 Bacteria 2630
716 Ga0207707_10098070 3300025912 Bacteria 2562
717 Ga0207707_10116639 3300025912 Bacteria 2333
718 Ga0207707_10125156 3300025912 Bacteria 2248
719 Ga0207707_10910238 3300025912 Bacteria 727
720 Ga0207695_10007408 3300025913 Bacteria 13981
721 Ga0207695_10022440 3300025913 Bacteria 7163
722 Ga0207695_10037646 3300025913 Bacteria 5218
723 Ga0207695_10072134 3300025913 Bacteria 3525
724 Ga0207695_10075457 3300025913 Bacteria 3430
725 Ga0207695_10109531 3300025913 Bacteria 2743
726 Ga0207695_10123755 3300025913 Bacteria 2551
727 Ga0207695_10372110 3300025913 Bacteria 1315
728 Ga0207695_10960423 3300025913 Unclassified 734
729 Ga0207671_10024462 3300025914 Bacteria 4542
730 Ga0207671_10030939 3300025914 Bacteria 3991
731 Ga0207671_10032741 3300025914 Bacteria 3867
732 Ga0207671_10099930 3300025914 Bacteria 2196
733 Ga0207671_10138047 3300025914 Unclassified 1876
734 Ga0207671_10611092 3300025914 Bacteria 869
735 Ga0207671_11000955 3300025914 Unclassified 659
736 Ga0207693_10000089 3300025915 Bacteria 81143
737 Ga0207693_10000106 3300025915 Bacteria 75776
738 Ga0207693_10000478 3300025915 Bacteria 36490
739 Ga0207693_10002945 3300025915 Bacteria 14737
740 Ga0207693_10007165 3300025915 Bacteria 9190
741 Ga0207693_10013816 3300025915 Bacteria 6501
742 Ga0207693_10026924 3300025915 Bacteria 4548
743 Ga0207693_10046217 3300025915 Bacteria 3420
744 Ga0207693_10128351 3300025915 Bacteria 1993
745 Ga0207693_10133114 3300025915 Bacteria 1954
746 Ga0207693_10178348 3300025915 Bacteria 1671
747 Ga0207693_10289648 3300025915 Bacteria 1283
748 Ga0207693_10834232 3300025915 Bacteria 709
749 Ga0207693_11119766 3300025915 Bacteria 597
750 Ga0207663_10001049 3300025916 Bacteria 12676
751 Ga0207663_10005124 3300025916 Bacteria 6588
752 Ga0207663_10036016 3300025916 Bacteria 2974
753 Ga0207663_10045885 3300025916 Bacteria 2690
754 Ga0207663_10050065 3300025916 Bacteria 2594
755 Ga0207663_10067326 3300025916 Bacteria 2296
756 Ga0207663_10083265 3300025916 Bacteria 2101
757 Ga0207663_10101173 3300025916 Bacteria 1936
758 Ga0207663_10111144 3300025916 Bacteria 1859
759 Ga0207663_10172153 3300025916 Bacteria 1539
760 Ga0207663_10307978 3300025916 Bacteria 1186
761 Ga0207663_10330244 3300025916 Bacteria 1148
762 Ga0207663_10531406 3300025916 Bacteria 917
763 Ga0207663_10767062 3300025916 Bacteria 767
764 Ga0207663_10784502 3300025916 Bacteria 758
765 Ga0207663_10961387 3300025916 Bacteria 684
766 Ga0207663_11166378 3300025916 Bacteria 620
767 Ga0207663_11604146 3300025916 Unclassified 524
768 Ga0207660_10073963 3300025917 Bacteria 2486
769 Ga0207660_10080008 3300025917 Bacteria 2398
770 Ga0207660_10274268 3300025917 Bacteria 1337
771 Ga0207660_10486656 3300025917 Bacteria 1000
772 Ga0207662_10005327 3300025918 Bacteria 6843
773 Ga0207657_10000535 3300025919 Bacteria 40427
774 Ga0207657_10001828 3300025919 Bacteria 22959
775 Ga0207657_10002724 3300025919 Bacteria 19022
776 Ga0207649_10001639 3300025920 Bacteria 12996
777 Ga0207649_10005022 3300025920 Bacteria 7155
778 Ga0207649_10008845 3300025920 Bacteria 5499
779 Ga0207649_10063863 3300025920 Bacteria 2326
780 Ga0207649_10158581 3300025920 Bacteria 1566
781 Ga0207652_10052293 3300025921 Bacteria 3505
782 Ga0207652_10139606 3300025921 Bacteria 2166
783 Ga0207652_10276842 3300025921 Bacteria 1514
784 Ga0207652_10402529 3300025921 Unclassified 1235
785 Ga0207652_10737636 3300025921 Bacteria 877
786 Ga0207646_10000296 3300025922 Bacteria 67683
787 Ga0207646_10001311 3300025922 Bacteria 30882
788 Ga0207646_10010514 3300025922 Bacteria 9032
789 Ga0207646_10028179 3300025922 Bacteria 5115
790 Ga0207646_10046246 3300025922 Bacteria 3905
791 Ga0207646_10046789 3300025922 Bacteria 3881
792 Ga0207646_10077906 3300025922 Bacteria 2962
793 Ga0207646_10231800 3300025922 Bacteria 1668
794 Ga0207646_10365106 3300025922 Bacteria 1304
795 Ga0207646_10385148 3300025922 Bacteria 1267
796 Ga0207646_10667664 3300025922 Bacteria 930
797 Ga0207646_11296974 3300025922 Unclassified 636
798 Ga0207681_10038573 3300025923 Bacteria 3166
799 Ga0207681_10076422 3300025923 Bacteria 2352
800 Ga0207681_10197599 3300025923 Bacteria 1542
801 Ga0207694_10001172 3300025924 Bacteria 22716
802 Ga0207694_10029940 3300025924 Bacteria 4157
803 Ga0207694_10030975 3300025924 Bacteria 4085
804 Ga0207694_10113628 3300025924 Bacteria 2156
805 Ga0207650_10000223 3300025925 Bacteria 64087
806 Ga0207650_10121450 3300025925 Bacteria 2035
807 Ga0207659_10433888 3300025926 Bacteria 1104
808 Ga0207687_10003198 3300025927 Bacteria 11100
809 Ga0207687_10016635 3300025927 Bacteria 4832
810 Ga0207687_10064399 3300025927 Bacteria 2599
811 Ga0207687_10252179 3300025927 Bacteria 1403
812 Ga0207700_10000289 3300025928 Bacteria 29760
813 Ga0207700_10000888 3300025928 Bacteria 17211
814 Ga0207700_10001971 3300025928 Bacteria 11690
815 Ga0207700_10038958 3300025928 Bacteria 3455
816 Ga0207700_10041701 3300025928 Bacteria 3360
817 Ga0207700_10064554 3300025928 Bacteria 2789
818 Ga0207700_10093084 3300025928 Bacteria 2384
819 Ga0207700_10103713 3300025928 Bacteria 2274
820 Ga0207700_10136066 3300025928 Bacteria 2013
821 Ga0207700_10138557 3300025928 Bacteria 1996
822 Ga0207700_10154392 3300025928 Bacteria 1900
823 Ga0207700_10188701 3300025928 Bacteria 1731
824 Ga0207700_10244351 3300025928 Bacteria 1531
825 Ga0207700_10324223 3300025928 Bacteria 1335
826 Ga0207700_10353459 3300025928 Bacteria 1280
827 Ga0207700_10378154 3300025928 Bacteria 1238
828 Ga0207700_10503373 3300025928 Bacteria 1072
829 Ga0207700_10616269 3300025928 Bacteria 966
830 Ga0207700_10958648 3300025928 Bacteria 766
831 Ga0207700_11826428 3300025928 Unclassified 534
832 Ga0207664_10000118 3300025929 Bacteria 69258
833 Ga0207664_10003882 3300025929 Bacteria 10040
834 Ga0207664_10033923 3300025929 Bacteria 3927
835 Ga0207664_10041140 3300025929 Bacteria 3599
836 Ga0207664_10073025 3300025929 Bacteria 2767
837 Ga0207664_10093195 3300025929 Bacteria 2473
838 Ga0207664_10136743 3300025929 Bacteria 2068
839 Ga0207664_10138640 3300025929 Bacteria 2055
840 Ga0207664_10166224 3300025929 Bacteria 1885
841 Ga0207664_10177089 3300025929 Bacteria 1829
842 Ga0207664_10263335 3300025929 Bacteria 1508
843 Ga0207664_10298559 3300025929 Bacteria 1417
844 Ga0207664_10367275 3300025929 Bacteria 1276
845 Ga0207664_10392115 3300025929 Bacteria 1234
846 Ga0207664_10660827 3300025929 Bacteria 939
847 Ga0207664_11027098 3300025929 Bacteria 738
848 Ga0207664_11149802 3300025929 Bacteria 693
849 Ga0207664_11450318 3300025929 Unclassified 607
850 Ga0207664_11509216 3300025929 Unclassified 594
851 Ga0207644_10050252 3300025931 Bacteria 2988
852 Ga0207644_10053693 3300025931 Bacteria 2900
853 Ga0207644_11608850 3300025931 Unclassified 545
854 Ga0207690_10004009 3300025932 Bacteria 8694
855 Ga0207690_10018828 3300025932 Bacteria 4240
856 Ga0207690_10047080 3300025932 Bacteria 2859
857 Ga0207690_10140491 3300025932 Bacteria 1779
858 Ga0207706_10000613 3300025933 Bacteria 37863
859 Ga0207706_10000670 3300025933 Bacteria 35982
860 Ga0207706_10010049 3300025933 Bacteria 8671
861 Ga0207706_10762621 3300025933 Bacteria 824
862 Ga0207686_10038694 3300025934 Bacteria 2888
863 Ga0207686_10133109 3300025934 Bacteria 1708
864 Ga0207686_10169668 3300025934 Bacteria 1538
865 Ga0207686_10180694 3300025934 Bacteria 1496
866 Ga0207709_10018165 3300025935 Bacteria 3934
867 Ga0207670_10019581 3300025936 Bacteria 4136
868 Ga0207670_10291076 3300025936 Bacteria 1276
869 Ga0207669_10042896 3300025937 Bacteria 2645
870 Ga0207669_10375173 3300025937 Bacteria 1107
871 Ga0207704_10047312 3300025938 Bacteria 2570
872 Ga0207704_10097235 3300025938 Bacteria 1952
873 Ga0207704_10205401 3300025938 Bacteria 1445
874 Ga0207665_10001184 3300025939 Bacteria 17548
875 Ga0207665_10001526 3300025939 Bacteria 15570
876 Ga0207665_10001917 3300025939 Bacteria 14012
877 Ga0207665_10007063 3300025939 Bacteria 7434
878 Ga0207665_10018476 3300025939 Bacteria 4581
879 Ga0207665_10036854 3300025939 Bacteria 3254
880 Ga0207665_10051007 3300025939 Bacteria 2784
881 Ga0207665_10068713 3300025939 Bacteria 2415
882 Ga0207665_10163525 3300025939 Bacteria 1603
883 Ga0207665_10187819 3300025939 Bacteria 1500
884 Ga0207665_10323754 3300025939 Bacteria 1157
885 Ga0207665_10371240 3300025939 Bacteria 1084
886 Ga0207665_10512677 3300025939 Unclassified 928
887 Ga0207665_10515676 3300025939 Bacteria 925
888 Ga0207665_10560930 3300025939 Unclassified 888
889 Ga0207665_11054793 3300025939 Unclassified 647
890 Ga0207665_11103812 3300025939 Unclassified 632
891 Ga0207691_10000345 3300025940 Bacteria 46775
892 Ga0207691_10206787 3300025940 Bacteria 1707
