F493651
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1398 | 1076 | 549 | 403 |
Family's Representative Sequence
| Representative Sequence | 3300048921|Ga0496118_0034154|Ga0496118_0034154_1250_2461 |
| Length | 403 |
| Sequence | MTIDRRALGFGNSDRAIYAADPWTTRGRLYPENSSPTRSDFQRDRDRIVHTTAFRRLKHKTQVFIAQDGDHYRTRLTHTIEVAQIARALARALKLDEDLAEGVALVHDFGHTPFGHTGEDALHEVLLPYGGFDHNAQSLRIVTKLERRYADFDGINLTWESLEGLVKHNGPLLTKDGTGTRGPQPILDYCEIHDLQLDTFASLEAQVAAIADDIAYNTHDIDDGLRSGYLTFDMLEDIPFLSGLMGEVRERYPTLEPSRFTHEIMRRQITRMVEDVISVAQERLADIRPESADDVRHANRVIATFSQGMAETDRQIKAMLFKRIYRHPDIMRIRSGAAQIVTDLFSAYMANPKEMQSHYWVDHIAGLAEAPKARHVGDYLAGMTDTYAISAHRRLFDQTPDLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 9 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 10 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 11 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 12 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 13 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 14 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 15 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 16 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 17 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 18 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 19 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 20 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 21 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 22 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 23 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 24 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 25 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 26 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 27 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 28 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 29 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 30 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 31 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 32 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 33 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 34 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 35 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 36 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 37 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 38 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 39 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 40 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 41 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 42 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 43 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 44 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 45 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 46 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 47 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 48 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 49 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 50 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 51 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 52 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 53 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 54 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 55 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 56 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 57 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 58 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 59 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 60 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 61 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 62 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 63 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 64 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 65 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 66 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 67 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 68 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 69 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 70 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 71 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 72 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 73 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 74 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 75 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 76 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 77 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 78 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 79 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 80 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 81 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 82 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 83 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 84 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 85 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 86 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 87 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 88 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 89 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 90 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 91 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 92 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 93 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 94 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 95 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 96 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 97 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 98 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 99 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 100 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 101 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 102 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 103 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 104 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 105 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 106 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 107 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 108 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 109 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 110 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 111 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 112 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 113 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 114 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 115 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 116 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 117 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 118 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 119 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 120 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 121 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 122 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 123 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 124 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 125 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 126 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 127 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 128 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 129 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 130 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 131 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 132 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 133 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 134 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 135 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 136 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 137 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 138 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 139 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 140 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 141 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 142 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 143 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 144 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 145 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 146 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 147 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 148 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 149 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 150 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 151 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 152 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 153 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 154 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 155 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 156 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 157 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 158 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 159 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 160 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 161 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 162 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 163 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 164 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 165 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 166 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 167 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 168 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 169 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 170 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 171 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 172 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 173 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 174 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 175 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 176 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 177 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 178 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 179 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 180 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 181 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 182 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 183 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 184 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 185 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 186 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 187 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 188 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 189 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 190 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 191 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 192 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 193 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 194 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 195 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 196 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 197 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 198 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 199 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 200 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 201 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 202 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 203 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 204 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 205 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 206 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 207 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 208 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 209 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 210 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 211 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 212 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 213 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 214 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 215 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 216 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 217 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 218 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 219 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 220 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 221 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 222 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 223 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 224 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 225 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 226 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 227 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 228 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 229 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 230 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 231 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 232 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 233 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 234 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 235 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 236 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 237 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 238 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 239 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 240 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 241 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 242 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 243 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 244 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 245 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 246 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 247 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 248 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 249 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 250 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 251 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 252 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 253 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 254 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 255 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 256 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 257 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 258 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 259 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 260 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 261 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 262 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 263 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 264 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 265 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 266 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 267 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 268 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 269 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 270 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 271 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 272 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 273 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 274 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 275 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 276 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 277 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 278 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 279 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 280 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 281 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 282 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 283 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 284 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 285 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 286 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 287 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 288 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 289 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 290 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 291 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 292 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 293 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 294 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 295 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 296 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 297 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 298 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 299 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 300 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 301 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 302 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 303 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 304 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 305 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 306 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 307 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 308 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 309 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 310 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 311 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 312 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 313 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 314 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 