F493651

General Info

Members Datasets Scaffolds Average Seq Length
1398 1076 549 403

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0034154|Ga0496118_0034154_1250_2461
Length 403
Sequence MTIDRRALGFGNSDRAIYAADPWTTRGRLYPENSSPTRSDFQRDRDRIVHTTAFRRLKHKTQVFIAQDGDHYRTRLTHTIEVAQIARALARALKLDEDLAEGVALVHDFGHTPFGHTGEDALHEVLLPYGGFDHNAQSLRIVTKLERRYADFDGINLTWESLEGLVKHNGPLLTKDGTGTRGPQPILDYCEIHDLQLDTFASLEAQVAAIADDIAYNTHDIDDGLRSGYLTFDMLEDIPFLSGLMGEVRERYPTLEPSRFTHEIMRRQITRMVEDVISVAQERLADIRPESADDVRHANRVIATFSQGMAETDRQIKAMLFKRIYRHPDIMRIRSGAAQIVTDLFSAYMANPKEMQSHYWVDHIAGLAEAPKARHVGDYLAGMTDTYAISAHRRLFDQTPDLR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
17 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
18 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
33 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
34 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
35 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
36 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
37 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
38 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
39 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
40 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
41 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
42 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
43 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
44 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
45 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
46 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
47 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
48 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
49 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
50 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
51 2516143018 Ensifer sp. BR816 Isolate Nodule
52 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
53 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
54 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
55 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
56 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
57 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
58 2519899620 Rhizobium sp. Pop5 Isolate Nodule
59 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
60 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
61 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
62 2534681786 Brucella suis 92/29 Isolate Unclassified
63 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
64 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
65 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
66 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
67 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
68 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
69 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
70 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
71 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
72 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
73 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
74 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
75 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
76 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
77 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
78 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
79 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
80 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
81 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
82 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
83 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
84 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
85 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
86 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
87 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
88 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
89 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
90 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
91 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
92 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
93 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
94 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
95 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
96 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
97 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
98 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
99 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
100 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
101 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
102 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
103 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
104 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
105 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
106 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
107 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
108 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
109 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
110 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
111 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
112 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
113 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
114 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
115 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
116 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
117 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
118 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
119 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
120 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
121 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
122 2643221557 Ensifer sp. Root558 Isolate Unclassified
123 2643221558 Rhizobium sp. Root149 Isolate Unclassified
124 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
125 2643221568 Rhizobium sp. Root564 Isolate Unclassified
126 2643221582 Rhizobium sp. Root651 Isolate Unclassified
127 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
128 2643221599 Rhizobium sp. Root708 Isolate Unclassified
129 2643221607 Rhizobium sp. Root73 Isolate Unclassified
130 2643221610 Ensifer sp. Root74 Isolate Unclassified
131 2643221618 Ensifer sp. Root231 Isolate Unclassified
132 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
133 2643221626 Ensifer sp. Root31 Isolate Unclassified
134 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
135 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
136 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
137 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
138 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
139 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
140 2643221655 Ensifer sp. Root1252 Isolate Unclassified
141 2643221659 Ensifer sp. Root127 Isolate Unclassified
142 2643221668 Ensifer sp. Root423 Isolate Unclassified
143 2643221675 Ensifer sp. Root1298 Isolate Unclassified
144 2643221680 Ensifer sp. Root1312 Isolate Unclassified
145 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
146 2643221688 Rhizobium sp. Root482 Isolate Unclassified
147 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
148 2643221693 Rhizobium sp. Root491 Isolate Unclassified
149 2643221698 Ensifer sp. Root142 Isolate Unclassified
150 2643221712 Ensifer sp. Root258 Isolate Unclassified
151 2643221718 Rhizobium sp. Root268 Isolate Unclassified
152 2643221719 Rhizobium sp. Root274 Isolate Unclassified
153 2643221723 Ensifer sp. Root278 Isolate Unclassified
154 2643221726 Ensifer sp. Root954 Isolate Unclassified
155 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
156 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
157 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
158 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
159 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
160 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
161 2718217882 Rhizobium sp. N741 Isolate Nodule
162 2718217927 Rhizobium sp. N324 Isolate Nodule
163 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
164 2718218009 Rhizobium sp. N561 Isolate Nodule
165 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
166 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
167 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
168 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
169 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
170 2718218363 Rhizobium sp. N113 Isolate Nodule
171 2718218365 Rhizobium sp. N731 Isolate Nodule
172 2718218366 Rhizobium sp. N621 Isolate Nodule
173 2718218423 Rhizobium sp. N941 Isolate Nodule
174 2721755514 Rhizobium sp. N6212 Isolate Nodule
175 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
176 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
177 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
178 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
179 2721755809 Rhizobium sp. N541 Isolate Nodule
180 2721755810 Rhizobium sp. N871 Isolate Nodule
181 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
182 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
183 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
184 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
185 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
186 2728369365 Rhizobium sp. N1341 Isolate Nodule
187 2728369397 Rhizobium sp. N1314 Isolate Nodule
188 2738541293 Rhizobium sp. GV031 Isolate Unclassified
189 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
190 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
191 2738543024 Aminobacter sp. AP02 Isolate Unclassified
192 2751185800 Brucella pituitosa AA2 Isolate Unclassified
193 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
194 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
195 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
196 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
197 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
198 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
199 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
200 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
201 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
202 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
203 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
204 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
205 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
206 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
207 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
208 2791355256 Rhizobium sp. M10 Isolate Nodule
209 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
210 2791355260 Rhizobium sp. L9 Isolate Nodule
211 2791355261 Rhizobium sp. J15 Isolate Nodule
212 2791355262 Rhizobium sp. M1 Isolate Nodule
213 2791355263 Rhizobium chutanense C5 Isolate Nodule
214 2791355264 Rhizobium sp. S9 Isolate Nodule
215 2791355265 Rhizobium sp. H4 Isolate Nodule
216 2791355266 Rhizobium sp. L43 Isolate Nodule
217 2791355267 Rhizobium sp. L18 Isolate Nodule
218 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
219 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
220 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
221 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
222 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
223 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
224 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
225 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
226 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
227 2802429633 Rhizobium anhuiense J3 Isolate Nodule
228 2802429634 Rhizobium anhuiense S10 Isolate Nodule
229 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
230 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
231 2802429637 Rhizobium anhuiense C15 Isolate Nodule
232 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
233 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
234 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
235 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
236 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
237 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
238 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
239 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
240 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
241 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
242 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
243 2838048938 Rhizobium pisi 27/80 Isolate Nodule
244 2838061910 Rhizobium phaseoli L15 Isolate Nodule
245 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
246 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
247 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
248 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
249 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
250 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
251 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
252 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
253 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
254 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
255 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
256 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
257 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
258 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
259 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
260 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
261 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
262 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
263 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
264 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
265 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
266 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
267 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
268 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
269 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
270 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
271 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
272 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
273 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
274 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
275 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
276 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
277 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
278 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
279 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
280 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
281 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
282 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
283 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
284 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
285 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
286 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
287 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
288 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
289 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
290 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
291 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
292 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
293 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
294 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
295 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
296 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
297 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
298 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
299 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
300 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
301 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
302 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
303 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
304 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
305 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
306 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
307 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
308 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
309 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
310 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
311 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
312 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
313 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
314 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
315 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
316 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
317 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
318 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
319 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
320 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
321 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
322 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
323 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
324 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
325 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
326 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
327 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
328 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
329 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
330 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
331 2844163670 Ensifer sp. 1H6 Isolate Unclassified
332 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
333 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
334 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
335 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
336 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
337 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
338 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
339 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
340 2854911287 Brucella lupini LUP21 Isolate Unclassified
341 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
342 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
343 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
344 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
345 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
346 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
347 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
348 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
349 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
350 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
351 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
352 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
353 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
354 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
355 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
356 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
357 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
358 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
359 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
360 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
361 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
362 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
363 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
364 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
365 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
366 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
367 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
368 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
369 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
370 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
371 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
372 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
373 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
374 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
375 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