893 Ga0207691_10686022 3300025940 Unclassified 864
894 Ga0207711_10024220 3300025941 Bacteria 5080
895 Ga0207711_10031511 3300025941 Bacteria 4476
896 Ga0207711_10210624 3300025941 Bacteria 1775
897 Ga0207711_10282130 3300025941 Bacteria 1530
898 Ga0207689_10000499 3300025942 Bacteria 37043
899 Ga0207689_10004722 3300025942 Bacteria 12297
900 Ga0207689_10034521 3300025942 Bacteria 4201
901 Ga0207689_10056056 3300025942 Bacteria 3243
902 Ga0207661_10001212 3300025944 Bacteria 17237
903 Ga0207661_10014609 3300025944 Bacteria 5759
904 Ga0207661_10246278 3300025944 Bacteria 1587
905 Ga0207661_10387609 3300025944 Bacteria 1265
906 Ga0207661_10414098 3300025944 Bacteria 1223
907 Ga0207679_10000115 3300025945 Bacteria 64466
908 Ga0207679_10004660 3300025945 Bacteria 8540
909 Ga0207679_10036871 3300025945 Bacteria 3471
910 Ga0207679_10043935 3300025945 Bacteria 3221
911 Ga0207679_11058595 3300025945 Unclassified 744
912 Ga0207667_10000785 3300025949 Bacteria 41249
913 Ga0207667_10003707 3300025949 Bacteria 18846
914 Ga0207667_10012312 3300025949 Bacteria 9868
915 Ga0207667_10041063 3300025949 Bacteria 4921
916 Ga0207667_10057513 3300025949 Bacteria 4082
917 Ga0207667_10083773 3300025949 Bacteria 3302
918 Ga0207651_10028184 3300025960 Bacteria 3539
919 Ga0207651_10043996 3300025960 Bacteria 2984
920 Ga0207651_11150338 3300025960 Unclassified 696
921 Ga0207712_10012010 3300025961 Bacteria 5527
922 Ga0207712_10064748 3300025961 Bacteria 2607
923 Ga0207668_10091740 3300025972 Bacteria 2233
924 Ga0207668_10107238 3300025972 Bacteria 2088
925 Ga0207640_10004082 3300025981 Bacteria 7892
926 Ga0207640_10018685 3300025981 Bacteria 4079
927 Ga0207640_10024613 3300025981 Bacteria 3634
928 Ga0207640_10025664 3300025981 Bacteria 3570
929 Ga0207640_10092094 3300025981 Bacteria 2102
930 Ga0207640_10394309 3300025981 Bacteria 1125
931 Ga0207640_11103811 3300025981 Unclassified 702
932 Ga0207640_12025149 3300025981 Unclassified 522
933 Ga0207658_10039444 3300025986 Bacteria 3407
934 Ga0207677_10002530 3300026023 Bacteria 9583
935 Ga0207677_10003252 3300026023 Bacteria 8581
936 Ga0207677_10007719 3300026023 Bacteria 5972
937 Ga0207677_10019421 3300026023 Bacteria 4104
938 Ga0207677_10026550 3300026023 Bacteria 3635
939 Ga0207677_10096354 3300026023 Bacteria 2165
940 Ga0207703_10004647 3300026035 Bacteria 11216
941 Ga0207703_10007943 3300026035 Bacteria 8385
942 Ga0207703_10027824 3300026035 Bacteria 4453
943 Ga0207703_10119007 3300026035 Bacteria 2265
944 Ga0207703_10126739 3300026035 Bacteria 2199
945 Ga0207703_10273360 3300026035 Bacteria 1532
946 Ga0207639_10015221 3300026041 Bacteria 5420
947 Ga0207639_10070409 3300026041 Bacteria 2732
948 Ga0207639_10107358 3300026041 Unclassified 2268
949 Ga0207639_10320961 3300026041 Bacteria 1375
950 Ga0207639_10716238 3300026041 Bacteria 929
951 Ga0207678_10000130 3300026067 Bacteria 63279
952 Ga0207678_10001418 3300026067 Bacteria 21972
953 Ga0207678_10387169 3300026067 Bacteria 1209
954 Ga0207708_10025729 3300026075 Bacteria 4453
955 Ga0207702_10000089 3300026078 Bacteria 105440
956 Ga0207702_10001792 3300026078 Bacteria 21146
957 Ga0207702_10002571 3300026078 Bacteria 17059
958 Ga0207702_10011696 3300026078 Bacteria 7309
959 Ga0207702_10021538 3300026078 Bacteria 5338
960 Ga0207702_10138350 3300026078 Bacteria 2200
961 Ga0207702_10150683 3300026078 Bacteria 2115
962 Ga0207702_10629975 3300026078 Bacteria 1054
963 Ga0207702_10861300 3300026078 Bacteria 897
964 Ga0207641_10000287 3300026088 Bacteria 63251
965 Ga0207641_10017583 3300026088 Bacteria 5853
966 Ga0207641_10032145 3300026088 Bacteria 4357
967 Ga0207641_10083345 3300026088 Bacteria 2781
968 Ga0207641_10144071 3300026088 Bacteria 2153
969 Ga0207641_10178140 3300026088 Bacteria 1945
970 Ga0207641_10260168 3300026088 Bacteria 1624
971 Ga0207641_11132900 3300026088 Viruses 781
972 Ga0207648_10001253 3300026089 Bacteria 28381
973 Ga0207648_10007469 3300026089 Bacteria 10743
974 Ga0207648_10009512 3300026089 Bacteria 9300
975 Ga0207648_10104312 3300026089 Bacteria 2486
976 Ga0207676_10000115 3300026095 Bacteria 71633
977 Ga0207676_10001385 3300026095 Bacteria 18052
978 Ga0207676_10022329 3300026095 Bacteria 4654
979 Ga0207676_10098239 3300026095 Bacteria 2420
980 Ga0207674_10000309 3300026116 Bacteria 62067
981 Ga0207674_10001340 3300026116 Bacteria 31912
982 Ga0207674_10005897 3300026116 Bacteria 14522
983 Ga0207674_10027037 3300026116 Bacteria 6079
984 Ga0207674_10067233 3300026116 Bacteria 3608
985 Ga0207674_10411029 3300026116 Bacteria 1308
986 Ga0207675_100179691 3300026118 Bacteria 2026
987 Ga0207675_101612506 3300026118 Unclassified 669
988 Ga0207683_10000217 3300026121 Bacteria 50192
989 Ga0207683_10047570 3300026121 Bacteria 3757
990 Ga0207683_10220024 3300026121 Bacteria 1730
991 Ga0207683_10460220 3300026121 Bacteria 1173
992 Ga0207698_10005557 3300026142 Bacteria 7793
993 Ga0207698_10034675 3300026142 Bacteria 3682
994 Ga0207698_10086948 3300026142 Bacteria 2544
995 Ga0207698_10122828 3300026142 Bacteria 2201
996 Ga0207698_10544204 3300026142 Bacteria 1137
997 Ga0265356_1000460 3300028017 Bacteria 7375
998 Ga0268266_10000761 3300028379 Bacteria 43122
999 Ga0268266_10208361 3300028379 Bacteria 1792
1000 Ga0268265_10040417 3300028380 Bacteria 3444
1001 Ga0268265_10054561 3300028380 Bacteria 3033
1002 Ga0268265_10079055 3300028380 Bacteria 2589
1003 Ga0268265_10271720 3300028380 Bacteria 1512
1004 Ga0268264_10081808 3300028381 Bacteria 2761
1005 Ga0268264_10128399 3300028381 Bacteria 2244
1006 Ga0268264_10185595 3300028381 Bacteria 1892
1007 Ga0268264_10190056 3300028381 Bacteria 1871
1008 Ga0268264_10280871 3300028381 Bacteria 1560
1009 Ga0268264_10371132 3300028381 Bacteria 1368
1010 Ga0268264_10950407 3300028381 Unclassified 864
1011 Ga0268264_11035657 3300028381 Unclassified 828
1012 Ga0265338_10006709 3300028800 Bacteria 14542
1013 Ga0265338_10023713 3300028800 Bacteria 6294
1014 Ga0265338_10085823 3300028800 Bacteria 2622
1015 Ga0265338_10099173 3300028800 Bacteria 2380
1016 Ga0265338_10141362 3300028800 Bacteria 1885
1017 Ga0265338_10332241 3300028800 Bacteria 1097
1018 Ga0265338_11009597 3300028800 Unclassified 563
1019 Ga0265762_1000555 3300030760 Bacteria 6533
1020 Ga0265762_1001369 3300030760 Bacteria 4425
1021 Ga0265762_1001687 3300030760 Bacteria 4019
1022 Ga0265770_1007389 3300030878 Bacteria 1546
1023 Ga0265770_1040770 3300030878 Bacteria 812
1024 Ga0265770_1066978 3300030878 Bacteria 678
1025 Ga0265760_10002193 3300031090 Bacteria 5707
1026 Ga0265760_10008888 3300031090 Bacteria 2870
1027 Ga0265760_10018621 3300031090 Bacteria 2000
1028 Ga0265760_10054506 3300031090 Bacteria 1207
1029 Ga0265760_10118488 3300031090 Unclassified 848
1030 Ga0265760_10141911 3300031090 Bacteria 783
1031 Ga0265760_10160093 3300031090 Bacteria 743
1032 Ga0265332_10124037 3300031238 Bacteria 1085
1033 Ga0265328_10010953 3300031239 Bacteria 3637
1034 Ga0265325_10173829 3300031241 Bacteria 1007
1035 Ga0265340_10030035 3300031247 Bacteria 2726
1036 Ga0265340_10039248 3300031247 Bacteria 2337
1037 Ga0265340_10064085 3300031247 Unclassified 1753
1038 Ga0265340_10072102 3300031247 Bacteria 1636
1039 Ga0265340_10079574 3300031247 Bacteria 1545
1040 Ga0265339_10005007 3300031249 Bacteria 8914
1041 Ga0265339_10005406 3300031249 Bacteria 8511
1042 Ga0265339_10057224 3300031249 Bacteria 2108
1043 Ga0265339_10110504 3300031249 Bacteria 1422
1044 Ga0265339_10171582 3300031249 Bacteria 1085
1045 Ga0265316_10002496 3300031344 Bacteria 19052
1046 Ga0265316_10026402 3300031344 Bacteria 4831
1047 Ga0265316_10071116 3300031344 Bacteria 2682
1048 Ga0265316_10505109 3300031344 Bacteria 863
1049 Ga0265316_11192118 3300031344 Bacteria 527
1050 Ga0307408_100818075 3300031548 Bacteria 847
1051 Ga0265314_10002671 3300031711 Bacteria 17879
1052 Ga0265314_10010032 3300031711 Bacteria 7940
1053 Ga0265314_10033779 3300031711 Bacteria 3744
1054 Ga0265342_10040359 3300031712 Bacteria 2831
1055 Ga0307405_10110461 3300031731 Bacteria 1862
1056 Ga0307410_10006635 3300031852 Bacteria 6264
1057 Ga0307410_10291128 3300031852 Bacteria 1285
1058 Ga0307406_10887178 3300031901 Bacteria 758
1059 Ga0307407_10148674 3300031903 Bacteria 1520
1060 Ga0307412_10044143 3300031911 Bacteria 2908
1061 Ga0307412_10464530 3300031911 Bacteria 1046
1062 Ga0307412_10773190 3300031911 Unclassified 831
1063 Ga0307412_10866646 3300031911 Bacteria 789
1064 Ga0307409_100040606 3300031995 Bacteria 3466
1065 Ga0307416_100091640 3300032002 Bacteria 2611
1066 Ga0307414_10384718 3300032004 Bacteria 1214
1067 Ga0307411_10010176 3300032005 Bacteria 4998