315 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 316 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 317 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 318 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 319 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 320 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 321 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 322 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 323 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 324 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 325 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 326 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 327 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 328 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 329 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 330 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 331 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 332 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 333 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 334 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 335 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 336 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 337 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 338 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 339 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 340 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 341 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 342 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 343 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 344 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 345 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 346 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 347 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 348 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 349 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 350 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 351 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 352 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 353 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 354 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 355 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 356 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 357 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 358 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 359 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 360 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 361 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 362 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 363 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 364 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 365 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 366 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 367 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 368 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 369 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 370 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 371 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 372 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 373 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 374 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 375 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 376 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 377 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 378 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 379 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 380 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 381 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 382 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 383 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 384 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 385 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 386 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 387 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 388 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 389 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 390 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 391 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 392 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 393 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 394 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 395 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 396 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 397 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 398 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 399 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 400 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 401 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 402 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 403 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 404 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 405 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 406 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 407 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 408 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 409 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 410 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 411 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 412 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 413 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 414 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 415 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 416 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 417 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 418 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 419 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 420 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 421 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 422 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 423 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 424 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 425 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 426 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 427 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 428 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 429 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 430 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 431 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 432 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 433 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 434 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 435 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 436 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 437 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 438 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 439 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 440 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 441 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 442 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 443 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 444 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 445 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 446 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 447 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 448 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 449 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 450 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 451 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 452 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 453 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 454 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 455 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 456 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 457 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 458 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 459 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 460 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 461 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 462 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 463 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 464 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 465 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 466 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 467 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 468 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 469 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 470 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 471 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 472 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 473 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 474 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 475 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 476 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 477 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 478 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 479 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 480 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 481 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 482 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 483 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 484 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 485 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 486 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 487 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 488 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 489 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 490 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 491 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 492 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 493 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 494 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 495 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 496 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 497 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 498 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 499 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 500 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 501 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 502 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 503 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 504 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 505 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 506 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 507 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 508 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 509 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 510 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 511 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 512 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 513 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 514 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 515 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 516 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 517 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 518 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 519 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 520 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 521 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 522 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 523 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 524 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 525 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 526 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 527 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 528 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 529 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 530 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 531 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 532 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 533 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 534 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 535 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 536 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 537 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 538 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 539 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 540 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 541 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 542 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 543 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 544 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 545 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 546 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 547 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 548 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 549 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 550 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 551 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 552 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 553 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 554 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 555 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 556 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 557 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 558 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 559 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 560 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 561 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 562 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 563 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 564 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 565 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 566 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 567 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 568 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 569 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 570 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 571 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 572 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 573 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 574 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 575 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 576 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 577 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 578 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 579 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 580 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 581 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 582 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 583 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 584 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 585 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 586 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 587 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 588 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 589 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 590 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 591 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 592 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 593 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 594 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 595 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 596 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 597 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 598 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 599 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 600 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 601 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 602 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 603 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 604 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 605 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 606 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 607 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 608 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 609 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 610 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 611 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 612 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 613 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 614 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 615 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 616 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 617 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 618 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 619 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 620 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 621 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 622 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 623 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 624 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 625 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 626 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 627 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 628 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 629 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 630 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 