376 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
377 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
378 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
379 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
380 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
381 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
382 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
383 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
384 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
385 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
386 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
387 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
388 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
389 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
390 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
391 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
392 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
393 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
394 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
395 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
396 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
397 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
398 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
399 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
400 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
401 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
402 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
403 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
404 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
405 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
406 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
407 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
408 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
409 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
410 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
411 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
412 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
413 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
414 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
415 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
416 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
417 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
418 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
419 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
420 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
421 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
422 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
423 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
424 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
425 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
426 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
427 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
428 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
429 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
430 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
431 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
432 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
433 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
434 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
435 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
436 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
437 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
438 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
439 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
440 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
441 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
442 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
443 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
444 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
445 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
446 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
447 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
448 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
449 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
450 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
451 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
452 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
453 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
454 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
455 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
456 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
457 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
458 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
459 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
460 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
461 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
462 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
463 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
464 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
465 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
466 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
467 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
468 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
469 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
470 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
471 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
472 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
473 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
474 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
475 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
476 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
477 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
478 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
479 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
480 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
481 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
482 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
483 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
484 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
485 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
486 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
487 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
488 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
489 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
490 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
491 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
492 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
493 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
494 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
495 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
496 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
497 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
498 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
499 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
500 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
501 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
502 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
503 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
504 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
505 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
506 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
507 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
508 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
509 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
510 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
511 2933599457 Rhizobium phaseoli M3 Isolate Nodule
512 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
513 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
514 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
515 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
516 2936381700 Rhizobium chutanense C16 Isolate Unclassified
517 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
518 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
519 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
520 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
521 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
522 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
523 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
524 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
525 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
526 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
527 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
528 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
529 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
530 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
531 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
532 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
533 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
534 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
535 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
536 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
537 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
538 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
539 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
540 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
541 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
542 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
543 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
544 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
545 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
546 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
547 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
548 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
549 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
550 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
551 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
552 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
553 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
554 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
555 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
556 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
557 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
558 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
559 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
560 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
561 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
562 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
563 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
564 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
565 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
566 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
567 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
568 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
569 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
570 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
571 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
572 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
573 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
574 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
575 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
576 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
577 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
578 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
579 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
580 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
581 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
582 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
583 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
584 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
585 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
586 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
587 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
588 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
589 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
590 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
591 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
592 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
593 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
594 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
595 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
596 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
597 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
598 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
599 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
600 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
601 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
602 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
603 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
604 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
605 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
606 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
607 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
608 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
609 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
610 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
611 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
612 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
613 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
614 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
615 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
616 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
617 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
618 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
619 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
620 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
621 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
622 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
623 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
624 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
625 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
626 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
627 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
628 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
629 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
630 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
631 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
632 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
633 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
634 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
635 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
636 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
637 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
638 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
639 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
640 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
641 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
642 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
643 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
644 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
645 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
646 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
647 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
648 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
649 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
650 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
651 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
652 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
653 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
654 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
655 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
656 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
657 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
658 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
659 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
660 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
661 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
662 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
663 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
664 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
665 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
666 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
667 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
668 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
669 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
670 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
671 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
672 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
673 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
674 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
675 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
676 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
677 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
678 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
679 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
680 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
681 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
682 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
683 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
684 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
685 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
686 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
687 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
688 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
689 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
690 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
691 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
692 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
693 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
694 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
695 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
696 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
697 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
698 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
699 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
700 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
701 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
702 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
703 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
704 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
705 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
706 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
707 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
708 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
709 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
710 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
711 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
712 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
713 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
714 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
715 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
716 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
717 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
718 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
719 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
720 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
721 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
722 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
723 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
724 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
725 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