1068 Ga0307411_11330951 3300032005 Unclassified 655
1069 Ga0316212_1008681 3300033547 Bacteria 1460
1070 Ga0373930_0060732 3300034816 Bacteria 843
1071 Ga0373958_0035222 3300034819 Unclassified 1001
1072 Ga0373938_0013461 3300034957 Bacteria 1553
1073 Ga0373926_0002011 3300035083 Bacteria 6389
1074 Ga0373926_0130968 3300035083 Bacteria 950
1075 Ga0373926_0230632 3300035083 Unclassified 716
1076 Ga0373929_0016269 3300035085 Unclassified 1456
1077 Ga0373934_0148320 3300035086 Bacteria 960
1078 Ga0373940_0169494 3300035088 Unclassified 705
1079 Ga0373944_0104907 3300035089 Bacteria 959
1080 Ga0373944_0303312 3300035089 Unclassified 600
1081 Ga0373952_0010030 3300035092 Bacteria 1824
1082 Ga0373923_0092910 3300035111 Bacteria 1322
1083 Ga0373923_0108092 3300035111 Bacteria 1233
1084 Ga0373923_0372602 3300035111 Unclassified 684
1085 Ga0373932_0183595 3300035112 Bacteria 735
1086 Ga0373932_0340592 3300035112 Unclassified 568
1087 Ga0373932_0364845 3300035112 Unclassified 552
1088 Ga0373936_0010711 3300035113 Bacteria 3463
1089 Ga0373936_0069620 3300035113 Bacteria 1448
1090 Ga0373936_0084887 3300035113 Bacteria 1322
1091 Ga0373936_0100838 3300035113 Bacteria 1218
1092 Ga0373936_0112569 3300035113 Bacteria 1157
1093 Ga0373936_0126371 3300035113 Bacteria 1096
1094 Ga0373936_0263468 3300035113 Unclassified 772
1095 Ga0373939_0007117 3300035114 Bacteria 2712
1096 Ga0373939_0079980 3300035114 Unclassified 1083
1097 Ga0373941_0030121 3300035115 Bacteria 1606
1098 Ga0373945_0193149 3300035116 Bacteria 842
1099 Ga0373945_0279639 3300035116 Bacteria 711
1100 Ga0373945_0412959 3300035116 Bacteria 593
1101 Ga0373953_0074673 3300035117 Bacteria 1403
1102 Ga0373954_0187440 3300035118 Bacteria 1015
1103 Ga0373956_0287152 3300035119 Bacteria 783
1104 Ga0373943_0036935 3300035170 Bacteria 2342
1105 Ga0373943_0064816 3300035170 Bacteria 1835
1106 Ga0373943_0113914 3300035170 Bacteria 1430
1107 Ga0373943_0158163 3300035170 Bacteria 1232
1108 Ga0373943_0158321 3300035170 Bacteria 1231
1109 Ga0373943_0717124 3300035170 Bacteria 593
1110 Ga0373946_0072145 3300035171 Bacteria 1494
1111 Ga0373946_0095391 3300035171 Bacteria 1325
1112 Ga0373946_0118343 3300035171 Bacteria 1207
1113 Ga0373946_0316002 3300035171 Bacteria 775
1114 Ga0373955_0039567 3300035172 Bacteria 2518
1115 Ga0373955_0111391 3300035172 Bacteria 1583
1116 Ga0373955_0162616 3300035172 Bacteria 1318
1117 Ga0373955_0262071 3300035172 Bacteria 1038
1118 Ga0373955_0515418 3300035172 Bacteria 731
1119 Ga0373942_0027742 3300035207 Bacteria 1475
1120 Ga0373962_0316974 3300035242 Unclassified 556
1121 Ga0373924_0044436 3300035410 Bacteria 1826
1122 Ga0373931_0004545 3300035691 Bacteria 6346
1123 Ga0373931_0041928 3300035691 Bacteria 2405
1124 Ga0373931_0079597 3300035691 Bacteria 1805
1125 Ga0373931_0573114 3300035691 Unclassified 735
1126 Ga0373931_1076048 3300035691 Unclassified 547
1127 Ga0373935_0083839 3300035692 Bacteria 2075
1128 Ga0373935_0256813 3300035692 Bacteria 1224
1129 Ga0373935_0285663 3300035692 Bacteria 1162
1130 Ga0373935_0355477 3300035692 Bacteria 1045
1131 Ga0373935_0456900 3300035692 Bacteria 923
1132 Ga0373935_1316233 3300035692 Unclassified 539
1133 Ga0373927_0037883 3300035695 Bacteria 3133
1134 Ga0373927_0062914 3300035695 Bacteria 2400
1135 Ga0373927_0100844 3300035695 Bacteria 1877
1136 Ga0373927_0121129 3300035695 Bacteria 1707
1137 Ga0373927_0176315 3300035695 Bacteria 1402
1138 Ga0373927_0235474 3300035695 Bacteria 1203
1139 Ga0373927_0341556 3300035695 Bacteria 986
1140 Ga0373933_0050319 3300035724 Bacteria 2487
1141 Ga0373933_0136851 3300035724 Bacteria 1544
1142 Ga0373933_0229637 3300035724 Bacteria 1192
1143 Ga0373933_0437550 3300035724 Bacteria 855
1144 Ga0373933_0872130 3300035724 Unclassified 593
1145 Ga0373947_0003282 3300035725 Bacteria 9589
1146 Ga0373947_0016844 3300035725 Bacteria 4198
1147 Ga0373947_0066081 3300035725 Bacteria 2207
1148 Ga0373947_0283724 3300035725 Unclassified 1101
1149 Ga0373947_0329156 3300035725 Bacteria 1023
1150 Ga0373947_0363894 3300035725 Unclassified 972
1151 Ga0373937_0022486 3300036401 Bacteria 5670
1152 Ga0373937_0075249 3300036401 Bacteria 3117
1153 Ga0373937_0075367 3300036401 Bacteria 3114
1154 Ga0373937_0136990 3300036401 Bacteria 2289
1155 Ga0373937_0257177 3300036401 Bacteria 1646
1156 Ga0373937_0384876 3300036401 Bacteria 1330
1157 Ga0373925_0022151 3300037068 Unclassified 4633
1158 Ga0373925_0064821 3300037068 Bacteria 2751
1159 Ga0373925_0160860 3300037068 Bacteria 1768
1160 Ga0373925_0248800 3300037068 Bacteria 1425
1161 Ga0373925_0299562 3300037068 Bacteria 1298
1162 Ga0373925_0434075 3300037068 Unclassified 1074
1163 Ga0373925_0865301 3300037068 Unclassified 745
1164 Ga0373925_1353700 3300037068 Unclassified 584
1165 Ga0395900_1021777 3300037418 Unclassified 746
1166 Ga0395898_1391984 3300037466 Unclassified 629
1167 Ga0395905_0245982 3300037471 Bacteria 1671
1168 Ga0395905_0318132 3300037471 Bacteria 1446
1169 Ga0395905_0467630 3300037471 Bacteria 1160
1170 Ga0436364_0298147 3300037853 Bacteria 2748
1171 Ga0395901_0538954 3300038443 Bacteria 1184
1172 Ga0436365_0833051 3300039437 Bacteria 1316
1173 Ga0436360_0673425 3300039438 Bacteria 710
1174 Ga0436360_0967961 3300039438 Bacteria 1543
1175 Ga0436363_0009640 3300039450 Bacteria 1177
1176 Ga0436363_0209267 3300039450 Bacteria 5921
1177 Ga0436363_0284783 3300039450 Bacteria 2301
1178 Ga0436363_0808254 3300039450 Bacteria 897
1179 Ga0436363_0845898 3300039450 Bacteria 904
1180 Ga0436362_0381178 3300039453 Bacteria 570
1181 Ga0451839_0843721 3300041496 Bacteria 2089
1182 Ga0451577_1156179 3300042876 Bacteria 691
1183 Ga0466961_0319338 3300044693 Bacteria 947
1184 Ga0466963_0019363 3300044694 Bacteria 4267
1185 Ga0466963_0311414 3300044694 Bacteria 1108
1186 Ga0466964_0139691 3300044706 Bacteria 1112
1187 Ga0466964_0175058 3300044706 Bacteria 1013
1188 Ga0453684_0757408 3300044712 Bacteria 1051
1189 Ga0466968_0207311 3300044735 Bacteria 920
1190 Ga0466968_0449759 3300044735 Bacteria 637
1191 Ga0466959_0326706 3300045049 Bacteria 1048
1192 Ga0466959_0406429 3300045049 Unclassified 925
1193 Ga0466959_0758399 3300045049 Bacteria 649
1194 Ga0466959_0804752 3300045049 Unclassified 628
1195 Ga0451576_0095439 3300045051 Bacteria 3093
1196 Ga0451576_0532981 3300045051 Bacteria 1234
1197 Ga0451576_1638010 3300045051 Unclassified 667
1198 Ga0466967_0006951 3300045976 Bacteria 8095
1199 Ga0466967_0032212 3300045976 Bacteria 4423
1200 Ga0466967_0055087 3300045976 Bacteria 3502
1201 Ga0466967_0241580 3300045976 Bacteria 1723
1202 Ga0466967_1618604 3300045976 Bacteria 645
1203 Ga0466967_2462982 3300045976 Unclassified 515
1204 Ga0495603_0113431 3300046455 Bacteria 1580
1205 Ga0495629_0013250 3300046459 Bacteria 5952
1206 Ga0495653_0508547 3300046463 Bacteria 750
1207 Ga0495653_0605907 3300046463 Unclassified 673
1208 Ga0495580_0000031 3300046472 Bacteria 76248
1209 Ga0495580_0002510 3300046472 Bacteria 16008
1210 Ga0495580_0003785 3300046472 Bacteria 12813
1211 Ga0495580_0008038 3300046472 Bacteria 8423
1212 Ga0495580_0011952 3300046472 Bacteria 6691
1213 Ga0495580_0012257 3300046472 Bacteria 6584
1214 Ga0495580_0013423 3300046472 Bacteria 6250
1215 Ga0495580_0019954 3300046472 Bacteria 4969
1216 Ga0495580_0042560 3300046472 Bacteria 3236
1217 Ga0495580_0060755 3300046472 Bacteria 2654
1218 Ga0495580_0074308 3300046472 Bacteria 2372
1219 Ga0495580_0121783 3300046472 Bacteria 1811
1220 Ga0495580_0269184 3300046472 Bacteria 1164
1221 Ga0495580_0396984 3300046472 Unclassified 930
1222 Ga0495580_0438370 3300046472 Bacteria 877
1223 Ga0495580_0516691 3300046472 Bacteria 796
1224 Ga0495580_0545248 3300046472 Unclassified 771
1225 Ga0495580_0603181 3300046472 Bacteria 725
1226 Ga0495580_0750577 3300046472 Unclassified 636
1227 Ga0495582_0001059 3300046473 Bacteria 15471
1228 Ga0495582_0010750 3300046473 Bacteria 5036
1229 Ga0495582_0159874 3300046473 Bacteria 1281
1230 Ga0495582_0255001 3300046473 Bacteria 1006
1231 Ga0495639_0062931 3300046475 Bacteria 1703
1232 Ga0495639_0069115 3300046475 Bacteria 1629
1233 Ga0495639_0367620 3300046475 Bacteria 724
1234 Ga0495662_0172779 3300046476 Bacteria 1065
1235 Ga0495584_0685658 3300046491 Unclassified 522
1236 Ga0495618_0600598 3300046514 Unclassified 655
1237 Ga0495630_0273481 3300046517 Bacteria 1290
1238 Ga0495630_0386677 3300046517 Bacteria 1072
1239 Ga0495666_0063034 3300046526 Bacteria 1770
1240 Ga0495666_0204804 3300046526 Bacteria 906
1241 Ga0495666_0385087 3300046526 Bacteria 631
1242 Ga0495652_0579790 3300046529 Bacteria 768
1243 Ga0495665_0025755 3300046531 Bacteria 3158
1244 Ga0495665_0064771 3300046531 Bacteria 1929