631 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 632 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 633 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 634 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 635 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 636 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 637 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 638 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 639 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 640 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 641 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 642 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 643 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 644 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 645 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 646 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 647 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 648 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 649 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 650 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 651 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 652 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 653 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 654 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 655 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 656 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 657 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 658 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 659 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 660 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 661 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 662 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 663 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 664 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 665 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 666 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 667 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 668 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 669 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 670 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 671 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 672 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 673 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 674 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 675 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 676 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 677 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 678 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 679 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 680 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 681 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 682 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 683 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 684 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 685 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 686 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 687 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 688 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 689 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 690 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 691 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 692 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 693 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 694 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 695 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 696 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 697 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 698 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 699 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 700 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 701 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 702 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 703 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 704 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 705 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 706 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 707 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 708 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 709 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 710 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 711 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 712 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 713 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 714 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 715 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 716 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 717 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 718 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 719 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 720 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 721 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 722 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 723 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 724 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 725 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 726 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 727 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 728 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 729 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 730 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 731 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 732 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 733 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 734 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 735 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 736 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 737 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 738 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 739 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 740 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 741 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 742 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 743 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 744 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 745 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 746 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 747 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 748 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 749 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 750 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 751 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 752 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 753 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 754 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 755 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 756 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 757 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 758 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 759 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 760 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 761 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 762 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 763 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 764 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 765 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 766 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 767 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 768 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 769 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 770 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 771 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 772 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 773 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 774 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 775 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 776 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 777 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 778 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 779 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 780 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 781 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 782 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 783 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 784 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 785 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 786 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 787 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 788 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 789 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 790 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 791 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 792 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 793 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 794 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 795 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 796 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 797 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 798 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 799 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 800 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 801 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 802 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 803 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 804 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 805 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 806 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 807 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 808 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 809 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 810 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 811 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 812 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 813 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 814 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 815 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 816 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 817 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 818 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 819 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 820 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 821 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 822 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 823 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 824 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 825 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 826 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 827 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 828 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 829 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 830 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 831 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 832 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 833 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 834 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 835 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 836 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 837 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 838 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 839 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 840 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 841 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 842 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 843 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 844 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 845 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 846 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 847 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 848 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 849 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 850 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 851 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 852 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 853 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 854 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 855 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 856 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 857 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 858 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 859 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 860 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 861 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 862 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 863 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 864 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 865 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 866 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 867 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 868 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 869 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 870 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 871 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 872 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 873 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 874 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 875 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 876 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 877 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 878 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 879 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 880 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 881 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 882 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 883 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 884 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 885 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 886 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 887 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 888 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 889 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 890 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 891 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 892 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 893 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 894 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 895 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 896 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 897 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 898 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 899 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 900 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 901 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 902 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 903 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 904 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 905 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 906 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 907 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 908 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 909 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 910 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 911 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 912 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 916 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 917 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 918 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 919 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 920 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 922 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 933 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 936 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 937 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 938 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 939 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 940 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 941 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 942 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 943 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 944 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 945 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 946 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 947 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 948 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 949 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 950 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 951 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 952 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 953 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 954 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 955 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 956 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 957 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 958 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 959 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 960 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 961 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 962 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 