726 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
727 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
728 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
729 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
730 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
731 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
732 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
733 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
734 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
735 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
736 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
737 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
738 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
739 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
740 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
741 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
742 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
743 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
744 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
745 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
746 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
747 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
748 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
749 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
750 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
751 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
752 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
753 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
754 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
755 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
756 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
757 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
758 2996887358 Rhizobium sp. R711 Isolate Nodule
759 2996893221 Rhizobium sp. R635 Isolate Nodule
760 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
761 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
762 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
763 3004167301 Mesorhizobium loti 582 Isolate Unclassified
764 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
765 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
766 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
767 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
768 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
769 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
770 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
771 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
772 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
773 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
774 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
775 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
776 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
777 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
778 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
779 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
780 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
781 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
782 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
783 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
784 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
785 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
786 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
787 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
788 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
789 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
790 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
791 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
792 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
793 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
794 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
795 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
796 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
797 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
798 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
799 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
800 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
801 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
802 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
803 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
804 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
805 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
806 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
807 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
808 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
809 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
810 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
811 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
812 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
813 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
814 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
815 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
816 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
817 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
818 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
819 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
820 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
821 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
822 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
823 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
824 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
825 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
826 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
827 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
828 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
829 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
830 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
831 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
832 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
833 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
834 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
835 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
836 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
837 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
838 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
839 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
840 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
841 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
842 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
843 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
844 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
845 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
846 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
847 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
848 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
849 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
850 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
851 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
852 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
853 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
854 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
855 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
856 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
857 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
858 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
859 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
860 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
861 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
862 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
863 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
864 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
865 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
866 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
867 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
868 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
869 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
870 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
871 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
872 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
873 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
874 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
875 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
876 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
877 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
878 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
879 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
880 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
881 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
882 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
883 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
884 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
885 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
886 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
887 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
888 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
889 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
890 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
891 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
892 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
893 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
894 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
895 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
896 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
897 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
898 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
899 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
900 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
901 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
902 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
903 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
904 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
905 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
906 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
907 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
908 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
909 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
910 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
911 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
912 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
913 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
914 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
915 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
916 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
917 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
918 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
919 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
920 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
921 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
922 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
923 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
924 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
925 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
926 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
927 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
928 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
929 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
930 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
931 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
932 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
933 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
934 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
935 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
936 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
937 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
938 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
939 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
940 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
941 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
942 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
943 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
944 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
945 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
946 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
947 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
948 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
949 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
950 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
951 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
952 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
953 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
954 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
955 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
956 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
957 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
958 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
959 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
960 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
961 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
962 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
963 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
964 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
965 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
966 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
967 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
968 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
969 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
970 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
971 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
972 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
973 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
974 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
975 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
976 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
977 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
978 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
979 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
980 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
981 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
982 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
983 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
984 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
985 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
986 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
987 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
988 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
989 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
990 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
991 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
992 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
993 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
994 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
995 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
996 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
997 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
998 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
999 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1000 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1001 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1002 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1003 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1004 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1005 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1006 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1007 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1008 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1009 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1010 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1011 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1012 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1013 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1014 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1015 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1016 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1017 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1018 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1019 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1020 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1021 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1022 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1023 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1024 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1025 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1026 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1027 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1028 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1029 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1030 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1031 8005258706 Rhizobium sp. R693 Isolate Nodule
1032 8005275841 Rhizobium sp. N4311 Isolate Nodule
1033 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1034 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1035 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1036 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1037 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1038 8005321885 Rhizobium sp. R72 Isolate Nodule
1039 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1040 8005382845 Rhizobium sp. R634 Isolate Nodule
1041 8005395548 Rhizobium sp. R339 Isolate Nodule
1042 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1043 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1044 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1045 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1046 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1047 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1048 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1049 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1050 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1051 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1052 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1053 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1054 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1055 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1056 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1057 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1058 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1059 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1060 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1061 8018176218 Rhizobium sp. N122 Isolate Nodule
1062 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1063 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1064 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1065 8024501048 Rhizobium sp. H4 Isolate Nodule
1066 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1067 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1068 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1069 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1070 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1071 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1072 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1073 8056382006 Rhizobium croatiense 13T Isolate Nodule
1074 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1075 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1076 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.27
Metatranscriptomes 0