1245 Ga0495640_0214361 3300046533 Bacteria 1216
1246 Ga0495640_0245433 3300046533 Bacteria 1123
1247 Ga0495586_0828540 3300046535 Unclassified 533
1248 Ga0495587_0108369 3300046536 Unclassified 1597
1249 Ga0495645_0153799 3300046543 Bacteria 1596
1250 Ga0495667_0478810 3300046559 Unclassified 781
1251 Ga0495659_0029097 3300046664 Bacteria 1916
1252 Ga0495657_0692047 3300046675 Unclassified 586
1253 Ga0495623_0023471 3300046679 Bacteria 3981
1254 Ga0495623_0703022 3300046679 Unclassified 518
1255 Ga0495658_0744781 3300046683 Unclassified 628
1256 Ga0495669_0054259 3300046684 Bacteria 1804
1257 Ga0495669_0058045 3300046684 Bacteria 1747
1258 Ga0495613_0126079 3300046689 Bacteria 1836
1259 Ga0495624_0448279 3300046690 Bacteria 773
1260 Ga0495624_0458877 3300046690 Bacteria 763
1261 Ga0495624_0535561 3300046690 Bacteria 700
1262 Ga0495624_0740002 3300046690 Bacteria 583
1263 Ga0495670_0166420 3300046691 Bacteria 1160
1264 Ga0495649_0352483 3300046694 Bacteria 744
1265 Ga0495600_0900233 3300046809 Unclassified 522
1266 Ga0495604_0109922 3300047317 Unclassified 2012
1267 Ga0495604_0437500 3300047317 Bacteria 856
1268 Ga0495674_0075852 3300047319 Bacteria 2893
1269 Ga0495674_0135485 3300047319 Bacteria 2073
1270 Ga0495674_0137641 3300047319 Bacteria 2054
1271 Ga0495675_0041145 3300047444 Bacteria 2945
1272 Ga0495675_0332838 3300047444 Bacteria 896
1273 Ga0495684_0216793 3300047471 Bacteria 1405
1274 Ga0495684_0875416 3300047471 Bacteria 581
1275 Ga0495593_0287981 3300047673 Bacteria 821
1276 Ga0495602_0043932 3300048088 Bacteria 4057
1277 Ga0495602_0166686 3300048088 Bacteria 1714
1278 Ga0495602_0329407 3300048088 Bacteria 1108
1279 Ga0495602_0820984 3300048088 Bacteria 623
1280 Ga0496100_0033637 3300048903 Bacteria 3209
1281 Ga0496100_0086547 3300048903 Bacteria 2129
1282 Ga0496100_0101346 3300048903 Bacteria 1985
1283 Ga0496100_0102743 3300048903 Bacteria 1973
1284 Ga0496100_0382645 3300048903 Bacteria 1069
1285 Ga0496101_0175686 3300048904 Bacteria 1647
1286 Ga0496101_0323270 3300048904 Bacteria 1210
1287 Ga0496101_1496540 3300048904 Unclassified 525
1288 Ga0496102_0001424 3300048905 Bacteria 21214
1289 Ga0496102_0021406 3300048905 Bacteria 5718
1290 Ga0496102_0052423 3300048905 Bacteria 3717
1291 Ga0496102_0078474 3300048905 Bacteria 3040
1292 Ga0496102_0149569 3300048905 Bacteria 2193
1293 Ga0496102_0153471 3300048905 Bacteria 2165
1294 Ga0496102_0183631 3300048905 Bacteria 1971
1295 Ga0496102_0185835 3300048905 Bacteria 1959
1296 Ga0496102_0257323 3300048905 Bacteria 1646
1297 Ga0496102_0280180 3300048905 Bacteria 1572
1298 Ga0496103_0003887 3300048906 Bacteria 9090
1299 Ga0496103_0005029 3300048906 Bacteria 7974
1300 Ga0496103_0048205 3300048906 Bacteria 2632
1301 Ga0496104_0018664 3300048907 Bacteria 6331
1302 Ga0496104_0031354 3300048907 Bacteria 4943
1303 Ga0496104_0075482 3300048907 Bacteria 3210
1304 Ga0496104_0105810 3300048907 Bacteria 2696
1305 Ga0496104_0328056 3300048907 Bacteria 1443
1306 Ga0496104_0336874 3300048907 Bacteria 1421
1307 Ga0496104_0362288 3300048907 Bacteria 1362
1308 Ga0496104_0365399 3300048907 Bacteria 1355
1309 Ga0496104_1143113 3300048907 Bacteria 682
1310 Ga0496105_0060287 3300048908 Bacteria 3131
1311 Ga0496105_0560915 3300048908 Bacteria 890
1312 Ga0496106_0014952 3300048909 Bacteria 5742
1313 Ga0496106_0041788 3300048909 Bacteria 3437
1314 Ga0496106_0093211 3300048909 Bacteria 2327
1315 Ga0496106_0332237 3300048909 Bacteria 1220
1316 Ga0496107_0016408 3300048910 Bacteria 5200
1317 Ga0496107_0094872 3300048910 Bacteria 2182
1318 Ga0496107_1174746 3300048910 Unclassified 552
1319 Ga0496108_0000325 3300048911 Bacteria 40507
1320 Ga0496108_0040500 3300048911 Bacteria 3884
1321 Ga0496108_0322918 3300048911 Bacteria 1346
1322 Ga0496108_0549062 3300048911 Bacteria 1008
1323 Ga0496108_0554139 3300048911 Bacteria 1003
1324 Ga0496109_0000117 3300048912 Bacteria 82245
1325 Ga0496109_0096787 3300048912 Bacteria 2735
1326 Ga0496109_0426308 3300048912 Bacteria 1253
1327 Ga0496109_1053736 3300048912 Bacteria 750
1328 Ga0496109_1749891 3300048912 Unclassified 555
1329 Ga0496110_0006359 3300048913 Bacteria 9337
1330 Ga0496110_0025595 3300048913 Bacteria 5044
1331 Ga0496111_0094258 3300048914 Bacteria 2195
1332 Ga0496111_0724057 3300048914 Unclassified 723
1333 Ga0496112_0000283 3300048915 Bacteria 32864
1334 Ga0496112_0014557 3300048915 Bacteria 7307
1335 Ga0496112_0016004 3300048915 Bacteria 7013
1336 Ga0496112_0021267 3300048915 Bacteria 6167
1337 Ga0496112_0024757 3300048915 Bacteria 5755
1338 Ga0496112_0047441 3300048915 Bacteria 4214
1339 Ga0496112_0050645 3300048915 Bacteria 4073
1340 Ga0496112_0056839 3300048915 Bacteria 3851
1341 Ga0496112_0099290 3300048915 Bacteria 2881
1342 Ga0496112_0119918 3300048915 Bacteria 2600
1343 Ga0496112_0238847 3300048915 Bacteria 1770
1344 Ga0496112_0476740 3300048915 Bacteria 1185
1345 Ga0496113_0007994 3300048916 Bacteria 6854
1346 Ga0496113_0109867 3300048916 Bacteria 2145
1347 Ga0496113_0383886 3300048916 Bacteria 1127
1348 Ga0496113_1315066 3300048916 Unclassified 562
1349 Ga0496114_0033551 3300048917 Bacteria 4230
1350 Ga0496115_0012224 3300048918 Bacteria 6455
1351 Ga0496115_0031114 3300048918 Bacteria 4202
1352 Ga0496115_0112581 3300048918 Bacteria 2236
1353 Ga0496126_0539047 3300048929 Unclassified 928
1354 Ga0501290_024838 3300049513 Bacteria 836
1355 Ga0501292_045035 3300049515 Unclassified 770
1356 Ga0501295_095458 3300049518 Unclassified 692
1357 Ga0501297_024373 3300049520 Bacteria 773
1358 Ga0501298_002596 3300049521 Bacteria 2748
1359 Ga0501298_137844 3300049521 Bacteria 588
1360 Ga0501299_062524 3300049522 Unclassified 791
1361 Ga0501299_125162 3300049522 Unclassified 624
1362 Ga0501216_084325 3300049660 Unclassified 677
1363 Ga0501222_026356 3300049662 Bacteria 789
1364 Ga0501227_200439 3300049665 Unclassified 565
1365 Ga0501239_015045 3300049672 Unclassified 901
1366 Ga0501247_035382 3300049677 Bacteria 697
1367 Ga0501250_008377 3300049680 Bacteria 1139
1368 Ga0501225_0095308 3300049705 Unclassified 865
1369 Ga0501245_138972 3300049708 Unclassified 527
1370 Ga0501083_0072867 3300049744 Bacteria 2283
1371 Ga0501083_0145012 3300049744 Bacteria 1554
1372 nmdc:mga0n895_102873_c1 3300050512 Bacteria 2867
1373 nmdc:mga0n895_27328_c1 3300050512 Bacteria 5419
1374 nmdc:mga0n895_273663_c1 3300050512 Bacteria 1713
1375 nmdc:mga0rr50_224426_c1 3300050513 Bacteria 1552
1376 nmdc:mga0rr50_284_c1 3300050513 Bacteria 27442
1377 nmdc:mga0rr50_292441_c1 3300050513 Bacteria 1361
1378 nmdc:mga0rr50_542920_c1 3300050513 Bacteria 990
1379 nmdc:mga0rr50_84483_c1 3300050513 Bacteria 2458
1380 nmdc:mga0rr50_8721_c1 3300050513 Bacteria 6325
1381 nmdc:mga0rr50_91738_c1 3300050513 Bacteria 2367
1382 nmdc:mga0rr50_995542_c1 3300050513 Bacteria 714
1383 nmdc:mga08x19_21264_c1 3300050514 Bacteria 4003
1384 nmdc:mga08x19_24287_c1 3300050514 Bacteria 3766
1385 nmdc:mga08x19_448477_c1 3300050514 Bacteria 908
1386 nmdc:mga08x19_4593_c1 3300050514 Bacteria 8199
1387 nmdc:mga08x19_5882_c1 3300050514 Bacteria 7254
1388 nmdc:mga08x19_83365_c1 3300050514 Bacteria 2102
1389 nmdc:mga08x19_88067_c1 3300050514 Bacteria 2046
1390 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
1391 Ga0495601_0078108 3300053077 Bacteria 2121
1392 Ga0495612_0516633 3300053078 Unclassified 549
1393 Ga0495612_0572909 3300053078 Unclassified 521
1394 Ga0495595_0093703 3300053084 Bacteria 1443
1395 Ga0495619_0147079 3300053085 Bacteria 1625
1396 Ga0495619_0220997 3300053085 Bacteria 1312
1397 Ga0495619_0284660 3300053085 Bacteria 1145
1398 Ga0500590_254941 3300053148 Bacteria 694
1399 Ga0501084_1112720 3300054114 Unclassified 663
1400 Ga0207695_10762659
1401 MRS1b_contig_6134550
1402 MBSR1b_contig_12674636
1403 MBSR1b_contig_2772953
1404 JGI24752J21851_1003898
1405 JGI24751J29686_10001643
1406 rootL2_10044960
1407 rootL2_10120147
1408 Ga0065712_10106543
1409 Ga0065712_10163917
1410 Ga0065715_10002805
1411 Ga0065715_10096374
1412 Ga0065715_10096533
1413 Ga0065707_10326253
1414 Ga0070658_10015673
1415 Ga0070658_11282360
1416 Ga0070676_10247845
1417 Ga0070676_10358536
1418 Ga0070683_100014455
1419 Ga0070683_100041687
1420 Ga0070683_100075451
1421 Ga0070683_100356050
1422 Ga0070690_100017809
1423 Ga0070690_100061607
1424 Ga0070670_100010385
1425 Ga0070670_100083025
1426 Ga0070670_100196114
1427 Ga0070677_10036802
1428 Ga0068869_100000550
1429 Ga0068869_100034351
1430 Ga0068869_100627344
1431 Ga0070666_10024078
1432 Ga0070666_10541298
1433 Ga0070666_10656648
1434 Ga0070680_100015909
1435 Ga0070680_100044409
1436 Ga0070680_100313656
1437 Ga0070682_100010415