963 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 964 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 965 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 966 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 967 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 968 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 969 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 970 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 971 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 972 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 973 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 974 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 975 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 976 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 977 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 978 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 979 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 980 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 981 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 982 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 983 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 984 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 985 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 986 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 987 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 988 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 989 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 990 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 991 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 992 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 993 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 994 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 995 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 996 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 997 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 998 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 999 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1000 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1001 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1002 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1003 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1004 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1005 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1006 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1007 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1008 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1009 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1010 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1011 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1012 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1013 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1014 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1015 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1016 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1017 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1018 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1019 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1020 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1021 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1022 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1023 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1024 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1025 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1026 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1027 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1028 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1029 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1030 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1031 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1032 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1033 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1034 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1035 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1036 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1037 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1038 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1039 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1040 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1041 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1042 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1043 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1044 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1045 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1046 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1047 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1048 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1049 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1050 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1051 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1052 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1053 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1054 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1055 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1056 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1057 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1058 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1059 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1060 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1061 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1062 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1063 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1064 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1065 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1066 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1067 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1068 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1069 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1070 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1071 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1072 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1073 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1074 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1075 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1076 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 39.27 |
| Metatranscriptomes | 0 |
| Isolates | 60.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 15.16 |
| Nodule | 47.07 |
| Rhizoplane | 1.57 |
| Rhizosphere | 19.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000001 | 3300001979 | Bacteria | 168537 |
| 2 | JGI24740J21852_10007318 | 3300001979 | Bacteria | 4497 |
| 3 | JGI24740J21852_10010983 | 3300001979 | Bacteria | 3462 |
| 4 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 5 | JGI25156J39149_1000027 | 3300002705 | Bacteria | 127396 |
| 6 | JGI25156J39149_1001896 | 3300002705 | Bacteria | 8143 |
| 7 | JGI25162J39368_1000963 | 3300002737 | Bacteria | 18339 |
| 8 | JGI25162J39368_1002413 | 3300002737 | Bacteria | 7323 |
| 9 | JGI25154J39366_1000181 | 3300002738 | Bacteria | 49117 |
| 10 | JGI25158J39367_1000135 | 3300002739 | Bacteria | 17270 |
| 11 | JGI25158J39367_1000975 | 3300002739 | Bacteria | 5264 |
| 12 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 13 | JGI25157J39369_1001076 | 3300002741 | Bacteria | 12316 |
| 14 | JGI25152J39213_1000534 | 3300002773 | Bacteria | 21021 |
| 15 | JGI25152J39213_1000545 | 3300002773 | Bacteria | 20722 |
| 16 | JGI25152J39213_1003397 | 3300002773 | Bacteria | 5454 |
| 17 | JGI25152J39213_1004376 | 3300002773 | Bacteria | 4465 |
| 18 | JGI25152J39213_1012822 | 3300002773 | Bacteria | 1776 |
| 19 | JGI25152J39213_1012828 | 3300002773 | Bacteria | 1776 |
| 20 | JGI25150J39212_1000047 | 3300002774 | Bacteria | 75103 |
| 21 | JGI25150J39212_1000380 | 3300002774 | Bacteria | 21273 |
| 22 | JGI25150J39212_1002361 | 3300002774 | Bacteria | 4738 |
| 23 | JGI25159J45721_1000006 | 3300002987 | Bacteria | 188201 |
| 24 | JGI25159J45721_1001165 | 3300002987 | Bacteria | 11213 |
| 25 | JGI25159J45721_1002092 | 3300002987 | Bacteria | 7840 |
| 26 | JGI25151J46595_10000126 | 3300003187 | Bacteria | 103193 |
| 27 | JGI25151J46595_10011907 | 3300003187 | Bacteria | 3977 |
| 28 | JGI25165J46597_1000062 | 3300003214 | Bacteria | 206459 |
| 29 | JGI25165J46597_1000900 | 3300003214 | Bacteria | 20669 |
| 30 | JGI25165J46597_1000920 | 3300003214 | Bacteria | 20377 |
| 31 | JGI25165J46597_1001027 | 3300003214 | Bacteria | 18335 |
| 32 | JGI25153J46596_10001078 | 3300003215 | Bacteria | 16640 |
| 33 | JGI25153J46596_10007194 | 3300003215 | Bacteria | 5517 |
| 34 | JGI25153J46596_10031675 | 3300003215 | Bacteria | 1776 |
| 35 | JGI25153J46596_10031676 | 3300003215 | Bacteria | 1776 |
| 36 | JGI25153J46596_10033910 | 3300003215 | Bacteria | 1677 |
| 37 | rootL2_10018543 | 3300003322 | Bacteria | 7640 |
| 38 | rootH1_10019945 | 3300003323 | Bacteria | 1750 |
| 39 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 40 | JGI25160J50197_1000019 | 3300003354 | Bacteria | 233980 |
| 41 | JGI25160J50197_1000664 | 3300003354 | Bacteria | 19152 |
| 42 | JGI25160J50197_1008485 | 3300003354 | Bacteria | 3910 |
| 43 | JGI25160J50197_1012480 | 3300003354 | Bacteria | 2945 |
| 44 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 45 | JGI25161J50226_1000467 | 3300003374 | Bacteria | 18513 |
| 46 | JGI25161J50226_1000680 | 3300003374 | Bacteria | 13469 |
| 47 | JGI25161J50226_1000904 | 3300003374 | Bacteria | 10676 |
| 48 | Ga0055542_1001237 | 3300003762 | Bacteria | 14181 |
| 49 | Ga0055526_1000462 | 3300003771 | Bacteria | 32312 |
| 50 | Ga0055526_1001096 | 3300003771 | Bacteria | 19688 |
| 51 | Ga0055526_1003315 | 3300003771 | Bacteria | 10309 |
| 52 | Ga0055526_1008997 | 3300003771 | Bacteria | 4884 |
| 53 | Ga0055524_1001178 | 3300003775 | Bacteria | 15594 |
| 54 | Ga0055524_1002226 | 3300003775 | Bacteria | 10159 |
| 55 | Ga0055524_1003918 | 3300003775 | Bacteria | 7052 |
| 56 | Ga0055536_1002723 | 3300003781 | Bacteria | 9796 |
| 57 | Ga0055528_1000051 | 3300003790 | Bacteria | 91974 |
| 58 | Ga0055528_1000448 | 3300003790 | Bacteria | 32948 |
| 59 | Ga0055528_1006972 | 3300003790 | Bacteria | 5058 |
| 60 | Ga0055528_1007775 | 3300003790 | Bacteria | 4690 |
| 61 | Ga0055540_1002665 | 3300003792 | Bacteria | 9227 |
| 62 | Ga0055531_10002882 | 3300003794 | Bacteria | 11201 |
| 63 | Ga0055531_10003417 | 3300003794 | Bacteria | 10139 |
| 64 | Ga0058692_1002873 | 3300003856 | Bacteria | 5604 |
| 65 | Ga0058692_1004482 | 3300003856 | Bacteria | 4131 |
| 66 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 67 | Ga0055543_1000275 | 3300004625 | Bacteria | 38327 |
| 68 | Ga0055543_1000867 | 3300004625 | Bacteria | 14523 |
| 69 | Ga0055543_1000935 | 3300004625 | Bacteria | 13507 |
| 70 | Ga0065165_1000149 | 3300005262 | Bacteria | 122370 |
| 71 | Ga0065165_1000272 | 3300005262 | Bacteria | 88086 |
| 72 | Ga0065165_1001907 | 3300005262 | Bacteria | 19958 |
| 73 | Ga0065165_1008226 | 3300005262 | Bacteria | 4938 |
| 74 | Ga0070670_100056538 | 3300005331 | Bacteria | 3367 |
| 75 | Ga0070660_100136645 | 3300005339 | Bacteria | 1964 |
| 76 | Ga0070671_100043803 | 3300005355 | Bacteria | 3719 |
| 77 | Ga0070667_100159462 | 3300005367 | Bacteria | 1986 |
| 78 | Ga0070663_100010806 | 3300005455 | Bacteria | 5702 |
| 79 | Ga0070665_100025262 | 3300005548 | Bacteria | 5986 |
| 80 | Ga0070665_100040711 | 3300005548 | Bacteria | 4670 |
| 81 | Ga0070665_100044244 | 3300005548 | Bacteria | 4471 |
| 82 | Ga0068856_100196996 | 3300005614 | Bacteria | 2028 |
| 83 | Ga0075365_10001830 | 3300006038 | Bacteria | 9956 |
| 84 | Ga0075365_10022285 | 3300006038 | Bacteria | 3967 |
| 85 | Ga0075365_10035815 | 3300006038 | Bacteria | 3213 |
| 86 | Ga0075365_10052238 | 3300006038 | Bacteria | 2702 |
| 87 | Ga0075363_100012575 | 3300006048 | Bacteria | 4084 |
| 88 | Ga0075363_100020583 | 3300006048 | Bacteria | 3310 |
| 89 | Ga0075363_100106348 | 3300006048 | Bacteria | 1556 |
| 90 | Ga0075364_10001918 | 3300006051 | Bacteria | 11579 |
| 91 | Ga0075364_10035513 | 3300006051 | Bacteria | 3221 |
| 92 | Ga0075362_10000297 | 3300006177 | Bacteria | 14109 |
| 93 | Ga0075362_10052629 | 3300006177 | Bacteria | 1825 |
| 94 | Ga0075367_10006256 | 3300006178 | Bacteria | 6000 |
| 95 | Ga0075367_10105249 | 3300006178 | Bacteria | 1728 |
| 96 | Ga0075369_10000735 | 3300006186 | Bacteria | 10608 |
| 97 | Ga0075369_10008326 | 3300006186 | Bacteria | 3987 |
| 98 | Ga0075369_10040288 | 3300006186 | Bacteria | 1996 |
| 99 | Ga0075366_10010376 | 3300006195 | Bacteria | 5229 |
| 100 | Ga0075366_10015206 | 3300006195 | Bacteria | 4407 |
| 101 | Ga0075370_10014017 | 3300006353 | Bacteria | 4269 |
| 102 | Ga0075370_10028124 | 3300006353 | Bacteria | 3124 |
| 103 | Ga0075370_10085274 | 3300006353 | Bacteria | 1818 |
| 104 | Ga0079104_1000129 | 3300006946 | Bacteria | 108427 |
| 105 | Ga0079104_1010900 | 3300006946 | Bacteria | 2956 |
| 106 | Ga0099826_10002926 | 3300006948 | Bacteria | 11342 |
| 107 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 108 | Ga0105240_10047849 | 3300009093 | Bacteria | 5408 |
| 109 | Ga0105248_10279957 | 3300009177 | Bacteria | 1878 |
| 110 | Ga0105237_10001991 | 3300009545 | Bacteria | 25984 |
| 111 | Ga0105237_10045855 | 3300009545 | Bacteria | 4399 |
| 112 | Ga0105238_10004648 | 3300009551 | Bacteria | 13589 |
| 113 | Ga0105249_10042443 | 3300009553 | Bacteria | 4136 |
| 114 | Ga0123341_1000001 | 3300009765 | Bacteria | 314908 |
| 115 | Ga0123342_1021352 | 3300009766 | Bacteria | 4559 |
| 116 | Ga0123342_1023582 | 3300009766 | Bacteria | 3969 |
| 117 | Ga0105239_10003100 | 3300010375 | Bacteria | 20616 |
| 118 | Ga0105239_10471607 | 3300010375 | Bacteria | 1425 |
| 119 | Ga0157373_10005196 | 3300013100 | Bacteria | 9780 |
| 120 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 121 | Ga0157370_10000309 | 3300013104 | Bacteria | 61167 |
| 122 | Ga0157370_10000665 | 3300013104 | Bacteria | 42812 |
| 123 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 124 | Ga0183363_1143 | 3300015690 | Bacteria | 17948 |
| 125 | Ga0214544_1000024 | 3300021320 | Bacteria | 163562 |
| 126 | Ga0214542_1000015 | 3300021321 | Bacteria | 227912 |
| 127 | Ga0214542_1026484 | 3300021321 | Bacteria | 2825 |
| 128 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 129 | Ga0214543_1000064 | 3300021327 | Bacteria | 126778 |
| 130 | Ga0228711_1000528 | 3300022739 | Bacteria | 47804 |
| 131 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 132 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 133 | Ga0209760_102358 | 3300025207 | Bacteria | 1776 |
| 134 | Ga0209436_100039 | 3300025208 | Bacteria | 75732 |
| 135 | Ga0209436_100390 | 3300025208 | Bacteria | 19835 |
| 136 | Ga0209436_109217 | 3300025208 | Bacteria | 1901 |
| 137 | Ga0209672_101326 | 3300025228 | Bacteria | 9432 |
| 138 | Ga0209563_104361 | 3300025230 | Bacteria | 2719 |
| 139 | Ga0209437_100153 | 3300025233 | Bacteria | 154068 |
| 140 | Ga0209437_100201 | 3300025233 | Bacteria | 119080 |
| 141 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 142 | Ga0207425_1001043 | 3300025245 | Bacteria | 12850 |
| 143 | Ga0207425_1006562 | 3300025245 | Bacteria | 3168 |
| 144 | Ga0207425_1008343 | 3300025245 | Bacteria | 2659 |
| 145 | Ga0207425_1011258 | 3300025245 | Bacteria | 2141 |
| 146 | Ga0207425_1020406 | 3300025245 | Bacteria | 1417 |
| 147 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 148 | Ga0209026_1000024 | 3300025250 | Bacteria | 355839 |
| 149 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 150 | Ga0209677_101154 | 3300025253 | Bacteria | 12276 |
| 151 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 152 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 153 | Ga0209759_1000389 | 3300025256 | Bacteria | 54772 |
| 154 | Ga0209129_1000034 | 3300025258 | Bacteria | 330950 |
| 155 | Ga0209129_1000140 | 3300025258 | Bacteria | 122574 |
| 156 | Ga0209129_1000470 | 3300025258 | Bacteria | 29594 |
| 157 | Ga0209129_1000947 | 3300025258 | Bacteria | 17460 |
| 158 | Ga0209129_1001001 | 3300025258 | Bacteria | 16842 |
| 159 | Ga0209129_1002822 | 3300025258 | Bacteria | 8060 |
| 160 | Ga0209129_1003476 | 3300025258 | Bacteria | 6823 |
| 161 | Ga0209233_1000129 | 3300025261 | Bacteria | 206511 |
| 162 | Ga0209233_1000175 | 3300025261 | Bacteria | 144221 |
| 163 | Ga0209233_1000226 | 3300025261 | Bacteria | 103045 |
| 164 | Ga0209233_1000248 | 3300025261 | Bacteria | 87812 |
| 165 | Ga0209455_1000183 | 3300025272 | Bacteria | 99952 |
| 166 | Ga0209673_1000068 | 3300025273 | Bacteria | 245891 |
| 167 | Ga0209673_1000230 | 3300025273 | Bacteria | 109505 |
| 168 | Ga0209673_1001478 | 3300025273 | Bacteria | 22012 |
| 169 | Ga0209673_1002170 | 3300025273 | Bacteria | 14508 |
| 170 | Ga0209673_1003247 | 3300025273 | Bacteria | 9822 |
| 171 | Ga0209673_1005149 | 3300025273 | Bacteria | 6689 |
| 172 | Ga0209673_1009980 | 3300025273 | Bacteria | 4048 |
| 173 | Ga0209673_1024873 | 3300025273 | Bacteria | 2002 |
| 174 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 175 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 176 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 177 | Ga0209676_1002948 | 3300025292 | Bacteria | 11110 |
| 178 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 179 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 180 | Ga0209025_1000097 | 3300025294 | Bacteria | 236632 |
| 181 | Ga0209025_1000702 | 3300025294 | Bacteria | 57061 |
| 182 | Ga0209025_1005300 | 3300025294 | Bacteria | 10589 |
| 183 | Ga0209025_1007667 | 3300025294 | Bacteria | 7972 |
| 184 | Ga0209025_1011412 | 3300025294 | Bacteria | 5858 |
| 185 | Ga0209025_1013526 | 3300025294 | Bacteria | 5119 |
| 186 | Ga0209025_1020919 | 3300025294 | Bacteria | 3549 |
| 187 | Ga0209025_1058870 | 3300025294 | Bacteria | 1455 |
| 188 | Ga0209564_1000137 | 3300025295 | Bacteria | 183874 |
| 189 | Ga0209564_1000373 | 3300025295 | Bacteria | 82785 |
| 190 | Ga0209564_1000740 | 3300025295 | Bacteria | 46349 |
| 191 | Ga0209564_1001522 | 3300025295 | Bacteria | 23049 |