Isolates 60.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 15.16
Nodule 47.07
Rhizoplane 1.57
Rhizosphere 19.53
Stem 0
Stem Tuber 0
Unclassified 16.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000001 3300001979 Bacteria 168537
2 JGI24740J21852_10007318 3300001979 Bacteria 4497
3 JGI24740J21852_10010983 3300001979 Bacteria 3462
4 JGI25155J39150_1000011 3300002704 Bacteria 207685
5 JGI25156J39149_1000027 3300002705 Bacteria 127396
6 JGI25156J39149_1001896 3300002705 Bacteria 8143
7 JGI25162J39368_1000963 3300002737 Bacteria 18339
8 JGI25162J39368_1002413 3300002737 Bacteria 7323
9 JGI25154J39366_1000181 3300002738 Bacteria 49117
10 JGI25158J39367_1000135 3300002739 Bacteria 17270
11 JGI25158J39367_1000975 3300002739 Bacteria 5264
12 JGI25157J39369_1000010 3300002741 Bacteria 207685
13 JGI25157J39369_1001076 3300002741 Bacteria 12316
14 JGI25152J39213_1000534 3300002773 Bacteria 21021
15 JGI25152J39213_1000545 3300002773 Bacteria 20722
16 JGI25152J39213_1003397 3300002773 Bacteria 5454
17 JGI25152J39213_1004376 3300002773 Bacteria 4465
18 JGI25152J39213_1012822 3300002773 Bacteria 1776
19 JGI25152J39213_1012828 3300002773 Bacteria 1776
20 JGI25150J39212_1000047 3300002774 Bacteria 75103
21 JGI25150J39212_1000380 3300002774 Bacteria 21273
22 JGI25150J39212_1002361 3300002774 Bacteria 4738
23 JGI25159J45721_1000006 3300002987 Bacteria 188201
24 JGI25159J45721_1001165 3300002987 Bacteria 11213
25 JGI25159J45721_1002092 3300002987 Bacteria 7840
26 JGI25151J46595_10000126 3300003187 Bacteria 103193
27 JGI25151J46595_10011907 3300003187 Bacteria 3977
28 JGI25165J46597_1000062 3300003214 Bacteria 206459
29 JGI25165J46597_1000900 3300003214 Bacteria 20669
30 JGI25165J46597_1000920 3300003214 Bacteria 20377
31 JGI25165J46597_1001027 3300003214 Bacteria 18335
32 JGI25153J46596_10001078 3300003215 Bacteria 16640
33 JGI25153J46596_10007194 3300003215 Bacteria 5517
34 JGI25153J46596_10031675 3300003215 Bacteria 1776
35 JGI25153J46596_10031676 3300003215 Bacteria 1776
36 JGI25153J46596_10033910 3300003215 Bacteria 1677
37 rootL2_10018543 3300003322 Bacteria 7640
38 rootH1_10019945 3300003323 Bacteria 1750
39 JGI25160J50197_1000004 3300003354 Bacteria 419797
40 JGI25160J50197_1000019 3300003354 Bacteria 233980
41 JGI25160J50197_1000664 3300003354 Bacteria 19152
42 JGI25160J50197_1008485 3300003354 Bacteria 3910
43 JGI25160J50197_1012480 3300003354 Bacteria 2945
44 JGI25161J50226_1000003 3300003374 Bacteria 413345
45 JGI25161J50226_1000467 3300003374 Bacteria 18513
46 JGI25161J50226_1000680 3300003374 Bacteria 13469
47 JGI25161J50226_1000904 3300003374 Bacteria 10676
48 Ga0055542_1001237 3300003762 Bacteria 14181
49 Ga0055526_1000462 3300003771 Bacteria 32312
50 Ga0055526_1001096 3300003771 Bacteria 19688
51 Ga0055526_1003315 3300003771 Bacteria 10309
52 Ga0055526_1008997 3300003771 Bacteria 4884
53 Ga0055524_1001178 3300003775 Bacteria 15594
54 Ga0055524_1002226 3300003775 Bacteria 10159
55 Ga0055524_1003918 3300003775 Bacteria 7052
56 Ga0055536_1002723 3300003781 Bacteria 9796
57 Ga0055528_1000051 3300003790 Bacteria 91974
58 Ga0055528_1000448 3300003790 Bacteria 32948
59 Ga0055528_1006972 3300003790 Bacteria 5058
60 Ga0055528_1007775 3300003790 Bacteria 4690
61 Ga0055540_1002665 3300003792 Bacteria 9227
62 Ga0055531_10002882 3300003794 Bacteria 11201
63 Ga0055531_10003417 3300003794 Bacteria 10139
64 Ga0058692_1002873 3300003856 Bacteria 5604
65 Ga0058692_1004482 3300003856 Bacteria 4131
66 Ga0055543_1000001 3300004625 Bacteria 419949
67 Ga0055543_1000275 3300004625 Bacteria 38327
68 Ga0055543_1000867 3300004625 Bacteria 14523
69 Ga0055543_1000935 3300004625 Bacteria 13507
70 Ga0065165_1000149 3300005262 Bacteria 122370
71 Ga0065165_1000272 3300005262 Bacteria 88086
72 Ga0065165_1001907 3300005262 Bacteria 19958
73 Ga0065165_1008226 3300005262 Bacteria 4938
74 Ga0070670_100056538 3300005331 Bacteria 3367
75 Ga0070660_100136645 3300005339 Bacteria 1964
76 Ga0070671_100043803 3300005355 Bacteria 3719
77 Ga0070667_100159462 3300005367 Bacteria 1986
78 Ga0070663_100010806 3300005455 Bacteria 5702
79 Ga0070665_100025262 3300005548 Bacteria 5986
80 Ga0070665_100040711 3300005548 Bacteria 4670
81 Ga0070665_100044244 3300005548 Bacteria 4471
82 Ga0068856_100196996 3300005614 Bacteria 2028
83 Ga0075365_10001830 3300006038 Bacteria 9956
84 Ga0075365_10022285 3300006038 Bacteria 3967
85 Ga0075365_10035815 3300006038 Bacteria 3213
86 Ga0075365_10052238 3300006038 Bacteria 2702
87 Ga0075363_100012575 3300006048 Bacteria 4084
88 Ga0075363_100020583 3300006048 Bacteria 3310
89 Ga0075363_100106348 3300006048 Bacteria 1556
90 Ga0075364_10001918 3300006051 Bacteria 11579
91 Ga0075364_10035513 3300006051 Bacteria 3221
92 Ga0075362_10000297 3300006177 Bacteria 14109
93 Ga0075362_10052629 3300006177 Bacteria 1825
94 Ga0075367_10006256 3300006178 Bacteria 6000
95 Ga0075367_10105249 3300006178 Bacteria 1728
96 Ga0075369_10000735 3300006186 Bacteria 10608
97 Ga0075369_10008326 3300006186 Bacteria 3987
98 Ga0075369_10040288 3300006186 Bacteria 1996
99 Ga0075366_10010376 3300006195 Bacteria 5229
100 Ga0075366_10015206 3300006195 Bacteria 4407
101 Ga0075370_10014017 3300006353 Bacteria 4269
102 Ga0075370_10028124 3300006353 Bacteria 3124
103 Ga0075370_10085274 3300006353 Bacteria 1818
104 Ga0079104_1000129 3300006946 Bacteria 108427
105 Ga0079104_1010900 3300006946 Bacteria 2956
106 Ga0099826_10002926 3300006948 Bacteria 11342
107 Ga0105240_10000005 3300009093 Bacteria 702630
108 Ga0105240_10047849 3300009093 Bacteria 5408
109 Ga0105248_10279957 3300009177 Bacteria 1878
110 Ga0105237_10001991 3300009545 Bacteria 25984
111 Ga0105237_10045855 3300009545 Bacteria 4399
112 Ga0105238_10004648 3300009551 Bacteria 13589
113 Ga0105249_10042443 3300009553 Bacteria 4136
114 Ga0123341_1000001 3300009765 Bacteria 314908
115 Ga0123342_1021352 3300009766 Bacteria 4559
116 Ga0123342_1023582 3300009766 Bacteria 3969
117 Ga0105239_10003100 3300010375 Bacteria 20616
118 Ga0105239_10471607 3300010375 Bacteria 1425
119 Ga0157373_10005196 3300013100 Bacteria 9780
120 Ga0157371_10000015 3300013102 Bacteria 339838
121 Ga0157370_10000309 3300013104 Bacteria 61167
122 Ga0157370_10000665 3300013104 Bacteria 42812
123 Ga0171463_1011 3300013249 Bacteria 230603
124 Ga0183363_1143 3300015690 Bacteria 17948
125 Ga0214544_1000024 3300021320 Bacteria 163562
126 Ga0214542_1000015 3300021321 Bacteria 227912
127 Ga0214542_1026484 3300021321 Bacteria 2825
128 Ga0214543_1000011 3300021327 Bacteria 344093
129 Ga0214543_1000064 3300021327 Bacteria 126778
130 Ga0228711_1000528 3300022739 Bacteria 47804
131 Ga0228710_1000006 3300022740 Bacteria 209134
132 Ga0209435_100022 3300025206 Bacteria 207766
133 Ga0209760_102358 3300025207 Bacteria 1776
134 Ga0209436_100039 3300025208 Bacteria 75732
135 Ga0209436_100390 3300025208 Bacteria 19835
136 Ga0209436_109217 3300025208 Bacteria 1901
137 Ga0209672_101326 3300025228 Bacteria 9432
138 Ga0209563_104361 3300025230 Bacteria 2719
139 Ga0209437_100153 3300025233 Bacteria 154068
140 Ga0209437_100201 3300025233 Bacteria 119080
141 Ga0207425_1000010 3300025245 Bacteria 572898
142 Ga0207425_1001043 3300025245 Bacteria 12850
143 Ga0207425_1006562 3300025245 Bacteria 3168
144 Ga0207425_1008343 3300025245 Bacteria 2659
145 Ga0207425_1011258 3300025245 Bacteria 2141
146 Ga0207425_1020406 3300025245 Bacteria 1417
147 Ga0209646_1000078 3300025246 Bacteria 207766
148 Ga0209026_1000024 3300025250 Bacteria 355839
149 Ga0209026_1000065 3300025250 Bacteria 207766
150 Ga0209677_101154 3300025253 Bacteria 12276
151 Ga0209148_1000050 3300025254 Bacteria 413178
152 Ga0209759_1000055 3300025256 Bacteria 207766
153 Ga0209759_1000389 3300025256 Bacteria 54772
154 Ga0209129_1000034 3300025258 Bacteria 330950
155 Ga0209129_1000140 3300025258 Bacteria 122574
156 Ga0209129_1000470 3300025258 Bacteria 29594
157 Ga0209129_1000947 3300025258 Bacteria 17460
158 Ga0209129_1001001 3300025258 Bacteria 16842
159 Ga0209129_1002822 3300025258 Bacteria 8060
160 Ga0209129_1003476 3300025258 Bacteria 6823
161 Ga0209233_1000129 3300025261 Bacteria 206511
162 Ga0209233_1000175 3300025261 Bacteria 144221
163 Ga0209233_1000226 3300025261 Bacteria 103045
164 Ga0209233_1000248 3300025261 Bacteria 87812
165 Ga0209455_1000183 3300025272 Bacteria 99952
166 Ga0209673_1000068 3300025273 Bacteria 245891
167 Ga0209673_1000230 3300025273 Bacteria 109505
168 Ga0209673_1001478 3300025273 Bacteria 22012
169 Ga0209673_1002170 3300025273 Bacteria 14508
170 Ga0209673_1003247 3300025273 Bacteria 9822
171 Ga0209673_1005149 3300025273 Bacteria 6689
172 Ga0209673_1009980 3300025273 Bacteria 4048
173 Ga0209673_1024873 3300025273 Bacteria 2002
174 Ga0209130_1000006 3300025284 Bacteria 596528
175 Ga0209130_1000007 3300025284 Bacteria 591584
176 Ga0209130_1000012 3300025284 Bacteria 421329
177 Ga0209676_1002948 3300025292 Bacteria 11110
178 Ga0209025_1000022 3300025294 Bacteria 574487
179 Ga0209025_1000033 3300025294 Bacteria 414511
180 Ga0209025_1000097 3300025294 Bacteria 236632
181 Ga0209025_1000702 3300025294 Bacteria 57061
182 Ga0209025_1005300 3300025294 Bacteria 10589
183 Ga0209025_1007667 3300025294 Bacteria 7972
184 Ga0209025_1011412 3300025294 Bacteria 5858
185 Ga0209025_1013526 3300025294 Bacteria 5119
186 Ga0209025_1020919 3300025294 Bacteria 3549
187 Ga0209025_1058870 3300025294 Bacteria 1455
188 Ga0209564_1000137 3300025295 Bacteria 183874
189 Ga0209564_1000373 3300025295 Bacteria 82785
190 Ga0209564_1000740 3300025295 Bacteria 46349
191 Ga0209564_1001522 3300025295 Bacteria 23049
192 Ga0209564_1007164 3300025295 Bacteria 5815
193 Ga0209758_1000080 3300025297 Bacteria 261472
194 Ga0209758_1000520 3300025297 Bacteria 61722
195 Ga0209758_1000633 3300025297 Bacteria 53969
196 Ga0209758_1000822 3300025297 Bacteria 43449
197 Ga0209758_1001240 3300025297 Bacteria 31770
198 Ga0209758_1001887 3300025297 Bacteria 22869
199 Ga0209758_1005650 3300025297 Bacteria 9476
200 Ga0209758_1019549 3300025297 Bacteria 3260
201 Ga0209758_1025829 3300025297 Bacteria 2564
202 Ga0209050_1004383 3300025298 Bacteria 9579
203 Ga0209050_1011067 3300025298 Bacteria 4338
204 Ga0209256_1000319 3300025299 Bacteria 82827
205 Ga0209256_1001551 3300025299 Bacteria 22876
206 Ga0209256_1001710 3300025299 Bacteria 21107
207 Ga0209256_1001971 3300025299 Bacteria 18502
208 Ga0209256_1002545 3300025299 Bacteria 14596
209 Ga0209256_1009788 3300025299 Bacteria 4132
210 Ga0207426_1000003 3300025302 Bacteria 1063212
211 Ga0207426_1000010 3300025302 Bacteria 796003
212 Ga0207426_1000094 3300025302 Bacteria 275293
213 Ga0207426_1000111 3300025302 Bacteria 234032
214 Ga0207426_1000853 3300025302 Bacteria 32038
215 Ga0209051_1000166 3300025303 Bacteria 120265
216 Ga0209051_1003640 3300025303 Bacteria 9983
217 Ga0209051_1011805 3300025303 Bacteria 4278
218 Ga0209051_1039818 3300025303 Bacteria 1692
219 Ga0209051_1043535 3300025303 Bacteria 1574
220 Ga0209257_1001307 3300025304 Bacteria 30337
221 Ga0209257_1003894 3300025304 Bacteria 12172
222 Ga0209257_1005270 3300025304 Bacteria 9217
223 Ga0209257_1026675 3300025304 Bacteria 1940
224 Ga0207680_10068849 3300025903 Bacteria 2185
225 Ga0207647_10056612 3300025904 Bacteria 2405
226 Ga0207705_10037788 3300025909 Bacteria 3455
227 Ga0207695_10000011 3300025913 Bacteria 910221
228 Ga0207695_10060785 3300025913 Bacteria 3908
229 Ga0207671_10000276 3300025914 Bacteria 76490
230 Ga0207671_10084009 3300025914 Bacteria 2391
231 Ga0207694_10018118 3300025924 Bacteria 5324
232 Ga0207650_10065133 3300025925 Bacteria 2730
233 Ga0207644_10051817 3300025931 Bacteria 2947
234 Ga0207667_10227130 3300025949 Bacteria 1912
235 Ga0207668_10125634 3300025972 Bacteria 1950
236 Ga0207640_10060572 3300025981 Bacteria 2503
237 Ga0207678_10076269 3300026067 Bacteria 2871
238 Ga0207678_10138722 3300026067 Bacteria 2075
239 Ga0207698_10110899 3300026142 Bacteria 2299
240 Ga0207698_10274067 3300026142 Bacteria 1557
241 Ga0209281_1000036 3300027111 Bacteria 369415
242 Ga0209281_1000047 3300027111 Bacteria 326514
243 Ga0209281_1000268 3300027111 Bacteria 100508
244 Ga0209281_1000578 3300027111 Bacteria 43096
245 Ga0209371_1000178 3300027312 Bacteria 93894
246 Ga0209371_1000382 3300027312 Bacteria 47344
247 Ga0209371_1001444 3300027312 Bacteria 16135
248 Ga0209371_1002027 3300027312 Bacteria 12116
249 Ga0209282_1000026 3300027666 Bacteria 166272
250 Ga0209282_1000095 3300027666 Bacteria 60099
251 Ga0209813_10005272 3300027866 Bacteria 3129
252 Ga0209813_10031440 3300027866 Bacteria 1567
253 Ga0268266_10025145 3300028379 Bacteria 5068
254 Ga0268266_10030382 3300028379 Bacteria 4590
255 Ga0268266_10170832 3300028379 Bacteria 1973
256 Ga0307515_10000274 3300028794 Bacteria 126011
257 Ga0307515_10000656 3300028794 Bacteria 79816
258 Ga0307515_10036369 3300028794 Bacteria 7967
259 Ga0307515_10040065 3300028794 Bacteria 7420
260 Ga0268256_1000837 3300030500 Bacteria 21879
261 Ga0268256_1002533 3300030500 Bacteria 9201
262 Ga0307513_10003280 3300031456 Bacteria 22033
263 Ga0307513_10010898 3300031456 Bacteria 11355
264 Ga0307408_100025176 3300031548 Bacteria 4073
265 Ga0307408_100032605 3300031548 Bacteria 3633
266 Ga0307405_10002526 3300031731 Bacteria 8099
267 Ga0307405_10193754 3300031731 Bacteria 1470
268 Ga0307406_10058516 3300031901 Bacteria 2477
269 Ga0307412_10002014 3300031911 Bacteria 11279
270 Ga0315914_1000008 3300031967 Bacteria 209133
271 Ga0315913_1000137 3300033430 Bacteria 47802
272 Ga0315915_1000014 3300033464 Bacteria 171068
273 Ga0373927_0002192 3300035695 Bacteria 14352
274 Ga0373925_0016473 3300037068 Bacteria 5355
275 Ga0395899_0203361 3300037312 Bacteria 1380
276 Ga0395898_0043866 3300037466 Bacteria 4406
277 Ga0395905_0000700 3300037471 Bacteria 44432
278 Ga0395905_0093994 3300037471 Bacteria 2812
279 Ga0395905_0164691 3300037471 Bacteria 2083
280 Ga0395901_0080673 3300038443 Bacteria 3398
281 Ga0439436_0028385 3300041404 Bacteria 1633
282 Ga0439439_0021574 3300041406 Bacteria 1605
283 Ga0439465_0004501 3300041413 Bacteria 4508
284 Ga0439465_0016694 3300041413 Bacteria 2290
285 Ga0451787_319395 3300041441 Bacteria 3711
286 Ga0451798_0610660 3300041458 Bacteria 2916
287 Ga0451839_0405469 3300041496 Bacteria 3198
288 Ga0451845_0331327 3300041501 Bacteria 1973
289 Ga0451843_0429565 3300041509 Bacteria 3247
290 Ga0439449_0015080 3300042007 Bacteria 2904
291 Ga0439449_0037976 3300042007 Bacteria 1791
292 Ga0466965_0076334 3300044683 Bacteria 1691
293 Ga0466966_0097048 3300044684 Bacteria 1825
294 Ga0466970_0004213 3300044765 Bacteria 7078
295 Ga0466957_0111140 3300044842 Bacteria 1738
296 Ga0495629_0039145 3300046459 Bacteria 3337
297 Ga0495638_0000687 3300046460 Bacteria 36753
298 Ga0495638_0010851 3300046460 Bacteria 6299
299 Ga0495651_0043436 3300046462 Bacteria 3488
300 Ga0495650_0048953 3300046471 Bacteria 1758
301 Ga0495605_0000460 3300046474 Bacteria 36596
302 Ga0495585_0011038 3300046492 Bacteria 5364
303 Ga0495585_0046508 3300046492 Bacteria 2420
304 Ga0495583_0013238 3300046506 Bacteria 4614
305 Ga0495606_0000959 3300046507 Bacteria 42315
306 Ga0495606_0077124 3300046507 Bacteria 2081
307 Ga0495610_0007814 3300046512 Bacteria 7044
308 Ga0495616_0055894 3300046513 Bacteria 1952
309 Ga0495620_0036350 3300046515 Bacteria 2205
310 Ga0495628_0045009 3300046516 Bacteria 3510
311 Ga0495631_0013261 3300046518 Bacteria 4004
312 Ga0495632_0002325 3300046519 Bacteria 14631
313 Ga0495632_0066771 3300046519 Bacteria 1735
314 Ga0495643_0006856 3300046522 Bacteria 7423
315 Ga0495643_0030079 3300046522 Bacteria 3035
316 Ga0495643_0031760 3300046522 Bacteria 2936
317 Ga0495643_0061730 3300046522 Bacteria 1986
318 Ga0495652_0066969 3300046529 Bacteria 3012
319 Ga0495654_0001209 3300046530 Bacteria 18382
320 Ga0495633_0020647 3300046558 Bacteria 3309
321 Ga0495668_0005947 3300046616 Bacteria 8104
322 Ga0495625_0010879 3300046660 Bacteria 7477
323 Ga0495625_0039680 3300046660 Bacteria 3437
324 Ga0495588_0001225 3300046674 Bacteria 11061
325 Ga0495657_0041037 3300046675 Bacteria 3170
326 Ga0495649_0052616 3300046694 Bacteria 2206
327 Ga0495660_0030040 3300046810 Bacteria 3063
328 Ga0495660_0056170 3300046810 Bacteria 2128
329 Ga0495672_0034276 3300047320 Bacteria 3138
330 Ga0495681_0042887 3300047470 Bacteria 2186
331 Ga0495686_0000989 3300047472 Bacteria 34642
332 Ga0495686_0019154 3300047472 Bacteria 4577
333 Ga0495686_0047323 3300047472 Bacteria 2716
334 Ga0495686_0089945 3300047472 Bacteria 1865
335 Ga0495626_0058288 3300048091 Bacteria 1765
336 Ga0496100_0074167 3300048903 Bacteria 2279
337 Ga0496102_0094757 3300048905 Bacteria 2766
338 Ga0496103_0005774 3300048906 Bacteria 7388
339 Ga0496106_0007752 3300048909 Bacteria 7946
340 Ga0496106_0208759 3300048909 Bacteria 1555
341 Ga0496107_0114642 3300048910 Bacteria 1983
342 Ga0496109_0172328 3300048912 Bacteria 2031
343 Ga0496111_0186323 3300048914 Bacteria 1543
344 Ga0496114_0156867 3300048917 Bacteria 1977
345 Ga0496116_0000061 3300048919 Bacteria 271860
346 Ga0496116_0003692 3300048919 Bacteria 14987
347 Ga0496116_0011986 3300048919 Bacteria 7119
348 Ga0496116_0013279 3300048919 Bacteria 6658
349 Ga0496116_0045233 3300048919 Bacteria 2982
350 Ga0496117_0000002 3300048920 Bacteria 2483758
351 Ga0496117_0001684 3300048920 Bacteria 30795
352 Ga0496117_0013916 3300048920 Bacteria 6974
353 Ga0496117_0031949 3300048920 Bacteria 4010
354 Ga0496117_0078894 3300048920 Bacteria 2171
355 Ga0496117_0094613 3300048920 Bacteria 1912
356 Ga0496118_0000460 3300048921 Bacteria 67445
357 Ga0496118_0000756 3300048921 Bacteria 52299
358 Ga0496118_0004327 3300048921 Bacteria 16930
359 Ga0496118_0034154 3300048921 Bacteria 4156
360 Ga0496118_0044985 3300048921 Bacteria 3451
361 Ga0496119_0009961 3300048922 Bacteria 8058
362 Ga0496119_0012100 3300048922 Bacteria 7048
363 Ga0496119_0021313 3300048922 Bacteria 4689
364 Ga0496119_0037445 3300048922 Bacteria 3150
365 Ga0496119_0055707 3300048922 Bacteria 2400
366 Ga0496120_0000078 3300048923 Bacteria 162312
367 Ga0496120_0001824 3300048923 Bacteria 23801
368 Ga0496120_0005495 3300048923 Bacteria 10088
369 Ga0496120_0010777 3300048923 Bacteria 6336
370 Ga0496121_0000001 3300048924 Bacteria 1830318
371 Ga0496121_0000182 3300048924 Bacteria 139638
372 Ga0496121_0001247 3300048924 Bacteria 44170
373 Ga0496121_0010224 3300048924 Bacteria 10622
374 Ga0496121_0029857 3300048924 Bacteria 5023
375 Ga0496121_0216017 3300048924 Bacteria 1354
376 Ga0496122_0000001 3300048925 Bacteria 1827766
377 Ga0496122_0000179 3300048925 Bacteria 149332
378 Ga0496122_0004590 3300048925 Bacteria 17003
379 Ga0496122_0012559 3300048925 Bacteria 8410
380 Ga0496122_0013836 3300048925 Bacteria 7856
381 Ga0496122_0031709 3300048925 Bacteria 4389
382 Ga0496122_0037942 3300048925 Bacteria 3868
383 Ga0496122_0044491 3300048925 Bacteria 3463
384 Ga0496122_0045680 3300048925 Bacteria 3401
385 Ga0496123_0000001 3300048926 Bacteria 1831497
386 Ga0496123_0000768 3300048926 Bacteria 51899
387 Ga0496123_0007000 3300048926 Bacteria 10753
388 Ga0496123_0012058 3300048926 Bacteria 7411
389 Ga0496123_0012459 3300048926 Bacteria 7248
390 Ga0496123_0056256 3300048926 Bacteria 2573
391 Ga0496123_0095531 3300048926 Bacteria 1748
392 Ga0496124_0000112 3300048927 Bacteria 166282
393 Ga0496124_0008314 3300048927 Bacteria 10861
394 Ga0496124_0012622 3300048927 Bacteria 8315
395 Ga0496124_0015634 3300048927 Bacteria 7264
396 Ga0496124_0024327 3300048927 Bacteria 5511
397 Ga0496124_0028108 3300048927 Bacteria 5034
398 Ga0496124_0029389 3300048927 Bacteria 4899
399 Ga0496124_0070150 3300048927 Bacteria 2908
400 Ga0496124_0122494 3300048927 Bacteria 2076
401 Ga0496124_0194511 3300048927 Bacteria 1548
402 Ga0496124_0208734 3300048927 Bacteria 1479
403 Ga0496125_0000001 3300048928 Bacteria 1766138
404 Ga0496125_0004146 3300048928 Bacteria 16908
405 Ga0496125_0015487 3300048928 Bacteria 7370
406 Ga0496125_0040643 3300048928 Bacteria 3986
407 Ga0496125_0097657 3300048928 Bacteria 2176
408 Ga0496126_0000397 3300048929 Bacteria 89305
409 Ga0496126_0045426 3300048929 Bacteria 4037
410 Ga0496126_0052378 3300048929 Bacteria 3710
411 Ga0496126_0054169 3300048929 Bacteria 3635
412 Ga0496126_0099260 3300048929 Bacteria 2550
413 Ga0496126_0185095 3300048929 Bacteria 1766
414 Ga0496126_0344350 3300048929 Bacteria 1220
415 Ga0496126_0347699 3300048929 Bacteria 1213
416 Ga0501031_0010302 3300049568 Bacteria 6089
417 Ga0501031_0068405 3300049568 Bacteria 2313
418 Ga0501032_0000133 3300049569 Bacteria 60434
419 Ga0501032_0000201 3300049569 Bacteria 49742