1438 Ga0068868_100003943
1439 Ga0068868_100009681
1440 Ga0068868_100034367
1441 Ga0068868_100053324
1442 Ga0068868_100135625
1443 Ga0070660_100004316
1444 Ga0070660_100011820
1445 Ga0070660_100053314
1446 Ga0070689_100042634
1447 Ga0070687_100007241
1448 Ga0070661_100011241
1449 Ga0070661_100012801
1450 Ga0070661_100015105
1451 Ga0070661_100030051
1452 Ga0070661_100069047
1453 Ga0070692_10145265
1454 Ga0070692_11072468
1455 Ga0070668_100002735
1456 Ga0070668_100024225
1457 Ga0070668_100862645
1458 Ga0070669_100011554
1459 Ga0070669_100570349
1460 Ga0070669_101447395
1461 Ga0070675_100007612
1462 Ga0070675_100465790
1463 Ga0070671_100014648
1464 Ga0070671_101277177
1465 Ga0070671_102016829
1466 Ga0070673_100008691
1467 Ga0070673_100155066
1468 Ga0070673_101185853
1469 Ga0070673_101488463
1470 Ga0070688_100007204
1471 Ga0070688_100252055
1472 Ga0070688_100313026
1473 Ga0070659_100001922
1474 Ga0070659_100006129
1475 Ga0070659_100039236
1476 Ga0070659_100854978
1477 Ga0070667_100009820
1478 Ga0070667_100386271
1479 Ga0070667_101014396
1480 Ga0070709_10028242
1481 Ga0070709_10049599
1482 Ga0070709_10086997
1483 Ga0070709_10089106
1484 Ga0070709_10259874
1485 Ga0070709_10366360
1486 Ga0070709_10795488
1487 Ga0070709_10848509
1488 Ga0070709_11647796
1489 Ga0070714_100009049
1490 Ga0070714_100025843
1491 Ga0070714_100031288
1492 Ga0070714_100036765
1493 Ga0070714_100102975
1494 Ga0070714_100124419
1495 Ga0070714_100133533
1496 Ga0070714_100171080
1497 Ga0070714_100195863
1498 Ga0070714_100226227
1499 Ga0070714_100281523
1500 Ga0070714_100466376
1501 Ga0070714_100559407
1502 Ga0070714_100727115
1503 Ga0070714_101128171
1504 Ga0070714_101136190
1505 Ga0070713_100000342
1506 Ga0070713_100000449
1507 Ga0070713_100000510
1508 Ga0070713_100006751
1509 Ga0070713_100007164
1510 Ga0070713_100117524
1511 Ga0070713_100120784
1512 Ga0070713_100125991
1513 Ga0070713_100143012
1514 Ga0070713_100170845
1515 Ga0070713_100226221
1516 Ga0070713_100526522
1517 Ga0070713_100602633
1518 Ga0070713_100647877
1519 Ga0070713_100849201
1520 Ga0070713_100937109
1521 Ga0070713_100982851
1522 Ga0070710_10003161
1523 Ga0070710_10008637
1524 Ga0070710_10050390
1525 Ga0070710_10066409
1526 Ga0070710_10087209
1527 Ga0070710_10102028
1528 Ga0070710_10102984
1529 Ga0070710_10226597
1530 Ga0070710_10281110
1531 Ga0070710_10341182
1532 Ga0070711_100000442
1533 Ga0070711_100001861
1534 Ga0070711_100004128
1535 Ga0070711_100015933
1536 Ga0070711_100020744
1537 Ga0070711_100021709
1538 Ga0070711_100030425
1539 Ga0070711_100058991
1540 Ga0070711_100084396
1541 Ga0070711_100230865
1542 Ga0070711_100258832
1543 Ga0070711_100261769
1544 Ga0070711_100803118
1545 Ga0070711_100871277
1546 Ga0070711_101190836
1547 Ga0070705_100181212
1548 Ga0070700_100057144
1549 Ga0070700_100065656
1550 Ga0070694_100190002
1551 Ga0070708_100001221
1552 Ga0070708_100001401
1553 Ga0070708_100001766
1554 Ga0070708_100002020
1555 Ga0070708_100015287
1556 Ga0070708_100041536
1557 Ga0070708_100141295
1558 Ga0070708_100239549
1559 Ga0070708_100267103
1560 Ga0070708_100277146
1561 Ga0070708_100278362
1562 Ga0070708_100567037
1563 Ga0070708_101531594
1564 Ga0070663_100016476
1565 Ga0070663_100024595
1566 Ga0070663_100346437
1567 Ga0070663_100819606
1568 Ga0070678_100065037
1569 Ga0070662_100004700
1570 Ga0070662_100027940
1571 Ga0070662_100031533
1572 Ga0070662_100658530
1573 Ga0070681_10000055
1574 Ga0070681_10013007
1575 Ga0070681_10040657
1576 Ga0070681_10050460
1577 Ga0070681_10067150
1578 Ga0070681_10079440
1579 Ga0070681_10349137
1580 Ga0070681_11035074
1581 Ga0068867_100006586
1582 Ga0068867_100018246
1583 Ga0068867_100088181
1584 Ga0068867_100170473
1585 Ga0070685_10013905
1586 Ga0070685_10018810
1587 Ga0070685_10449102
1588 Ga0070706_100000173
1589 Ga0070706_100001295
1590 Ga0070706_100001629
1591 Ga0070706_100012117
1592 Ga0070706_100066056
1593 Ga0070706_100330570
1594 Ga0070706_100373941
1595 Ga0070706_100417314
1596 Ga0070706_100516501
1597 Ga0070707_100000719
1598 Ga0070707_100002543
1599 Ga0070707_100006148
1600 Ga0070707_100017757
1601 Ga0070707_100074860
1602 Ga0070707_100086920
1603 Ga0070707_100090046
1604 Ga0070707_100324535
1605 Ga0070707_100374943
1606 Ga0070707_100463635
1607 Ga0070707_100683554
1608 Ga0070707_100813554
1609 Ga0070698_100000162
1610 Ga0070698_100005121
1611 Ga0070698_100046332
1612 Ga0070698_100284864
1613 Ga0070698_100489974
1614 Ga0070698_101218205
1615 Ga0070699_100002067
1616 Ga0070699_100003692
1617 Ga0070699_100010658
1618 Ga0070699_100056787
1619 Ga0070699_100135777
1620 Ga0070699_100273308
1621 Ga0070699_100276146
1622 Ga0070699_101014370
1623 Ga0070699_101539241
1624 Ga0070679_100043594
1625 Ga0070679_100104117
1626 Ga0070679_100125511
1627 Ga0070679_100129486
1628 Ga0070679_100345679
1629 Ga0070679_100356677
1630 Ga0070679_100473412
1631 Ga0070679_101199890
1632 Ga0070684_100002587
1633 Ga0070684_100006632
1634 Ga0070684_100011364
1635 Ga0070684_100065317
1636 Ga0070684_100100813
1637 Ga0070684_100451397
1638 Ga0070697_100000872
1639 Ga0070697_100001177
1640 Ga0070697_100001505
1641 Ga0070697_100002837
1642 Ga0070697_100004369
1643 Ga0070697_100030681
1644 Ga0070697_100085647
1645 Ga0070697_100127377
1646 Ga0070697_100427397
1647 Ga0070697_101300671
1648 Ga0070697_101911273
1649 Ga0068853_100006282
1650 Ga0068853_100024491
1651 Ga0068853_100026542
1652 Ga0068853_100087705
1653 Ga0068853_100132158
1654 Ga0068853_100201330
1655 Ga0070672_100034848
1656 Ga0070672_100262707
1657 Ga0070672_101357245
1658 Ga0070686_100005128
1659 Ga0070686_100018382
1660 Ga0070695_100147601
1661 Ga0070695_100203508
1662 Ga0070695_100607884
1663 Ga0070695_100811161
1664 Ga0070696_100175780
1665 Ga0070696_100665759
1666 Ga0070696_100674064
1667 Ga0070696_101134960
1668 Ga0070693_100052027
1669 Ga0070693_100098916
1670 Ga0070693_100150163
1671 Ga0070693_100232130
1672 Ga0070693_100255593
1673 Ga0070693_100283876
1674 Ga0070693_100920994
1675 Ga0070693_100950713
1676 Ga0070665_100036861
1677 Ga0070665_100133753
1678 Ga0070704_100596670
1679 Ga0070704_101277702
1680 Ga0070704_101386752
1681 Ga0068855_100002871
1682 Ga0068855_100005054
1683 Ga0068855_100015407
1684 Ga0068855_100018256
1685 Ga0068855_100023648
1686 Ga0068855_100031434
1687 Ga0068855_101969389
1688 Ga0070664_100001796
1689 Ga0070664_100007823
1690 Ga0070664_100008620
1691 Ga0070664_100091253
1692 Ga0070664_100247630
1693 Ga0070664_100359456
1694 Ga0070664_100568069
1695 Ga0068857_100000041
1696 Ga0068857_100002662
1697 Ga0068857_100247182
1698 Ga0068857_102444562
1699 Ga0068854_100003861
1700 Ga0068854_100006005
1701 Ga0068854_100006817
1702 Ga0068854_100009154
1703 Ga0068854_100044808
1704 Ga0068854_101232071
1705 Ga0068856_100000355
1706 Ga0068856_100001245
1707 Ga0068856_100001397
1708 Ga0068856_100004211
1709 Ga0068856_100004843
1710 Ga0068856_100026475
1711 Ga0068856_100032662
1712 Ga0068856_100053439
1713 Ga0068856_100104443
1714 Ga0068856_100273997
1715 Ga0068856_100671620
1716 Ga0070702_100017598
1717 Ga0068852_100021601
1718 Ga0068852_100022927
1719 Ga0068852_100054469
1720 Ga0068852_100342315
1721 Ga0068852_100422722
1722 Ga0068859_100002075
1723 Ga0068859_100022875
1724 Ga0068859_100124359
1725 Ga0068864_100002938
1726 Ga0068864_100036397
1727 Ga0068864_100070542
1728 Ga0068866_10012020
1729 Ga0068866_10012922
1730 Ga0068866_10023270
1731 Ga0068866_10067387
1732 Ga0068866_10650028
1733 Ga0068861_100022258
1734 Ga0068861_100152261
1735 Ga0068861_100245419
1736 Ga0068851_10001990
1737 Ga0068851_10005815
1738 Ga0068870_10001819
1739 Ga0068870_10155454
1740 Ga0068863_100017215
1741 Ga0068863_100024499
1742 Ga0068863_100042876
1743 Ga0068863_100074990
1744 Ga0068863_100120258
1745 Ga0068863_100276668
1746 Ga0068863_100684329
1747 Ga0068863_101697625
1748 Ga0068858_100002616
1749 Ga0068858_100007357
1750 Ga0068858_100025619
1751 Ga0068858_100026311
1752 Ga0068858_100076855
1753 Ga0068858_100115576
1754 Ga0068858_100456882
1755 Ga0068858_100657913
1756 Ga0068860_100007831
1757 Ga0068860_100060146
1758 Ga0068860_100098636
1759 Ga0068860_100102188
1760 Ga0068860_100182762
1761 Ga0068860_100406359
1762 Ga0068860_100584243
1763 Ga0068860_100650321
1764 Ga0068862_100011071
1765 Ga0068862_100043213
1766 Ga0068862_100256123
1767 Ga0081455_10786581
1768 Ga0081540_1044237
1769 Ga0081540_1225570
1770 Ga0070717_10000612
1771 Ga0070717_10000837
1772 Ga0070717_10002552
1773 Ga0070717_10010813
1774 Ga0070717_10017807
1775 Ga0070717_10018682
1776 Ga0070717_10019341
1777 Ga0070717_10022103
1778 Ga0070717_10033939
1779 Ga0070717_10039607
1780 Ga0070717_10070032
1781 Ga0070717_10071148