| 192 | Ga0209564_1007164 | 3300025295 | Bacteria | 5815 |
| 193 | Ga0209758_1000080 | 3300025297 | Bacteria | 261472 |
| 194 | Ga0209758_1000520 | 3300025297 | Bacteria | 61722 |
| 195 | Ga0209758_1000633 | 3300025297 | Bacteria | 53969 |
| 196 | Ga0209758_1000822 | 3300025297 | Bacteria | 43449 |
| 197 | Ga0209758_1001240 | 3300025297 | Bacteria | 31770 |
| 198 | Ga0209758_1001887 | 3300025297 | Bacteria | 22869 |
| 199 | Ga0209758_1005650 | 3300025297 | Bacteria | 9476 |
| 200 | Ga0209758_1019549 | 3300025297 | Bacteria | 3260 |
| 201 | Ga0209758_1025829 | 3300025297 | Bacteria | 2564 |
| 202 | Ga0209050_1004383 | 3300025298 | Bacteria | 9579 |
| 203 | Ga0209050_1011067 | 3300025298 | Bacteria | 4338 |
| 204 | Ga0209256_1000319 | 3300025299 | Bacteria | 82827 |
| 205 | Ga0209256_1001551 | 3300025299 | Bacteria | 22876 |
| 206 | Ga0209256_1001710 | 3300025299 | Bacteria | 21107 |
| 207 | Ga0209256_1001971 | 3300025299 | Bacteria | 18502 |
| 208 | Ga0209256_1002545 | 3300025299 | Bacteria | 14596 |
| 209 | Ga0209256_1009788 | 3300025299 | Bacteria | 4132 |
| 210 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 211 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 212 | Ga0207426_1000094 | 3300025302 | Bacteria | 275293 |
| 213 | Ga0207426_1000111 | 3300025302 | Bacteria | 234032 |
| 214 | Ga0207426_1000853 | 3300025302 | Bacteria | 32038 |
| 215 | Ga0209051_1000166 | 3300025303 | Bacteria | 120265 |
| 216 | Ga0209051_1003640 | 3300025303 | Bacteria | 9983 |
| 217 | Ga0209051_1011805 | 3300025303 | Bacteria | 4278 |
| 218 | Ga0209051_1039818 | 3300025303 | Bacteria | 1692 |
| 219 | Ga0209051_1043535 | 3300025303 | Bacteria | 1574 |
| 220 | Ga0209257_1001307 | 3300025304 | Bacteria | 30337 |
| 221 | Ga0209257_1003894 | 3300025304 | Bacteria | 12172 |
| 222 | Ga0209257_1005270 | 3300025304 | Bacteria | 9217 |
| 223 | Ga0209257_1026675 | 3300025304 | Bacteria | 1940 |
| 224 | Ga0207680_10068849 | 3300025903 | Bacteria | 2185 |
| 225 | Ga0207647_10056612 | 3300025904 | Bacteria | 2405 |
| 226 | Ga0207705_10037788 | 3300025909 | Bacteria | 3455 |
| 227 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 228 | Ga0207695_10060785 | 3300025913 | Bacteria | 3908 |
| 229 | Ga0207671_10000276 | 3300025914 | Bacteria | 76490 |
| 230 | Ga0207671_10084009 | 3300025914 | Bacteria | 2391 |
| 231 | Ga0207694_10018118 | 3300025924 | Bacteria | 5324 |
| 232 | Ga0207650_10065133 | 3300025925 | Bacteria | 2730 |
| 233 | Ga0207644_10051817 | 3300025931 | Bacteria | 2947 |
| 234 | Ga0207667_10227130 | 3300025949 | Bacteria | 1912 |
| 235 | Ga0207668_10125634 | 3300025972 | Bacteria | 1950 |
| 236 | Ga0207640_10060572 | 3300025981 | Bacteria | 2503 |
| 237 | Ga0207678_10076269 | 3300026067 | Bacteria | 2871 |
| 238 | Ga0207678_10138722 | 3300026067 | Bacteria | 2075 |
| 239 | Ga0207698_10110899 | 3300026142 | Bacteria | 2299 |
| 240 | Ga0207698_10274067 | 3300026142 | Bacteria | 1557 |
| 241 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 242 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 243 | Ga0209281_1000268 | 3300027111 | Bacteria | 100508 |
| 244 | Ga0209281_1000578 | 3300027111 | Bacteria | 43096 |
| 245 | Ga0209371_1000178 | 3300027312 | Bacteria | 93894 |
| 246 | Ga0209371_1000382 | 3300027312 | Bacteria | 47344 |
| 247 | Ga0209371_1001444 | 3300027312 | Bacteria | 16135 |
| 248 | Ga0209371_1002027 | 3300027312 | Bacteria | 12116 |
| 249 | Ga0209282_1000026 | 3300027666 | Bacteria | 166272 |
| 250 | Ga0209282_1000095 | 3300027666 | Bacteria | 60099 |
| 251 | Ga0209813_10005272 | 3300027866 | Bacteria | 3129 |
| 252 | Ga0209813_10031440 | 3300027866 | Bacteria | 1567 |
| 253 | Ga0268266_10025145 | 3300028379 | Bacteria | 5068 |
| 254 | Ga0268266_10030382 | 3300028379 | Bacteria | 4590 |
| 255 | Ga0268266_10170832 | 3300028379 | Bacteria | 1973 |
| 256 | Ga0307515_10000274 | 3300028794 | Bacteria | 126011 |
| 257 | Ga0307515_10000656 | 3300028794 | Bacteria | 79816 |
| 258 | Ga0307515_10036369 | 3300028794 | Bacteria | 7967 |
| 259 | Ga0307515_10040065 | 3300028794 | Bacteria | 7420 |
| 260 | Ga0268256_1000837 | 3300030500 | Bacteria | 21879 |
| 261 | Ga0268256_1002533 | 3300030500 | Bacteria | 9201 |
| 262 | Ga0307513_10003280 | 3300031456 | Bacteria | 22033 |
| 263 | Ga0307513_10010898 | 3300031456 | Bacteria | 11355 |
| 264 | Ga0307408_100025176 | 3300031548 | Bacteria | 4073 |
| 265 | Ga0307408_100032605 | 3300031548 | Bacteria | 3633 |
| 266 | Ga0307405_10002526 | 3300031731 | Bacteria | 8099 |
| 267 | Ga0307405_10193754 | 3300031731 | Bacteria | 1470 |
| 268 | Ga0307406_10058516 | 3300031901 | Bacteria | 2477 |
| 269 | Ga0307412_10002014 | 3300031911 | Bacteria | 11279 |
| 270 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 271 | Ga0315913_1000137 | 3300033430 | Bacteria | 47802 |
| 272 | Ga0315915_1000014 | 3300033464 | Bacteria | 171068 |
| 273 | Ga0373927_0002192 | 3300035695 | Bacteria | 14352 |
| 274 | Ga0373925_0016473 | 3300037068 | Bacteria | 5355 |
| 275 | Ga0395899_0203361 | 3300037312 | Bacteria | 1380 |
| 276 | Ga0395898_0043866 | 3300037466 | Bacteria | 4406 |
| 277 | Ga0395905_0000700 | 3300037471 | Bacteria | 44432 |
| 278 | Ga0395905_0093994 | 3300037471 | Bacteria | 2812 |
| 279 | Ga0395905_0164691 | 3300037471 | Bacteria | 2083 |
| 280 | Ga0395901_0080673 | 3300038443 | Bacteria | 3398 |
| 281 | Ga0439436_0028385 | 3300041404 | Bacteria | 1633 |
| 282 | Ga0439439_0021574 | 3300041406 | Bacteria | 1605 |
| 283 | Ga0439465_0004501 | 3300041413 | Bacteria | 4508 |
| 284 | Ga0439465_0016694 | 3300041413 | Bacteria | 2290 |
| 285 | Ga0451787_319395 | 3300041441 | Bacteria | 3711 |
| 286 | Ga0451798_0610660 | 3300041458 | Bacteria | 2916 |
| 287 | Ga0451839_0405469 | 3300041496 | Bacteria | 3198 |
| 288 | Ga0451845_0331327 | 3300041501 | Bacteria | 1973 |
| 289 | Ga0451843_0429565 | 3300041509 | Bacteria | 3247 |
| 290 | Ga0439449_0015080 | 3300042007 | Bacteria | 2904 |
| 291 | Ga0439449_0037976 | 3300042007 | Bacteria | 1791 |
| 292 | Ga0466965_0076334 | 3300044683 | Bacteria | 1691 |
| 293 | Ga0466966_0097048 | 3300044684 | Bacteria | 1825 |
| 294 | Ga0466970_0004213 | 3300044765 | Bacteria | 7078 |
| 295 | Ga0466957_0111140 | 3300044842 | Bacteria | 1738 |
| 296 | Ga0495629_0039145 | 3300046459 | Bacteria | 3337 |
| 297 | Ga0495638_0000687 | 3300046460 | Bacteria | 36753 |
| 298 | Ga0495638_0010851 | 3300046460 | Bacteria | 6299 |
| 299 | Ga0495651_0043436 | 3300046462 | Bacteria | 3488 |
| 300 | Ga0495650_0048953 | 3300046471 | Bacteria | 1758 |
| 301 | Ga0495605_0000460 | 3300046474 | Bacteria | 36596 |
| 302 | Ga0495585_0011038 | 3300046492 | Bacteria | 5364 |
| 303 | Ga0495585_0046508 | 3300046492 | Bacteria | 2420 |
| 304 | Ga0495583_0013238 | 3300046506 | Bacteria | 4614 |
| 305 | Ga0495606_0000959 | 3300046507 | Bacteria | 42315 |
| 306 | Ga0495606_0077124 | 3300046507 | Bacteria | 2081 |
| 307 | Ga0495610_0007814 | 3300046512 | Bacteria | 7044 |
| 308 | Ga0495616_0055894 | 3300046513 | Bacteria | 1952 |
| 309 | Ga0495620_0036350 | 3300046515 | Bacteria | 2205 |
| 310 | Ga0495628_0045009 | 3300046516 | Bacteria | 3510 |
| 311 | Ga0495631_0013261 | 3300046518 | Bacteria | 4004 |
| 312 | Ga0495632_0002325 | 3300046519 | Bacteria | 14631 |
| 313 | Ga0495632_0066771 | 3300046519 | Bacteria | 1735 |
| 314 | Ga0495643_0006856 | 3300046522 | Bacteria | 7423 |
| 315 | Ga0495643_0030079 | 3300046522 | Bacteria | 3035 |
| 316 | Ga0495643_0031760 | 3300046522 | Bacteria | 2936 |
| 317 | Ga0495643_0061730 | 3300046522 | Bacteria | 1986 |
| 318 | Ga0495652_0066969 | 3300046529 | Bacteria | 3012 |
| 319 | Ga0495654_0001209 | 3300046530 | Bacteria | 18382 |
| 320 | Ga0495633_0020647 | 3300046558 | Bacteria | 3309 |
| 321 | Ga0495668_0005947 | 3300046616 | Bacteria | 8104 |
| 322 | Ga0495625_0010879 | 3300046660 | Bacteria | 7477 |
| 323 | Ga0495625_0039680 | 3300046660 | Bacteria | 3437 |
| 324 | Ga0495588_0001225 | 3300046674 | Bacteria | 11061 |
| 325 | Ga0495657_0041037 | 3300046675 | Bacteria | 3170 |
| 326 | Ga0495649_0052616 | 3300046694 | Bacteria | 2206 |
| 327 | Ga0495660_0030040 | 3300046810 | Bacteria | 3063 |
| 328 | Ga0495660_0056170 | 3300046810 | Bacteria | 2128 |
| 329 | Ga0495672_0034276 | 3300047320 | Bacteria | 3138 |
| 330 | Ga0495681_0042887 | 3300047470 | Bacteria | 2186 |
| 331 | Ga0495686_0000989 | 3300047472 | Bacteria | 34642 |
| 332 | Ga0495686_0019154 | 3300047472 | Bacteria | 4577 |
| 333 | Ga0495686_0047323 | 3300047472 | Bacteria | 2716 |
| 334 | Ga0495686_0089945 | 3300047472 | Bacteria | 1865 |
| 335 | Ga0495626_0058288 | 3300048091 | Bacteria | 1765 |
| 336 | Ga0496100_0074167 | 3300048903 | Bacteria | 2279 |
| 337 | Ga0496102_0094757 | 3300048905 | Bacteria | 2766 |
| 338 | Ga0496103_0005774 | 3300048906 | Bacteria | 7388 |
| 339 | Ga0496106_0007752 | 3300048909 | Bacteria | 7946 |
| 340 | Ga0496106_0208759 | 3300048909 | Bacteria | 1555 |
| 341 | Ga0496107_0114642 | 3300048910 | Bacteria | 1983 |
| 342 | Ga0496109_0172328 | 3300048912 | Bacteria | 2031 |
| 343 | Ga0496111_0186323 | 3300048914 | Bacteria | 1543 |
| 344 | Ga0496114_0156867 | 3300048917 | Bacteria | 1977 |
| 345 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 346 | Ga0496116_0003692 | 3300048919 | Bacteria | 14987 |
| 347 | Ga0496116_0011986 | 3300048919 | Bacteria | 7119 |
| 348 | Ga0496116_0013279 | 3300048919 | Bacteria | 6658 |
| 349 | Ga0496116_0045233 | 3300048919 | Bacteria | 2982 |
| 350 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 351 | Ga0496117_0001684 | 3300048920 | Bacteria | 30795 |
| 352 | Ga0496117_0013916 | 3300048920 | Bacteria | 6974 |
| 353 | Ga0496117_0031949 | 3300048920 | Bacteria | 4010 |
| 354 | Ga0496117_0078894 | 3300048920 | Bacteria | 2171 |
| 355 | Ga0496117_0094613 | 3300048920 | Bacteria | 1912 |
| 356 | Ga0496118_0000460 | 3300048921 | Bacteria | 67445 |
| 357 | Ga0496118_0000756 | 3300048921 | Bacteria | 52299 |
| 358 | Ga0496118_0004327 | 3300048921 | Bacteria | 16930 |
| 359 | Ga0496118_0034154 | 3300048921 | Bacteria | 4156 |
| 360 | Ga0496118_0044985 | 3300048921 | Bacteria | 3451 |
| 361 | Ga0496119_0009961 | 3300048922 | Bacteria | 8058 |
| 362 | Ga0496119_0012100 | 3300048922 | Bacteria | 7048 |
| 363 | Ga0496119_0021313 | 3300048922 | Bacteria | 4689 |
| 364 | Ga0496119_0037445 | 3300048922 | Bacteria | 3150 |
| 365 | Ga0496119_0055707 | 3300048922 | Bacteria | 2400 |
| 366 | Ga0496120_0000078 | 3300048923 | Bacteria | 162312 |
| 367 | Ga0496120_0001824 | 3300048923 | Bacteria | 23801 |
| 368 | Ga0496120_0005495 | 3300048923 | Bacteria | 10088 |
| 369 | Ga0496120_0010777 | 3300048923 | Bacteria | 6336 |
| 370 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 371 | Ga0496121_0000182 | 3300048924 | Bacteria | 139638 |
| 372 | Ga0496121_0001247 | 3300048924 | Bacteria | 44170 |
| 373 | Ga0496121_0010224 | 3300048924 | Bacteria | 10622 |
| 374 | Ga0496121_0029857 | 3300048924 | Bacteria | 5023 |
| 375 | Ga0496121_0216017 | 3300048924 | Bacteria | 1354 |
| 376 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 377 | Ga0496122_0000179 | 3300048925 | Bacteria | 149332 |
| 378 | Ga0496122_0004590 | 3300048925 | Bacteria | 17003 |
| 379 | Ga0496122_0012559 | 3300048925 | Bacteria | 8410 |
| 380 | Ga0496122_0013836 | 3300048925 | Bacteria | 7856 |
| 381 | Ga0496122_0031709 | 3300048925 | Bacteria | 4389 |
| 382 | Ga0496122_0037942 | 3300048925 | Bacteria | 3868 |
| 383 | Ga0496122_0044491 | 3300048925 | Bacteria | 3463 |
| 384 | Ga0496122_0045680 | 3300048925 | Bacteria | 3401 |
| 385 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 386 | Ga0496123_0000768 | 3300048926 | Bacteria | 51899 |
| 387 | Ga0496123_0007000 | 3300048926 | Bacteria | 10753 |
| 388 | Ga0496123_0012058 | 3300048926 | Bacteria | 7411 |
| 389 | Ga0496123_0012459 | 3300048926 | Bacteria | 7248 |
| 390 | Ga0496123_0056256 | 3300048926 | Bacteria | 2573 |
| 391 | Ga0496123_0095531 | 3300048926 | Bacteria | 1748 |
| 392 | Ga0496124_0000112 | 3300048927 | Bacteria | 166282 |
| 393 | Ga0496124_0008314 | 3300048927 | Bacteria | 10861 |
| 394 | Ga0496124_0012622 | 3300048927 | Bacteria | 8315 |
| 395 | Ga0496124_0015634 | 3300048927 | Bacteria | 7264 |
| 396 | Ga0496124_0024327 | 3300048927 | Bacteria | 5511 |
| 397 | Ga0496124_0028108 | 3300048927 | Bacteria | 5034 |
| 398 | Ga0496124_0029389 | 3300048927 | Bacteria | 4899 |
| 399 | Ga0496124_0070150 | 3300048927 | Bacteria | 2908 |
| 400 | Ga0496124_0122494 | 3300048927 | Bacteria | 2076 |
| 401 | Ga0496124_0194511 | 3300048927 | Bacteria | 1548 |
| 402 | Ga0496124_0208734 | 3300048927 | Bacteria | 1479 |
| 403 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 404 | Ga0496125_0004146 | 3300048928 | Bacteria | 16908 |
| 405 | Ga0496125_0015487 | 3300048928 | Bacteria | 7370 |
| 406 | Ga0496125_0040643 | 3300048928 | Bacteria | 3986 |
| 407 | Ga0496125_0097657 | 3300048928 | Bacteria | 2176 |
| 408 | Ga0496126_0000397 | 3300048929 | Bacteria | 89305 |
| 409 | Ga0496126_0045426 | 3300048929 | Bacteria | 4037 |
| 410 | Ga0496126_0052378 | 3300048929 | Bacteria | 3710 |
| 411 | Ga0496126_0054169 | 3300048929 | Bacteria | 3635 |
| 412 | Ga0496126_0099260 | 3300048929 | Bacteria | 2550 |
| 413 | Ga0496126_0185095 | 3300048929 | Bacteria | 1766 |
| 414 | Ga0496126_0344350 | 3300048929 | Bacteria | 1220 |
| 415 | Ga0496126_0347699 | 3300048929 | Bacteria | 1213 |
| 416 | Ga0501031_0010302 | 3300049568 | Bacteria | 6089 |
| 417 | Ga0501031_0068405 | 3300049568 | Bacteria | 2313 |
| 418 | Ga0501032_0000133 | 3300049569 | Bacteria | 60434 |
| 419 | Ga0501032_0000201 | 3300049569 | Bacteria | 49742 |
| 420 | Ga0501032_0020787 | 3300049569 | Bacteria | 4569 |
| 421 | Ga0501032_0026712 | 3300049569 | Bacteria | 3968 |
| 422 | Ga0501033_0000121 | 3300049570 | Bacteria | 75242 |
| 423 | Ga0501033_0000132 | 3300049570 | Bacteria | 72558 |
| 424 | Ga0501033_0000201 | 3300049570 | Bacteria | 57158 |
| 425 | Ga0501033_0003702 | 3300049570 | Bacteria | 12434 |
| 426 | Ga0501033_0027898 | 3300049570 | Bacteria | 4243 |
| 427 | Ga0501033_0039171 | 3300049570 | Bacteria | 3541 |
| 428 | Ga0501033_0050652 | 3300049570 | Bacteria | 3079 |
| 429 | Ga0501034_0000005 | 3300049571 | Bacteria | 367512 |
| 430 | Ga0501034_0000064 | 3300049571 | Bacteria | 189461 |
| 431 | Ga0501034_0029087 | 3300049571 | Bacteria | 5618 |
| 432 | Ga0501034_0048119 | 3300049571 | Bacteria | 4303 |
| 433 | Ga0501034_0058508 | 3300049571 | Bacteria | 3874 |
| 434 | Ga0501034_0153522 | 3300049571 | Bacteria | 2277 |
| 435 | Ga0501034_0198266 | 3300049571 | Bacteria | 1966 |
| 436 | Ga0501034_0200040 | 3300049571 | Bacteria | 1956 |
| 437 | Ga0501036_0000005 | 3300049572 | Bacteria | 246420 |
| 438 | Ga0501036_0000084 | 3300049572 | Bacteria | 58568 |
| 439 | Ga0501037_0000045 | 3300049573 | Bacteria | 117148 |
| 440 | Ga0501037_0000148 | 3300049573 | Bacteria | 65185 |
| 441 | Ga0501037_0000753 | 3300049573 | Bacteria | 24482 |
| 442 | Ga0501037_0052335 | 3300049573 | Bacteria | 2987 |
| 443 | Ga0501037_0054337 | 3300049573 | Bacteria | 2929 |
| 444 | Ga0501037_0158277 | 3300049573 | Bacteria | 1616 |
| 445 | Ga0501038_0000001 | 3300049574 | Bacteria | 375481 |
| 446 | Ga0501038_0000443 | 3300049574 | Bacteria | 36113 |
| 447 | Ga0501038_0071949 | 3300049574 | Bacteria | 2932 |
| 448 | Ga0501038_0167685 | 3300049574 | Bacteria | 1780 |
| 449 | Ga0501038_0180847 | 3300049574 | Bacteria | 1701 |
| 450 | Ga0501039_0000007 | 3300049575 | Bacteria | 277831 |
| 451 | Ga0501039_0000103 | 3300049575 | Bacteria | 57916 |
| 452 | Ga0501040_0076234 | 3300049576 | Bacteria | 2318 |
| 453 | Ga0501042_0019271 | 3300049578 | Bacteria | 4735 |
| 454 | Ga0501043_0000031 | 3300049579 | Bacteria | 140707 |
| 455 | Ga0501043_0001143 | 3300049579 | Bacteria | 23350 |
| 456 | Ga0501043_0003831 | 3300049579 | Bacteria | 12371 |
| 457 | Ga0501043_0039104 | 3300049579 | Bacteria | 3729 |
| 458 | Ga0501043_0107789 | 3300049579 | Bacteria | 2188 |
| 459 | Ga0501043_0166819 | 3300049579 | Bacteria | 1719 |
| 460 | Ga0501046_0021155 | 3300049580 | Bacteria | 5372 |
| 461 | Ga0501046_0134546 | 3300049580 | Bacteria | 1873 |
| 462 | Ga0501047_0029467 | 3300049581 | Bacteria | 5291 |
| 463 | Ga0501047_0038552 | 3300049581 | Bacteria | 4623 |
| 464 | Ga0501047_0042680 | 3300049581 | Bacteria | 4382 |
| 465 | Ga0501047_0130942 | 3300049581 | Bacteria | 2389 |
| 466 | Ga0501047_0144146 | 3300049581 | Bacteria | 2260 |
| 467 | Ga0501047_0242965 | 3300049581 | Bacteria | 1650 |
| 468 | Ga0501048_0031346 | 3300049582 | Bacteria | 3845 |
| 469 | Ga0501069_0000362 | 3300049585 | Bacteria | 20433 |
| 470 | Ga0501069_0035239 | 3300049585 | Bacteria | 2756 |
| 471 | Ga0501070_0001857 | 3300049586 | Bacteria | 18639 |
| 472 | Ga0501070_0014344 | 3300049586 | Bacteria | 6669 |
| 473 | Ga0501070_0018593 | 3300049586 | Bacteria | 5829 |
| 474 | Ga0501070_0024134 | 3300049586 | Bacteria | 5099 |
| 475 | Ga0501070_0115186 | 3300049586 | Bacteria | 2220 |
| 476 | Ga0501070_0163009 | 3300049586 | Bacteria | 1838 |
| 477 | Ga0501071_0060948 | 3300049587 | Bacteria | 2732 |
| 478 | Ga0501073_0006987 | 3300049589 | Bacteria | 8409 |
| 479 | Ga0501073_0012864 | 3300049589 | Bacteria | 6100 |
| 480 | Ga0501073_0039895 | 3300049589 | Bacteria | 3325 |
| 481 | Ga0501074_0002910 | 3300049590 | Bacteria | 12017 |
| 482 | Ga0501074_0108661 | 3300049590 | Bacteria | 1985 |
| 483 | Ga0501080_0006230 | 3300049742 | Bacteria | 10704 |
| 484 | Ga0501080_0054526 | 3300049742 | Bacteria | 3722 |
| 485 | Ga0501080_0123188 | 3300049742 | Bacteria | 2402 |
| 486 | Ga0501083_0001104 | 3300049744 | Bacteria | 18056 |
| 487 | Ga0501083_0121982 | 3300049744 | Bacteria | 1709 |
| 488 | Ga0501035_0000008 | 3300049822 | Bacteria | 313425 |
| 489 | Ga0501035_0000036 | 3300049822 | Bacteria | 165008 |
| 490 | Ga0501035_0000105 | 3300049822 | Bacteria | 104877 |
| 491 | Ga0501035_0003084 | 3300049822 | Bacteria | 16000 |
| 492 | Ga0501035_0003178 | 3300049822 | Bacteria | 15755 |
| 493 | Ga0501035_0005364 | 3300049822 | Bacteria | 12122 |
| 494 | Ga0501035_0029020 | 3300049822 | Bacteria | 5046 |
| 495 | Ga0501035_0099670 | 3300049822 | Bacteria | 2550 |
| 496 | Ga0501044_0000001 | 3300049823 | Bacteria | 418087 |
| 497 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 498 | Ga0501044_0003123 | 3300049823 | Bacteria | 18777 |
| 499 | Ga0501044_0004154 | 3300049823 | Bacteria | 16266 |