420 Ga0501032_0020787 3300049569 Bacteria 4569
421 Ga0501032_0026712 3300049569 Bacteria 3968
422 Ga0501033_0000121 3300049570 Bacteria 75242
423 Ga0501033_0000132 3300049570 Bacteria 72558
424 Ga0501033_0000201 3300049570 Bacteria 57158
425 Ga0501033_0003702 3300049570 Bacteria 12434
426 Ga0501033_0027898 3300049570 Bacteria 4243
427 Ga0501033_0039171 3300049570 Bacteria 3541
428 Ga0501033_0050652 3300049570 Bacteria 3079
429 Ga0501034_0000005 3300049571 Bacteria 367512
430 Ga0501034_0000064 3300049571 Bacteria 189461
431 Ga0501034_0029087 3300049571 Bacteria 5618
432 Ga0501034_0048119 3300049571 Bacteria 4303
433 Ga0501034_0058508 3300049571 Bacteria 3874
434 Ga0501034_0153522 3300049571 Bacteria 2277
435 Ga0501034_0198266 3300049571 Bacteria 1966
436 Ga0501034_0200040 3300049571 Bacteria 1956
437 Ga0501036_0000005 3300049572 Bacteria 246420
438 Ga0501036_0000084 3300049572 Bacteria 58568
439 Ga0501037_0000045 3300049573 Bacteria 117148
440 Ga0501037_0000148 3300049573 Bacteria 65185
441 Ga0501037_0000753 3300049573 Bacteria 24482
442 Ga0501037_0052335 3300049573 Bacteria 2987
443 Ga0501037_0054337 3300049573 Bacteria 2929
444 Ga0501037_0158277 3300049573 Bacteria 1616
445 Ga0501038_0000001 3300049574 Bacteria 375481
446 Ga0501038_0000443 3300049574 Bacteria 36113
447 Ga0501038_0071949 3300049574 Bacteria 2932
448 Ga0501038_0167685 3300049574 Bacteria 1780
449 Ga0501038_0180847 3300049574 Bacteria 1701
450 Ga0501039_0000007 3300049575 Bacteria 277831
451 Ga0501039_0000103 3300049575 Bacteria 57916
452 Ga0501040_0076234 3300049576 Bacteria 2318
453 Ga0501042_0019271 3300049578 Bacteria 4735
454 Ga0501043_0000031 3300049579 Bacteria 140707
455 Ga0501043_0001143 3300049579 Bacteria 23350
456 Ga0501043_0003831 3300049579 Bacteria 12371
457 Ga0501043_0039104 3300049579 Bacteria 3729
458 Ga0501043_0107789 3300049579 Bacteria 2188
459 Ga0501043_0166819 3300049579 Bacteria 1719
460 Ga0501046_0021155 3300049580 Bacteria 5372
461 Ga0501046_0134546 3300049580 Bacteria 1873
462 Ga0501047_0029467 3300049581 Bacteria 5291
463 Ga0501047_0038552 3300049581 Bacteria 4623
464 Ga0501047_0042680 3300049581 Bacteria 4382
465 Ga0501047_0130942 3300049581 Bacteria 2389
466 Ga0501047_0144146 3300049581 Bacteria 2260
467 Ga0501047_0242965 3300049581 Bacteria 1650
468 Ga0501048_0031346 3300049582 Bacteria 3845
469 Ga0501069_0000362 3300049585 Bacteria 20433
470 Ga0501069_0035239 3300049585 Bacteria 2756
471 Ga0501070_0001857 3300049586 Bacteria 18639
472 Ga0501070_0014344 3300049586 Bacteria 6669
473 Ga0501070_0018593 3300049586 Bacteria 5829
474 Ga0501070_0024134 3300049586 Bacteria 5099
475 Ga0501070_0115186 3300049586 Bacteria 2220
476 Ga0501070_0163009 3300049586 Bacteria 1838
477 Ga0501071_0060948 3300049587 Bacteria 2732
478 Ga0501073_0006987 3300049589 Bacteria 8409
479 Ga0501073_0012864 3300049589 Bacteria 6100
480 Ga0501073_0039895 3300049589 Bacteria 3325
481 Ga0501074_0002910 3300049590 Bacteria 12017
482 Ga0501074_0108661 3300049590 Bacteria 1985
483 Ga0501080_0006230 3300049742 Bacteria 10704
484 Ga0501080_0054526 3300049742 Bacteria 3722
485 Ga0501080_0123188 3300049742 Bacteria 2402
486 Ga0501083_0001104 3300049744 Bacteria 18056
487 Ga0501083_0121982 3300049744 Bacteria 1709
488 Ga0501035_0000008 3300049822 Bacteria 313425
489 Ga0501035_0000036 3300049822 Bacteria 165008
490 Ga0501035_0000105 3300049822 Bacteria 104877
491 Ga0501035_0003084 3300049822 Bacteria 16000
492 Ga0501035_0003178 3300049822 Bacteria 15755
493 Ga0501035_0005364 3300049822 Bacteria 12122
494 Ga0501035_0029020 3300049822 Bacteria 5046
495 Ga0501035_0099670 3300049822 Bacteria 2550
496 Ga0501044_0000001 3300049823 Bacteria 418087
497 Ga0501044_0000011 3300049823 Bacteria 257385
498 Ga0501044_0003123 3300049823 Bacteria 18777
499 Ga0501044_0004154 3300049823 Bacteria 16266
500 Ga0501044_0017912 3300049823 Bacteria 7596
501 Ga0501044_0020059 3300049823 Bacteria 7137
502 Ga0501044_0050351 3300049823 Bacteria 4298
503 Ga0501044_0254640 3300049823 Bacteria 1695
504 Ga0501045_0016743 3300049824 Bacteria 5207
505 nmdc:mga03683_10679_c1 3300050489 Bacteria 3299
506 nmdc:mga03683_903_c1 3300050489 Bacteria 8535
507 nmdc:mga00v17_222_c2 3300050491 Bacteria 26927
508 nmdc:mga00v17_80_c1 3300050491 Bacteria 58183
509 nmdc:mga0yw44_1395_c1 3300050492 Bacteria 9576
510 nmdc:mga0yw44_6407_c1 3300050492 Bacteria 5685
511 nmdc:mga0yw44_69639_c1 3300050492 Bacteria 2180
512 nmdc:mga0k408_12079_c1 3300050493 Bacteria 4716
513 nmdc:mga07m45_6227_c1 3300050496 Bacteria 6025
514 nmdc:mga0sz30_20665_c1 3300050516 Bacteria 2657
515 nmdc:mga0sz30_27106_c1 3300050516 Bacteria 2352
516 nmdc:mga0sz30_8434_c1 3300050516 Bacteria 3893
517 Ga0495655_0008142 3300053083 Bacteria 1980
518 Ga0500578_0181128 3300053086 Bacteria 1298
519 Ga0500572_003721 3300053111 Bacteria 3460
520 Ga0500594_0000647 3300053118 Bacteria 7433
521 Ga0500608_021456 3300053122 Bacteria 2985
522 Ga0500618_000510 3300053125 Bacteria 24654
523 Ga0500618_000871 3300053125 Bacteria 16116
524 Ga0500618_004612 3300053125 Bacteria 4346
525 Ga0500618_020318 3300053125 Bacteria 1627
526 Ga0500658_0001748 3300053134 Bacteria 8573
527 Ga0500658_0008813 3300053134 Bacteria 3723
528 Ga0500658_0083936 3300053134 Bacteria 1367
529 Ga0500561_0000062 3300053137 Bacteria 21493
530 Ga0500568_0000212 3300053139 Bacteria 50122
531 Ga0500568_0001356 3300053139 Bacteria 15924
532 Ga0500568_0004459 3300053139 Bacteria 7476
533 Ga0500568_0041443 3300053139 Bacteria 1850
534 Ga0500573_0003702 3300053140 Bacteria 7954
535 Ga0500590_014477 3300053148 Bacteria 4066
536 Ga0500604_0019893 3300053151 Bacteria 1884
537 Ga0500616_0000647 3300053153 Bacteria 41713
538 Ga0500616_0005012 3300053153 Bacteria 9176
539 Ga0500616_0032687 3300053153 Bacteria 2843
540 Ga0500622_0000158 3300053156 Bacteria 71215
541 Ga0500622_0000178 3300053156 Bacteria 69024
542 Ga0500624_000357 3300053157 Bacteria 14815
543 Ga0500627_0004905 3300053158 Bacteria 4371
544 Ga0500627_0056350 3300053158 Bacteria 1722
545 Ga0500634_0001576 3300053161 Bacteria 8977
546 Ga0500634_0054472 3300053161 Bacteria 2143
547 Ga0500636_0000019 3300053177 Bacteria 105042
548 Ga0500636_0001577 3300053177 Bacteria 12406
549 Ga0501082_0035934 3300060353 Bacteria 4270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0216017 Ga0496121_0216017_80_1186 368
2 iso_pu_bacteria 2984537506 2984541058 370
3 3300049568 Ga0501031_0010302 Ga0501031_0010302_2686_3897 375
4 3300049569 Ga0501032_0000133 Ga0501032_0000133_29595_30806 375
5 3300049570 Ga0501033_0000121 Ga0501033_0000121_7685_8896 375
6 3300049571 Ga0501034_0000064 Ga0501034_0000064_28545_29756 375
7 3300049572 Ga0501036_0000084 Ga0501036_0000084_28545_29756 375
8 3300049573 Ga0501037_0000148 Ga0501037_0000148_29595_30806 375
9 3300049574 Ga0501038_0000443 Ga0501038_0000443_6358_7569 375
10 3300049575 Ga0501039_0000103 Ga0501039_0000103_28161_29372 375
11 3300049579 Ga0501043_0001143 Ga0501043_0001143_18646_19857 375
12 3300049580 Ga0501046_0021155 Ga0501046_0021155_3677_4888 375
13 3300049581 Ga0501047_0144146 Ga0501047_0144146_348_1559 375
14 3300049822 Ga0501035_0000105 Ga0501035_0000105_75139_76350 375
15 3300049823 Ga0501044_0003123 Ga0501044_0003123_6295_7506 375
16 iso_pu_bacteria 2965110997 2965115138 380
17 3300049571 Ga0501034_0029087 Ga0501034_0029087_69_1304 382
18 3300053158 Ga0500627_0056350 Ga0500627_0056350_393_1616 382
19 iso_pu_bacteria 2903513507 2903514017 383
20 iso_pu_bacteria 2987673487 2987677423 384
21 3300048927 Ga0496124_0194511 Ga0496124_0194511_48_1217 389
22 3300048929 Ga0496126_0344350 Ga0496126_0344350_37_1206 389
23 3300048929 Ga0496126_0347699 Ga0496126_0347699_30_1199 389
24 3300049574 Ga0501038_0071949 Ga0501038_0071949_53_1243 393
25 3300027312 Ga0209371_1002027 Ga0209371_100202711 394
26 iso_pu_bacteria 2791355262 2793335228 394
27 iso_pu_bacteria 2965102966 2965110347 394
28 iso_pu_bacteria 8004361976 8004368072 394
29 3300003856 Ga0058692_1002873 Ga0058692_10028731 395
30 3300025294 Ga0209025_1000702 Ga0209025_100070218 395
31 3300027312 Ga0209371_1000178 Ga0209371_100017822 395
32 3300030500 Ga0268256_1000837 Ga0268256_10008374 395
33 iso_pu_bacteria 2906363423 2906369806 395
34 3300048925 Ga0496122_0000179 Ga0496122_0000179_133729_134946 396
35 3300048926 Ga0496123_0000768 Ga0496123_0000768_36296_37513 396
36 3300048927 Ga0496124_0028108 Ga0496124_0028108_3133_4350 396
37 iso_pu_bacteria 2765235802 2765465061 396
38 3300006178 Ga0075367_10006256 Ga0075367_100062563 398
39 3300025245 Ga0207425_1008343 Ga0207425_10083433 398
40 3300025258 Ga0209129_1000140 Ga0209129_100014086 398
41 3300025273 Ga0209673_1000068 Ga0209673_100006861 398
42 3300025294 Ga0209025_1005300 Ga0209025_10053009 398
43 3300025294 Ga0209025_1020919 Ga0209025_10209191 398
44 3300025295 Ga0209564_1000137 Ga0209564_1000137232 398
45 3300025299 Ga0209256_1001710 Ga0209256_100171027 398
46 3300025299 Ga0209256_1001971 Ga0209256_100197110 398
47 3300025303 Ga0209051_1043535 Ga0209051_10435352 398
48 iso_pu_bacteria 2511231027 2511391416 398
49 iso_pu_bacteria 2534681786 2535484609 398
50 iso_pu_bacteria 2767802442 2770198228 398
51 iso_pu_bacteria 2775506902 2776271166 398
52 iso_pu_bacteria 2775506904 2776280837 398
53 iso_pu_bacteria 2839993093 2839994999 398
54 iso_pu_bacteria 2840764183 2840767888 398
55 iso_pu_bacteria 2842871566 2842872404 398
56 iso_pu_bacteria 2854911287 2854915213 398
57 iso_pu_bacteria 2894652903 2894656442 398
58 iso_pu_bacteria 2904578770 2904581045 398
59 iso_pu_bacteria 2915650412 2915651705 398
60 iso_pu_bacteria 2919119836 2919121162 398
61 iso_pu_bacteria 2928521798 2928523504 398
62 iso_pu_bacteria 2954011201 2954015785 398
63 iso_pu_bacteria 3002141150 3002144157 398
64 iso_pu_bacteria 2643221637 2644210999 399
65 iso_pu_bacteria 2508501123 2509115571 400
66 iso_pu_bacteria 2508501127 2509141746 400
67 iso_pu_bacteria 2509276018 2509371189 400
68 iso_pu_bacteria 2509276022 2509396680 400
69 iso_pu_bacteria 2510065059 2510313847 400
70 iso_pu_bacteria 2512875016 2512931094 400
71 iso_pu_bacteria 2512875024 2512958811 400
72 iso_pu_bacteria 2513237164 2514037633 400
73 iso_pu_bacteria 2513237305 2514420262 400
74 iso_pu_bacteria 2513237351 2514590331 400
75 iso_pu_bacteria 2588253730 2588516853 400
76 iso_pu_bacteria 2597489875 2597814269 400
77 iso_pu_bacteria 2643221595 2643989204 400
78 iso_pu_bacteria 2643221627 2644152776 400
79 iso_pu_bacteria 2687453392 2688598832 400
80 iso_pu_bacteria 2721755686 2723575778 400
81 iso_pu_bacteria 2756170246 2756675719 400
82 iso_pu_bacteria 2791355123 2792749726 400
83 iso_pu_bacteria 2844002411 2844006226 400
84 iso_pu_bacteria 2844009547 2844014173 400
85 iso_pu_bacteria 2856320880 2856325646 400
86 iso_pu_bacteria 2856328259 2856331523 400
87 iso_pu_bacteria 2856334872 2856339024 400
88 iso_pu_bacteria 2856342000 2856342968 400
89 iso_pu_bacteria 2857367948 2857371978 400
90 iso_pu_bacteria 2869162929 2869169118 400
91 iso_pu_bacteria 2869242130 2869247414 400
92 iso_pu_bacteria 2869249662 2869250841 400
93 iso_pu_bacteria 2869256925 2869262088 400
94 iso_pu_bacteria 2869264136 2869271127 400
95 iso_pu_bacteria 2869271264 2869272303 400
96 iso_pu_bacteria 2869278585 2869279268 400
97 iso_pu_bacteria 2871451962 2871452830 400
98 iso_pu_bacteria 2871459585 2871462822 400
99 iso_pu_bacteria 2871481445 2871485309 400
100 iso_pu_bacteria 2874109183 2874115479 400
101 iso_pu_bacteria 2874116593 2874118873 400
102 iso_pu_bacteria 2874123672 2874130798 400
103 iso_pu_bacteria 2874139085 2874145015 400
104 iso_pu_bacteria 2874162495 2874166308 400
105 iso_pu_bacteria 2874168670 2874174385 400
106 iso_pu_bacteria 2876363079 2876365650 400
107 iso_pu_bacteria 2876386047 2876388537 400
108 iso_pu_bacteria 2876399893 2876406071 400
109 iso_pu_bacteria 2876406927 2876411231 400
110 iso_pu_bacteria 2878738818 2878745652 400
111 iso_pu_bacteria 2885312484 2885317566 400
112 iso_pu_bacteria 2888343758 2888347260 400
113 iso_pu_bacteria 2903448605 2903455437 400
114 iso_pu_bacteria 2903521522 2903523579 400
115 iso_pu_bacteria 2903528002 2903534213 400
116 iso_pu_bacteria 2906370794 2906372344 400
117 iso_pu_bacteria 2906386501 2906388444 400
118 iso_pu_bacteria 2906393657 2906394685 400
119 iso_pu_bacteria 2906401398 2906406573 400
120 iso_pu_bacteria 2906408224 2906412950 400
121 iso_pu_bacteria 2906427513 2906427706 400
122 iso_pu_bacteria 2922151315 2922154623 400
123 iso_pu_bacteria 2922172374 2922176032 400
124 iso_pu_bacteria 2924733363 2924739320 400
125 iso_pu_bacteria 2924748358 2924752729 400
126 iso_pu_bacteria 2924762789 2924766819 400
127 iso_pu_bacteria 2924776078 2924783896 400
128 iso_pu_bacteria 2937822353 2937824896 400
129 iso_pu_bacteria 2937836603 2937837993 400
130 iso_pu_bacteria 2937848649 2937855078 400
131 iso_pu_bacteria 2937861824 2937862385 400
132 iso_pu_bacteria 2937868953 2937869933 400
133 iso_pu_bacteria 2937877337 2937877427 400
134 iso_pu_bacteria 2937972304 2937975467 400
135 iso_pu_bacteria 2937980651 2937986689 400
136 iso_pu_bacteria 2958034702 2958035409 400
137 iso_pu_bacteria 2958041894 2958043596 400
138 iso_pu_bacteria 2958064165 2958067814 400
139 iso_pu_bacteria 2958071322 2958072667 400
140 iso_pu_bacteria 2958084443 2958084533 400
141 iso_pu_bacteria 2958092219 2958093186 400
142 iso_pu_bacteria 2958108152 2958112047 400
143 iso_pu_bacteria 2958122699 2958129660 400
144 iso_pu_bacteria 2958144490 2958148682 400
145 iso_pu_bacteria 2961136820 2961140870 400
146 iso_pu_bacteria 2961183825 2961190173 400
147 iso_pu_bacteria 2963644680 2963648125 400
148 iso_pu_bacteria 2965025482 2965026583 400
149 iso_pu_bacteria 2965032056 2965037212 400
150 iso_pu_bacteria 2965040258 2965042073 400
151 iso_pu_bacteria 2965047637 2965049626 400
152 iso_pu_bacteria 2965089291 2965089313 400
153 iso_pu_bacteria 2968016561 2968018044 400
154 iso_pu_bacteria 2968083720 2968090947 400
155 iso_pu_bacteria 2968138860 2968145905 400
156 iso_pu_bacteria 2970469710 2970471781 400
157 iso_pu_bacteria 2970489779 2970495736 400
158 iso_pu_bacteria 2970510686 2970512857 400
159 iso_pu_bacteria 2970524798 2970530747 400
160 iso_pu_bacteria 2970532167 2970538313 400
161 iso_pu_bacteria 2970540015 2970543599 400
162 iso_pu_bacteria 2970547951 2970552697 400
163 iso_pu_bacteria 2970593180 2970593864 400
164 iso_pu_bacteria 2970619444 2970620728 400
165 iso_pu_bacteria 2977851361 2977856940 400
166 iso_pu_bacteria 2977872689 2977875622 400
167 iso_pu_bacteria 2977915119 2977922521 400
168 iso_pu_bacteria 2977922695 2977929253 400
169 iso_pu_bacteria 2977935797 2977940726 400
170 iso_pu_bacteria 2977950692 2977955176 400
171 iso_pu_bacteria 2977957713 2977963753 400
172 iso_pu_bacteria 2977986579 2977987909 400
173 iso_pu_bacteria 2979764755 2979768391 400
174 iso_pu_bacteria 2979772303 2979774557 400
175 iso_pu_bacteria 2979793036 2979793617 400
176 iso_pu_bacteria 2987645492 2987645502 400
177 iso_pu_bacteria 2987666974 2987668839 400
178 iso_pu_bacteria 2996310559 2996312280 400
179 iso_pu_bacteria 2996348954 2996350565 400
180 iso_pu_bacteria 2996386984 2996389297 400
181 iso_pu_bacteria 3000135777 3000140172 400
182 iso_pu_bacteria 3004167301 3004169329 400
183 iso_pu_bacteria 3004195979 3004203099 400
184 iso_pu_bacteria 3004211236 3004211891 400
185 iso_pu_bacteria 3004218560 3004219138 400
186 iso_pu_bacteria 3004248173 3004253323 400
187 iso_pu_bacteria 3004268573 3004268931 400
188 iso_pu_bacteria 3004275668 3004277263 400
189 iso_pu_bacteria 3004334049 3004341282 400
190 iso_pu_bacteria 637000159 637074197 400
191 iso_pu_bacteria 649633066 649873348 400
192 iso_pu_bacteria 8004300914 8004301175 400
193 iso_pu_bacteria 8004312739 8004312816 400
194 iso_pu_bacteria 8004395343 8004403072 400
195 iso_pu_bacteria 8004727605 8004730344 400
196 iso_pu_bacteria 8055617313 8055621314 400
197 iso_pu_bacteria 2508501122 2509107803 401
198 iso_pu_bacteria 2509276019 2509376200 401
199 iso_pu_bacteria 2509276021 2509387287 401
200 iso_pu_bacteria 2509276033 2509442687 401
201 iso_pu_bacteria 2510065019 2510132768 401
202 iso_pu_bacteria 2510065057 2510306265 401
203 iso_pu_bacteria 2510461069 2510841791 401
204 iso_pu_bacteria 2510461076 2510894054 401
205 iso_pu_bacteria 2510461076 2510899079 401
206 iso_pu_bacteria 2510917026 2511170400 401
207 iso_pu_bacteria 2510917028 2511181961 401
208 iso_pu_bacteria 2510917030 2511195076 401
209 iso_pu_bacteria 2511231052 2511501436 401
210 iso_pu_bacteria 2512047086 2512532857 401
211 iso_pu_bacteria 2512875026 2512971815 401
212 iso_pu_bacteria 2513237084 2513570141 401
213 iso_pu_bacteria 2513237085 2513575406 401
214 iso_pu_bacteria 2513237086 2513583112 401
215 iso_pu_bacteria 2513237088 2513598045 401
216 iso_pu_bacteria 2513237089 2513605198 401
217 iso_pu_bacteria 2513237091 2513617890 401
218 iso_pu_bacteria 2513237093 2513632909 401
219 iso_pu_bacteria 2513237103 2513710359 401
220 iso_pu_bacteria 2513237138 2513869900 401
221 iso_pu_bacteria 2513237140 2513884876 401
222 iso_pu_bacteria 2513237143 2513905889 401
223 iso_pu_bacteria 2513237144 2513909641 401
224 iso_pu_bacteria 2513237146 2513926385 401
225 iso_pu_bacteria 2513237156 2513986686 401
226 iso_pu_bacteria 2513237159 2514000345 401
227 iso_pu_bacteria 2513237160 2514005365 401
228 iso_pu_bacteria 2513237162 2514019758 401
229 iso_pu_bacteria 2515075009 2515111713 401
230 iso_pu_bacteria 2515154107 2515611424 401
231 iso_pu_bacteria 2515154113 2515634797 401
232 iso_pu_bacteria 2515154114 2515642035 401
233 iso_pu_bacteria 2515154116 2515656099 401
234 iso_pu_bacteria 2515154134 2515739200 401
235 iso_pu_bacteria 2516143018 2516209303 401
236 iso_pu_bacteria 2516653046 2516892715 401
237 iso_pu_bacteria 2516653077 2517040405 401
238 iso_pu_bacteria 2516653085 2517075890 401
239 iso_pu_bacteria 2517093000 2517094476 401
240 iso_pu_bacteria 2517287029 2517406267 401
241 iso_pu_bacteria 2517487022 2517569527 401
242 iso_pu_bacteria 2519899620 2520379530 401
243 iso_pu_bacteria 2524023207 2524452934 401
244 iso_pu_bacteria 2524023209 2524461302 401
245 iso_pu_bacteria 2529292951 2530645006 401
246 iso_pu_bacteria 2534681796 2535516073 401
247 iso_pu_bacteria 2537561587 2537875958 401
248 iso_pu_bacteria 2551306084 2551674183 401
249 iso_pu_bacteria 2551306084 2551680335 401
250 iso_pu_bacteria 2551306085 2551687056 401
251 iso_pu_bacteria 2551306086 2551692301 401
252 iso_pu_bacteria 2551306087 2551704840 401
253 iso_pu_bacteria 2551306089 2551710991 401
254 iso_pu_bacteria 2551306090 2551720721 401
255 iso_pu_bacteria 2551306091 2551724486 401
256 iso_pu_bacteria 2551306092 2551737638 401
257 iso_pu_bacteria 2551306093 2551740224 401
258 iso_pu_bacteria 2554235003 2554247786 401
259 iso_pu_bacteria 2558860100 2558863068 401
260 iso_pu_bacteria 2558860242 2559294919 401
261 iso_pu_bacteria 2558860983 2561468943 401
262 iso_pu_bacteria 2582581283 2585168364 401
263 iso_pu_bacteria 2582581294 2585199791 401
264 iso_pu_bacteria 2582581298 2585226018 401
265 iso_pu_bacteria 2582581299 2585232502 401
266 iso_pu_bacteria 2582581304 2585254265 401
267 iso_pu_bacteria 2582581306 2585268991 401
268 iso_pu_bacteria 2582581308 2585276842 401
269 iso_pu_bacteria 2582581315 2585324159 401
270 iso_pu_bacteria 2582581316 2585333448 401
271 iso_pu_bacteria 2582581865 2585389516 401
272 iso_pu_bacteria 2582581866 2585393872 401
273 iso_pu_bacteria 2582581867 2585400619 401
274 iso_pu_bacteria 2585427526 2585528840 401
275 iso_pu_bacteria 2585427527 2585534855 401
276 iso_pu_bacteria 2585427528 2585540251 401
277 iso_pu_bacteria 2585427529 2585546978 401
278 iso_pu_bacteria 2585427530 2585551700 401
279 iso_pu_bacteria 2585427590 2585819823 401
280 iso_pu_bacteria 2585427593 2585838449 401
281 iso_pu_bacteria 2585427594 2585845725 401
282 iso_pu_bacteria 2585427633 2585995504 401
283 iso_pu_bacteria 2585427634 2586000106 401
284 iso_pu_bacteria 2599185170 2599418186 401
285 iso_pu_bacteria 2599185210 2599604180 401
286 iso_pu_bacteria 2599185236 2599721327 401
287 iso_pu_bacteria 2599185352 2600192391 401
288 iso_pu_bacteria 2600255279 2601608027 401
289 iso_pu_bacteria 2600255308 2601744802 401
290 iso_pu_bacteria 2615840624 2616292928 401
291 iso_pu_bacteria 2615840626 2616308215 401
292 iso_pu_bacteria 2615840698 2616556763 401
293 iso_pu_bacteria 2617270742 2617381570 401
294 iso_pu_bacteria 2643221557 2643808472 401
295 iso_pu_bacteria 2643221558 2643812133 401