1782 Ga0070717_10107426
1783 Ga0070717_10116686
1784 Ga0070717_10127189
1785 Ga0070717_10158352
1786 Ga0070717_10279005
1787 Ga0070717_10310993
1788 Ga0070717_10934544
1789 Ga0070715_10036633
1790 Ga0070715_10173929
1791 Ga0070715_10425755
1792 Ga0070716_100000315
1793 Ga0070716_100002728
1794 Ga0070716_100022367
1795 Ga0070716_100045706
1796 Ga0070716_100057722
1797 Ga0070716_100181762
1798 Ga0070716_100192049
1799 Ga0070716_100299177
1800 Ga0070716_100382842
1801 Ga0070716_100478900
1802 Ga0070716_100566176
1803 Ga0070716_100600345
1804 Ga0070716_100618362
1805 Ga0070712_100000957
1806 Ga0070712_100002811
1807 Ga0070712_100005172
1808 Ga0070712_100008543
1809 Ga0070712_100009656
1810 Ga0070712_100021898
1811 Ga0070712_100028726
1812 Ga0070712_100062307
1813 Ga0070712_100104060
1814 Ga0070712_100205175
1815 Ga0070712_100357420
1816 Ga0070712_100376734
1817 Ga0070712_100480477
1818 Ga0070712_100480809
1819 Ga0070712_101070604
1820 Ga0070712_101076198
1821 Ga0070712_101372494
1822 Ga0070712_101937193
1823 Ga0097621_100000533
1824 Ga0097621_100000581
1825 Ga0097621_100002510
1826 Ga0097621_100144578
1827 Ga0097621_100262211
1828 Ga0097621_100300200
1829 Ga0097621_100564685
1830 Ga0097621_100717551
1831 Ga0097621_101038986
1832 Ga0068871_100000664
1833 Ga0068871_100014943
1834 Ga0068871_100015369
1835 Ga0068871_100031751
1836 Ga0068871_100049053
1837 Ga0068871_100060236
1838 Ga0068871_100167412
1839 Ga0068871_100241076
1840 Ga0068871_100743332
1841 Ga0068871_100754639
1842 Ga0068871_101789899
1843 Ga0075434_100002766
1844 Ga0075434_100281638
1845 Ga0068865_100003096
1846 Ga0068865_100023261
1847 Ga0068865_100528660
1848 Ga0068865_100708932
1849 Ga0068865_100930424
1850 Ga0075436_100000526
1851 Ga0075436_100000572
1852 Ga0075436_100001967
1853 Ga0075436_100168229
1854 Ga0075436_100500103
1855 Ga0097620_100002075
1856 Ga0097620_100022875
1857 Ga0097620_100124361
1858 Ga0075435_100000105
1859 Ga0075435_100010275
1860 Ga0075435_100076906
1861 Ga0075435_100099110
1862 Ga0075435_100544363
1863 Ga0075435_100547156
1864 Ga0099794_10194192
1865 Ga0099795_10043645
1866 Ga0105250_10055205
1867 Ga0105250_10120417
1868 Ga0105250_10141585
1869 Ga0105240_10007621
1870 Ga0105240_10013860
1871 Ga0105240_10021427
1872 Ga0105240_10022551
1873 Ga0105240_10025047
1874 Ga0105240_10027526
1875 Ga0105240_10104584
1876 Ga0105240_10113356
1877 Ga0105240_10175573
1878 Ga0105240_10254282
1879 Ga0105240_10715243
1880 Ga0105240_11774798
1881 Ga0105240_11868822
1882 Ga0111539_11130271
1883 Ga0105245_10006495
1884 Ga0105245_10014743
1885 Ga0105245_10063179
1886 Ga0105245_10064487
1887 Ga0105245_10378492
1888 Ga0105247_10001928
1889 Ga0105247_10070177
1890 Ga0105247_10079259
1891 Ga0105247_10339017
1892 Ga0105247_10458712
1893 Ga0105241_10000916
1894 Ga0105241_10003223
1895 Ga0105241_10022387
1896 Ga0105241_10031221
1897 Ga0105241_10323336
1898 Ga0105242_10045809
1899 Ga0105242_10184738
1900 Ga0105242_10254945
1901 Ga0105242_11074846
1902 Ga0105242_13171759
1903 Ga0105248_10095292
1904 Ga0105248_10316778
1905 Ga0105248_10334484
1906 Ga0105248_10371816
1907 Ga0105237_10010811
1908 Ga0105237_10047409
1909 Ga0105237_10061462
1910 Ga0105237_10065472
1911 Ga0105237_10160607
1912 Ga0105237_10200670
1913 Ga0105237_10213745
1914 Ga0105237_10572746
1915 Ga0105237_10601658
1916 Ga0105237_10637221
1917 Ga0105238_10000533
1918 Ga0105238_10005181
1919 Ga0105238_10018190
1920 Ga0105238_10345765
1921 Ga0105238_10622744
1922 Ga0105238_10623030
1923 Ga0105238_10647210
1924 Ga0105249_10002069
1925 Ga0105249_10006862
1926 Ga0105249_10021522
1927 Ga0105249_10217668
1928 Ga0099796_10065184
1929 Ga0105239_10006785
1930 Ga0105239_10007480
1931 Ga0105239_10050561
1932 Ga0105239_10096517
1933 Ga0105239_10112070
1934 Ga0105239_10446777
1935 Ga0105246_10001260
1936 Ga0105246_10016393
1937 Ga0105246_10056385
1938 Ga0105246_10320392
1939 Ga0157373_10000288
1940 Ga0157373_10025303
1941 Ga0157373_10039846
1942 Ga0157373_10057653
1943 Ga0157373_10252112
1944 Ga0157373_11324032
1945 Ga0157371_10004724
1946 Ga0157371_10008279
1947 Ga0157371_10074331
1948 Ga0157370_10010473
1949 Ga0157370_10253785
1950 Ga0157370_10278282
1951 Ga0157370_10884554
1952 Ga0157370_10989186
1953 Ga0157369_10000170
1954 Ga0157369_10012417
1955 Ga0157369_10030994
1956 Ga0157369_10089041
1957 Ga0157369_10100163
1958 Ga0157369_10142571
1959 Ga0157369_10751932
1960 Ga0157369_12368184
1961 Ga0157374_10000316
1962 Ga0157374_10000330
1963 Ga0157374_10000533
1964 Ga0157374_10003747
1965 Ga0157374_10044724
1966 Ga0157374_10093741
1967 Ga0157374_10108158
1968 Ga0157374_10111176
1969 Ga0157374_10895945
1970 Ga0157374_11707748
1971 Ga0157374_12246990
1972 Ga0157378_10000085
1973 Ga0157378_10000182
1974 Ga0157378_10000924
1975 Ga0157378_10025170
1976 Ga0157378_10093762
1977 Ga0157378_10203910
1978 Ga0157378_10229872
1979 Ga0157378_10342086
1980 Ga0157378_10556177
1981 Ga0157378_11295854
1982 Ga0163162_10001077
1983 Ga0163162_10016811
1984 Ga0163162_10051295
1985 Ga0163162_10147284
1986 Ga0163162_10970233
1987 Ga0157372_10000504
1988 Ga0157372_10000620
1989 Ga0157372_10001563
1990 Ga0157372_10002374
1991 Ga0157372_10003529
1992 Ga0157372_10005602
1993 Ga0157372_10006002
1994 Ga0157372_10012821
1995 Ga0157372_10019856
1996 Ga0157372_10027371
1997 Ga0157372_10057292
1998 Ga0157372_10116652
1999 Ga0157372_10131676
2000 Ga0157372_10210955
2001 Ga0157372_10426370
2002 Ga0157372_11316169
2003 Ga0157375_12202760
2004 Ga0157375_13069503
2005 Ga0157375_13605409
2006 Ga0163163_10010337
2007 Ga0163163_10026579
2008 Ga0163163_10097597
2009 Ga0163163_10102847
2010 Ga0163163_10324039
2011 Ga0163163_10414850
2012 Ga0182008_10003217
2013 Ga0182008_10023722
2014 Ga0157377_10003658
2015 Ga0157377_10172352
2016 Ga0157379_10000791
2017 Ga0157379_10023673
2018 Ga0157379_10038649
2019 Ga0157379_10066305
2020 Ga0157379_10255717
2021 Ga0157379_10432937
2022 Ga0157376_10009674
2023 Ga0157376_10064429
2024 Ga0157376_10088762
2025 Ga0157376_10129801
2026 Ga0157376_10538200
2027 Ga0157376_10650055
2028 Ga0157376_10864868
2029 Ga0157376_11936142
2030 Ga0182006_1019129
2031 Ga0182007_10001556
2032 Ga0182007_10022074
2033 Ga0182005_1016896
2034 Ga0163161_10058965
2035 Ga0163161_10494140
2036 Ga0213874_10166228
2037 Ga0213871_10034000
2038 Ga0224570_100090
2039 Ga0224569_102128
2040 Ga0224572_1001260
2041 Ga0224572_1006373
2042 Ga0224572_1050959
2043 Ga0228598_1001197
2044 Ga0228598_1001295
2045 Ga0228598_1003153
2046 Ga0228598_1010611
2047 Ga0207697_10007399
2048 Ga0207656_10270253
2049 Ga0207656_10346402
2050 Ga0207692_10014791
2051 Ga0207692_10021671
2052 Ga0207692_10041283
2053 Ga0207692_10043923
2054 Ga0207692_10044990
2055 Ga0207692_10061411
2056 Ga0207692_10081692
2057 Ga0207692_10527302
2058 Ga0207692_10665267
2059 Ga0207692_10716580
2060 Ga0207642_10009113
2061 Ga0207642_10013622
2062 Ga0207642_10318506
2063 Ga0207710_10002674
2064 Ga0207710_10324250
2065 Ga0207688_10007680
2066 Ga0207680_10094289
2067 Ga0207680_10120604
2068 Ga0207680_10155328
2069 Ga0207647_10006395
2070 Ga0207647_10021548
2071 Ga0207647_10026162
2072 Ga0207647_10038205
2073 Ga0207685_10005599
2074 Ga0207685_10015359
2075 Ga0207685_10047595
2076 Ga0207685_10091752
2077 Ga0207685_10368683
2078 Ga0207685_10374503
2079 Ga0207699_10006949
2080 Ga0207699_10011142
2081 Ga0207699_10014789
2082 Ga0207699_10050376
2083 Ga0207699_10071036
2084 Ga0207699_10092829
2085 Ga0207699_10098615
2086 Ga0207699_10102345
2087 Ga0207699_10123868
2088 Ga0207699_10259783
2089 Ga0207699_10262814
2090 Ga0207699_10474242
2091 Ga0207699_10737767
2092 Ga0207699_11035511
2093 Ga0207699_11057704
2094 Ga0207645_10000181
2095 Ga0207645_10239939
2096 Ga0207643_10000474
2097 Ga0207643_10193945
2098 Ga0207705_10846676
2099 Ga0207705_11029136
2100 Ga0207684_10000217
2101 Ga0207684_10000267
2102 Ga0207684_10006270
2103 Ga0207684_10029324
2104 Ga0207684_10282610
2105 Ga0207684_10322565
2106 Ga0207684_10643037
2107 Ga0207654_10006558
2108 Ga0207654_10007076
2109 Ga0207654_10030891
2110 Ga0207654_10128336
2111 Ga0207654_10147974
2112 Ga0207654_10159214
2113 Ga0207707_10000739
2114 Ga0207707_10093271
2115 Ga0207707_10098070
2116 Ga0207707_10116639
2117 Ga0207707_10125156
2118 Ga0207707_10910238
2119 Ga0207695_10007408
2120 Ga0207695_10022440
2121 Ga0207695_10037646
2122 Ga0207695_10072134
2123 Ga0207695_10075457
2124 Ga0207695_10109531
2125 Ga0207695_10123755
2126 Ga0207695_10372110
2127 Ga0207695_10960423
2128 Ga0207671_10024462
2129 Ga0207671_10030939
2130 Ga0207671_10032741
2131 Ga0207671_10099930
2132 Ga0207671_10138047
2133 Ga0207671_10611092
2134 Ga0207671_11000955
2135 Ga0207693_10000089