| 500 | Ga0501044_0017912 | 3300049823 | Bacteria | 7596 |
| 501 | Ga0501044_0020059 | 3300049823 | Bacteria | 7137 |
| 502 | Ga0501044_0050351 | 3300049823 | Bacteria | 4298 |
| 503 | Ga0501044_0254640 | 3300049823 | Bacteria | 1695 |
| 504 | Ga0501045_0016743 | 3300049824 | Bacteria | 5207 |
| 505 | nmdc:mga03683_10679_c1 | 3300050489 | Bacteria | 3299 |
| 506 | nmdc:mga03683_903_c1 | 3300050489 | Bacteria | 8535 |
| 507 | nmdc:mga00v17_222_c2 | 3300050491 | Bacteria | 26927 |
| 508 | nmdc:mga00v17_80_c1 | 3300050491 | Bacteria | 58183 |
| 509 | nmdc:mga0yw44_1395_c1 | 3300050492 | Bacteria | 9576 |
| 510 | nmdc:mga0yw44_6407_c1 | 3300050492 | Bacteria | 5685 |
| 511 | nmdc:mga0yw44_69639_c1 | 3300050492 | Bacteria | 2180 |
| 512 | nmdc:mga0k408_12079_c1 | 3300050493 | Bacteria | 4716 |
| 513 | nmdc:mga07m45_6227_c1 | 3300050496 | Bacteria | 6025 |
| 514 | nmdc:mga0sz30_20665_c1 | 3300050516 | Bacteria | 2657 |
| 515 | nmdc:mga0sz30_27106_c1 | 3300050516 | Bacteria | 2352 |
| 516 | nmdc:mga0sz30_8434_c1 | 3300050516 | Bacteria | 3893 |
| 517 | Ga0495655_0008142 | 3300053083 | Bacteria | 1980 |
| 518 | Ga0500578_0181128 | 3300053086 | Bacteria | 1298 |
| 519 | Ga0500572_003721 | 3300053111 | Bacteria | 3460 |
| 520 | Ga0500594_0000647 | 3300053118 | Bacteria | 7433 |
| 521 | Ga0500608_021456 | 3300053122 | Bacteria | 2985 |
| 522 | Ga0500618_000510 | 3300053125 | Bacteria | 24654 |
| 523 | Ga0500618_000871 | 3300053125 | Bacteria | 16116 |
| 524 | Ga0500618_004612 | 3300053125 | Bacteria | 4346 |
| 525 | Ga0500618_020318 | 3300053125 | Bacteria | 1627 |
| 526 | Ga0500658_0001748 | 3300053134 | Bacteria | 8573 |
| 527 | Ga0500658_0008813 | 3300053134 | Bacteria | 3723 |
| 528 | Ga0500658_0083936 | 3300053134 | Bacteria | 1367 |
| 529 | Ga0500561_0000062 | 3300053137 | Bacteria | 21493 |
| 530 | Ga0500568_0000212 | 3300053139 | Bacteria | 50122 |
| 531 | Ga0500568_0001356 | 3300053139 | Bacteria | 15924 |
| 532 | Ga0500568_0004459 | 3300053139 | Bacteria | 7476 |
| 533 | Ga0500568_0041443 | 3300053139 | Bacteria | 1850 |
| 534 | Ga0500573_0003702 | 3300053140 | Bacteria | 7954 |
| 535 | Ga0500590_014477 | 3300053148 | Bacteria | 4066 |
| 536 | Ga0500604_0019893 | 3300053151 | Bacteria | 1884 |
| 537 | Ga0500616_0000647 | 3300053153 | Bacteria | 41713 |
| 538 | Ga0500616_0005012 | 3300053153 | Bacteria | 9176 |
| 539 | Ga0500616_0032687 | 3300053153 | Bacteria | 2843 |
| 540 | Ga0500622_0000158 | 3300053156 | Bacteria | 71215 |
| 541 | Ga0500622_0000178 | 3300053156 | Bacteria | 69024 |
| 542 | Ga0500624_000357 | 3300053157 | Bacteria | 14815 |
| 543 | Ga0500627_0004905 | 3300053158 | Bacteria | 4371 |
| 544 | Ga0500627_0056350 | 3300053158 | Bacteria | 1722 |
| 545 | Ga0500634_0001576 | 3300053161 | Bacteria | 8977 |
| 546 | Ga0500634_0054472 | 3300053161 | Bacteria | 2143 |
| 547 | Ga0500636_0000019 | 3300053177 | Bacteria | 105042 |
| 548 | Ga0500636_0001577 | 3300053177 | Bacteria | 12406 |
| 549 | Ga0501082_0035934 | 3300060353 | Bacteria | 4270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0216017 | Ga0496121_0216017_80_1186 | 368 |
| 2 | iso_pu_bacteria | 2984537506 | 2984541058 | 370 |
| 3 | 3300049568 | Ga0501031_0010302 | Ga0501031_0010302_2686_3897 | 375 |
| 4 | 3300049569 | Ga0501032_0000133 | Ga0501032_0000133_29595_30806 | 375 |
| 5 | 3300049570 | Ga0501033_0000121 | Ga0501033_0000121_7685_8896 | 375 |
| 6 | 3300049571 | Ga0501034_0000064 | Ga0501034_0000064_28545_29756 | 375 |
| 7 | 3300049572 | Ga0501036_0000084 | Ga0501036_0000084_28545_29756 | 375 |
| 8 | 3300049573 | Ga0501037_0000148 | Ga0501037_0000148_29595_30806 | 375 |
| 9 | 3300049574 | Ga0501038_0000443 | Ga0501038_0000443_6358_7569 | 375 |
| 10 | 3300049575 | Ga0501039_0000103 | Ga0501039_0000103_28161_29372 | 375 |
| 11 | 3300049579 | Ga0501043_0001143 | Ga0501043_0001143_18646_19857 | 375 |
| 12 | 3300049580 | Ga0501046_0021155 | Ga0501046_0021155_3677_4888 | 375 |
| 13 | 3300049581 | Ga0501047_0144146 | Ga0501047_0144146_348_1559 | 375 |
| 14 | 3300049822 | Ga0501035_0000105 | Ga0501035_0000105_75139_76350 | 375 |
| 15 | 3300049823 | Ga0501044_0003123 | Ga0501044_0003123_6295_7506 | 375 |
| 16 | iso_pu_bacteria | 2965110997 | 2965115138 | 380 |
| 17 | 3300049571 | Ga0501034_0029087 | Ga0501034_0029087_69_1304 | 382 |
| 18 | 3300053158 | Ga0500627_0056350 | Ga0500627_0056350_393_1616 | 382 |
| 19 | iso_pu_bacteria | 2903513507 | 2903514017 | 383 |
| 20 | iso_pu_bacteria | 2987673487 | 2987677423 | 384 |
| 21 | 3300048927 | Ga0496124_0194511 | Ga0496124_0194511_48_1217 | 389 |
| 22 | 3300048929 | Ga0496126_0344350 | Ga0496126_0344350_37_1206 | 389 |
| 23 | 3300048929 | Ga0496126_0347699 | Ga0496126_0347699_30_1199 | 389 |
| 24 | 3300049574 | Ga0501038_0071949 | Ga0501038_0071949_53_1243 | 393 |
| 25 | 3300027312 | Ga0209371_1002027 | Ga0209371_100202711 | 394 |
| 26 | iso_pu_bacteria | 2791355262 | 2793335228 | 394 |
| 27 | iso_pu_bacteria | 2965102966 | 2965110347 | 394 |
| 28 | iso_pu_bacteria | 8004361976 | 8004368072 | 394 |
| 29 | 3300003856 | Ga0058692_1002873 | Ga0058692_10028731 | 395 |
| 30 | 3300025294 | Ga0209025_1000702 | Ga0209025_100070218 | 395 |
| 31 | 3300027312 | Ga0209371_1000178 | Ga0209371_100017822 | 395 |
| 32 | 3300030500 | Ga0268256_1000837 | Ga0268256_10008374 | 395 |
| 33 | iso_pu_bacteria | 2906363423 | 2906369806 | 395 |
| 34 | 3300048925 | Ga0496122_0000179 | Ga0496122_0000179_133729_134946 | 396 |
| 35 | 3300048926 | Ga0496123_0000768 | Ga0496123_0000768_36296_37513 | 396 |
| 36 | 3300048927 | Ga0496124_0028108 | Ga0496124_0028108_3133_4350 | 396 |
| 37 | iso_pu_bacteria | 2765235802 | 2765465061 | 396 |
| 38 | 3300006178 | Ga0075367_10006256 | Ga0075367_100062563 | 398 |
| 39 | 3300025245 | Ga0207425_1008343 | Ga0207425_10083433 | 398 |
| 40 | 3300025258 | Ga0209129_1000140 | Ga0209129_100014086 | 398 |
| 41 | 3300025273 | Ga0209673_1000068 | Ga0209673_100006861 | 398 |
| 42 | 3300025294 | Ga0209025_1005300 | Ga0209025_10053009 | 398 |
| 43 | 3300025294 | Ga0209025_1020919 | Ga0209025_10209191 | 398 |
| 44 | 3300025295 | Ga0209564_1000137 | Ga0209564_1000137232 | 398 |
| 45 | 3300025299 | Ga0209256_1001710 | Ga0209256_100171027 | 398 |
| 46 | 3300025299 | Ga0209256_1001971 | Ga0209256_100197110 | 398 |
| 47 | 3300025303 | Ga0209051_1043535 | Ga0209051_10435352 | 398 |
| 48 | iso_pu_bacteria | 2511231027 | 2511391416 | 398 |
| 49 | iso_pu_bacteria | 2534681786 | 2535484609 | 398 |
| 50 | iso_pu_bacteria | 2767802442 | 2770198228 | 398 |
| 51 | iso_pu_bacteria | 2775506902 | 2776271166 | 398 |
| 52 | iso_pu_bacteria | 2775506904 | 2776280837 | 398 |
| 53 | iso_pu_bacteria | 2839993093 | 2839994999 | 398 |
| 54 | iso_pu_bacteria | 2840764183 | 2840767888 | 398 |
| 55 | iso_pu_bacteria | 2842871566 | 2842872404 | 398 |
| 56 | iso_pu_bacteria | 2854911287 | 2854915213 | 398 |
| 57 | iso_pu_bacteria | 2894652903 | 2894656442 | 398 |
| 58 | iso_pu_bacteria | 2904578770 | 2904581045 | 398 |
| 59 | iso_pu_bacteria | 2915650412 | 2915651705 | 398 |
| 60 | iso_pu_bacteria | 2919119836 | 2919121162 | 398 |
| 61 | iso_pu_bacteria | 2928521798 | 2928523504 | 398 |
| 62 | iso_pu_bacteria | 2954011201 | 2954015785 | 398 |
| 63 | iso_pu_bacteria | 3002141150 | 3002144157 | 398 |
| 64 | iso_pu_bacteria | 2643221637 | 2644210999 | 399 |
| 65 | iso_pu_bacteria | 2508501123 | 2509115571 | 400 |
| 66 | iso_pu_bacteria | 2508501127 | 2509141746 | 400 |
| 67 | iso_pu_bacteria | 2509276018 | 2509371189 | 400 |
| 68 | iso_pu_bacteria | 2509276022 | 2509396680 | 400 |
| 69 | iso_pu_bacteria | 2510065059 | 2510313847 | 400 |
| 70 | iso_pu_bacteria | 2512875016 | 2512931094 | 400 |
| 71 | iso_pu_bacteria | 2512875024 | 2512958811 | 400 |
| 72 | iso_pu_bacteria | 2513237164 | 2514037633 | 400 |
| 73 | iso_pu_bacteria | 2513237305 | 2514420262 | 400 |
| 74 | iso_pu_bacteria | 2513237351 | 2514590331 | 400 |
| 75 | iso_pu_bacteria | 2588253730 | 2588516853 | 400 |
| 76 | iso_pu_bacteria | 2597489875 | 2597814269 | 400 |
| 77 | iso_pu_bacteria | 2643221595 | 2643989204 | 400 |
| 78 | iso_pu_bacteria | 2643221627 | 2644152776 | 400 |
| 79 | iso_pu_bacteria | 2687453392 | 2688598832 | 400 |
| 80 | iso_pu_bacteria | 2721755686 | 2723575778 | 400 |
| 81 | iso_pu_bacteria | 2756170246 | 2756675719 | 400 |
| 82 | iso_pu_bacteria | 2791355123 | 2792749726 | 400 |
| 83 | iso_pu_bacteria | 2844002411 | 2844006226 | 400 |
| 84 | iso_pu_bacteria | 2844009547 | 2844014173 | 400 |
| 85 | iso_pu_bacteria | 2856320880 | 2856325646 | 400 |
| 86 | iso_pu_bacteria | 2856328259 | 2856331523 | 400 |
| 87 | iso_pu_bacteria | 2856334872 | 2856339024 | 400 |
| 88 | iso_pu_bacteria | 2856342000 | 2856342968 | 400 |
| 89 | iso_pu_bacteria | 2857367948 | 2857371978 | 400 |
| 90 | iso_pu_bacteria | 2869162929 | 2869169118 | 400 |
| 91 | iso_pu_bacteria | 2869242130 | 2869247414 | 400 |
| 92 | iso_pu_bacteria | 2869249662 | 2869250841 | 400 |
| 93 | iso_pu_bacteria | 2869256925 | 2869262088 | 400 |
| 94 | iso_pu_bacteria | 2869264136 | 2869271127 | 400 |
| 95 | iso_pu_bacteria | 2869271264 | 2869272303 | 400 |
| 96 | iso_pu_bacteria | 2869278585 | 2869279268 | 400 |
| 97 | iso_pu_bacteria | 2871451962 | 2871452830 | 400 |
| 98 | iso_pu_bacteria | 2871459585 | 2871462822 | 400 |
| 99 | iso_pu_bacteria | 2871481445 | 2871485309 | 400 |
| 100 | iso_pu_bacteria | 2874109183 | 2874115479 | 400 |
| 101 | iso_pu_bacteria | 2874116593 | 2874118873 | 400 |
| 102 | iso_pu_bacteria | 2874123672 | 2874130798 | 400 |
| 103 | iso_pu_bacteria | 2874139085 | 2874145015 | 400 |
| 104 | iso_pu_bacteria | 2874162495 | 2874166308 | 400 |
| 105 | iso_pu_bacteria | 2874168670 | 2874174385 | 400 |
| 106 | iso_pu_bacteria | 2876363079 | 2876365650 | 400 |
| 107 | iso_pu_bacteria | 2876386047 | 2876388537 | 400 |
| 108 | iso_pu_bacteria | 2876399893 | 2876406071 | 400 |
| 109 | iso_pu_bacteria | 2876406927 | 2876411231 | 400 |
| 110 | iso_pu_bacteria | 2878738818 | 2878745652 | 400 |
| 111 | iso_pu_bacteria | 2885312484 | 2885317566 | 400 |
| 112 | iso_pu_bacteria | 2888343758 | 2888347260 | 400 |
| 113 | iso_pu_bacteria | 2903448605 | 2903455437 | 400 |
| 114 | iso_pu_bacteria | 2903521522 | 2903523579 | 400 |
| 115 | iso_pu_bacteria | 2903528002 | 2903534213 | 400 |
| 116 | iso_pu_bacteria | 2906370794 | 2906372344 | 400 |
| 117 | iso_pu_bacteria | 2906386501 | 2906388444 | 400 |
| 118 | iso_pu_bacteria | 2906393657 | 2906394685 | 400 |
| 119 | iso_pu_bacteria | 2906401398 | 2906406573 | 400 |
| 120 | iso_pu_bacteria | 2906408224 | 2906412950 | 400 |
| 121 | iso_pu_bacteria | 2906427513 | 2906427706 | 400 |
| 122 | iso_pu_bacteria | 2922151315 | 2922154623 | 400 |
| 123 | iso_pu_bacteria | 2922172374 | 2922176032 | 400 |
| 124 | iso_pu_bacteria | 2924733363 | 2924739320 | 400 |
| 125 | iso_pu_bacteria | 2924748358 | 2924752729 | 400 |
| 126 | iso_pu_bacteria | 2924762789 | 2924766819 | 400 |
| 127 | iso_pu_bacteria | 2924776078 | 2924783896 | 400 |
| 128 | iso_pu_bacteria | 2937822353 | 2937824896 | 400 |
| 129 | iso_pu_bacteria | 2937836603 | 2937837993 | 400 |
| 130 | iso_pu_bacteria | 2937848649 | 2937855078 | 400 |
| 131 | iso_pu_bacteria | 2937861824 | 2937862385 | 400 |
| 132 | iso_pu_bacteria | 2937868953 | 2937869933 | 400 |
| 133 | iso_pu_bacteria | 2937877337 | 2937877427 | 400 |
| 134 | iso_pu_bacteria | 2937972304 | 2937975467 | 400 |
| 135 | iso_pu_bacteria | 2937980651 | 2937986689 | 400 |
| 136 | iso_pu_bacteria | 2958034702 | 2958035409 | 400 |
| 137 | iso_pu_bacteria | 2958041894 | 2958043596 | 400 |
| 138 | iso_pu_bacteria | 2958064165 | 2958067814 | 400 |
| 139 | iso_pu_bacteria | 2958071322 | 2958072667 | 400 |
| 140 | iso_pu_bacteria | 2958084443 | 2958084533 | 400 |
| 141 | iso_pu_bacteria | 2958092219 | 2958093186 | 400 |
| 142 | iso_pu_bacteria | 2958108152 | 2958112047 | 400 |
| 143 | iso_pu_bacteria | 2958122699 | 2958129660 | 400 |
| 144 | iso_pu_bacteria | 2958144490 | 2958148682 | 400 |
| 145 | iso_pu_bacteria | 2961136820 | 2961140870 | 400 |
| 146 | iso_pu_bacteria | 2961183825 | 2961190173 | 400 |
| 147 | iso_pu_bacteria | 2963644680 | 2963648125 | 400 |
| 148 | iso_pu_bacteria | 2965025482 | 2965026583 | 400 |
| 149 | iso_pu_bacteria | 2965032056 | 2965037212 | 400 |
| 150 | iso_pu_bacteria | 2965040258 | 2965042073 | 400 |
| 151 | iso_pu_bacteria | 2965047637 | 2965049626 | 400 |
| 152 | iso_pu_bacteria | 2965089291 | 2965089313 | 400 |
| 153 | iso_pu_bacteria | 2968016561 | 2968018044 | 400 |
| 154 | iso_pu_bacteria | 2968083720 | 2968090947 | 400 |
| 155 | iso_pu_bacteria | 2968138860 | 2968145905 | 400 |
| 156 | iso_pu_bacteria | 2970469710 | 2970471781 | 400 |
| 157 | iso_pu_bacteria | 2970489779 | 2970495736 | 400 |
| 158 | iso_pu_bacteria | 2970510686 | 2970512857 | 400 |
| 159 | iso_pu_bacteria | 2970524798 | 2970530747 | 400 |
| 160 | iso_pu_bacteria | 2970532167 | 2970538313 | 400 |
| 161 | iso_pu_bacteria | 2970540015 | 2970543599 | 400 |
| 162 | iso_pu_bacteria | 2970547951 | 2970552697 | 400 |
| 163 | iso_pu_bacteria | 2970593180 | 2970593864 | 400 |
| 164 | iso_pu_bacteria | 2970619444 | 2970620728 | 400 |
| 165 | iso_pu_bacteria | 2977851361 | 2977856940 | 400 |
| 166 | iso_pu_bacteria | 2977872689 | 2977875622 | 400 |
| 167 | iso_pu_bacteria | 2977915119 | 2977922521 | 400 |
| 168 | iso_pu_bacteria | 2977922695 | 2977929253 | 400 |
| 169 | iso_pu_bacteria | 2977935797 | 2977940726 | 400 |
| 170 | iso_pu_bacteria | 2977950692 | 2977955176 | 400 |
| 171 | iso_pu_bacteria | 2977957713 | 2977963753 | 400 |
| 172 | iso_pu_bacteria | 2977986579 | 2977987909 | 400 |
| 173 | iso_pu_bacteria | 2979764755 | 2979768391 | 400 |
| 174 | iso_pu_bacteria | 2979772303 | 2979774557 | 400 |
| 175 | iso_pu_bacteria | 2979793036 | 2979793617 | 400 |
| 176 | iso_pu_bacteria | 2987645492 | 2987645502 | 400 |
| 177 | iso_pu_bacteria | 2987666974 | 2987668839 | 400 |
| 178 | iso_pu_bacteria | 2996310559 | 2996312280 | 400 |
| 179 | iso_pu_bacteria | 2996348954 | 2996350565 | 400 |
| 180 | iso_pu_bacteria | 2996386984 | 2996389297 | 400 |
| 181 | iso_pu_bacteria | 3000135777 | 3000140172 | 400 |
| 182 | iso_pu_bacteria | 3004167301 | 3004169329 | 400 |
| 183 | iso_pu_bacteria | 3004195979 | 3004203099 | 400 |
| 184 | iso_pu_bacteria | 3004211236 | 3004211891 | 400 |
| 185 | iso_pu_bacteria | 3004218560 | 3004219138 | 400 |
| 186 | iso_pu_bacteria | 3004248173 | 3004253323 | 400 |
| 187 | iso_pu_bacteria | 3004268573 | 3004268931 | 400 |
| 188 | iso_pu_bacteria | 3004275668 | 3004277263 | 400 |
| 189 | iso_pu_bacteria | 3004334049 | 3004341282 | 400 |
| 190 | iso_pu_bacteria | 637000159 | 637074197 | 400 |
| 191 | iso_pu_bacteria | 649633066 | 649873348 | 400 |
| 192 | iso_pu_bacteria | 8004300914 | 8004301175 | 400 |
| 193 | iso_pu_bacteria | 8004312739 | 8004312816 | 400 |
| 194 | iso_pu_bacteria | 8004395343 | 8004403072 | 400 |
| 195 | iso_pu_bacteria | 8004727605 | 8004730344 | 400 |
| 196 | iso_pu_bacteria | 8055617313 | 8055621314 | 400 |
| 197 | iso_pu_bacteria | 2508501122 | 2509107803 | 401 |
| 198 | iso_pu_bacteria | 2509276019 | 2509376200 | 401 |
| 199 | iso_pu_bacteria | 2509276021 | 2509387287 | 401 |
| 200 | iso_pu_bacteria | 2509276033 | 2509442687 | 401 |
| 201 | iso_pu_bacteria | 2510065019 | 2510132768 | 401 |
| 202 | iso_pu_bacteria | 2510065057 | 2510306265 | 401 |
| 203 | iso_pu_bacteria | 2510461069 | 2510841791 | 401 |
| 204 | iso_pu_bacteria | 2510461076 | 2510894054 | 401 |
| 205 | iso_pu_bacteria | 2510461076 | 2510899079 | 401 |
| 206 | iso_pu_bacteria | 2510917026 | 2511170400 | 401 |
| 207 | iso_pu_bacteria | 2510917028 | 2511181961 | 401 |
| 208 | iso_pu_bacteria | 2510917030 | 2511195076 | 401 |
| 209 | iso_pu_bacteria | 2511231052 | 2511501436 | 401 |
| 210 | iso_pu_bacteria | 2512047086 | 2512532857 | 401 |
| 211 | iso_pu_bacteria | 2512875026 | 2512971815 | 401 |
| 212 | iso_pu_bacteria | 2513237084 | 2513570141 | 401 |
| 213 | iso_pu_bacteria | 2513237085 | 2513575406 | 401 |
| 214 | iso_pu_bacteria | 2513237086 | 2513583112 | 401 |
| 215 | iso_pu_bacteria | 2513237088 | 2513598045 | 401 |
| 216 | iso_pu_bacteria | 2513237089 | 2513605198 | 401 |
| 217 | iso_pu_bacteria | 2513237091 | 2513617890 | 401 |
| 218 | iso_pu_bacteria | 2513237093 | 2513632909 | 401 |
| 219 | iso_pu_bacteria | 2513237103 | 2513710359 | 401 |
| 220 | iso_pu_bacteria | 2513237138 | 2513869900 | 401 |
| 221 | iso_pu_bacteria | 2513237140 | 2513884876 | 401 |
| 222 | iso_pu_bacteria | 2513237143 | 2513905889 | 401 |
| 223 | iso_pu_bacteria | 2513237144 | 2513909641 | 401 |
| 224 | iso_pu_bacteria | 2513237146 | 2513926385 | 401 |
| 225 | iso_pu_bacteria | 2513237156 | 2513986686 | 401 |
| 226 | iso_pu_bacteria | 2513237159 | 2514000345 | 401 |
| 227 | iso_pu_bacteria | 2513237160 | 2514005365 | 401 |
| 228 | iso_pu_bacteria | 2513237162 | 2514019758 | 401 |
| 229 | iso_pu_bacteria | 2515075009 | 2515111713 | 401 |
| 230 | iso_pu_bacteria | 2515154107 | 2515611424 | 401 |
| 231 | iso_pu_bacteria | 2515154113 | 2515634797 | 401 |
| 232 | iso_pu_bacteria | 2515154114 | 2515642035 | 401 |
| 233 | iso_pu_bacteria | 2515154116 | 2515656099 | 401 |
| 234 | iso_pu_bacteria | 2515154134 | 2515739200 | 401 |
| 235 | iso_pu_bacteria | 2516143018 | 2516209303 | 401 |
| 236 | iso_pu_bacteria | 2516653046 | 2516892715 | 401 |
| 237 | iso_pu_bacteria | 2516653077 | 2517040405 | 401 |
| 238 | iso_pu_bacteria | 2516653085 | 2517075890 | 401 |
| 239 | iso_pu_bacteria | 2517093000 | 2517094476 | 401 |
| 240 | iso_pu_bacteria | 2517287029 | 2517406267 | 401 |
| 241 | iso_pu_bacteria | 2517487022 | 2517569527 | 401 |
| 242 | iso_pu_bacteria | 2519899620 | 2520379530 | 401 |
| 243 | iso_pu_bacteria | 2524023207 | 2524452934 | 401 |
| 244 | iso_pu_bacteria | 2524023209 | 2524461302 | 401 |
| 245 | iso_pu_bacteria | 2529292951 | 2530645006 | 401 |
| 246 | iso_pu_bacteria | 2534681796 | 2535516073 | 401 |
| 247 | iso_pu_bacteria | 2537561587 | 2537875958 | 401 |
| 248 | iso_pu_bacteria | 2551306084 | 2551674183 | 401 |
| 249 | iso_pu_bacteria | 2551306084 | 2551680335 | 401 |
| 250 | iso_pu_bacteria | 2551306085 | 2551687056 | 401 |
| 251 | iso_pu_bacteria | 2551306086 | 2551692301 | 401 |
| 252 | iso_pu_bacteria | 2551306087 | 2551704840 | 401 |
| 253 | iso_pu_bacteria | 2551306089 | 2551710991 | 401 |
| 254 | iso_pu_bacteria | 2551306090 | 2551720721 | 401 |
| 255 | iso_pu_bacteria | 2551306091 | 2551724486 | 401 |