296 iso_pu_bacteria 2643221568 2643854462 401
297 iso_pu_bacteria 2643221582 2643919410 401
298 iso_pu_bacteria 2643221599 2644005978 401
299 iso_pu_bacteria 2643221607 2644049498 401
300 iso_pu_bacteria 2643221610 2644066435 401
301 iso_pu_bacteria 2643221618 2644109465 401
302 iso_pu_bacteria 2643221626 2644145150 401
303 iso_pu_bacteria 2643221634 2644193195 401
304 iso_pu_bacteria 2643221636 2644204094 401
305 iso_pu_bacteria 2643221643 2644238199 401
306 iso_pu_bacteria 2643221653 2644300217 401
307 iso_pu_bacteria 2643221655 2644307730 401
308 iso_pu_bacteria 2643221659 2644332506 401
309 iso_pu_bacteria 2643221668 2644378023 401
310 iso_pu_bacteria 2643221675 2644415352 401
311 iso_pu_bacteria 2643221680 2644450247 401
312 iso_pu_bacteria 2643221686 2644482532 401
313 iso_pu_bacteria 2643221688 2644494658 401
314 iso_pu_bacteria 2643221689 2644499035 401
315 iso_pu_bacteria 2643221693 2644522312 401
316 iso_pu_bacteria 2643221698 2644544253 401
317 iso_pu_bacteria 2643221712 2644613819 401
318 iso_pu_bacteria 2643221719 2644658443 401
319 iso_pu_bacteria 2643221723 2644677966 401
320 iso_pu_bacteria 2643221726 2644687799 401
321 iso_pu_bacteria 2657244999 2657683647 401
322 iso_pu_bacteria 2667528174 2671115612 401
323 iso_pu_bacteria 2690316117 2692316372 401
324 iso_pu_bacteria 2718217882 2719180655 401
325 iso_pu_bacteria 2718217927 2719385260 401
326 iso_pu_bacteria 2718217997 2719665086 401
327 iso_pu_bacteria 2718218009 2719731404 401
328 iso_pu_bacteria 2718218199 2720491506 401
329 iso_pu_bacteria 2718218232 2720612800 401
330 iso_pu_bacteria 2718218233 2720619651 401
331 iso_pu_bacteria 2718218235 2720631091 401
332 iso_pu_bacteria 2718218269 2720774818 401
333 iso_pu_bacteria 2718218363 2721146749 401
334 iso_pu_bacteria 2718218365 2721158272 401
335 iso_pu_bacteria 2718218366 2721163628 401
336 iso_pu_bacteria 2718218423 2721398981 401
337 iso_pu_bacteria 2721755514 2722839798 401
338 iso_pu_bacteria 2721755556 2723026454 401
339 iso_pu_bacteria 2721755684 2723559996 401
340 iso_pu_bacteria 2721755685 2723566617 401
341 iso_pu_bacteria 2721755809 2724037794 401
342 iso_pu_bacteria 2721755810 2724044160 401
343 iso_pu_bacteria 2721755819 2724089425 401
344 iso_pu_bacteria 2721755822 2724103882 401
345 iso_pu_bacteria 2721755823 2724109720 401
346 iso_pu_bacteria 2724679232 2725951732 401
347 iso_pu_bacteria 2728369352 2730107390 401
348 iso_pu_bacteria 2728369365 2730163892 401
349 iso_pu_bacteria 2728369397 2730297904 401
350 iso_pu_bacteria 2738541293 2738799349 401
351 iso_pu_bacteria 2738541317 2738945325 401
352 iso_pu_bacteria 2738541333 2739037891 401
353 iso_pu_bacteria 2765235942 2766068045 401
354 iso_pu_bacteria 2775507049 2776913184 401
355 iso_pu_bacteria 2775507266 2778176357 401
356 iso_pu_bacteria 2791355082 2792581140 401
357 iso_pu_bacteria 2791355091 2792623147 401
358 iso_pu_bacteria 2791355092 2792626911 401
359 iso_pu_bacteria 2791355094 2792642660 401
360 iso_pu_bacteria 2791355256 2793297034 401
361 iso_pu_bacteria 2791355259 2793315606 401
362 iso_pu_bacteria 2791355260 2793321358 401
363 iso_pu_bacteria 2791355261 2793330009 401
364 iso_pu_bacteria 2791355263 2793342700 401
365 iso_pu_bacteria 2791355264 2793350405 401
366 iso_pu_bacteria 2791355265 2793352139 401
367 iso_pu_bacteria 2791355266 2793360499 401
368 iso_pu_bacteria 2791355267 2793366288 401
369 iso_pu_bacteria 2802428858 2802718811 401
370 iso_pu_bacteria 2802428859 2802726422 401
371 iso_pu_bacteria 2802428860 2802732965 401
372 iso_pu_bacteria 2802428861 2802738320 401
373 iso_pu_bacteria 2802428862 2802744652 401
374 iso_pu_bacteria 2802428863 2802751142 401
375 iso_pu_bacteria 2802429268 2804751916 401
376 iso_pu_bacteria 2802429605 2805930055 401
377 iso_pu_bacteria 2802429606 2805934949 401
378 iso_pu_bacteria 2802429633 2806045651 401
379 iso_pu_bacteria 2802429634 2806053695 401
380 iso_pu_bacteria 2802429635 2806060895 401
381 iso_pu_bacteria 2802429636 2806067770 401
382 iso_pu_bacteria 2802429637 2806072878 401
383 iso_pu_bacteria 2808606387 2808985311 401
384 iso_pu_bacteria 2818991272 2819242166 401
385 iso_pu_bacteria 2818991439 2819559744 401
386 iso_pu_bacteria 2818991448 2819610525 401
387 iso_pu_bacteria 2818991453 2819638272 401
388 iso_pu_bacteria 2821123053 2821129366 401
389 iso_pu_bacteria 2838016132 2838018613 401
390 iso_pu_bacteria 2838022645 2838022693 401
391 iso_pu_bacteria 2838029111 2838032298 401
392 iso_pu_bacteria 2838035591 2838041126 401
393 iso_pu_bacteria 2838042994 2838047686 401
394 iso_pu_bacteria 2838048938 2838052303 401
395 iso_pu_bacteria 2838061910 2838066472 401
396 iso_pu_bacteria 2838068647 2838071219 401
397 iso_pu_bacteria 2838074704 2838079384 401
398 iso_pu_bacteria 2838661181 2838663164 401
399 iso_pu_bacteria 2838668709 2838669860 401
400 iso_pu_bacteria 2838675328 2838676155 401
401 iso_pu_bacteria 2838680041 2838682760 401
402 iso_pu_bacteria 2838686498 2838693255 401
403 iso_pu_bacteria 2838694306 2838697394 401
404 iso_pu_bacteria 2838701080 2838702232 401
405 iso_pu_bacteria 2838707686 2838709428 401
406 iso_pu_bacteria 2838714209 2838715037 401
407 iso_pu_bacteria 2838719591 2838721163 401
408 iso_pu_bacteria 2838724970 2838725796 401
409 iso_pu_bacteria 2838729681 2838736117 401
410 iso_pu_bacteria 2838736955 2838738601 401
411 iso_pu_bacteria 2838742623 2838748890 401
412 iso_pu_bacteria 2841840854 2841841030 401
413 iso_pu_bacteria 2841846520 2841848120 401
414 iso_pu_bacteria 2841851746 2841858226 401
415 iso_pu_bacteria 2841859092 2841859329 401
416 iso_pu_bacteria 2841864319 2841865066 401
417 iso_pu_bacteria 2842077413 2842077539 401
418 iso_pu_bacteria 2842110456 2842111057 401
419 iso_pu_bacteria 2842118031 2842119952 401
420 iso_pu_bacteria 2842124991 2842125850 401
421 iso_pu_bacteria 2842130223 2842131049 401
422 iso_pu_bacteria 2842140634 2842140808 401
423 iso_pu_bacteria 2842146304 2842147223 401
424 iso_pu_bacteria 2842152218 2842153781 401
425 iso_pu_bacteria 2842156927 2842163065 401
426 iso_pu_bacteria 2842163707 2842165153 401
427 iso_pu_bacteria 2842170452 2842171280 401
428 iso_pu_bacteria 2842175837 2842177401 401
429 iso_pu_bacteria 2842180545 2842186697 401
430 iso_pu_bacteria 2842187318 2842188145 401
431 iso_pu_bacteria 2842192696 2842197171 401
432 iso_pu_bacteria 2842198810 2842201480 401
433 iso_pu_bacteria 2842205361 2842206574 401
434 iso_pu_bacteria 2842211629 2842212456 401
435 iso_pu_bacteria 2842217011 2842220471 401
436 iso_pu_bacteria 2842224351 2842225925 401
437 iso_pu_bacteria 2842229732 2842235980 401
438 iso_pu_bacteria 2842237096 2842238841 401
439 iso_pu_bacteria 2842243621 2842249839 401
440 iso_pu_bacteria 2842250916 2842252288 401
441 iso_pu_bacteria 2842257432 2842263800 401
442 iso_pu_bacteria 2842264693 2842268598 401
443 iso_pu_bacteria 2842271015 2842277723 401
444 iso_pu_bacteria 2842278818 2842280031 401
445 iso_pu_bacteria 2842285085 2842287660 401
446 iso_pu_bacteria 2842291075 2842291201 401
447 iso_pu_bacteria 2842298080 2842302892 401
448 iso_pu_bacteria 2842304105 2842310326 401
449 iso_pu_bacteria 2842311132 2842315277 401
450 iso_pu_bacteria 2842317721 2842318418 401
451 iso_pu_bacteria 2842341865 2842347059 401
452 iso_pu_bacteria 2842357229 2842362568 401
453 iso_pu_bacteria 2842363717 2842366891 401
454 iso_pu_bacteria 2842370503 2842373390 401
455 iso_pu_bacteria 2842377471 2842377597 401
456 iso_pu_bacteria 2842384541 2842386462 401
457 iso_pu_bacteria 2842395702 2842399651 401
458 iso_pu_bacteria 2842402390 2842404811 401
459 iso_pu_bacteria 2842409023 2842411394 401
460 iso_pu_bacteria 2842415677 2842418155 401
461 iso_pu_bacteria 2842422224 2842425125 401
462 iso_pu_bacteria 2842428310 2842432731 401
463 iso_pu_bacteria 2842434925 2842439036 401
464 iso_pu_bacteria 2842441272 2842445665 401
465 iso_pu_bacteria 2842447887 2842451592 401
466 iso_pu_bacteria 2842462802 2842466983 401
467 iso_pu_bacteria 2842469257 2842473650 401
468 iso_pu_bacteria 2842475841 2842479073 401
469 iso_pu_bacteria 2842482326 2842483207 401
470 iso_pu_bacteria 2842489311 2842494460 401
471 iso_pu_bacteria 2842495871 2842500607 401
472 iso_pu_bacteria 2842502639 2842506207 401
473 iso_pu_bacteria 2842509118 2842510086 401
474 iso_pu_bacteria 2842515876 2842516113 401
475 iso_pu_bacteria 2842521101 2842526015 401
476 iso_pu_bacteria 2844163670 2844170341 401
477 iso_pu_bacteria 2844454524 2844454622 401
478 iso_pu_bacteria 2847417321 2847418560 401
479 iso_pu_bacteria 2847686936 2847692609 401
480 iso_pu_bacteria 2848992105 2848993538 401
481 iso_pu_bacteria 2850079185 2850080861 401
482 iso_pu_bacteria 2852387548 2852389476 401
483 iso_pu_bacteria 2854896431 2854901931 401
484 iso_pu_bacteria 2854916844 2854920292 401
485 iso_pu_bacteria 2855825444 2855825529 401
486 iso_pu_bacteria 2855839649 2855840907 401
487 iso_pu_bacteria 2855872281 2855873835 401
488 iso_pu_bacteria 2857516855 2857523037 401
489 iso_pu_bacteria 2857531043 2857535253 401
490 iso_pu_bacteria 2858800743 2858801446 401
491 iso_pu_bacteria 2871495908 2871502855 401
492 iso_pu_bacteria 2874102143 2874104826 401
493 iso_pu_bacteria 2876369609 2876375255 401
494 iso_pu_bacteria 2876392853 2876394614 401
495 iso_pu_bacteria 2878760144 2878766747 401
496 iso_pu_bacteria 2878767105 2878773944 401
497 iso_pu_bacteria 2881147464 2881151963 401
498 iso_pu_bacteria 2881161766 2881167909 401
499 iso_pu_bacteria 2885305155 2885309831 401
500 iso_pu_bacteria 2885326080 2885329563 401
501 iso_pu_bacteria 2885334103 2885334397 401
502 iso_pu_bacteria 2891048133 2891052299 401
503 iso_pu_bacteria 2896384573 2896387050 401
504 iso_pu_bacteria 2899792073 2899794197 401
505 iso_pu_bacteria 2899803654 2899807417 401
506 iso_pu_bacteria 2899845264 2899846504 401
507 iso_pu_bacteria 2903540706 2903547994 401
508 iso_pu_bacteria 2904659560 2904661248 401
509 iso_pu_bacteria 2906328253 2906329638 401
510 iso_pu_bacteria 2913295892 2913300504 401
511 iso_pu_bacteria 2913308742 2913310029 401
512 iso_pu_bacteria 2915980308 2915985269 401
513 iso_pu_bacteria 2915986958 2915989712 401
514 iso_pu_bacteria 2915993759 2915998448 401
515 iso_pu_bacteria 2916000859 2916004397 401
516 iso_pu_bacteria 2916007675 2916014483 401
517 iso_pu_bacteria 2916014648 2916015211 401
518 iso_pu_bacteria 2916021584 2916024678 401
519 iso_pu_bacteria 2916028427 2916033499 401
520 iso_pu_bacteria 2916035215 2916041746 401
521 iso_pu_bacteria 2916041962 2916044150 401
522 iso_pu_bacteria 2916048683 2916054188 401
523 iso_pu_bacteria 2916055098 2916061704 401
524 iso_pu_bacteria 2916061851 2916062388 401
525 iso_pu_bacteria 2916068649 2916071016 401
526 iso_pu_bacteria 2916076590 2916079805 401
527 iso_pu_bacteria 2919100787 2919104238 401
528 iso_pu_bacteria 2919114240 2919115128 401
529 iso_pu_bacteria 2919166419 2919168798 401
530 iso_pu_bacteria 2919171160 2919175465 401
531 iso_pu_bacteria 2919408235 2919409660 401
532 iso_pu_bacteria 2920760137 2920765637 401
533 iso_pu_bacteria 2920822456 2920824281 401
534 iso_pu_bacteria 2921201388 2921204250 401
535 iso_pu_bacteria 2921208531 2921210000 401
536 iso_pu_bacteria 2921237296 2921244187 401
537 iso_pu_bacteria 2921244191 2921246842 401
538 iso_pu_bacteria 2921250672 2921253916 401
539 iso_pu_bacteria 2921257292 2921257450 401
540 iso_pu_bacteria 2921263974 2921264673 401
541 iso_pu_bacteria 2921282425 2921284835 401
542 iso_pu_bacteria 2921289301 2921293290 401
543 iso_pu_bacteria 2921296804 2921297901 401
544 iso_pu_bacteria 2923556063 2923558249 401
545 iso_pu_bacteria 2924144063 2924146479 401
546 iso_pu_bacteria 2924150972 2924156051 401
547 iso_pu_bacteria 2924158325 2924158981 401
548 iso_pu_bacteria 2924165586 2924171002 401
549 iso_pu_bacteria 2924172951 2924175516 401
550 iso_pu_bacteria 2924179722 2924182247 401
551 iso_pu_bacteria 2924186466 2924189344 401
552 iso_pu_bacteria 2924193448 2924193968 401
553 iso_pu_bacteria 2924193448 2924193996 401
554 iso_pu_bacteria 2924200457 2924202772 401
555 iso_pu_bacteria 2924207177 2924213876 401
556 iso_pu_bacteria 2924214083 2924215787 401
557 iso_pu_bacteria 2924221636 2924222571 401
558 iso_pu_bacteria 2924228884 2924233176 401
559 iso_pu_bacteria 2924726620 2924728872 401
560 iso_pu_bacteria 2926754445 2926756173 401
561 iso_pu_bacteria 2926760298 2926760405 401
562 iso_pu_bacteria 2929138655 2929139804 401
563 iso_pu_bacteria 2933006813 2933008427 401
564 iso_pu_bacteria 2933011516 2933013243 401
565 iso_pu_bacteria 2933016740 2933019783 401
566 iso_pu_bacteria 2933570622 2933576766 401
567 iso_pu_bacteria 2933586486 2933587082 401
568 iso_pu_bacteria 2933594066 2933597932 401
569 iso_pu_bacteria 2933599457 2933602018 401
570 iso_pu_bacteria 2935894831 2935900472 401
571 iso_pu_bacteria 2935901341 2935904988 401
572 iso_pu_bacteria 2936367885 2936373326 401
573 iso_pu_bacteria 2936375103 2936378592 401
574 iso_pu_bacteria 2936381700 2936384696 401
575 iso_pu_bacteria 2936996657 2937001258 401
576 iso_pu_bacteria 2937002841 2937004645 401
577 iso_pu_bacteria 2937009748 2937012578 401
578 iso_pu_bacteria 2937016420 2937017032 401
579 iso_pu_bacteria 2937023124 2937029272 401
580 iso_pu_bacteria 2937029754 2937031244 401
581 iso_pu_bacteria 2937036028 2937038511 401
582 iso_pu_bacteria 2937042894 2937043144 401
583 iso_pu_bacteria 2937049772 2937055642 401
584 iso_pu_bacteria 2937056579 2937057789 401
585 iso_pu_bacteria 2937063883 2937069600 401
586 iso_pu_bacteria 2937071275 2937072800 401
587 iso_pu_bacteria 2937078374 2937080038 401
588 iso_pu_bacteria 2937084907 2937085400 401
589 iso_pu_bacteria 2937091812 2937093273 401
590 iso_pu_bacteria 2937098957 2937105422 401
591 iso_pu_bacteria 2937106411 2937107441 401
592 iso_pu_bacteria 2937113482 2937118332 401
593 iso_pu_bacteria 2937119839 2937123100 401
594 iso_pu_bacteria 2937126314 2937127954 401
595 iso_pu_bacteria 2937891427 2937894896 401
596 iso_pu_bacteria 2937994558 2938001870 401
597 iso_pu_bacteria 2941499720 2941499764 401
598 iso_pu_bacteria 2957375807 2957378636 401
599 iso_pu_bacteria 2957382221 2957384457 401
600 iso_pu_bacteria 2957388812 2957389759 401
601 iso_pu_bacteria 2957395598 2957396652 401
602 iso_pu_bacteria 2957402308 2957405877 401
603 iso_pu_bacteria 2957408893 2957411184 401
604 iso_pu_bacteria 2957415311 2957415780 401
605 iso_pu_bacteria 2957422303 2957424304 401
606 iso_pu_bacteria 2957430029 2957433482 401
607 iso_pu_bacteria 2957437181 2957439935 401
608 iso_pu_bacteria 2957443900 2957445533 401
609 iso_pu_bacteria 2957450854 2957457594 401
610 iso_pu_bacteria 2957457609 2957458058 401
611 iso_pu_bacteria 2957464669 2957467970 401
612 iso_pu_bacteria 2957471148 2957474362 401
613 iso_pu_bacteria 2957478035 2957478540 401
614 iso_pu_bacteria 2957484790 2957485663 401
615 iso_pu_bacteria 2957491536 2957491936 401
616 iso_pu_bacteria 2957498199 2957502508 401
617 iso_pu_bacteria 2957505466 2957511758 401
618 iso_pu_bacteria 2958115193 2958118804 401
619 iso_pu_bacteria 2958165035 2958171925 401
620 iso_pu_bacteria 2960584000 2960587600 401
621 iso_pu_bacteria 2960591022 2960596204 401
622 iso_pu_bacteria 2960597568 2960601333 401
623 iso_pu_bacteria 2960603979 2960605373 401
624 iso_pu_bacteria 2960610863 2960616453 401
625 iso_pu_bacteria 2960617483 2960618805 401
626 iso_pu_bacteria 2960624210 2960628618 401
627 iso_pu_bacteria 2960631154 2960632721 401
628 iso_pu_bacteria 2960637947 2960645122 401
629 iso_pu_bacteria 2960645483 2960650441 401
630 iso_pu_bacteria 2960652885 2960657546 401
631 iso_pu_bacteria 2960660292 2960665508 401
632 iso_pu_bacteria 2960667422 2960669521 401
633 iso_pu_bacteria 2960674078 2960679763 401
634 iso_pu_bacteria 2960680706 2960686900 401
635 iso_pu_bacteria 2960687367 2960688835 401
636 iso_pu_bacteria 2960693952 2960695922 401
637 iso_pu_bacteria 2961114664 2961116400 401
638 iso_pu_bacteria 2961163497 2961170371 401
639 iso_pu_bacteria 2964607997 2964611660 401
640 iso_pu_bacteria 2964615318 2964617525 401
641 iso_pu_bacteria 2964621998 2964625194 401
642 iso_pu_bacteria 2964628898 2964635130 401
643 iso_pu_bacteria 2964636051 2964642297 401
644 iso_pu_bacteria 2964643177 2964645963 401
645 iso_pu_bacteria 2964649959 2964652160 401
646 iso_pu_bacteria 2964656573 2964657498 401
647 iso_pu_bacteria 2964663802 2964665023 401
648 iso_pu_bacteria 2964670856 2964672242 401
649 iso_pu_bacteria 2964678106 2964679143 401
650 iso_pu_bacteria 2964685014 2964688772 401
651 iso_pu_bacteria 2964691889 2964693768 401
652 iso_pu_bacteria 2964698721 2964702963 401
653 iso_pu_bacteria 2964705432 2964709749 401
654 iso_pu_bacteria 2964712639 2964713343 401
655 iso_pu_bacteria 2964719344 2964720563 401
656 iso_pu_bacteria 2965018300 2965025117 401
657 iso_pu_bacteria 2965062239 2965065230 401
658 iso_pu_bacteria 2967664464 2967668138 401
659 iso_pu_bacteria 2967671571 2967672986 401
660 iso_pu_bacteria 2967678726 2967683825 401
661 iso_pu_bacteria 2967686174 2967687300 401
662 iso_pu_bacteria 2967693043 2967693584 401
663 iso_pu_bacteria 2967699805 2967700564 401
664 iso_pu_bacteria 2967706974 2967711633 401
665 iso_pu_bacteria 2967714385 2967715722 401
666 iso_pu_bacteria 2967721400 2967726865 401
667 iso_pu_bacteria 2967728569 2967734341 401
668 iso_pu_bacteria 2967735183 2967736441 401
669 iso_pu_bacteria 2967742019 2967742795 401
670 iso_pu_bacteria 2967748971 2967750035 401
671 iso_pu_bacteria 2967755722 2967758068 401
672 iso_pu_bacteria 2967762386 2967763526 401
673 iso_pu_bacteria 2967769361 2967771551 401
674 iso_pu_bacteria 2967775926 2967782011 401
675 iso_pu_bacteria 2968091066 2968096620 401
676 iso_pu_bacteria 2968097103 2968099982 401
677 iso_pu_bacteria 2968110612 2968112306 401
678 iso_pu_bacteria 2968128360 2968132672 401
679 iso_pu_bacteria 2968171901 2968178758 401
680 iso_pu_bacteria 2970019648 2970023386 401
681 iso_pu_bacteria 2970026789 2970029323 401
682 iso_pu_bacteria 2970033650 2970035594 401
683 iso_pu_bacteria 2970040964 2970042080 401
684 iso_pu_bacteria 2970047711 2970048742 401
685 iso_pu_bacteria 2970054988 2970061372 401
686 iso_pu_bacteria 2970061556 2970062431 401
687 iso_pu_bacteria 2970068827 2970072243 401
688 iso_pu_bacteria 2970076120 2970077400 401
689 iso_pu_bacteria 2970082768 2970085161 401
690 iso_pu_bacteria 2970088815 2970091532 401
691 iso_pu_bacteria 2970095765 2970102411 401
692 iso_pu_bacteria 2970102677 2970107729 401
693 iso_pu_bacteria 2970109326 2970113378 401
694 iso_pu_bacteria 2970116247 2970121424 401
695 iso_pu_bacteria 2970122695 2970124664 401
696 iso_pu_bacteria 2970129317 2970130283 401
697 iso_pu_bacteria 2970136068 2970138385 401
698 iso_pu_bacteria 2970143518 2970145478 401
699 iso_pu_bacteria 2970149975 2970153221 401
700 iso_pu_bacteria 2970156795 2970159005 401
701 iso_pu_bacteria 2970164137 2970170516 401
702 iso_pu_bacteria 2970170962 2970175377 401
703 iso_pu_bacteria 2970177841 2970181227 401
704 iso_pu_bacteria 2970184632 2970191566 401
705 iso_pu_bacteria 2970191845 2970193931 401
706 iso_pu_bacteria 2970554993 2970561603 401
707 iso_pu_bacteria 2977516862 2977520861 401
708 iso_pu_bacteria 2977523885 2977527326 401
709 iso_pu_bacteria 2977530762 2977534971 401
710 iso_pu_bacteria 2977537788 2977540219 401
711 iso_pu_bacteria 2977544691 2977547661 401
712 iso_pu_bacteria 2977551784 2977554900 401
713 iso_pu_bacteria 2977558990 2977562494 401
714 iso_pu_bacteria 2977565890 2977568305 401
715 iso_pu_bacteria 2977572785 2977577310 401
716 iso_pu_bacteria 2977579622 2977583620 401
717 iso_pu_bacteria 2977858184 2977861077 401
718 iso_pu_bacteria 2977864932 2977865880 401
719 iso_pu_bacteria 2978969890 2978971485 401
720 iso_pu_bacteria 2979089926 2979094320 401
721 iso_pu_bacteria 2979095461 2979098299 401
722 iso_pu_bacteria 2979100975 2979103553 401
723 iso_pu_bacteria 2979779861 2979786293 401
724 iso_pu_bacteria 2984509177 2984511879 401
725 iso_pu_bacteria 2984518228 2984521761 401
726 iso_pu_bacteria 2984587000 2984588629 401
727 iso_pu_bacteria 2987659509 2987666612 401
728 iso_pu_bacteria 2989771324 2989776085 401
729 iso_pu_bacteria 2989776772 2989778557 401
730 iso_pu_bacteria 2995392953 2995393247 401
731 iso_pu_bacteria 2996887358 2996892326 401
732 iso_pu_bacteria 2996893221 2996893908 401
733 iso_pu_bacteria 3003930520 3003933285 401
734 iso_pu_bacteria 3004188549 3004195614 401
735 iso_pu_bacteria 3005409236 3005412933 401
736 iso_pu_bacteria 3005445848 3005447092 401
737 iso_pu_bacteria 3005452660 3005453827 401