2136 Ga0207693_10000106
2137 Ga0207693_10000478
2138 Ga0207693_10002945
2139 Ga0207693_10007165
2140 Ga0207693_10013816
2141 Ga0207693_10026924
2142 Ga0207693_10046217
2143 Ga0207693_10128351
2144 Ga0207693_10133114
2145 Ga0207693_10178348
2146 Ga0207693_10289648
2147 Ga0207693_10834232
2148 Ga0207693_11119766
2149 Ga0207663_10001049
2150 Ga0207663_10005124
2151 Ga0207663_10036016
2152 Ga0207663_10045885
2153 Ga0207663_10050065
2154 Ga0207663_10067326
2155 Ga0207663_10083265
2156 Ga0207663_10101173
2157 Ga0207663_10111144
2158 Ga0207663_10172153
2159 Ga0207663_10307978
2160 Ga0207663_10330244
2161 Ga0207663_10531406
2162 Ga0207663_10767062
2163 Ga0207663_10784502
2164 Ga0207663_10961387
2165 Ga0207663_11166378
2166 Ga0207663_11604146
2167 Ga0207660_10073963
2168 Ga0207660_10080008
2169 Ga0207660_10274268
2170 Ga0207660_10486656
2171 Ga0207662_10005327
2172 Ga0207657_10000535
2173 Ga0207657_10001828
2174 Ga0207657_10002724
2175 Ga0207649_10001639
2176 Ga0207649_10005022
2177 Ga0207649_10008845
2178 Ga0207649_10063863
2179 Ga0207649_10158581
2180 Ga0207652_10052293
2181 Ga0207652_10139606
2182 Ga0207652_10276842
2183 Ga0207652_10402529
2184 Ga0207652_10737636
2185 Ga0207646_10000296
2186 Ga0207646_10001311
2187 Ga0207646_10010514
2188 Ga0207646_10028179
2189 Ga0207646_10046246
2190 Ga0207646_10046789
2191 Ga0207646_10077906
2192 Ga0207646_10231800
2193 Ga0207646_10365106
2194 Ga0207646_10385148
2195 Ga0207646_10667664
2196 Ga0207646_11296974
2197 Ga0207681_10038573
2198 Ga0207681_10076422
2199 Ga0207681_10197599
2200 Ga0207694_10001172
2201 Ga0207694_10029940
2202 Ga0207694_10030975
2203 Ga0207694_10113628
2204 Ga0207650_10000223
2205 Ga0207650_10121450
2206 Ga0207659_10433888
2207 Ga0207687_10003198
2208 Ga0207687_10016635
2209 Ga0207687_10064399
2210 Ga0207687_10252179
2211 Ga0207700_10000289
2212 Ga0207700_10000888
2213 Ga0207700_10001971
2214 Ga0207700_10038958
2215 Ga0207700_10041701
2216 Ga0207700_10064554
2217 Ga0207700_10093084
2218 Ga0207700_10103713
2219 Ga0207700_10136066
2220 Ga0207700_10138557
2221 Ga0207700_10154392
2222 Ga0207700_10188701
2223 Ga0207700_10244351
2224 Ga0207700_10324223
2225 Ga0207700_10353459
2226 Ga0207700_10378154
2227 Ga0207700_10503373
2228 Ga0207700_10616269
2229 Ga0207700_10958648
2230 Ga0207700_11826428
2231 Ga0207664_10000118
2232 Ga0207664_10003882
2233 Ga0207664_10033923
2234 Ga0207664_10041140
2235 Ga0207664_10073025
2236 Ga0207664_10093195
2237 Ga0207664_10136743
2238 Ga0207664_10138640
2239 Ga0207664_10166224
2240 Ga0207664_10177089
2241 Ga0207664_10263335
2242 Ga0207664_10298559
2243 Ga0207664_10367275
2244 Ga0207664_10392115
2245 Ga0207664_10660827
2246 Ga0207664_11027098
2247 Ga0207664_11149802
2248 Ga0207664_11450318
2249 Ga0207664_11509216
2250 Ga0207644_10050252
2251 Ga0207644_10053693
2252 Ga0207644_11608850
2253 Ga0207690_10004009
2254 Ga0207690_10018828
2255 Ga0207690_10047080
2256 Ga0207690_10140491
2257 Ga0207706_10000613
2258 Ga0207706_10000670
2259 Ga0207706_10010049
2260 Ga0207706_10762621
2261 Ga0207686_10038694
2262 Ga0207686_10133109
2263 Ga0207686_10169668
2264 Ga0207686_10180694
2265 Ga0207709_10018165
2266 Ga0207670_10019581
2267 Ga0207670_10291076
2268 Ga0207669_10042896
2269 Ga0207669_10375173
2270 Ga0207704_10047312
2271 Ga0207704_10097235
2272 Ga0207704_10205401
2273 Ga0207665_10001184
2274 Ga0207665_10001526
2275 Ga0207665_10001917
2276 Ga0207665_10007063
2277 Ga0207665_10018476
2278 Ga0207665_10036854
2279 Ga0207665_10051007
2280 Ga0207665_10068713
2281 Ga0207665_10163525
2282 Ga0207665_10187819
2283 Ga0207665_10323754
2284 Ga0207665_10371240
2285 Ga0207665_10512677
2286 Ga0207665_10515676
2287 Ga0207665_10560930
2288 Ga0207665_11054793
2289 Ga0207665_11103812
2290 Ga0207691_10000345
2291 Ga0207691_10206787
2292 Ga0207691_10686022
2293 Ga0207711_10024220
2294 Ga0207711_10031511
2295 Ga0207711_10210624
2296 Ga0207711_10282130
2297 Ga0207689_10000499
2298 Ga0207689_10004722
2299 Ga0207689_10034521
2300 Ga0207689_10056056
2301 Ga0207661_10001212
2302 Ga0207661_10014609
2303 Ga0207661_10246278
2304 Ga0207661_10387609
2305 Ga0207661_10414098
2306 Ga0207679_10000115
2307 Ga0207679_10004660
2308 Ga0207679_10036871
2309 Ga0207679_10043935
2310 Ga0207679_11058595
2311 Ga0207667_10000785
2312 Ga0207667_10003707
2313 Ga0207667_10012312
2314 Ga0207667_10041063
2315 Ga0207667_10057513
2316 Ga0207667_10083773
2317 Ga0207651_10028184
2318 Ga0207651_10043996
2319 Ga0207651_11150338
2320 Ga0207712_10012010
2321 Ga0207712_10064748
2322 Ga0207668_10091740
2323 Ga0207668_10107238
2324 Ga0207640_10004082
2325 Ga0207640_10018685
2326 Ga0207640_10024613
2327 Ga0207640_10025664
2328 Ga0207640_10092094
2329 Ga0207640_10394309
2330 Ga0207640_11103811
2331 Ga0207640_12025149
2332 Ga0207658_10039444
2333 Ga0207677_10002530
2334 Ga0207677_10003252
2335 Ga0207677_10007719
2336 Ga0207677_10019421
2337 Ga0207677_10026550
2338 Ga0207677_10096354
2339 Ga0207703_10004647
2340 Ga0207703_10007943
2341 Ga0207703_10027824
2342 Ga0207703_10119007
2343 Ga0207703_10126739
2344 Ga0207703_10273360
2345 Ga0207639_10015221
2346 Ga0207639_10070409
2347 Ga0207639_10107358
2348 Ga0207639_10320961
2349 Ga0207639_10716238
2350 Ga0207678_10000130
2351 Ga0207678_10001418
2352 Ga0207678_10387169
2353 Ga0207708_10025729
2354 Ga0207702_10000089
2355 Ga0207702_10001792
2356 Ga0207702_10002571
2357 Ga0207702_10011696
2358 Ga0207702_10021538
2359 Ga0207702_10138350
2360 Ga0207702_10150683
2361 Ga0207702_10629975
2362 Ga0207702_10861300
2363 Ga0207641_10000287
2364 Ga0207641_10017583
2365 Ga0207641_10032145
2366 Ga0207641_10083345
2367 Ga0207641_10144071
2368 Ga0207641_10178140
2369 Ga0207641_10260168
2370 Ga0207641_11132900
2371 Ga0207648_10001253
2372 Ga0207648_10007469
2373 Ga0207648_10009512
2374 Ga0207648_10104312
2375 Ga0207676_10000115
2376 Ga0207676_10001385
2377 Ga0207676_10022329
2378 Ga0207676_10098239
2379 Ga0207674_10000309
2380 Ga0207674_10001340
2381 Ga0207674_10005897
2382 Ga0207674_10027037
2383 Ga0207674_10067233
2384 Ga0207674_10411029
2385 Ga0207675_100179691
2386 Ga0207675_101612506
2387 Ga0207683_10000217
2388 Ga0207683_10047570
2389 Ga0207683_10220024
2390 Ga0207683_10460220
2391 Ga0207698_10005557
2392 Ga0207698_10034675
2393 Ga0207698_10086948
2394 Ga0207698_10122828
2395 Ga0207698_10544204
2396 Ga0265356_1000460
2397 Ga0268266_10000761
2398 Ga0268266_10208361
2399 Ga0268265_10040417
2400 Ga0268265_10054561
2401 Ga0268265_10079055
2402 Ga0268265_10271720
2403 Ga0268264_10081808
2404 Ga0268264_10128399
2405 Ga0268264_10185595
2406 Ga0268264_10190056
2407 Ga0268264_10280871
2408 Ga0268264_10371132
2409 Ga0268264_10950407
2410 Ga0268264_11035657
2411 Ga0265338_10006709
2412 Ga0265338_10023713
2413 Ga0265338_10085823
2414 Ga0265338_10099173
2415 Ga0265338_10141362
2416 Ga0265338_10332241
2417 Ga0265338_11009597
2418 Ga0265762_1000555
2419 Ga0265762_1001369
2420 Ga0265762_1001687
2421 Ga0265770_1007389
2422 Ga0265770_1040770
2423 Ga0265770_1066978
2424 Ga0265760_10002193
2425 Ga0265760_10008888
2426 Ga0265760_10018621
2427 Ga0265760_10054506
2428 Ga0265760_10118488
2429 Ga0265760_10141911
2430 Ga0265760_10160093
2431 Ga0265332_10124037
2432 Ga0265328_10010953
2433 Ga0265325_10173829
2434 Ga0265340_10030035
2435 Ga0265340_10039248
2436 Ga0265340_10064085
2437 Ga0265340_10072102
2438 Ga0265340_10079574
2439 Ga0265339_10005007
2440 Ga0265339_10005406
2441 Ga0265339_10057224
2442 Ga0265339_10110504
2443 Ga0265339_10171582
2444 Ga0265316_10002496
2445 Ga0265316_10026402
2446 Ga0265316_10071116
2447 Ga0265316_10505109
2448 Ga0265316_11192118
2449 Ga0307408_100818075
2450 Ga0265314_10002671
2451 Ga0265314_10010032
2452 Ga0265314_10033779
2453 Ga0265342_10040359
2454 Ga0307405_10110461
2455 Ga0307410_10006635
2456 Ga0307410_10291128
2457 Ga0307406_10887178
2458 Ga0307407_10148674
2459 Ga0307412_10044143
2460 Ga0307412_10464530
2461 Ga0307412_10773190
2462 Ga0307412_10866646
2463 Ga0307409_100040606
2464 Ga0307416_100091640
2465 Ga0307414_10384718
2466 Ga0307411_10010176
2467 Ga0307411_11330951
2468 Ga0316212_1008681
2469 Ga0373930_0060732
2470 Ga0373958_0035222
2471 Ga0373938_0013461
2472 Ga0373926_0002011
2473 Ga0373926_0130968
2474 Ga0373926_0230632
2475 Ga0373929_0016269
2476 Ga0373934_0148320
2477 Ga0373940_0169494
2478 Ga0373944_0104907
2479 Ga0373944_0303312
2480 Ga0373952_0010030
2481 Ga0373923_0092910
2482 Ga0373923_0108092
2483 Ga0373923_0372602
2484 Ga0373932_0183595
2485 Ga0373932_0340592
2486 Ga0373932_0364845
2487 Ga0373936_0010711
2488 Ga0373936_0069620
2489 Ga0373936_0084887
2490 Ga0373936_0100838
2491 Ga0373936_0112569
2492 Ga0373936_0126371