| 256 | iso_pu_bacteria | 2551306092 | 2551737638 | 401 |
| 257 | iso_pu_bacteria | 2551306093 | 2551740224 | 401 |
| 258 | iso_pu_bacteria | 2554235003 | 2554247786 | 401 |
| 259 | iso_pu_bacteria | 2558860100 | 2558863068 | 401 |
| 260 | iso_pu_bacteria | 2558860242 | 2559294919 | 401 |
| 261 | iso_pu_bacteria | 2558860983 | 2561468943 | 401 |
| 262 | iso_pu_bacteria | 2582581283 | 2585168364 | 401 |
| 263 | iso_pu_bacteria | 2582581294 | 2585199791 | 401 |
| 264 | iso_pu_bacteria | 2582581298 | 2585226018 | 401 |
| 265 | iso_pu_bacteria | 2582581299 | 2585232502 | 401 |
| 266 | iso_pu_bacteria | 2582581304 | 2585254265 | 401 |
| 267 | iso_pu_bacteria | 2582581306 | 2585268991 | 401 |
| 268 | iso_pu_bacteria | 2582581308 | 2585276842 | 401 |
| 269 | iso_pu_bacteria | 2582581315 | 2585324159 | 401 |
| 270 | iso_pu_bacteria | 2582581316 | 2585333448 | 401 |
| 271 | iso_pu_bacteria | 2582581865 | 2585389516 | 401 |
| 272 | iso_pu_bacteria | 2582581866 | 2585393872 | 401 |
| 273 | iso_pu_bacteria | 2582581867 | 2585400619 | 401 |
| 274 | iso_pu_bacteria | 2585427526 | 2585528840 | 401 |
| 275 | iso_pu_bacteria | 2585427527 | 2585534855 | 401 |
| 276 | iso_pu_bacteria | 2585427528 | 2585540251 | 401 |
| 277 | iso_pu_bacteria | 2585427529 | 2585546978 | 401 |
| 278 | iso_pu_bacteria | 2585427530 | 2585551700 | 401 |
| 279 | iso_pu_bacteria | 2585427590 | 2585819823 | 401 |
| 280 | iso_pu_bacteria | 2585427593 | 2585838449 | 401 |
| 281 | iso_pu_bacteria | 2585427594 | 2585845725 | 401 |
| 282 | iso_pu_bacteria | 2585427633 | 2585995504 | 401 |
| 283 | iso_pu_bacteria | 2585427634 | 2586000106 | 401 |
| 284 | iso_pu_bacteria | 2599185170 | 2599418186 | 401 |
| 285 | iso_pu_bacteria | 2599185210 | 2599604180 | 401 |
| 286 | iso_pu_bacteria | 2599185236 | 2599721327 | 401 |
| 287 | iso_pu_bacteria | 2599185352 | 2600192391 | 401 |
| 288 | iso_pu_bacteria | 2600255279 | 2601608027 | 401 |
| 289 | iso_pu_bacteria | 2600255308 | 2601744802 | 401 |
| 290 | iso_pu_bacteria | 2615840624 | 2616292928 | 401 |
| 291 | iso_pu_bacteria | 2615840626 | 2616308215 | 401 |
| 292 | iso_pu_bacteria | 2615840698 | 2616556763 | 401 |
| 293 | iso_pu_bacteria | 2617270742 | 2617381570 | 401 |
| 294 | iso_pu_bacteria | 2643221557 | 2643808472 | 401 |
| 295 | iso_pu_bacteria | 2643221558 | 2643812133 | 401 |
| 296 | iso_pu_bacteria | 2643221568 | 2643854462 | 401 |
| 297 | iso_pu_bacteria | 2643221582 | 2643919410 | 401 |
| 298 | iso_pu_bacteria | 2643221599 | 2644005978 | 401 |
| 299 | iso_pu_bacteria | 2643221607 | 2644049498 | 401 |
| 300 | iso_pu_bacteria | 2643221610 | 2644066435 | 401 |
| 301 | iso_pu_bacteria | 2643221618 | 2644109465 | 401 |
| 302 | iso_pu_bacteria | 2643221626 | 2644145150 | 401 |
| 303 | iso_pu_bacteria | 2643221634 | 2644193195 | 401 |
| 304 | iso_pu_bacteria | 2643221636 | 2644204094 | 401 |
| 305 | iso_pu_bacteria | 2643221643 | 2644238199 | 401 |
| 306 | iso_pu_bacteria | 2643221653 | 2644300217 | 401 |
| 307 | iso_pu_bacteria | 2643221655 | 2644307730 | 401 |
| 308 | iso_pu_bacteria | 2643221659 | 2644332506 | 401 |
| 309 | iso_pu_bacteria | 2643221668 | 2644378023 | 401 |
| 310 | iso_pu_bacteria | 2643221675 | 2644415352 | 401 |
| 311 | iso_pu_bacteria | 2643221680 | 2644450247 | 401 |
| 312 | iso_pu_bacteria | 2643221686 | 2644482532 | 401 |
| 313 | iso_pu_bacteria | 2643221688 | 2644494658 | 401 |
| 314 | iso_pu_bacteria | 2643221689 | 2644499035 | 401 |
| 315 | iso_pu_bacteria | 2643221693 | 2644522312 | 401 |
| 316 | iso_pu_bacteria | 2643221698 | 2644544253 | 401 |
| 317 | iso_pu_bacteria | 2643221712 | 2644613819 | 401 |
| 318 | iso_pu_bacteria | 2643221719 | 2644658443 | 401 |
| 319 | iso_pu_bacteria | 2643221723 | 2644677966 | 401 |
| 320 | iso_pu_bacteria | 2643221726 | 2644687799 | 401 |
| 321 | iso_pu_bacteria | 2657244999 | 2657683647 | 401 |
| 322 | iso_pu_bacteria | 2667528174 | 2671115612 | 401 |
| 323 | iso_pu_bacteria | 2690316117 | 2692316372 | 401 |
| 324 | iso_pu_bacteria | 2718217882 | 2719180655 | 401 |
| 325 | iso_pu_bacteria | 2718217927 | 2719385260 | 401 |
| 326 | iso_pu_bacteria | 2718217997 | 2719665086 | 401 |
| 327 | iso_pu_bacteria | 2718218009 | 2719731404 | 401 |
| 328 | iso_pu_bacteria | 2718218199 | 2720491506 | 401 |
| 329 | iso_pu_bacteria | 2718218232 | 2720612800 | 401 |
| 330 | iso_pu_bacteria | 2718218233 | 2720619651 | 401 |
| 331 | iso_pu_bacteria | 2718218235 | 2720631091 | 401 |
| 332 | iso_pu_bacteria | 2718218269 | 2720774818 | 401 |
| 333 | iso_pu_bacteria | 2718218363 | 2721146749 | 401 |
| 334 | iso_pu_bacteria | 2718218365 | 2721158272 | 401 |
| 335 | iso_pu_bacteria | 2718218366 | 2721163628 | 401 |
| 336 | iso_pu_bacteria | 2718218423 | 2721398981 | 401 |
| 337 | iso_pu_bacteria | 2721755514 | 2722839798 | 401 |
| 338 | iso_pu_bacteria | 2721755556 | 2723026454 | 401 |
| 339 | iso_pu_bacteria | 2721755684 | 2723559996 | 401 |
| 340 | iso_pu_bacteria | 2721755685 | 2723566617 | 401 |
| 341 | iso_pu_bacteria | 2721755809 | 2724037794 | 401 |
| 342 | iso_pu_bacteria | 2721755810 | 2724044160 | 401 |
| 343 | iso_pu_bacteria | 2721755819 | 2724089425 | 401 |
| 344 | iso_pu_bacteria | 2721755822 | 2724103882 | 401 |
| 345 | iso_pu_bacteria | 2721755823 | 2724109720 | 401 |
| 346 | iso_pu_bacteria | 2724679232 | 2725951732 | 401 |
| 347 | iso_pu_bacteria | 2728369352 | 2730107390 | 401 |
| 348 | iso_pu_bacteria | 2728369365 | 2730163892 | 401 |
| 349 | iso_pu_bacteria | 2728369397 | 2730297904 | 401 |
| 350 | iso_pu_bacteria | 2738541293 | 2738799349 | 401 |
| 351 | iso_pu_bacteria | 2738541317 | 2738945325 | 401 |
| 352 | iso_pu_bacteria | 2738541333 | 2739037891 | 401 |
| 353 | iso_pu_bacteria | 2765235942 | 2766068045 | 401 |
| 354 | iso_pu_bacteria | 2775507049 | 2776913184 | 401 |
| 355 | iso_pu_bacteria | 2775507266 | 2778176357 | 401 |
| 356 | iso_pu_bacteria | 2791355082 | 2792581140 | 401 |
| 357 | iso_pu_bacteria | 2791355091 | 2792623147 | 401 |
| 358 | iso_pu_bacteria | 2791355092 | 2792626911 | 401 |
| 359 | iso_pu_bacteria | 2791355094 | 2792642660 | 401 |
| 360 | iso_pu_bacteria | 2791355256 | 2793297034 | 401 |
| 361 | iso_pu_bacteria | 2791355259 | 2793315606 | 401 |
| 362 | iso_pu_bacteria | 2791355260 | 2793321358 | 401 |
| 363 | iso_pu_bacteria | 2791355261 | 2793330009 | 401 |
| 364 | iso_pu_bacteria | 2791355263 | 2793342700 | 401 |
| 365 | iso_pu_bacteria | 2791355264 | 2793350405 | 401 |
| 366 | iso_pu_bacteria | 2791355265 | 2793352139 | 401 |
| 367 | iso_pu_bacteria | 2791355266 | 2793360499 | 401 |
| 368 | iso_pu_bacteria | 2791355267 | 2793366288 | 401 |
| 369 | iso_pu_bacteria | 2802428858 | 2802718811 | 401 |
| 370 | iso_pu_bacteria | 2802428859 | 2802726422 | 401 |
| 371 | iso_pu_bacteria | 2802428860 | 2802732965 | 401 |
| 372 | iso_pu_bacteria | 2802428861 | 2802738320 | 401 |
| 373 | iso_pu_bacteria | 2802428862 | 2802744652 | 401 |
| 374 | iso_pu_bacteria | 2802428863 | 2802751142 | 401 |
| 375 | iso_pu_bacteria | 2802429268 | 2804751916 | 401 |
| 376 | iso_pu_bacteria | 2802429605 | 2805930055 | 401 |
| 377 | iso_pu_bacteria | 2802429606 | 2805934949 | 401 |
| 378 | iso_pu_bacteria | 2802429633 | 2806045651 | 401 |
| 379 | iso_pu_bacteria | 2802429634 | 2806053695 | 401 |
| 380 | iso_pu_bacteria | 2802429635 | 2806060895 | 401 |
| 381 | iso_pu_bacteria | 2802429636 | 2806067770 | 401 |
| 382 | iso_pu_bacteria | 2802429637 | 2806072878 | 401 |
| 383 | iso_pu_bacteria | 2808606387 | 2808985311 | 401 |
| 384 | iso_pu_bacteria | 2818991272 | 2819242166 | 401 |
| 385 | iso_pu_bacteria | 2818991439 | 2819559744 | 401 |
| 386 | iso_pu_bacteria | 2818991448 | 2819610525 | 401 |
| 387 | iso_pu_bacteria | 2818991453 | 2819638272 | 401 |
| 388 | iso_pu_bacteria | 2821123053 | 2821129366 | 401 |
| 389 | iso_pu_bacteria | 2838016132 | 2838018613 | 401 |
| 390 | iso_pu_bacteria | 2838022645 | 2838022693 | 401 |
| 391 | iso_pu_bacteria | 2838029111 | 2838032298 | 401 |
| 392 | iso_pu_bacteria | 2838035591 | 2838041126 | 401 |
| 393 | iso_pu_bacteria | 2838042994 | 2838047686 | 401 |
| 394 | iso_pu_bacteria | 2838048938 | 2838052303 | 401 |
| 395 | iso_pu_bacteria | 2838061910 | 2838066472 | 401 |
| 396 | iso_pu_bacteria | 2838068647 | 2838071219 | 401 |
| 397 | iso_pu_bacteria | 2838074704 | 2838079384 | 401 |
| 398 | iso_pu_bacteria | 2838661181 | 2838663164 | 401 |
| 399 | iso_pu_bacteria | 2838668709 | 2838669860 | 401 |
| 400 | iso_pu_bacteria | 2838675328 | 2838676155 | 401 |
| 401 | iso_pu_bacteria | 2838680041 | 2838682760 | 401 |
| 402 | iso_pu_bacteria | 2838686498 | 2838693255 | 401 |
| 403 | iso_pu_bacteria | 2838694306 | 2838697394 | 401 |
| 404 | iso_pu_bacteria | 2838701080 | 2838702232 | 401 |
| 405 | iso_pu_bacteria | 2838707686 | 2838709428 | 401 |
| 406 | iso_pu_bacteria | 2838714209 | 2838715037 | 401 |
| 407 | iso_pu_bacteria | 2838719591 | 2838721163 | 401 |
| 408 | iso_pu_bacteria | 2838724970 | 2838725796 | 401 |
| 409 | iso_pu_bacteria | 2838729681 | 2838736117 | 401 |
| 410 | iso_pu_bacteria | 2838736955 | 2838738601 | 401 |
| 411 | iso_pu_bacteria | 2838742623 | 2838748890 | 401 |
| 412 | iso_pu_bacteria | 2841840854 | 2841841030 | 401 |
| 413 | iso_pu_bacteria | 2841846520 | 2841848120 | 401 |
| 414 | iso_pu_bacteria | 2841851746 | 2841858226 | 401 |
| 415 | iso_pu_bacteria | 2841859092 | 2841859329 | 401 |
| 416 | iso_pu_bacteria | 2841864319 | 2841865066 | 401 |
| 417 | iso_pu_bacteria | 2842077413 | 2842077539 | 401 |
| 418 | iso_pu_bacteria | 2842110456 | 2842111057 | 401 |
| 419 | iso_pu_bacteria | 2842118031 | 2842119952 | 401 |
| 420 | iso_pu_bacteria | 2842124991 | 2842125850 | 401 |
| 421 | iso_pu_bacteria | 2842130223 | 2842131049 | 401 |
| 422 | iso_pu_bacteria | 2842140634 | 2842140808 | 401 |
| 423 | iso_pu_bacteria | 2842146304 | 2842147223 | 401 |
| 424 | iso_pu_bacteria | 2842152218 | 2842153781 | 401 |
| 425 | iso_pu_bacteria | 2842156927 | 2842163065 | 401 |
| 426 | iso_pu_bacteria | 2842163707 | 2842165153 | 401 |
| 427 | iso_pu_bacteria | 2842170452 | 2842171280 | 401 |
| 428 | iso_pu_bacteria | 2842175837 | 2842177401 | 401 |
| 429 | iso_pu_bacteria | 2842180545 | 2842186697 | 401 |
| 430 | iso_pu_bacteria | 2842187318 | 2842188145 | 401 |
| 431 | iso_pu_bacteria | 2842192696 | 2842197171 | 401 |
| 432 | iso_pu_bacteria | 2842198810 | 2842201480 | 401 |
| 433 | iso_pu_bacteria | 2842205361 | 2842206574 | 401 |
| 434 | iso_pu_bacteria | 2842211629 | 2842212456 | 401 |
| 435 | iso_pu_bacteria | 2842217011 | 2842220471 | 401 |
| 436 | iso_pu_bacteria | 2842224351 | 2842225925 | 401 |
| 437 | iso_pu_bacteria | 2842229732 | 2842235980 | 401 |
| 438 | iso_pu_bacteria | 2842237096 | 2842238841 | 401 |
| 439 | iso_pu_bacteria | 2842243621 | 2842249839 | 401 |
| 440 | iso_pu_bacteria | 2842250916 | 2842252288 | 401 |
| 441 | iso_pu_bacteria | 2842257432 | 2842263800 | 401 |
| 442 | iso_pu_bacteria | 2842264693 | 2842268598 | 401 |
| 443 | iso_pu_bacteria | 2842271015 | 2842277723 | 401 |
| 444 | iso_pu_bacteria | 2842278818 | 2842280031 | 401 |
| 445 | iso_pu_bacteria | 2842285085 | 2842287660 | 401 |
| 446 | iso_pu_bacteria | 2842291075 | 2842291201 | 401 |
| 447 | iso_pu_bacteria | 2842298080 | 2842302892 | 401 |
| 448 | iso_pu_bacteria | 2842304105 | 2842310326 | 401 |
| 449 | iso_pu_bacteria | 2842311132 | 2842315277 | 401 |
| 450 | iso_pu_bacteria | 2842317721 | 2842318418 | 401 |
| 451 | iso_pu_bacteria | 2842341865 | 2842347059 | 401 |
| 452 | iso_pu_bacteria | 2842357229 | 2842362568 | 401 |
| 453 | iso_pu_bacteria | 2842363717 | 2842366891 | 401 |
| 454 | iso_pu_bacteria | 2842370503 | 2842373390 | 401 |
| 455 | iso_pu_bacteria | 2842377471 | 2842377597 | 401 |
| 456 | iso_pu_bacteria | 2842384541 | 2842386462 | 401 |
| 457 | iso_pu_bacteria | 2842395702 | 2842399651 | 401 |
| 458 | iso_pu_bacteria | 2842402390 | 2842404811 | 401 |
| 459 | iso_pu_bacteria | 2842409023 | 2842411394 | 401 |
| 460 | iso_pu_bacteria | 2842415677 | 2842418155 | 401 |
| 461 | iso_pu_bacteria | 2842422224 | 2842425125 | 401 |
| 462 | iso_pu_bacteria | 2842428310 | 2842432731 | 401 |
| 463 | iso_pu_bacteria | 2842434925 | 2842439036 | 401 |
| 464 | iso_pu_bacteria | 2842441272 | 2842445665 | 401 |
| 465 | iso_pu_bacteria | 2842447887 | 2842451592 | 401 |
| 466 | iso_pu_bacteria | 2842462802 | 2842466983 | 401 |
| 467 | iso_pu_bacteria | 2842469257 | 2842473650 | 401 |
| 468 | iso_pu_bacteria | 2842475841 | 2842479073 | 401 |
| 469 | iso_pu_bacteria | 2842482326 | 2842483207 | 401 |
| 470 | iso_pu_bacteria | 2842489311 | 2842494460 | 401 |
| 471 | iso_pu_bacteria | 2842495871 | 2842500607 | 401 |
| 472 | iso_pu_bacteria | 2842502639 | 2842506207 | 401 |
| 473 | iso_pu_bacteria | 2842509118 | 2842510086 | 401 |
| 474 | iso_pu_bacteria | 2842515876 | 2842516113 | 401 |
| 475 | iso_pu_bacteria | 2842521101 | 2842526015 | 401 |
| 476 | iso_pu_bacteria | 2844163670 | 2844170341 | 401 |
| 477 | iso_pu_bacteria | 2844454524 | 2844454622 | 401 |
| 478 | iso_pu_bacteria | 2847417321 | 2847418560 | 401 |
| 479 | iso_pu_bacteria | 2847686936 | 2847692609 | 401 |
| 480 | iso_pu_bacteria | 2848992105 | 2848993538 | 401 |
| 481 | iso_pu_bacteria | 2850079185 | 2850080861 | 401 |
| 482 | iso_pu_bacteria | 2852387548 | 2852389476 | 401 |
| 483 | iso_pu_bacteria | 2854896431 | 2854901931 | 401 |
| 484 | iso_pu_bacteria | 2854916844 | 2854920292 | 401 |
| 485 | iso_pu_bacteria | 2855825444 | 2855825529 | 401 |
| 486 | iso_pu_bacteria | 2855839649 | 2855840907 | 401 |
| 487 | iso_pu_bacteria | 2855872281 | 2855873835 | 401 |
| 488 | iso_pu_bacteria | 2857516855 | 2857523037 | 401 |
| 489 | iso_pu_bacteria | 2857531043 | 2857535253 | 401 |
| 490 | iso_pu_bacteria | 2858800743 | 2858801446 | 401 |
| 491 | iso_pu_bacteria | 2871495908 | 2871502855 | 401 |
| 492 | iso_pu_bacteria | 2874102143 | 2874104826 | 401 |
| 493 | iso_pu_bacteria | 2876369609 | 2876375255 | 401 |
| 494 | iso_pu_bacteria | 2876392853 | 2876394614 | 401 |
| 495 | iso_pu_bacteria | 2878760144 | 2878766747 | 401 |
| 496 | iso_pu_bacteria | 2878767105 | 2878773944 | 401 |
| 497 | iso_pu_bacteria | 2881147464 | 2881151963 | 401 |
| 498 | iso_pu_bacteria | 2881161766 | 2881167909 | 401 |
| 499 | iso_pu_bacteria | 2885305155 | 2885309831 | 401 |
| 500 | iso_pu_bacteria | 2885326080 | 2885329563 | 401 |
| 501 | iso_pu_bacteria | 2885334103 | 2885334397 | 401 |
| 502 | iso_pu_bacteria | 2891048133 | 2891052299 | 401 |
| 503 | iso_pu_bacteria | 2896384573 | 2896387050 | 401 |
| 504 | iso_pu_bacteria | 2899792073 | 2899794197 | 401 |
| 505 | iso_pu_bacteria | 2899803654 | 2899807417 | 401 |
| 506 | iso_pu_bacteria | 2899845264 | 2899846504 | 401 |
| 507 | iso_pu_bacteria | 2903540706 | 2903547994 | 401 |
| 508 | iso_pu_bacteria | 2904659560 | 2904661248 | 401 |
| 509 | iso_pu_bacteria | 2906328253 | 2906329638 | 401 |
| 510 | iso_pu_bacteria | 2913295892 | 2913300504 | 401 |
| 511 | iso_pu_bacteria | 2913308742 | 2913310029 | 401 |
| 512 | iso_pu_bacteria | 2915980308 | 2915985269 | 401 |
| 513 | iso_pu_bacteria | 2915986958 | 2915989712 | 401 |
| 514 | iso_pu_bacteria | 2915993759 | 2915998448 | 401 |
| 515 | iso_pu_bacteria | 2916000859 | 2916004397 | 401 |
| 516 | iso_pu_bacteria | 2916007675 | 2916014483 | 401 |
| 517 | iso_pu_bacteria | 2916014648 | 2916015211 | 401 |
| 518 | iso_pu_bacteria | 2916021584 | 2916024678 | 401 |
| 519 | iso_pu_bacteria | 2916028427 | 2916033499 | 401 |
| 520 | iso_pu_bacteria | 2916035215 | 2916041746 | 401 |
| 521 | iso_pu_bacteria | 2916041962 | 2916044150 | 401 |
| 522 | iso_pu_bacteria | 2916048683 | 2916054188 | 401 |
| 523 | iso_pu_bacteria | 2916055098 | 2916061704 | 401 |
| 524 | iso_pu_bacteria | 2916061851 | 2916062388 | 401 |
| 525 | iso_pu_bacteria | 2916068649 | 2916071016 | 401 |
| 526 | iso_pu_bacteria | 2916076590 | 2916079805 | 401 |
| 527 | iso_pu_bacteria | 2919100787 | 2919104238 | 401 |
| 528 | iso_pu_bacteria | 2919114240 | 2919115128 | 401 |
| 529 | iso_pu_bacteria | 2919166419 | 2919168798 | 401 |
| 530 | iso_pu_bacteria | 2919171160 | 2919175465 | 401 |
| 531 | iso_pu_bacteria | 2919408235 | 2919409660 | 401 |
| 532 | iso_pu_bacteria | 2920760137 | 2920765637 | 401 |
| 533 | iso_pu_bacteria | 2920822456 | 2920824281 | 401 |
| 534 | iso_pu_bacteria | 2921201388 | 2921204250 | 401 |
| 535 | iso_pu_bacteria | 2921208531 | 2921210000 | 401 |
| 536 | iso_pu_bacteria | 2921237296 | 2921244187 | 401 |
| 537 | iso_pu_bacteria | 2921244191 | 2921246842 | 401 |
| 538 | iso_pu_bacteria | 2921250672 | 2921253916 | 401 |
| 539 | iso_pu_bacteria | 2921257292 | 2921257450 | 401 |
| 540 | iso_pu_bacteria | 2921263974 | 2921264673 | 401 |
| 541 | iso_pu_bacteria | 2921282425 | 2921284835 | 401 |
| 542 | iso_pu_bacteria | 2921289301 | 2921293290 | 401 |
| 543 | iso_pu_bacteria | 2921296804 | 2921297901 | 401 |
| 544 | iso_pu_bacteria | 2923556063 | 2923558249 | 401 |
| 545 | iso_pu_bacteria | 2924144063 | 2924146479 | 401 |
| 546 | iso_pu_bacteria | 2924150972 | 2924156051 | 401 |
| 547 | iso_pu_bacteria | 2924158325 | 2924158981 | 401 |
| 548 | iso_pu_bacteria | 2924165586 | 2924171002 | 401 |
| 549 | iso_pu_bacteria | 2924172951 | 2924175516 | 401 |
| 550 | iso_pu_bacteria | 2924179722 | 2924182247 | 401 |
| 551 | iso_pu_bacteria | 2924186466 | 2924189344 | 401 |
| 552 | iso_pu_bacteria | 2924193448 | 2924193968 | 401 |
| 553 | iso_pu_bacteria | 2924193448 | 2924193996 | 401 |
| 554 | iso_pu_bacteria | 2924200457 | 2924202772 | 401 |
| 555 | iso_pu_bacteria | 2924207177 | 2924213876 | 401 |
| 556 | iso_pu_bacteria | 2924214083 | 2924215787 | 401 |
| 557 | iso_pu_bacteria | 2924221636 | 2924222571 | 401 |
| 558 | iso_pu_bacteria | 2924228884 | 2924233176 | 401 |
| 559 | iso_pu_bacteria | 2924726620 | 2924728872 | 401 |
| 560 | iso_pu_bacteria | 2926754445 | 2926756173 | 401 |
| 561 | iso_pu_bacteria | 2926760298 | 2926760405 | 401 |
| 562 | iso_pu_bacteria | 2929138655 | 2929139804 | 401 |
| 563 | iso_pu_bacteria | 2933006813 | 2933008427 | 401 |
| 564 | iso_pu_bacteria | 2933011516 | 2933013243 | 401 |
| 565 | iso_pu_bacteria | 2933016740 | 2933019783 | 401 |
| 566 | iso_pu_bacteria | 2933570622 | 2933576766 | 401 |
| 567 | iso_pu_bacteria | 2933586486 | 2933587082 | 401 |
| 568 | iso_pu_bacteria | 2933594066 | 2933597932 | 401 |
| 569 | iso_pu_bacteria | 2933599457 | 2933602018 | 401 |
| 570 | iso_pu_bacteria | 2935894831 | 2935900472 | 401 |
| 571 | iso_pu_bacteria | 2935901341 | 2935904988 | 401 |