738 iso_pu_bacteria 639633055 639647922 401
739 iso_pu_bacteria 648276728 648740199 401
740 iso_pu_bacteria 650716007 650740175 401
741 iso_pu_bacteria 8003570095 8003571236 401
742 iso_pu_bacteria 8003992118 8003993400 401
743 iso_pu_bacteria 8003999396 8004000657 401
744 iso_pu_bacteria 8004445564 8004451002 401
745 iso_pu_bacteria 8004703790 8004709706 401
746 iso_pu_bacteria 8005246636 8005250943 401
747 iso_pu_bacteria 8005258706 8005259608 401
748 iso_pu_bacteria 8005275841 8005280066 401
749 iso_pu_bacteria 8005282627 8005284133 401
750 iso_pu_bacteria 8005289223 8005294644 401
751 iso_pu_bacteria 8005301065 8005307182 401
752 iso_pu_bacteria 8005307578 8005314782 401
753 iso_pu_bacteria 8005321885 8005326853 401
754 iso_pu_bacteria 8005376324 8005378643 401
755 iso_pu_bacteria 8005382845 8005384891 401
756 iso_pu_bacteria 8005395548 8005398315 401
757 iso_pu_bacteria 8005430974 8005436260 401
758 iso_pu_bacteria 8005460587 8005462369 401
759 iso_pu_bacteria 8005484373 8005486505 401
760 iso_pu_bacteria 8005497431 8005499752 401
761 iso_pu_bacteria 8005542996 8005544747 401
762 iso_pu_bacteria 8005556819 8005558265 401
763 iso_pu_bacteria 8005563573 8005569446 401
764 iso_pu_bacteria 8005570704 8005575288 401
765 iso_pu_bacteria 8005619151 8005620957 401
766 iso_pu_bacteria 8005626139 8005627431 401
767 iso_pu_bacteria 8005645114 8005646416 401
768 iso_pu_bacteria 8005668836 8005671173 401
769 iso_pu_bacteria 8005682033 8005686479 401
770 iso_pu_bacteria 8005688590 8005695092 401
771 iso_pu_bacteria 8005695170 8005696321 401
772 iso_pu_bacteria 8018127388 8018128219 401
773 iso_pu_bacteria 8018150411 8018152620 401
774 iso_pu_bacteria 8018163183 8018167944 401
775 iso_pu_bacteria 8018176218 8018177832 401
776 iso_pu_bacteria 8023680758 8023680822 401
777 iso_pu_bacteria 8024479707 8024485595 401
778 iso_pu_bacteria 8024501048 8024505065 401
779 iso_pu_bacteria 8046767195 8046768594 401
780 iso_pu_bacteria 8049293176 8049294450 401
781 iso_pu_bacteria 8054460903 8054462230 401
782 iso_pu_bacteria 8054558443 8054563348 401
783 iso_pu_bacteria 8055431914 8055435888 401
784 iso_pu_bacteria 8056375014 8056379998 401
785 iso_pu_bacteria 8056382006 8056387706 401
786 iso_pu_bacteria 8056875544 8056876700 401
787 iso_pu_bacteria 8057575449 8057578129 401
788 iso_pu_bacteria 8057874678 8057875645 401
789 iso_pu_bacteria 2585427608 2585897580 402
790 iso_pu_bacteria 2643221623 2644129866 402
791 iso_pu_bacteria 2738543024 2739309384 402
792 iso_pu_bacteria 2889790730 2889792242 402
793 iso_pu_bacteria 2889914905 2889917024 402
794 iso_pu_bacteria 8002285264 8002285587 402
795 3300006178 Ga0075367_10105249 Ga0075367_101052492 403
796 3300048921 Ga0496118_0034154 Ga0496118_0034154_1250_2461 403
797 3300049570 Ga0501033_0050652 Ga0501033_0050652_809_2026 403
798 3300049573 Ga0501037_0158277 Ga0501037_0158277_141_1358 403
799 3300049581 Ga0501047_0038552 Ga0501047_0038552_545_1762 403
800 3300049823 Ga0501044_0254640 Ga0501044_0254640_44_1261 403
801 iso_pu_bacteria 2599185156 2599333379 403
802 iso_pu_bacteria 2791355253 2793279527 403
803 iso_pu_bacteria 2842922631 2842925214 403
804 3300001979 JGI24740J21852_10007318 JGI24740J21852_100073183 404
805 3300001979 JGI24740J21852_10010983 JGI24740J21852_100109832 404
806 3300002705 JGI25156J39149_1001896 JGI25156J39149_10018963 404
807 3300002741 JGI25157J39369_1001076 JGI25157J39369_10010769 404
808 3300003762 Ga0055542_1001237 Ga0055542_10012372 404
809 3300005339 Ga0070660_100136645 Ga0070660_1001366451 404
810 3300006038 Ga0075365_10022285 Ga0075365_100222853 404
811 3300006038 Ga0075365_10035815 Ga0075365_100358152 404
812 3300006038 Ga0075365_10052238 Ga0075365_100522382 404
813 3300006048 Ga0075363_100106348 Ga0075363_1001063482 404
814 3300006353 Ga0075370_10085274 Ga0075370_100852742 404
815 3300010375 Ga0105239_10471607 Ga0105239_104716072 404
816 3300025250 Ga0209026_1000024 Ga0209026_1000024201 404
817 3300025254 Ga0209148_1000050 Ga0209148_1000050155 404
818 3300025256 Ga0209759_1000389 Ga0209759_100038922 404
819 3300025272 Ga0209455_1000183 Ga0209455_100018358 404
820 3300025909 Ga0207705_10037788 Ga0207705_100377883 404
821 3300025913 Ga0207695_10060785 Ga0207695_100607856 404
822 3300025949 Ga0207667_10227130 Ga0207667_102271302 404
823 3300026067 Ga0207678_10076269 Ga0207678_100762693 404
824 3300026142 Ga0207698_10274067 Ga0207698_102740671 404
825 3300041413 Ga0439465_0016694 Ga0439465_0016694_866_2080 404
826 3300046515 Ga0495620_0036350 Ga0495620_0036350_167_1381 404
827 3300046522 Ga0495643_0061730 Ga0495643_0061730_504_1718 404
828 3300048091 Ga0495626_0058288 Ga0495626_0058288_76_1290 404
829 3300048912 Ga0496109_0172328 Ga0496109_0172328_278_1492 404
830 3300048927 Ga0496124_0122494 Ga0496124_0122494_27_1241 404
831 3300049570 Ga0501033_0027898 Ga0501033_0027898_2619_3842 404
832 3300049570 Ga0501033_0039171 Ga0501033_0039171_1619_2842 404
833 3300049571 Ga0501034_0058508 Ga0501034_0058508_1158_2381 404
834 3300049823 Ga0501044_0020059 Ga0501044_0020059_4063_5286 404
835 3300050492 nmdc:mga0yw44_6407_c1 nmdc:mga0yw44_6407_c1_2593_3807 404
836 3300050492 nmdc:mga0yw44_69639_c1 nmdc:mga0yw44_69639_c1_520_1734 404
837 3300053134 Ga0500658_0083936 Ga0500658_0083936_105_1319 404
838 iso_pu_bacteria 2751185800 2753359190 404
839 iso_pu_bacteria 2758568016 2758641435 404
840 3300002737 JGI25162J39368_1002413 JGI25162J39368_10024137 405
841 3300002738 JGI25154J39366_1000181 JGI25154J39366_100018114 405
842 3300002739 JGI25158J39367_1000135 JGI25158J39367_10001357 405
843 3300002739 JGI25158J39367_1000975 JGI25158J39367_10009753 405
844 3300002773 JGI25152J39213_1000534 JGI25152J39213_100053413 405
845 3300002773 JGI25152J39213_1000545 JGI25152J39213_10005453 405
846 3300002773 JGI25152J39213_1003397 JGI25152J39213_10033972 405
847 3300002773 JGI25152J39213_1004376 JGI25152J39213_10043762 405
848 3300002773 JGI25152J39213_1012822 JGI25152J39213_10128222 405
849 3300002773 JGI25152J39213_1012828 JGI25152J39213_10128282 405
850 3300002774 JGI25150J39212_1000047 JGI25150J39212_10000473 405
851 3300002774 JGI25150J39212_1000380 JGI25150J39212_10003803 405
852 3300002774 JGI25150J39212_1002361 JGI25150J39212_10023612 405
853 3300002987 JGI25159J45721_1000006 JGI25159J45721_1000006152 405
854 3300002987 JGI25159J45721_1001165 JGI25159J45721_100116510 405
855 3300002987 JGI25159J45721_1002092 JGI25159J45721_10020923 405
856 3300003187 JGI25151J46595_10000126 JGI25151J46595_1000012676 405
857 3300003187 JGI25151J46595_10011907 JGI25151J46595_100119072 405
858 3300003214 JGI25165J46597_1000062 JGI25165J46597_100006255 405
859 3300003214 JGI25165J46597_1000920 JGI25165J46597_10009202 405
860 3300003215 JGI25153J46596_10001078 JGI25153J46596_1000107819 405
861 3300003215 JGI25153J46596_10007194 JGI25153J46596_100071942 405
862 3300003215 JGI25153J46596_10031675 JGI25153J46596_100316752 405
863 3300003215 JGI25153J46596_10031676 JGI25153J46596_100316762 405
864 3300003215 JGI25153J46596_10033910 JGI25153J46596_100339102 405
865 3300003322 rootL2_10018543 rootL2_100185439 405
866 3300003323 rootH1_10019945 rootH1_100199451 405
867 3300003354 JGI25160J50197_1000004 JGI25160J50197_1000004321 405
868 3300003354 JGI25160J50197_1000019 JGI25160J50197_1000019157 405
869 3300003354 JGI25160J50197_1000664 JGI25160J50197_100066418 405
870 3300003354 JGI25160J50197_1008485 JGI25160J50197_10084853 405
871 3300003354 JGI25160J50197_1012480 JGI25160J50197_10124801 405
872 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003108 405
873 3300003374 JGI25161J50226_1000467 JGI25161J50226_100046715 405
874 3300003374 JGI25161J50226_1000680 JGI25161J50226_10006802 405
875 3300003374 JGI25161J50226_1000904 JGI25161J50226_10009047 405
876 3300003771 Ga0055526_1000462 Ga0055526_10004625 405
877 3300003771 Ga0055526_1001096 Ga0055526_100109610 405
878 3300003771 Ga0055526_1003315 Ga0055526_10033152 405
879 3300003771 Ga0055526_1008997 Ga0055526_10089974 405
880 3300003775 Ga0055524_1001178 Ga0055524_10011785 405
881 3300003775 Ga0055524_1002226 Ga0055524_10022262 405
882 3300003775 Ga0055524_1003918 Ga0055524_10039183 405
883 3300003781 Ga0055536_1002723 Ga0055536_10027233 405
884 3300003790 Ga0055528_1000051 Ga0055528_10000512 405
885 3300003790 Ga0055528_1000448 Ga0055528_100044821 405
886 3300003790 Ga0055528_1006972 Ga0055528_10069721 405
887 3300003790 Ga0055528_1007775 Ga0055528_10077754 405
888 3300003792 Ga0055540_1002665 Ga0055540_10026657 405
889 3300003794 Ga0055531_10002882 Ga0055531_100028827 405
890 3300003794 Ga0055531_10003417 Ga0055531_100034175 405
891 3300003856 Ga0058692_1004482 Ga0058692_10044822 405
892 3300004625 Ga0055543_1000001 Ga0055543_1000001114 405
893 3300004625 Ga0055543_1000275 Ga0055543_100027533 405
894 3300004625 Ga0055543_1000867 Ga0055543_10008672 405
895 3300004625 Ga0055543_1000935 Ga0055543_10009352 405
896 3300005262 Ga0065165_1000149 Ga0065165_100014937 405
897 3300005262 Ga0065165_1000272 Ga0065165_100027243 405
898 3300005262 Ga0065165_1001907 Ga0065165_10019073 405
899 3300005262 Ga0065165_1008226 Ga0065165_10082264 405
900 3300005355 Ga0070671_100043803 Ga0070671_1000438032 405
901 3300005367 Ga0070667_100159462 Ga0070667_1001594622 405
902 3300005455 Ga0070663_100010806 Ga0070663_1000108063 405
903 3300005548 Ga0070665_100025262 Ga0070665_1000252627 405
904 3300005548 Ga0070665_100040711 Ga0070665_1000407112 405
905 3300005548 Ga0070665_100044244 Ga0070665_1000442444 405
906 3300005614 Ga0068856_100196996 Ga0068856_1001969962 405
907 3300006038 Ga0075365_10001830 Ga0075365_100018302 405
908 3300006048 Ga0075363_100012575 Ga0075363_1000125753 405
909 3300006048 Ga0075363_100020583 Ga0075363_1000205831 405
910 3300006051 Ga0075364_10001918 Ga0075364_1000191812 405
911 3300006051 Ga0075364_10035513 Ga0075364_100355132 405
912 3300006177 Ga0075362_10000297 Ga0075362_100002973 405
913 3300006177 Ga0075362_10052629 Ga0075362_100526291 405
914 3300006186 Ga0075369_10000735 Ga0075369_100007353 405
915 3300006186 Ga0075369_10008326 Ga0075369_100083263 405
916 3300006186 Ga0075369_10040288 Ga0075369_100402882 405
917 3300006195 Ga0075366_10010376 Ga0075366_100103763 405
918 3300006195 Ga0075366_10015206 Ga0075366_100152062 405
919 3300006353 Ga0075370_10028124 Ga0075370_100281241 405
920 3300006946 Ga0079104_1000129 Ga0079104_100012999 405
921 3300006946 Ga0079104_1010900 Ga0079104_10109002 405
922 3300006948 Ga0099826_10002926 Ga0099826_100029262 405
923 3300009093 Ga0105240_10000005 Ga0105240_10000005106 405
924 3300009093 Ga0105240_10047849 Ga0105240_100478492 405
925 3300009177 Ga0105248_10279957 Ga0105248_102799572 405
926 3300009545 Ga0105237_10001991 Ga0105237_1000199110 405
927 3300009545 Ga0105237_10045855 Ga0105237_100458554 405
928 3300009551 Ga0105238_10004648 Ga0105238_100046483 405
929 3300009553 Ga0105249_10042443 Ga0105249_100424434 405
930 3300009765 Ga0123341_1000001 Ga0123341_1000001172 405
931 3300009766 Ga0123342_1021352 Ga0123342_10213526 405
932 3300009766 Ga0123342_1023582 Ga0123342_10235824 405
933 3300010375 Ga0105239_10003100 Ga0105239_100031004 405
934 3300013100 Ga0157373_10005196 Ga0157373_100051963 405
935 3300013102 Ga0157371_10000015 Ga0157371_10000015227 405
936 3300013104 Ga0157370_10000309 Ga0157370_1000030961 405
937 3300013104 Ga0157370_10000665 Ga0157370_1000066527 405
938 3300013249 Ga0171463_1011 Ga0171463_1011209 405
939 3300015690 Ga0183363_1143 Ga0183363_11437 405
940 3300021320 Ga0214544_1000024 Ga0214544_1000024117 405
941 3300021321 Ga0214542_1000015 Ga0214542_1000015102 405
942 3300021321 Ga0214542_1026484 Ga0214542_10264843 405
943 3300021327 Ga0214543_1000011 Ga0214543_1000011304 405
944 3300022739 Ga0228711_1000528 Ga0228711_10005285 405
945 3300022740 Ga0228710_1000006 Ga0228710_1000006140 405
946 3300025207 Ga0209760_102358 Ga0209760_1023581 405
947 3300025208 Ga0209436_100039 Ga0209436_10003963 405
948 3300025208 Ga0209436_100390 Ga0209436_1003904 405
949 3300025208 Ga0209436_109217 Ga0209436_1092172 405
950 3300025228 Ga0209672_101326 Ga0209672_1013264 405
951 3300025230 Ga0209563_104361 Ga0209563_1043612 405
952 3300025233 Ga0209437_100153 Ga0209437_10015381 405
953 3300025233 Ga0209437_100201 Ga0209437_10020146 405
954 3300025245 Ga0207425_1000010 Ga0207425_1000010267 405
955 3300025245 Ga0207425_1001043 Ga0207425_10010434 405
956 3300025245 Ga0207425_1006562 Ga0207425_10065624 405
957 3300025245 Ga0207425_1011258 Ga0207425_10112583 405
958 3300025245 Ga0207425_1020406 Ga0207425_10204061 405
959 3300025253 Ga0209677_101154 Ga0209677_1011543 405
960 3300025258 Ga0209129_1000034 Ga0209129_100003474 405
961 3300025258 Ga0209129_1000470 Ga0209129_100047016 405
962 3300025258 Ga0209129_1000947 Ga0209129_10009478 405
963 3300025258 Ga0209129_1001001 Ga0209129_100100113 405
964 3300025258 Ga0209129_1002822 Ga0209129_10028225 405
965 3300025258 Ga0209129_1003476 Ga0209129_10034763 405
966 3300025261 Ga0209233_1000129 Ga0209233_1000129138 405
967 3300025261 Ga0209233_1000175 Ga0209233_100017570 405
968 3300025261 Ga0209233_1000226 Ga0209233_100022627 405
969 3300025261 Ga0209233_1000248 Ga0209233_100024833 405
970 3300025273 Ga0209673_1000230 Ga0209673_100023028 405
971 3300025273 Ga0209673_1001478 Ga0209673_100147816 405
972 3300025273 Ga0209673_1002170 Ga0209673_100217011 405
973 3300025273 Ga0209673_1003247 Ga0209673_10032478 405
974 3300025273 Ga0209673_1005149 Ga0209673_10051496 405
975 3300025273 Ga0209673_1009980 Ga0209673_10099802 405
976 3300025273 Ga0209673_1024873 Ga0209673_10248732 405
977 3300025284 Ga0209130_1000006 Ga0209130_100000687 405
978 3300025284 Ga0209130_1000007 Ga0209130_1000007510 405
979 3300025284 Ga0209130_1000012 Ga0209130_1000012314 405
980 3300025292 Ga0209676_1002948 Ga0209676_10029487 405
981 3300025294 Ga0209025_1000022 Ga0209025_1000022315 405
982 3300025294 Ga0209025_1000033 Ga0209025_1000033347 405
983 3300025294 Ga0209025_1000097 Ga0209025_1000097141 405
984 3300025294 Ga0209025_1007667 Ga0209025_10076675 405
985 3300025294 Ga0209025_1011412 Ga0209025_10114125 405
986 3300025294 Ga0209025_1013526 Ga0209025_10135264 405
987 3300025294 Ga0209025_1058870 Ga0209025_10588702 405
988 3300025295 Ga0209564_1000373 Ga0209564_100037317 405
989 3300025295 Ga0209564_1000740 Ga0209564_100074027 405
990 3300025295 Ga0209564_1001522 Ga0209564_100152217 405
991 3300025295 Ga0209564_1007164 Ga0209564_10071643 405
992 3300025297 Ga0209758_1000080 Ga0209758_1000080206 405
993 3300025297 Ga0209758_1000520 Ga0209758_100052053 405
994 3300025297 Ga0209758_1000633 Ga0209758_100063356 405
995 3300025297 Ga0209758_1000822 Ga0209758_100082210 405
996 3300025297 Ga0209758_1001240 Ga0209758_100124010 405
997 3300025297 Ga0209758_1001887 Ga0209758_10018877 405
998 3300025297 Ga0209758_1005650 Ga0209758_10056507 405
999 3300025297 Ga0209758_1019549 Ga0209758_10195492 405
1000 3300025297 Ga0209758_1025829 Ga0209758_10258292 405
1001 3300025298 Ga0209050_1004383 Ga0209050_10043833 405
1002 3300025298 Ga0209050_1011067 Ga0209050_10110671 405
1003 3300025299 Ga0209256_1000319 Ga0209256_100031950 405
1004 3300025299 Ga0209256_1001551 Ga0209256_100155128 405
1005 3300025299 Ga0209256_1002545 Ga0209256_10025459 405
1006 3300025299 Ga0209256_1009788 Ga0209256_10097882 405
1007 3300025302 Ga0207426_1000003 Ga0207426_1000003950 405
1008 3300025302 Ga0207426_1000010 Ga0207426_1000010673 405
1009 3300025302 Ga0207426_1000094 Ga0207426_1000094138 405
1010 3300025302 Ga0207426_1000111 Ga0207426_1000111151 405
1011 3300025302 Ga0207426_1000853 Ga0207426_100085319 405
1012 3300025303 Ga0209051_1000166 Ga0209051_100016651 405
1013 3300025303 Ga0209051_1003640 Ga0209051_10036403 405
1014 3300025303 Ga0209051_1011805 Ga0209051_10118052 405
1015 3300025303 Ga0209051_1039818 Ga0209051_10398182 405
1016 3300025304 Ga0209257_1001307 Ga0209257_10013077 405
1017 3300025304 Ga0209257_1003894 Ga0209257_10038943 405
1018 3300025304 Ga0209257_1005270 Ga0209257_10052705 405
1019 3300025304 Ga0209257_1026675 Ga0209257_10266752 405
1020 3300025903 Ga0207680_10068849 Ga0207680_100688492 405
1021 3300025904 Ga0207647_10056612 Ga0207647_100566122 405
1022 3300025913 Ga0207695_10000011 Ga0207695_10000011809 405
1023 3300025914 Ga0207671_10000276 Ga0207671_1000027613 405
1024 3300025914 Ga0207671_10084009 Ga0207671_100840093 405
1025 3300025924 Ga0207694_10018118 Ga0207694_100181186 405
1026 3300025931 Ga0207644_10051817 Ga0207644_100518172 405
1027 3300025972 Ga0207668_10125634 Ga0207668_101256341 405
1028 3300025981 Ga0207640_10060572 Ga0207640_100605723 405
1029 3300026067 Ga0207678_10138722 Ga0207678_101387221 405
1030 3300026142 Ga0207698_10110899 Ga0207698_101108992 405
1031 3300027111 Ga0209281_1000036 Ga0209281_1000036150 405
1032 3300027111 Ga0209281_1000047 Ga0209281_100004792 405
1033 3300027111 Ga0209281_1000268 Ga0209281_100026853 405
1034 3300027111 Ga0209281_1000578 Ga0209281_100057833 405
1035 3300027312 Ga0209371_1000382 Ga0209371_100038236 405
1036 3300027312 Ga0209371_1001444 Ga0209371_10014447 405
1037 3300027666 Ga0209282_1000026 Ga0209282_1000026134 405
1038 3300027666 Ga0209282_1000095 Ga0209282_100009562 405
1039 3300027866 Ga0209813_10005272 Ga0209813_100052724 405
1040 3300027866 Ga0209813_10031440 Ga0209813_100314402 405
1041 3300028379 Ga0268266_10025145 Ga0268266_100251457 405
1042 3300028379 Ga0268266_10030382 Ga0268266_100303822 405
1043 3300028379 Ga0268266_10170832 Ga0268266_101708322 405
1044 3300028794 Ga0307515_10000274 Ga0307515_1000027465 405
1045 3300028794 Ga0307515_10000656 Ga0307515_1000065664 405
1046 3300028794 Ga0307515_10036369 Ga0307515_100363692 405
1047 3300028794 Ga0307515_10040065 Ga0307515_100400653 405
1048 3300030500 Ga0268256_1002533 Ga0268256_10025332 405
1049 3300031456 Ga0307513_10003280 Ga0307513_1000328014 405
1050 3300031456 Ga0307513_10010898 Ga0307513_100108987 405
1051 3300031548 Ga0307408_100032605 Ga0307408_1000326053 405
1052 3300031731 Ga0307405_10002526 Ga0307405_100025263 405
1053 3300031731 Ga0307405_10193754 Ga0307405_101937541 405
1054 3300031901 Ga0307406_10058516 Ga0307406_100585162 405
1055 3300031911 Ga0307412_10002014 Ga0307412_100020149 405
1056 3300031967 Ga0315914_1000008 Ga0315914_1000008139 405
1057 3300033430 Ga0315913_1000137 Ga0315913_100013739 405
1058 3300033464 Ga0315915_1000014 Ga0315915_100001437 405
1059 3300035695 Ga0373927_0002192 Ga0373927_0002192_10808_12025 405
1060 3300037068 Ga0373925_0016473 Ga0373925_0016473_1517_2734 405
1061 3300037312 Ga0395899_0203361 Ga0395899_0203361_127_1356 405
1062 3300037466 Ga0395898_0043866 Ga0395898_0043866_978_2207 405
1063 3300037471 Ga0395905_0000700 Ga0395905_0000700_17510_18727 405
1064 3300037471 Ga0395905_0093994 Ga0395905_0093994_28_1245 405
1065 3300037471 Ga0395905_0164691 Ga0395905_0164691_646_1875 405
1066 3300038443 Ga0395901_0080673 Ga0395901_0080673_2008_3225 405
1067 3300041404 Ga0439436_0028385 Ga0439436_0028385_208_1425 405
1068 3300041413 Ga0439465_0004501 Ga0439465_0004501_646_1863 405
1069 3300041441 Ga0451787_319395 Ga0451787_319395_1923_3140 405
1070 3300041458 Ga0451798_0610660 Ga0451798_0610660_458_1675 405
1071 3300041496 Ga0451839_0405469 Ga0451839_0405469_1833_3050 405
1072 3300041501 Ga0451845_0331327 Ga0451845_0331327_663_1880 405
1073 3300041509 Ga0451843_0429565 Ga0451843_0429565_753_1970 405
1074 3300042007 Ga0439449_0015080 Ga0439449_0015080_992_2209 405
1075 3300042007 Ga0439449_0037976 Ga0439449_0037976_427_1644 405
1076 3300044683 Ga0466965_0076334 Ga0466965_0076334_447_1676 405
1077 3300044684 Ga0466966_0097048 Ga0466966_0097048_420_1637 405
1078 3300044765 Ga0466970_0004213 Ga0466970_0004213_1280_2497 405
1079 3300044842 Ga0466957_0111140 Ga0466957_0111140_283_1500 405
1080 3300046459 Ga0495629_0039145 Ga0495629_0039145_80_1297 405
1081 3300046460 Ga0495638_0000687 Ga0495638_0000687_29746_30963 405
1082 3300046460 Ga0495638_0010851 Ga0495638_0010851_74_1291 405
1083 3300046462 Ga0495651_0043436 Ga0495651_0043436_942_2159 405
1084 3300046471 Ga0495650_0048953 Ga0495650_0048953_162_1379 405
1085 3300046474 Ga0495605_0000460 Ga0495605_0000460_5685_6902 405
1086 3300046492 Ga0495585_0011038 Ga0495585_0011038_331_1548 405
1087 3300046492 Ga0495585_0046508 Ga0495585_0046508_390_1607 405
1088 3300046506 Ga0495583_0013238 Ga0495583_0013238_400_1617 405
1089 3300046507 Ga0495606_0000959 Ga0495606_0000959_31347_32564 405
1090 3300046507 Ga0495606_0077124 Ga0495606_0077124_767_1984 405