2493 Ga0373936_0263468
2494 Ga0373939_0007117
2495 Ga0373939_0079980
2496 Ga0373941_0030121
2497 Ga0373945_0193149
2498 Ga0373945_0279639
2499 Ga0373945_0412959
2500 Ga0373953_0074673
2501 Ga0373954_0187440
2502 Ga0373956_0287152
2503 Ga0373943_0036935
2504 Ga0373943_0064816
2505 Ga0373943_0113914
2506 Ga0373943_0158163
2507 Ga0373943_0158321
2508 Ga0373943_0717124
2509 Ga0373946_0072145
2510 Ga0373946_0095391
2511 Ga0373946_0118343
2512 Ga0373946_0316002
2513 Ga0373955_0039567
2514 Ga0373955_0111391
2515 Ga0373955_0162616
2516 Ga0373955_0262071
2517 Ga0373955_0515418
2518 Ga0373942_0027742
2519 Ga0373962_0316974
2520 Ga0373924_0044436
2521 Ga0373931_0004545
2522 Ga0373931_0041928
2523 Ga0373931_0079597
2524 Ga0373931_0573114
2525 Ga0373931_1076048
2526 Ga0373935_0083839
2527 Ga0373935_0256813
2528 Ga0373935_0285663
2529 Ga0373935_0355477
2530 Ga0373935_0456900
2531 Ga0373935_1316233
2532 Ga0373927_0037883
2533 Ga0373927_0062914
2534 Ga0373927_0100844
2535 Ga0373927_0121129
2536 Ga0373927_0176315
2537 Ga0373927_0235474
2538 Ga0373927_0341556
2539 Ga0373933_0050319
2540 Ga0373933_0136851
2541 Ga0373933_0229637
2542 Ga0373933_0437550
2543 Ga0373933_0872130
2544 Ga0373947_0003282
2545 Ga0373947_0016844
2546 Ga0373947_0066081
2547 Ga0373947_0283724
2548 Ga0373947_0329156
2549 Ga0373947_0363894
2550 Ga0373937_0022486
2551 Ga0373937_0075249
2552 Ga0373937_0075367
2553 Ga0373937_0136990
2554 Ga0373937_0257177
2555 Ga0373937_0384876
2556 Ga0373925_0022151
2557 Ga0373925_0064821
2558 Ga0373925_0160860
2559 Ga0373925_0248800
2560 Ga0373925_0299562
2561 Ga0373925_0434075
2562 Ga0373925_0865301
2563 Ga0373925_1353700
2564 Ga0395900_1021777
2565 Ga0395898_1391984
2566 Ga0395905_0245982
2567 Ga0395905_0318132
2568 Ga0395905_0467630
2569 Ga0436364_0298147
2570 Ga0395901_0538954
2571 Ga0436365_0833051
2572 Ga0436360_0673425
2573 Ga0436360_0967961
2574 Ga0436363_0009640
2575 Ga0436363_0209267
2576 Ga0436363_0284783
2577 Ga0436363_0808254
2578 Ga0436363_0845898
2579 Ga0436362_0381178
2580 Ga0451839_0843721
2581 Ga0451577_1156179
2582 Ga0466961_0319338
2583 Ga0466963_0019363
2584 Ga0466963_0311414
2585 Ga0466964_0139691
2586 Ga0466964_0175058
2587 Ga0453684_0757408
2588 Ga0466968_0207311
2589 Ga0466968_0449759
2590 Ga0466959_0326706
2591 Ga0466959_0406429
2592 Ga0466959_0758399
2593 Ga0466959_0804752
2594 Ga0451576_0095439
2595 Ga0451576_0532981
2596 Ga0451576_1638010
2597 Ga0466967_0006951
2598 Ga0466967_0032212
2599 Ga0466967_0055087
2600 Ga0466967_0241580
2601 Ga0466967_1618604
2602 Ga0466967_2462982
2603 Ga0495603_0113431
2604 Ga0495629_0013250
2605 Ga0495653_0508547
2606 Ga0495653_0605907
2607 Ga0495580_0000031
2608 Ga0495580_0002510
2609 Ga0495580_0003785
2610 Ga0495580_0008038
2611 Ga0495580_0011952
2612 Ga0495580_0012257
2613 Ga0495580_0013423
2614 Ga0495580_0019954
2615 Ga0495580_0042560
2616 Ga0495580_0060755
2617 Ga0495580_0074308
2618 Ga0495580_0121783
2619 Ga0495580_0269184
2620 Ga0495580_0396984
2621 Ga0495580_0438370
2622 Ga0495580_0516691
2623 Ga0495580_0545248
2624 Ga0495580_0603181
2625 Ga0495580_0750577
2626 Ga0495582_0001059
2627 Ga0495582_0010750
2628 Ga0495582_0159874
2629 Ga0495582_0255001
2630 Ga0495639_0062931
2631 Ga0495639_0069115
2632 Ga0495639_0367620
2633 Ga0495662_0172779
2634 Ga0495584_0685658
2635 Ga0495618_0600598
2636 Ga0495630_0273481
2637 Ga0495630_0386677
2638 Ga0495666_0063034
2639 Ga0495666_0204804
2640 Ga0495666_0385087
2641 Ga0495652_0579790
2642 Ga0495665_0025755
2643 Ga0495665_0064771
2644 Ga0495640_0214361
2645 Ga0495640_0245433
2646 Ga0495586_0828540
2647 Ga0495587_0108369
2648 Ga0495645_0153799
2649 Ga0495667_0478810
2650 Ga0495659_0029097
2651 Ga0495657_0692047
2652 Ga0495623_0023471
2653 Ga0495623_0703022
2654 Ga0495658_0744781
2655 Ga0495669_0054259
2656 Ga0495669_0058045
2657 Ga0495613_0126079
2658 Ga0495624_0448279
2659 Ga0495624_0458877
2660 Ga0495624_0535561
2661 Ga0495624_0740002
2662 Ga0495670_0166420
2663 Ga0495649_0352483
2664 Ga0495600_0900233
2665 Ga0495604_0109922
2666 Ga0495604_0437500
2667 Ga0495674_0075852
2668 Ga0495674_0135485
2669 Ga0495674_0137641
2670 Ga0495675_0041145
2671 Ga0495675_0332838
2672 Ga0495684_0216793
2673 Ga0495684_0875416
2674 Ga0495593_0287981
2675 Ga0495602_0043932
2676 Ga0495602_0166686
2677 Ga0495602_0329407
2678 Ga0495602_0820984
2679 Ga0496100_0033637
2680 Ga0496100_0086547
2681 Ga0496100_0101346
2682 Ga0496100_0102743
2683 Ga0496100_0382645
2684 Ga0496101_0175686
2685 Ga0496101_0323270
2686 Ga0496101_1496540
2687 Ga0496102_0001424
2688 Ga0496102_0021406
2689 Ga0496102_0052423
2690 Ga0496102_0078474
2691 Ga0496102_0149569
2692 Ga0496102_0153471
2693 Ga0496102_0183631
2694 Ga0496102_0185835
2695 Ga0496102_0257323
2696 Ga0496102_0280180
2697 Ga0496103_0003887
2698 Ga0496103_0005029
2699 Ga0496103_0048205
2700 Ga0496104_0018664
2701 Ga0496104_0031354
2702 Ga0496104_0075482
2703 Ga0496104_0105810
2704 Ga0496104_0328056
2705 Ga0496104_0336874
2706 Ga0496104_0362288
2707 Ga0496104_0365399
2708 Ga0496104_1143113
2709 Ga0496105_0060287
2710 Ga0496105_0560915
2711 Ga0496106_0014952
2712 Ga0496106_0041788
2713 Ga0496106_0093211
2714 Ga0496106_0332237
2715 Ga0496107_0016408
2716 Ga0496107_0094872
2717 Ga0496107_1174746
2718 Ga0496108_0000325
2719 Ga0496108_0040500
2720 Ga0496108_0322918
2721 Ga0496108_0549062
2722 Ga0496108_0554139
2723 Ga0496109_0000117
2724 Ga0496109_0096787
2725 Ga0496109_0426308
2726 Ga0496109_1053736
2727 Ga0496109_1749891
2728 Ga0496110_0006359
2729 Ga0496110_0025595
2730 Ga0496111_0094258
2731 Ga0496111_0724057
2732 Ga0496112_0000283
2733 Ga0496112_0014557
2734 Ga0496112_0016004
2735 Ga0496112_0021267
2736 Ga0496112_0024757
2737 Ga0496112_0047441
2738 Ga0496112_0050645
2739 Ga0496112_0056839
2740 Ga0496112_0099290
2741 Ga0496112_0119918
2742 Ga0496112_0238847
2743 Ga0496112_0476740
2744 Ga0496113_0007994
2745 Ga0496113_0109867
2746 Ga0496113_0383886
2747 Ga0496113_1315066
2748 Ga0496114_0033551
2749 Ga0496115_0012224
2750 Ga0496115_0031114
2751 Ga0496115_0112581
2752 Ga0496126_0539047
2753 Ga0501290_024838
2754 Ga0501292_045035
2755 Ga0501295_095458
2756 Ga0501297_024373
2757 Ga0501298_002596
2758 Ga0501298_137844
2759 Ga0501299_062524
2760 Ga0501299_125162
2761 Ga0501216_084325
2762 Ga0501222_026356
2763 Ga0501227_200439
2764 Ga0501239_015045
2765 Ga0501247_035382
2766 Ga0501250_008377
2767 Ga0501225_0095308
2768 Ga0501245_138972
2769 Ga0501083_0072867
2770 Ga0501083_0145012
2771 nmdc:mga0n895_102873_c1
2772 nmdc:mga0n895_27328_c1
2773 nmdc:mga0n895_273663_c1
2774 nmdc:mga0rr50_224426_c1
2775 nmdc:mga0rr50_284_c1
2776 nmdc:mga0rr50_292441_c1
2777 nmdc:mga0rr50_542920_c1
2778 nmdc:mga0rr50_84483_c1
2779 nmdc:mga0rr50_8721_c1
2780 nmdc:mga0rr50_91738_c1
2781 nmdc:mga0rr50_995542_c1
2782 nmdc:mga08x19_21264_c1
2783 nmdc:mga08x19_24287_c1
2784 nmdc:mga08x19_448477_c1
2785 nmdc:mga08x19_4593_c1
2786 nmdc:mga08x19_5882_c1
2787 nmdc:mga08x19_83365_c1
2788 nmdc:mga08x19_88067_c1
2789 nmdc:mga0a205_378_c1
2790 Ga0495601_0078108
2791 Ga0495612_0516633
2792 Ga0495612_0572909
2793 Ga0495595_0093703
2794 Ga0495619_0147079
2795 Ga0495619_0220997
2796 Ga0495619_0284660
2797 Ga0500590_254941
2798 Ga0501084_1112720

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

13

123

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9218 11 129
7lz9-assembly1.cif.gz_A inactive form of vanr from s. coelicolor 0.917 11 128
6oec-assembly2.cif.gz_F yeast spc42 trimeric coiled-coil amino acids 181-211 fused to pdb: 3h5i 0.9153 11 129
6oec-assembly2.cif.gz_D yeast spc42 trimeric coiled-coil amino acids 181-211 fused to pdb: 3h5i 0.9143 11 129
6oec-assembly3.cif.gz_H yeast spc42 trimeric coiled-coil amino acids 181-211 fused to pdb: 3h5i 0.9133 11 129
ID Description Score Start End Superfamily
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9519 12 92 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9508 11 92 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9449 12 92 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9439 9 92 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.942 11 92 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V8WKD9-F1-model_v4 Response regulatory domain-containing protein 0.9737 12 132 GO:0000160
AF-A0A321LGX1-F1-model_v4 Response regulatory domain-containing protein 0.9694 11 133 GO:0000160
AF-A0A2V9FQ96-F1-model_v4 Response regulatory domain-containing protein 0.9673 37 132 GO:0000160
AF-A0A2V9VWX1-F1-model_v4 Response regulatory domain-containing protein 0.9604 1 134 GO:0000160
AF-A0A2V9YK45-F1-model_v4 Response regulatory domain-containing protein 0.9447 1 133 GO:0000160

Map