1091 3300046512 Ga0495610_0007814 Ga0495610_0007814_333_1550 405
1092 3300046513 Ga0495616_0055894 Ga0495616_0055894_120_1337 405
1093 3300046516 Ga0495628_0045009 Ga0495628_0045009_878_2095 405
1094 3300046518 Ga0495631_0013261 Ga0495631_0013261_410_1627 405
1095 3300046519 Ga0495632_0002325 Ga0495632_0002325_4240_5457 405
1096 3300046519 Ga0495632_0066771 Ga0495632_0066771_197_1414 405
1097 3300046522 Ga0495643_0006856 Ga0495643_0006856_6151_7368 405
1098 3300046522 Ga0495643_0030079 Ga0495643_0030079_669_1886 405
1099 3300046522 Ga0495643_0031760 Ga0495643_0031760_696_1913 405
1100 3300046558 Ga0495633_0020647 Ga0495633_0020647_650_1867 405
1101 3300046616 Ga0495668_0005947 Ga0495668_0005947_5604_6821 405
1102 3300046660 Ga0495625_0010879 Ga0495625_0010879_1352_2569 405
1103 3300046674 Ga0495588_0001225 Ga0495588_0001225_835_2052 405
1104 3300046675 Ga0495657_0041037 Ga0495657_0041037_1147_2364 405
1105 3300046694 Ga0495649_0052616 Ga0495649_0052616_249_1466 405
1106 3300046810 Ga0495660_0030040 Ga0495660_0030040_575_1792 405
1107 3300046810 Ga0495660_0056170 Ga0495660_0056170_386_1603 405
1108 3300047320 Ga0495672_0034276 Ga0495672_0034276_1074_2291 405
1109 3300047470 Ga0495681_0042887 Ga0495681_0042887_366_1583 405
1110 3300047472 Ga0495686_0000989 Ga0495686_0000989_26120_27337 405
1111 3300047472 Ga0495686_0019154 Ga0495686_0019154_112_1329 405
1112 3300047472 Ga0495686_0047323 Ga0495686_0047323_245_1462 405
1113 3300047472 Ga0495686_0089945 Ga0495686_0089945_318_1535 405
1114 3300048903 Ga0496100_0074167 Ga0496100_0074167_626_1843 405
1115 3300048905 Ga0496102_0094757 Ga0496102_0094757_1067_2284 405
1116 3300048906 Ga0496103_0005774 Ga0496103_0005774_760_1977 405
1117 3300048909 Ga0496106_0007752 Ga0496106_0007752_5736_6953 405
1118 3300048909 Ga0496106_0208759 Ga0496106_0208759_53_1270 405
1119 3300048910 Ga0496107_0114642 Ga0496107_0114642_491_1708 405
1120 3300048914 Ga0496111_0186323 Ga0496111_0186323_144_1361 405
1121 3300048917 Ga0496114_0156867 Ga0496114_0156867_182_1399 405
1122 3300048919 Ga0496116_0003692 Ga0496116_0003692_5910_7127 405
1123 3300048919 Ga0496116_0011986 Ga0496116_0011986_5883_7100 405
1124 3300048919 Ga0496116_0013279 Ga0496116_0013279_5346_6563 405
1125 3300048919 Ga0496116_0045233 Ga0496116_0045233_596_1813 405
1126 3300048920 Ga0496117_0000002 Ga0496117_0000002_893056_894273 405
1127 3300048920 Ga0496117_0001684 Ga0496117_0001684_4759_5976 405
1128 3300048920 Ga0496117_0013916 Ga0496117_0013916_19_1236 405
1129 3300048920 Ga0496117_0031949 Ga0496117_0031949_799_2016 405
1130 3300048920 Ga0496117_0078894 Ga0496117_0078894_15_1232 405
1131 3300048920 Ga0496117_0094613 Ga0496117_0094613_346_1563 405
1132 3300048921 Ga0496118_0000460 Ga0496118_0000460_19489_20706 405
1133 3300048921 Ga0496118_0000756 Ga0496118_0000756_24820_26037 405
1134 3300048921 Ga0496118_0004327 Ga0496118_0004327_8215_9432 405
1135 3300048922 Ga0496119_0009961 Ga0496119_0009961_5741_6958 405
1136 3300048922 Ga0496119_0012100 Ga0496119_0012100_4026_5252 405
1137 3300048922 Ga0496119_0037445 Ga0496119_0037445_402_1619 405
1138 3300048922 Ga0496119_0055707 Ga0496119_0055707_602_1819 405
1139 3300048923 Ga0496120_0000078 Ga0496120_0000078_89623_90840 405
1140 3300048923 Ga0496120_0001824 Ga0496120_0001824_10161_11390 405
1141 3300048923 Ga0496120_0005495 Ga0496120_0005495_5664_6881 405
1142 3300048923 Ga0496120_0010777 Ga0496120_0010777_80_1297 405
1143 3300048924 Ga0496121_0000001 Ga0496121_0000001_1181257_1182474 405
1144 3300048924 Ga0496121_0000182 Ga0496121_0000182_115951_117168 405
1145 3300048924 Ga0496121_0001247 Ga0496121_0001247_25590_26807 405
1146 3300048924 Ga0496121_0010224 Ga0496121_0010224_5543_6760 405
1147 3300048924 Ga0496121_0029857 Ga0496121_0029857_820_2037 405
1148 3300048925 Ga0496122_0000001 Ga0496122_0000001_199489_200706 405
1149 3300048925 Ga0496122_0004590 Ga0496122_0004590_8540_9757 405
1150 3300048925 Ga0496122_0012559 Ga0496122_0012559_2163_3380 405
1151 3300048925 Ga0496122_0013836 Ga0496122_0013836_5520_6737 405
1152 3300048925 Ga0496122_0037942 Ga0496122_0037942_1796_3022 405
1153 3300048925 Ga0496122_0044491 Ga0496122_0044491_2051_3268 405
1154 3300048925 Ga0496122_0045680 Ga0496122_0045680_935_2152 405
1155 3300048926 Ga0496123_0000001 Ga0496123_0000001_203220_204437 405
1156 3300048926 Ga0496123_0007000 Ga0496123_0007000_9490_10707 405
1157 3300048926 Ga0496123_0012058 Ga0496123_0012058_5297_6514 405
1158 3300048926 Ga0496123_0012459 Ga0496123_0012459_1025_2242 405
1159 3300048926 Ga0496123_0056256 Ga0496123_0056256_541_1758 405
1160 3300048927 Ga0496124_0000112 Ga0496124_0000112_84111_85328 405
1161 3300048927 Ga0496124_0008314 Ga0496124_0008314_7607_8824 405
1162 3300048927 Ga0496124_0012622 Ga0496124_0012622_5757_6974 405
1163 3300048927 Ga0496124_0015634 Ga0496124_0015634_1049_2266 405
1164 3300048927 Ga0496124_0024327 Ga0496124_0024327_553_1770 405
1165 3300048927 Ga0496124_0070150 Ga0496124_0070150_1093_2310 405
1166 3300048928 Ga0496125_0000001 Ga0496125_0000001_1339478_1340695 405
1167 3300048928 Ga0496125_0004146 Ga0496125_0004146_2779_3996 405
1168 3300048928 Ga0496125_0015487 Ga0496125_0015487_3308_4525 405
1169 3300048928 Ga0496125_0040643 Ga0496125_0040643_128_1345 405
1170 3300048929 Ga0496126_0045426 Ga0496126_0045426_2798_4027 405
1171 3300048929 Ga0496126_0052378 Ga0496126_0052378_536_1762 405
1172 3300048929 Ga0496126_0054169 Ga0496126_0054169_1375_2592 405
1173 3300048929 Ga0496126_0099260 Ga0496126_0099260_544_1761 405
1174 3300048929 Ga0496126_0185095 Ga0496126_0185095_17_1234 405
1175 3300049568 Ga0501031_0068405 Ga0501031_0068405_1071_2288 405
1176 3300049569 Ga0501032_0000201 Ga0501032_0000201_45243_46475 405
1177 3300049569 Ga0501032_0020787 Ga0501032_0020787_2222_3439 405
1178 3300049569 Ga0501032_0026712 Ga0501032_0026712_1643_2866 405
1179 3300049570 Ga0501033_0000132 Ga0501033_0000132_71187_72419 405
1180 3300049570 Ga0501033_0000201 Ga0501033_0000201_1985_3202 405
1181 3300049570 Ga0501033_0003702 Ga0501033_0003702_9916_11139 405
1182 3300049571 Ga0501034_0000005 Ga0501034_0000005_320841_322073 405
1183 3300049571 Ga0501034_0048119 Ga0501034_0048119_93_1310 405
1184 3300049571 Ga0501034_0153522 Ga0501034_0153522_844_2076 405
1185 3300049571 Ga0501034_0198266 Ga0501034_0198266_674_1891 405
1186 3300049571 Ga0501034_0200040 Ga0501034_0200040_474_1691 405
1187 3300049572 Ga0501036_0000005 Ga0501036_0000005_199709_200941 405
1188 3300049573 Ga0501037_0000045 Ga0501037_0000045_70588_71820 405
1189 3300049573 Ga0501037_0000753 Ga0501037_0000753_9982_11205 405
1190 3300049573 Ga0501037_0052335 Ga0501037_0052335_442_1665 405
1191 3300049573 Ga0501037_0054337 Ga0501037_0054337_1400_2617 405
1192 3300049574 Ga0501038_0000001 Ga0501038_0000001_320841_322073 405
1193 3300049574 Ga0501038_0167685 Ga0501038_0167685_389_1612 405
1194 3300049574 Ga0501038_0180847 Ga0501038_0180847_211_1428 405
1195 3300049575 Ga0501039_0000007 Ga0501039_0000007_175102_176334 405
1196 3300049576 Ga0501040_0076234 Ga0501040_0076234_132_1364 405
1197 3300049578 Ga0501042_0019271 Ga0501042_0019271_1116_2348 405
1198 3300049579 Ga0501043_0000031 Ga0501043_0000031_126325_127548 405
1199 3300049579 Ga0501043_0003831 Ga0501043_0003831_1900_3132 405
1200 3300049579 Ga0501043_0039104 Ga0501043_0039104_899_2116 405
1201 3300049579 Ga0501043_0107789 Ga0501043_0107789_43_1266 405
1202 3300049579 Ga0501043_0166819 Ga0501043_0166819_413_1636 405
1203 3300049580 Ga0501046_0134546 Ga0501046_0134546_184_1416 405
1204 3300049581 Ga0501047_0029467 Ga0501047_0029467_304_1536 405
1205 3300049581 Ga0501047_0042680 Ga0501047_0042680_1832_3055 405
1206 3300049581 Ga0501047_0130942 Ga0501047_0130942_861_2078 405
1207 3300049581 Ga0501047_0242965 Ga0501047_0242965_131_1354 405
1208 3300049582 Ga0501048_0031346 Ga0501048_0031346_2542_3774 405
1209 3300049585 Ga0501069_0000362 Ga0501069_0000362_10372_11595 405
1210 3300049585 Ga0501069_0035239 Ga0501069_0035239_490_1713 405
1211 3300049586 Ga0501070_0001857 Ga0501070_0001857_1144_2367 405
1212 3300049586 Ga0501070_0014344 Ga0501070_0014344_127_1359 405
1213 3300049586 Ga0501070_0018593 Ga0501070_0018593_2638_3861 405
1214 3300049586 Ga0501070_0024134 Ga0501070_0024134_1776_2999 405
1215 3300049586 Ga0501070_0115186 Ga0501070_0115186_261_1484 405
1216 3300049586 Ga0501070_0163009 Ga0501070_0163009_122_1345 405
1217 3300049587 Ga0501071_0060948 Ga0501071_0060948_751_1974 405
1218 3300049589 Ga0501073_0006987 Ga0501073_0006987_6710_7933 405
1219 3300049589 Ga0501073_0012864 Ga0501073_0012864_2590_3813 405
1220 3300049589 Ga0501073_0039895 Ga0501073_0039895_829_2061 405
1221 3300049590 Ga0501074_0002910 Ga0501074_0002910_923_2146 405
1222 3300049590 Ga0501074_0108661 Ga0501074_0108661_572_1804 405
1223 3300049742 Ga0501080_0006230 Ga0501080_0006230_9385_10617 405
1224 3300049742 Ga0501080_0054526 Ga0501080_0054526_712_1935 405
1225 3300049742 Ga0501080_0123188 Ga0501080_0123188_130_1353 405
1226 3300049744 Ga0501083_0001104 Ga0501083_0001104_10044_11267 405
1227 3300049744 Ga0501083_0121982 Ga0501083_0121982_351_1568 405
1228 3300049822 Ga0501035_0000008 Ga0501035_0000008_266720_267952 405
1229 3300049822 Ga0501035_0000036 Ga0501035_0000036_27929_29152 405
1230 3300049822 Ga0501035_0003084 Ga0501035_0003084_716_1939 405
1231 3300049822 Ga0501035_0003178 Ga0501035_0003178_2589_3806 405
1232 3300049822 Ga0501035_0005364 Ga0501035_0005364_4133_5356 405
1233 3300049822 Ga0501035_0029020 Ga0501035_0029020_2063_3286 405
1234 3300049822 Ga0501035_0099670 Ga0501035_0099670_463_1686 405
1235 3300049823 Ga0501044_0000001 Ga0501044_0000001_96015_97247 405
1236 3300049823 Ga0501044_0000011 Ga0501044_0000011_136643_137866 405
1237 3300049823 Ga0501044_0004154 Ga0501044_0004154_13293_14516 405
1238 3300049823 Ga0501044_0017912 Ga0501044_0017912_887_2110 405
1239 3300049823 Ga0501044_0050351 Ga0501044_0050351_1984_3207 405
1240 3300049824 Ga0501045_0016743 Ga0501045_0016743_3352_4584 405
1241 3300050489 nmdc:mga03683_10679_c1 nmdc:mga03683_10679_c1_1495_2712 405
1242 3300050489 nmdc:mga03683_903_c1 nmdc:mga03683_903_c1_2226_3443 405
1243 3300050491 nmdc:mga00v17_222_c2 nmdc:mga00v17_222_c2_4584_5801 405
1244 3300050491 nmdc:mga00v17_80_c1 nmdc:mga00v17_80_c1_24390_25607 405
1245 3300050492 nmdc:mga0yw44_1395_c1 nmdc:mga0yw44_1395_c1_6097_7317 405
1246 3300050493 nmdc:mga0k408_12079_c1 nmdc:mga0k408_12079_c1_811_2028 405
1247 3300050496 nmdc:mga07m45_6227_c1 nmdc:mga07m45_6227_c1_1957_3174 405
1248 3300050516 nmdc:mga0sz30_20665_c1 nmdc:mga0sz30_20665_c1_1013_2230 405
1249 3300050516 nmdc:mga0sz30_27106_c1 nmdc:mga0sz30_27106_c1_241_1458 405
1250 3300050516 nmdc:mga0sz30_8434_c1 nmdc:mga0sz30_8434_c1_1749_2966 405
1251 3300053083 Ga0495655_0008142 Ga0495655_0008142_700_1920 405
1252 3300053086 Ga0500578_0181128 Ga0500578_0181128_16_1233 405
1253 3300053111 Ga0500572_003721 Ga0500572_003721_1752_2969 405
1254 3300053118 Ga0500594_0000647 Ga0500594_0000647_5142_6359 405
1255 3300053122 Ga0500608_021456 Ga0500608_021456_1059_2276 405
1256 3300053125 Ga0500618_000871 Ga0500618_000871_9296_10513 405
1257 3300053125 Ga0500618_004612 Ga0500618_004612_2663_3880 405
1258 3300053125 Ga0500618_020318 Ga0500618_020318_44_1261 405
1259 3300053134 Ga0500658_0001748 Ga0500658_0001748_2757_3974 405
1260 3300053134 Ga0500658_0008813 Ga0500658_0008813_915_2132 405
1261 3300053137 Ga0500561_0000062 Ga0500561_0000062_14782_15999 405
1262 3300053139 Ga0500568_0000212 Ga0500568_0000212_42020_43237 405
1263 3300053139 Ga0500568_0001356 Ga0500568_0001356_5290_6507 405
1264 3300053139 Ga0500568_0004459 Ga0500568_0004459_809_2026 405
1265 3300053139 Ga0500568_0041443 Ga0500568_0041443_504_1721 405
1266 3300053148 Ga0500590_014477 Ga0500590_014477_886_2103 405
1267 3300053151 Ga0500604_0019893 Ga0500604_0019893_632_1849 405
1268 3300053153 Ga0500616_0000647 Ga0500616_0000647_18681_19898 405
1269 3300053153 Ga0500616_0005012 Ga0500616_0005012_2513_3730 405
1270 3300053153 Ga0500616_0032687 Ga0500616_0032687_1561_2778 405
1271 3300053156 Ga0500622_0000158 Ga0500622_0000158_35163_36380 405
1272 3300053156 Ga0500622_0000178 Ga0500622_0000178_56676_57893 405
1273 3300053157 Ga0500624_000357 Ga0500624_000357_11445_12662 405
1274 3300053158 Ga0500627_0004905 Ga0500627_0004905_2888_4105 405
1275 3300053161 Ga0500634_0001576 Ga0500634_0001576_972_2189 405
1276 3300053161 Ga0500634_0054472 Ga0500634_0054472_710_1927 405
1277 3300053177 Ga0500636_0000019 Ga0500636_0000019_67715_68932 405
1278 3300053177 Ga0500636_0001577 Ga0500636_0001577_5640_6857 405
1279 3300060353 Ga0501082_0035934 Ga0501082_0035934_971_2188 405
1280 iso_pu_bacteria 2513237090 2513610946 405
1281 iso_pu_bacteria 2599185301 2599938336 405
1282 iso_pu_bacteria 2643221550 2643774223 405
1283 iso_pu_bacteria 2643221551 2643775802 405
1284 iso_pu_bacteria 2643221555 2643794249 405
1285 iso_pu_bacteria 2643221564 2643837563 405
1286 iso_pu_bacteria 2693429783 2694629830 405
1287 iso_pu_bacteria 2693429784 2694636297 405
1288 iso_pu_bacteria 2847670302 2847675956 405
1289 iso_pu_bacteria 2856314179 2856314486 405
1290 iso_pu_bacteria 2856364286 2856370526 405
1291 iso_pu_bacteria 2857349434 2857350651 405
1292 iso_pu_bacteria 2869285874 2869291747 405
1293 iso_pu_bacteria 2871429161 2871434957 405
1294 iso_pu_bacteria 2871474448 2871475968 405
1295 iso_pu_bacteria 2871488783 2871495599 405
1296 iso_pu_bacteria 2874146452 2874149347 405
1297 iso_pu_bacteria 2874155637 2874157610 405
1298 iso_pu_bacteria 2876413966 2876415813 405
1299 iso_pu_bacteria 2878035449 2878040027 405
1300 iso_pu_bacteria 2878745973 2878752091 405
1301 iso_pu_bacteria 2878753008 2878757806 405
1302 iso_pu_bacteria 2878788777 2878794735 405
1303 iso_pu_bacteria 2881155292 2881155691 405
1304 iso_pu_bacteria 2881845957 2881849269 405
1305 iso_pu_bacteria 2881853255 2881855473 405
1306 iso_pu_bacteria 2881861095 2881868776 405
1307 iso_pu_bacteria 2882632389 2882638670 405
1308 iso_pu_bacteria 2882912400 2882918682 405
1309 iso_pu_bacteria 2885318864 2885325266 405
1310 iso_pu_bacteria 2885342637 2885348661 405
1311 iso_pu_bacteria 2885350715 2885353670 405
1312 iso_pu_bacteria 2888350351 2888356176 405
1313 iso_pu_bacteria 2889010040 2889011105 405
1314 iso_pu_bacteria 2889016732 2889017170 405
1315 iso_pu_bacteria 2903492973 2903493351 405
1316 iso_pu_bacteria 2903492973 2903506523 405
1317 iso_pu_bacteria 2906308376 2906314485 405
1318 iso_pu_bacteria 2906321335 2906327653 405
1319 iso_pu_bacteria 2906354277 2906359712 405
1320 iso_pu_bacteria 2906414383 2906414440 405
1321 iso_pu_bacteria 2922130491 2922135047 405
1322 iso_pu_bacteria 2922185730 2922189210 405
1323 iso_pu_bacteria 2924784321 2924785699 405
1324 iso_pu_bacteria 2937813078 2937816212 405
1325 iso_pu_bacteria 2937843397 2937846094 405
1326 iso_pu_bacteria 2938014810 2938020937 405
1327 iso_pu_bacteria 2958100919 2958101548 405
1328 iso_pu_bacteria 2958130278 2958136145 405
1329 iso_pu_bacteria 2958172287 2958176684 405
1330 iso_pu_bacteria 2958179912 2958185613 405
1331 iso_pu_bacteria 2961077736 2961083990 405
1332 iso_pu_bacteria 2961127735 2961128657 405
1333 iso_pu_bacteria 2961170736 2961174349 405
1334 iso_pu_bacteria 2965119406 2965125690 405
1335 iso_pu_bacteria 2967996073 2968000339 405
1336 iso_pu_bacteria 2968003550 2968003776 405
1337 iso_pu_bacteria 2968117919 2968121105 405
1338 iso_pu_bacteria 2970503327 2970506936 405
1339 iso_pu_bacteria 2977821940 2977822338 405
1340 iso_pu_bacteria 2977828996 2977833759 405
1341 iso_pu_bacteria 2977843712 2977846448 405
1342 iso_pu_bacteria 2977942078 2977947644 405
1343 iso_pu_bacteria 2977971508 2977973660 405
1344 iso_pu_bacteria 2979710463 2979711677 405
1345 iso_pu_bacteria 2979742915 2979751385 405
1346 iso_pu_bacteria 2979808191 2979812131 405
1347 iso_pu_bacteria 2987636660 2987637835 405
1348 iso_pu_bacteria 2987652177 2987653857 405
1349 iso_pu_bacteria 2996336353 2996336565 405
1350 iso_pu_bacteria 3004203850 3004205843 405
1351 iso_pu_bacteria 8004374579 8004379317 405
1352 iso_pu_bacteria 8004387939 8004394527 405
1353 iso_pu_bacteria 8004633249 8004633418 405
1354 iso_pu_bacteria 8004640170 8004640341 405
1355 iso_pu_bacteria 8004714634 8004720747 405
1356 3300053140 Ga0500573_0003702 Ga0500573_0003702_530_1765 406
1357 iso_pu_bacteria 2643221718 2644654654 406
1358 iso_pu_bacteria 2984601300 2984603339 406
1359 3300046530 Ga0495654_0001209 Ga0495654_0001209_2218_3498 407
1360 3300053125 Ga0500618_000510 Ga0500618_000510_18121_19401 407
1361 iso_pu_bacteria 3005416602 3005420478 407
1362 iso_pu_bacteria 8005314921 8005317429 407
1363 3300005331 Ga0070670_100056538 Ga0070670_1000565382 409
1364 3300021327 Ga0214543_1000064 Ga0214543_1000064142 409
1365 3300025206 Ga0209435_100022 Ga0209435_100022196 409
1366 3300025246 Ga0209646_1000078 Ga0209646_1000078196 409
1367 3300025250 Ga0209026_1000065 Ga0209026_1000065196 409
1368 3300025256 Ga0209759_1000055 Ga0209759_1000055196 409
1369 3300025925 Ga0207650_10065133 Ga0207650_100651333 409
1370 3300031548 Ga0307408_100025176 Ga0307408_1000251761 409
1371 3300041406 Ga0439439_0021574 Ga0439439_0021574_191_1450 409
1372 3300046529 Ga0495652_0066969 Ga0495652_0066969_362_1624 409
1373 3300046660 Ga0495625_0039680 Ga0495625_0039680_822_2081 409
1374 3300048919 Ga0496116_0000061 Ga0496116_0000061_73890_75152 409
1375 3300048921 Ga0496118_0044985 Ga0496118_0044985_178_1446 409
1376 3300048926 Ga0496123_0095531 Ga0496123_0095531_121_1383 409
1377 3300048927 Ga0496124_0208734 Ga0496124_0208734_21_1283 409
1378 3300048929 Ga0496126_0000397 Ga0496126_0000397_33691_34953 409
1379 iso_pu_bacteria 2510917022 2511132483 409
1380 iso_pu_bacteria 2582581307 2585272906 409
1381 iso_pu_bacteria 2585427531 2585558186 409
1382 iso_pu_bacteria 2585427609 2585904826 409
1383 iso_pu_bacteria 2585428125 2587980058 409
1384 iso_pu_bacteria 8005658619 8005659163 409
1385 iso_pu_bacteria 8024486573 8024492423 409
1386 3300006353 Ga0075370_10014017 Ga0075370_100140175 411
1387 iso_pu_bacteria 643692032 643825568 414
1388 3300001979 JGI24740J21852_10000001 JGI24740J21852_10000001172 418
1389 3300002704 JGI25155J39150_1000011 JGI25155J39150_100001114 418
1390 3300002705 JGI25156J39149_1000027 JGI25156J39149_100002714 418
1391 3300002737 JGI25162J39368_1000963 JGI25162J39368_10009632 418
1392 3300002741 JGI25157J39369_1000010 JGI25157J39369_1000010197 418
1393 3300003214 JGI25165J46597_1000900 JGI25165J46597_100090015 418
1394 3300003214 JGI25165J46597_1001027 JGI25165J46597_100102719 418
1395 3300048922 Ga0496119_0021313 Ga0496119_0021313_1235_2491 418
1396 3300048925 Ga0496122_0031709 Ga0496122_0031709_786_2042 418
1397 3300048927 Ga0496124_0029389 Ga0496124_0029389_2114_3370 418
1398 3300048928 Ga0496125_0097657 Ga0496125_0097657_457_1713 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13286

HD_assoc

Phosphohydrolase-associated domain

303

394

0.94

PF01966

HD

HD domain

75

217

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dqb-assembly1.cif.gz_B crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8967 27 411
2dqb-assembly1.cif.gz_E crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8852 27 411
2dqb-assembly1.cif.gz_C crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8809 20 411
2dqb-assembly1.cif.gz_D crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8802 24 411
2dqb-assembly1.cif.gz_F crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8791 20 411
ID Description Score Start End Superfamily
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8838 27 411 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8513 27 411 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7369 27 403 1.10.3210.10
af_Q58554_1_263_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6885 57 410 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6776 27 403 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A5R2MTS3-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9907 253 336 GO:0016787
AF-A0A529FL15-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9741 256 418 GO:0016787
AF-A0A3S1E6P1-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9677 234 418 GO:0016787
AF-A0A519YBG0-F1-model_v4 deleted 0.9665 245 418
AF-A0A529X4X1-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.966 207 418 GO:0016787

Feature Viewer

pLDDT pTM Quality
80.87 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map