| 572 | iso_pu_bacteria | 2936367885 | 2936373326 | 401 |
| 573 | iso_pu_bacteria | 2936375103 | 2936378592 | 401 |
| 574 | iso_pu_bacteria | 2936381700 | 2936384696 | 401 |
| 575 | iso_pu_bacteria | 2936996657 | 2937001258 | 401 |
| 576 | iso_pu_bacteria | 2937002841 | 2937004645 | 401 |
| 577 | iso_pu_bacteria | 2937009748 | 2937012578 | 401 |
| 578 | iso_pu_bacteria | 2937016420 | 2937017032 | 401 |
| 579 | iso_pu_bacteria | 2937023124 | 2937029272 | 401 |
| 580 | iso_pu_bacteria | 2937029754 | 2937031244 | 401 |
| 581 | iso_pu_bacteria | 2937036028 | 2937038511 | 401 |
| 582 | iso_pu_bacteria | 2937042894 | 2937043144 | 401 |
| 583 | iso_pu_bacteria | 2937049772 | 2937055642 | 401 |
| 584 | iso_pu_bacteria | 2937056579 | 2937057789 | 401 |
| 585 | iso_pu_bacteria | 2937063883 | 2937069600 | 401 |
| 586 | iso_pu_bacteria | 2937071275 | 2937072800 | 401 |
| 587 | iso_pu_bacteria | 2937078374 | 2937080038 | 401 |
| 588 | iso_pu_bacteria | 2937084907 | 2937085400 | 401 |
| 589 | iso_pu_bacteria | 2937091812 | 2937093273 | 401 |
| 590 | iso_pu_bacteria | 2937098957 | 2937105422 | 401 |
| 591 | iso_pu_bacteria | 2937106411 | 2937107441 | 401 |
| 592 | iso_pu_bacteria | 2937113482 | 2937118332 | 401 |
| 593 | iso_pu_bacteria | 2937119839 | 2937123100 | 401 |
| 594 | iso_pu_bacteria | 2937126314 | 2937127954 | 401 |
| 595 | iso_pu_bacteria | 2937891427 | 2937894896 | 401 |
| 596 | iso_pu_bacteria | 2937994558 | 2938001870 | 401 |
| 597 | iso_pu_bacteria | 2941499720 | 2941499764 | 401 |
| 598 | iso_pu_bacteria | 2957375807 | 2957378636 | 401 |
| 599 | iso_pu_bacteria | 2957382221 | 2957384457 | 401 |
| 600 | iso_pu_bacteria | 2957388812 | 2957389759 | 401 |
| 601 | iso_pu_bacteria | 2957395598 | 2957396652 | 401 |
| 602 | iso_pu_bacteria | 2957402308 | 2957405877 | 401 |
| 603 | iso_pu_bacteria | 2957408893 | 2957411184 | 401 |
| 604 | iso_pu_bacteria | 2957415311 | 2957415780 | 401 |
| 605 | iso_pu_bacteria | 2957422303 | 2957424304 | 401 |
| 606 | iso_pu_bacteria | 2957430029 | 2957433482 | 401 |
| 607 | iso_pu_bacteria | 2957437181 | 2957439935 | 401 |
| 608 | iso_pu_bacteria | 2957443900 | 2957445533 | 401 |
| 609 | iso_pu_bacteria | 2957450854 | 2957457594 | 401 |
| 610 | iso_pu_bacteria | 2957457609 | 2957458058 | 401 |
| 611 | iso_pu_bacteria | 2957464669 | 2957467970 | 401 |
| 612 | iso_pu_bacteria | 2957471148 | 2957474362 | 401 |
| 613 | iso_pu_bacteria | 2957478035 | 2957478540 | 401 |
| 614 | iso_pu_bacteria | 2957484790 | 2957485663 | 401 |
| 615 | iso_pu_bacteria | 2957491536 | 2957491936 | 401 |
| 616 | iso_pu_bacteria | 2957498199 | 2957502508 | 401 |
| 617 | iso_pu_bacteria | 2957505466 | 2957511758 | 401 |
| 618 | iso_pu_bacteria | 2958115193 | 2958118804 | 401 |
| 619 | iso_pu_bacteria | 2958165035 | 2958171925 | 401 |
| 620 | iso_pu_bacteria | 2960584000 | 2960587600 | 401 |
| 621 | iso_pu_bacteria | 2960591022 | 2960596204 | 401 |
| 622 | iso_pu_bacteria | 2960597568 | 2960601333 | 401 |
| 623 | iso_pu_bacteria | 2960603979 | 2960605373 | 401 |
| 624 | iso_pu_bacteria | 2960610863 | 2960616453 | 401 |
| 625 | iso_pu_bacteria | 2960617483 | 2960618805 | 401 |
| 626 | iso_pu_bacteria | 2960624210 | 2960628618 | 401 |
| 627 | iso_pu_bacteria | 2960631154 | 2960632721 | 401 |
| 628 | iso_pu_bacteria | 2960637947 | 2960645122 | 401 |
| 629 | iso_pu_bacteria | 2960645483 | 2960650441 | 401 |
| 630 | iso_pu_bacteria | 2960652885 | 2960657546 | 401 |
| 631 | iso_pu_bacteria | 2960660292 | 2960665508 | 401 |
| 632 | iso_pu_bacteria | 2960667422 | 2960669521 | 401 |
| 633 | iso_pu_bacteria | 2960674078 | 2960679763 | 401 |
| 634 | iso_pu_bacteria | 2960680706 | 2960686900 | 401 |
| 635 | iso_pu_bacteria | 2960687367 | 2960688835 | 401 |
| 636 | iso_pu_bacteria | 2960693952 | 2960695922 | 401 |
| 637 | iso_pu_bacteria | 2961114664 | 2961116400 | 401 |
| 638 | iso_pu_bacteria | 2961163497 | 2961170371 | 401 |
| 639 | iso_pu_bacteria | 2964607997 | 2964611660 | 401 |
| 640 | iso_pu_bacteria | 2964615318 | 2964617525 | 401 |
| 641 | iso_pu_bacteria | 2964621998 | 2964625194 | 401 |
| 642 | iso_pu_bacteria | 2964628898 | 2964635130 | 401 |
| 643 | iso_pu_bacteria | 2964636051 | 2964642297 | 401 |
| 644 | iso_pu_bacteria | 2964643177 | 2964645963 | 401 |
| 645 | iso_pu_bacteria | 2964649959 | 2964652160 | 401 |
| 646 | iso_pu_bacteria | 2964656573 | 2964657498 | 401 |
| 647 | iso_pu_bacteria | 2964663802 | 2964665023 | 401 |
| 648 | iso_pu_bacteria | 2964670856 | 2964672242 | 401 |
| 649 | iso_pu_bacteria | 2964678106 | 2964679143 | 401 |
| 650 | iso_pu_bacteria | 2964685014 | 2964688772 | 401 |
| 651 | iso_pu_bacteria | 2964691889 | 2964693768 | 401 |
| 652 | iso_pu_bacteria | 2964698721 | 2964702963 | 401 |
| 653 | iso_pu_bacteria | 2964705432 | 2964709749 | 401 |
| 654 | iso_pu_bacteria | 2964712639 | 2964713343 | 401 |
| 655 | iso_pu_bacteria | 2964719344 | 2964720563 | 401 |
| 656 | iso_pu_bacteria | 2965018300 | 2965025117 | 401 |
| 657 | iso_pu_bacteria | 2965062239 | 2965065230 | 401 |
| 658 | iso_pu_bacteria | 2967664464 | 2967668138 | 401 |
| 659 | iso_pu_bacteria | 2967671571 | 2967672986 | 401 |
| 660 | iso_pu_bacteria | 2967678726 | 2967683825 | 401 |
| 661 | iso_pu_bacteria | 2967686174 | 2967687300 | 401 |
| 662 | iso_pu_bacteria | 2967693043 | 2967693584 | 401 |
| 663 | iso_pu_bacteria | 2967699805 | 2967700564 | 401 |
| 664 | iso_pu_bacteria | 2967706974 | 2967711633 | 401 |
| 665 | iso_pu_bacteria | 2967714385 | 2967715722 | 401 |
| 666 | iso_pu_bacteria | 2967721400 | 2967726865 | 401 |
| 667 | iso_pu_bacteria | 2967728569 | 2967734341 | 401 |
| 668 | iso_pu_bacteria | 2967735183 | 2967736441 | 401 |
| 669 | iso_pu_bacteria | 2967742019 | 2967742795 | 401 |
| 670 | iso_pu_bacteria | 2967748971 | 2967750035 | 401 |
| 671 | iso_pu_bacteria | 2967755722 | 2967758068 | 401 |
| 672 | iso_pu_bacteria | 2967762386 | 2967763526 | 401 |
| 673 | iso_pu_bacteria | 2967769361 | 2967771551 | 401 |
| 674 | iso_pu_bacteria | 2967775926 | 2967782011 | 401 |
| 675 | iso_pu_bacteria | 2968091066 | 2968096620 | 401 |
| 676 | iso_pu_bacteria | 2968097103 | 2968099982 | 401 |
| 677 | iso_pu_bacteria | 2968110612 | 2968112306 | 401 |
| 678 | iso_pu_bacteria | 2968128360 | 2968132672 | 401 |
| 679 | iso_pu_bacteria | 2968171901 | 2968178758 | 401 |
| 680 | iso_pu_bacteria | 2970019648 | 2970023386 | 401 |
| 681 | iso_pu_bacteria | 2970026789 | 2970029323 | 401 |
| 682 | iso_pu_bacteria | 2970033650 | 2970035594 | 401 |
| 683 | iso_pu_bacteria | 2970040964 | 2970042080 | 401 |
| 684 | iso_pu_bacteria | 2970047711 | 2970048742 | 401 |
| 685 | iso_pu_bacteria | 2970054988 | 2970061372 | 401 |
| 686 | iso_pu_bacteria | 2970061556 | 2970062431 | 401 |
| 687 | iso_pu_bacteria | 2970068827 | 2970072243 | 401 |
| 688 | iso_pu_bacteria | 2970076120 | 2970077400 | 401 |
| 689 | iso_pu_bacteria | 2970082768 | 2970085161 | 401 |
| 690 | iso_pu_bacteria | 2970088815 | 2970091532 | 401 |
| 691 | iso_pu_bacteria | 2970095765 | 2970102411 | 401 |
| 692 | iso_pu_bacteria | 2970102677 | 2970107729 | 401 |
| 693 | iso_pu_bacteria | 2970109326 | 2970113378 | 401 |
| 694 | iso_pu_bacteria | 2970116247 | 2970121424 | 401 |
| 695 | iso_pu_bacteria | 2970122695 | 2970124664 | 401 |
| 696 | iso_pu_bacteria | 2970129317 | 2970130283 | 401 |
| 697 | iso_pu_bacteria | 2970136068 | 2970138385 | 401 |
| 698 | iso_pu_bacteria | 2970143518 | 2970145478 | 401 |
| 699 | iso_pu_bacteria | 2970149975 | 2970153221 | 401 |
| 700 | iso_pu_bacteria | 2970156795 | 2970159005 | 401 |
| 701 | iso_pu_bacteria | 2970164137 | 2970170516 | 401 |
| 702 | iso_pu_bacteria | 2970170962 | 2970175377 | 401 |
| 703 | iso_pu_bacteria | 2970177841 | 2970181227 | 401 |
| 704 | iso_pu_bacteria | 2970184632 | 2970191566 | 401 |
| 705 | iso_pu_bacteria | 2970191845 | 2970193931 | 401 |
| 706 | iso_pu_bacteria | 2970554993 | 2970561603 | 401 |
| 707 | iso_pu_bacteria | 2977516862 | 2977520861 | 401 |
| 708 | iso_pu_bacteria | 2977523885 | 2977527326 | 401 |
| 709 | iso_pu_bacteria | 2977530762 | 2977534971 | 401 |
| 710 | iso_pu_bacteria | 2977537788 | 2977540219 | 401 |
| 711 | iso_pu_bacteria | 2977544691 | 2977547661 | 401 |
| 712 | iso_pu_bacteria | 2977551784 | 2977554900 | 401 |
| 713 | iso_pu_bacteria | 2977558990 | 2977562494 | 401 |
| 714 | iso_pu_bacteria | 2977565890 | 2977568305 | 401 |
| 715 | iso_pu_bacteria | 2977572785 | 2977577310 | 401 |
| 716 | iso_pu_bacteria | 2977579622 | 2977583620 | 401 |
| 717 | iso_pu_bacteria | 2977858184 | 2977861077 | 401 |
| 718 | iso_pu_bacteria | 2977864932 | 2977865880 | 401 |
| 719 | iso_pu_bacteria | 2978969890 | 2978971485 | 401 |
| 720 | iso_pu_bacteria | 2979089926 | 2979094320 | 401 |
| 721 | iso_pu_bacteria | 2979095461 | 2979098299 | 401 |
| 722 | iso_pu_bacteria | 2979100975 | 2979103553 | 401 |
| 723 | iso_pu_bacteria | 2979779861 | 2979786293 | 401 |
| 724 | iso_pu_bacteria | 2984509177 | 2984511879 | 401 |
| 725 | iso_pu_bacteria | 2984518228 | 2984521761 | 401 |
| 726 | iso_pu_bacteria | 2984587000 | 2984588629 | 401 |
| 727 | iso_pu_bacteria | 2987659509 | 2987666612 | 401 |
| 728 | iso_pu_bacteria | 2989771324 | 2989776085 | 401 |
| 729 | iso_pu_bacteria | 2989776772 | 2989778557 | 401 |
| 730 | iso_pu_bacteria | 2995392953 | 2995393247 | 401 |
| 731 | iso_pu_bacteria | 2996887358 | 2996892326 | 401 |
| 732 | iso_pu_bacteria | 2996893221 | 2996893908 | 401 |
| 733 | iso_pu_bacteria | 3003930520 | 3003933285 | 401 |
| 734 | iso_pu_bacteria | 3004188549 | 3004195614 | 401 |
| 735 | iso_pu_bacteria | 3005409236 | 3005412933 | 401 |
| 736 | iso_pu_bacteria | 3005445848 | 3005447092 | 401 |
| 737 | iso_pu_bacteria | 3005452660 | 3005453827 | 401 |
| 738 | iso_pu_bacteria | 639633055 | 639647922 | 401 |
| 739 | iso_pu_bacteria | 648276728 | 648740199 | 401 |
| 740 | iso_pu_bacteria | 650716007 | 650740175 | 401 |
| 741 | iso_pu_bacteria | 8003570095 | 8003571236 | 401 |
| 742 | iso_pu_bacteria | 8003992118 | 8003993400 | 401 |
| 743 | iso_pu_bacteria | 8003999396 | 8004000657 | 401 |
| 744 | iso_pu_bacteria | 8004445564 | 8004451002 | 401 |
| 745 | iso_pu_bacteria | 8004703790 | 8004709706 | 401 |
| 746 | iso_pu_bacteria | 8005246636 | 8005250943 | 401 |
| 747 | iso_pu_bacteria | 8005258706 | 8005259608 | 401 |
| 748 | iso_pu_bacteria | 8005275841 | 8005280066 | 401 |
| 749 | iso_pu_bacteria | 8005282627 | 8005284133 | 401 |
| 750 | iso_pu_bacteria | 8005289223 | 8005294644 | 401 |
| 751 | iso_pu_bacteria | 8005301065 | 8005307182 | 401 |
| 752 | iso_pu_bacteria | 8005307578 | 8005314782 | 401 |
| 753 | iso_pu_bacteria | 8005321885 | 8005326853 | 401 |
| 754 | iso_pu_bacteria | 8005376324 | 8005378643 | 401 |
| 755 | iso_pu_bacteria | 8005382845 | 8005384891 | 401 |
| 756 | iso_pu_bacteria | 8005395548 | 8005398315 | 401 |
| 757 | iso_pu_bacteria | 8005430974 | 8005436260 | 401 |
| 758 | iso_pu_bacteria | 8005460587 | 8005462369 | 401 |
| 759 | iso_pu_bacteria | 8005484373 | 8005486505 | 401 |
| 760 | iso_pu_bacteria | 8005497431 | 8005499752 | 401 |
| 761 | iso_pu_bacteria | 8005542996 | 8005544747 | 401 |
| 762 | iso_pu_bacteria | 8005556819 | 8005558265 | 401 |
| 763 | iso_pu_bacteria | 8005563573 | 8005569446 | 401 |
| 764 | iso_pu_bacteria | 8005570704 | 8005575288 | 401 |
| 765 | iso_pu_bacteria | 8005619151 | 8005620957 | 401 |
| 766 | iso_pu_bacteria | 8005626139 | 8005627431 | 401 |
| 767 | iso_pu_bacteria | 8005645114 | 8005646416 | 401 |
| 768 | iso_pu_bacteria | 8005668836 | 8005671173 | 401 |
| 769 | iso_pu_bacteria | 8005682033 | 8005686479 | 401 |
| 770 | iso_pu_bacteria | 8005688590 | 8005695092 | 401 |
| 771 | iso_pu_bacteria | 8005695170 | 8005696321 | 401 |
| 772 | iso_pu_bacteria | 8018127388 | 8018128219 | 401 |
| 773 | iso_pu_bacteria | 8018150411 | 8018152620 | 401 |
| 774 | iso_pu_bacteria | 8018163183 | 8018167944 | 401 |
| 775 | iso_pu_bacteria | 8018176218 | 8018177832 | 401 |
| 776 | iso_pu_bacteria | 8023680758 | 8023680822 | 401 |
| 777 | iso_pu_bacteria | 8024479707 | 8024485595 | 401 |
| 778 | iso_pu_bacteria | 8024501048 | 8024505065 | 401 |
| 779 | iso_pu_bacteria | 8046767195 | 8046768594 | 401 |
| 780 | iso_pu_bacteria | 8049293176 | 8049294450 | 401 |
| 781 | iso_pu_bacteria | 8054460903 | 8054462230 | 401 |
| 782 | iso_pu_bacteria | 8054558443 | 8054563348 | 401 |
| 783 | iso_pu_bacteria | 8055431914 | 8055435888 | 401 |
| 784 | iso_pu_bacteria | 8056375014 | 8056379998 | 401 |
| 785 | iso_pu_bacteria | 8056382006 | 8056387706 | 401 |
| 786 | iso_pu_bacteria | 8056875544 | 8056876700 | 401 |
| 787 | iso_pu_bacteria | 8057575449 | 8057578129 | 401 |
| 788 | iso_pu_bacteria | 8057874678 | 8057875645 | 401 |
| 789 | iso_pu_bacteria | 2585427608 | 2585897580 | 402 |
| 790 | iso_pu_bacteria | 2643221623 | 2644129866 | 402 |
| 791 | iso_pu_bacteria | 2738543024 | 2739309384 | 402 |
| 792 | iso_pu_bacteria | 2889790730 | 2889792242 | 402 |
| 793 | iso_pu_bacteria | 2889914905 | 2889917024 | 402 |
| 794 | iso_pu_bacteria | 8002285264 | 8002285587 | 402 |
| 795 | 3300006178 | Ga0075367_10105249 | Ga0075367_101052492 | 403 |
| 796 | 3300048921 | Ga0496118_0034154 | Ga0496118_0034154_1250_2461 | 403 |
| 797 | 3300049570 | Ga0501033_0050652 | Ga0501033_0050652_809_2026 | 403 |
| 798 | 3300049573 | Ga0501037_0158277 | Ga0501037_0158277_141_1358 | 403 |
| 799 | 3300049581 | Ga0501047_0038552 | Ga0501047_0038552_545_1762 | 403 |
| 800 | 3300049823 | Ga0501044_0254640 | Ga0501044_0254640_44_1261 | 403 |
| 801 | iso_pu_bacteria | 2599185156 | 2599333379 | 403 |
| 802 | iso_pu_bacteria | 2791355253 | 2793279527 | 403 |
| 803 | iso_pu_bacteria | 2842922631 | 2842925214 | 403 |
| 804 | 3300001979 | JGI24740J21852_10007318 | JGI24740J21852_100073183 | 404 |
| 805 | 3300001979 | JGI24740J21852_10010983 | JGI24740J21852_100109832 | 404 |
| 806 | 3300002705 | JGI25156J39149_1001896 | JGI25156J39149_10018963 | 404 |
| 807 | 3300002741 | JGI25157J39369_1001076 | JGI25157J39369_10010769 | 404 |
| 808 | 3300003762 | Ga0055542_1001237 | Ga0055542_10012372 | 404 |
| 809 | 3300005339 | Ga0070660_100136645 | Ga0070660_1001366451 | 404 |
| 810 | 3300006038 | Ga0075365_10022285 | Ga0075365_100222853 | 404 |
| 811 | 3300006038 | Ga0075365_10035815 | Ga0075365_100358152 | 404 |
| 812 | 3300006038 | Ga0075365_10052238 | Ga0075365_100522382 | 404 |
| 813 | 3300006048 | Ga0075363_100106348 | Ga0075363_1001063482 | 404 |
| 814 | 3300006353 | Ga0075370_10085274 | Ga0075370_100852742 | 404 |
| 815 | 3300010375 | Ga0105239_10471607 | Ga0105239_104716072 | 404 |
| 816 | 3300025250 | Ga0209026_1000024 | Ga0209026_1000024201 | 404 |
| 817 | 3300025254 | Ga0209148_1000050 | Ga0209148_1000050155 | 404 |
| 818 | 3300025256 | Ga0209759_1000389 | Ga0209759_100038922 | 404 |
| 819 | 3300025272 | Ga0209455_1000183 | Ga0209455_100018358 | 404 |
| 820 | 3300025909 | Ga0207705_10037788 | Ga0207705_100377883 | 404 |
| 821 | 3300025913 | Ga0207695_10060785 | Ga0207695_100607856 | 404 |
| 822 | 3300025949 | Ga0207667_10227130 | Ga0207667_102271302 | 404 |
| 823 | 3300026067 | Ga0207678_10076269 | Ga0207678_100762693 | 404 |
| 824 | 3300026142 | Ga0207698_10274067 | Ga0207698_102740671 | 404 |
| 825 | 3300041413 | Ga0439465_0016694 | Ga0439465_0016694_866_2080 | 404 |
| 826 | 3300046515 | Ga0495620_0036350 | Ga0495620_0036350_167_1381 | 404 |
| 827 | 3300046522 | Ga0495643_0061730 | Ga0495643_0061730_504_1718 | 404 |
| 828 | 3300048091 | Ga0495626_0058288 | Ga0495626_0058288_76_1290 | 404 |
| 829 | 3300048912 | Ga0496109_0172328 | Ga0496109_0172328_278_1492 | 404 |
| 830 | 3300048927 | Ga0496124_0122494 | Ga0496124_0122494_27_1241 | 404 |
| 831 | 3300049570 | Ga0501033_0027898 | Ga0501033_0027898_2619_3842 | 404 |
| 832 | 3300049570 | Ga0501033_0039171 | Ga0501033_0039171_1619_2842 | 404 |
| 833 | 3300049571 | Ga0501034_0058508 | Ga0501034_0058508_1158_2381 | 404 |
| 834 | 3300049823 | Ga0501044_0020059 | Ga0501044_0020059_4063_5286 | 404 |
| 835 | 3300050492 | nmdc:mga0yw44_6407_c1 | nmdc:mga0yw44_6407_c1_2593_3807 | 404 |
| 836 | 3300050492 | nmdc:mga0yw44_69639_c1 | nmdc:mga0yw44_69639_c1_520_1734 | 404 |
| 837 | 3300053134 | Ga0500658_0083936 | Ga0500658_0083936_105_1319 | 404 |
| 838 | iso_pu_bacteria | 2751185800 | 2753359190 | 404 |
| 839 | iso_pu_bacteria | 2758568016 | 2758641435 | 404 |
| 840 | 3300002737 | JGI25162J39368_1002413 | JGI25162J39368_10024137 | 405 |
| 841 | 3300002738 | JGI25154J39366_1000181 | JGI25154J39366_100018114 | 405 |
| 842 | 3300002739 | JGI25158J39367_1000135 | JGI25158J39367_10001357 | 405 |
| 843 | 3300002739 | JGI25158J39367_1000975 | JGI25158J39367_10009753 | 405 |
| 844 | 3300002773 | JGI25152J39213_1000534 | JGI25152J39213_100053413 | 405 |
| 845 | 3300002773 | JGI25152J39213_1000545 | JGI25152J39213_10005453 | 405 |
| 846 | 3300002773 | JGI25152J39213_1003397 | JGI25152J39213_10033972 | 405 |
| 847 | 3300002773 | JGI25152J39213_1004376 | JGI25152J39213_10043762 | 405 |
| 848 | 3300002773 | JGI25152J39213_1012822 | JGI25152J39213_10128222 | 405 |
| 849 | 3300002773 | JGI25152J39213_1012828 | JGI25152J39213_10128282 | 405 |
| 850 | 3300002774 | JGI25150J39212_1000047 | JGI25150J39212_10000473 | 405 |
| 851 | 3300002774 | JGI25150J39212_1000380 | JGI25150J39212_10003803 | 405 |
| 852 | 3300002774 | JGI25150J39212_1002361 | JGI25150J39212_10023612 | 405 |
| 853 | 3300002987 | JGI25159J45721_1000006 | JGI25159J45721_1000006152 | 405 |
| 854 | 3300002987 | JGI25159J45721_1001165 | JGI25159J45721_100116510 | 405 |
| 855 | 3300002987 | JGI25159J45721_1002092 | JGI25159J45721_10020923 | 405 |
| 856 | 3300003187 | JGI25151J46595_10000126 | JGI25151J46595_1000012676 | 405 |
| 857 | 3300003187 | JGI25151J46595_10011907 | JGI25151J46595_100119072 | 405 |
| 858 | 3300003214 | JGI25165J46597_1000062 | JGI25165J46597_100006255 | 405 |
| 859 | 3300003214 | JGI25165J46597_1000920 | JGI25165J46597_10009202 | 405 |
| 860 | 3300003215 | JGI25153J46596_10001078 | JGI25153J46596_1000107819 | 405 |
| 861 | 3300003215 | JGI25153J46596_10007194 | JGI25153J46596_100071942 | 405 |
| 862 | 3300003215 | JGI25153J46596_10031675 | JGI25153J46596_100316752 | 405 |
| 863 | 3300003215 | JGI25153J46596_10031676 | JGI25153J46596_100316762 | 405 |
| 864 | 3300003215 | JGI25153J46596_10033910 | JGI25153J46596_100339102 | 405 |
| 865 | 3300003322 | rootL2_10018543 | rootL2_100185439 | 405 |
| 866 | 3300003323 | rootH1_10019945 | rootH1_100199451 | 405 |
| 867 | 3300003354 | JGI25160J50197_1000004 | JGI25160J50197_1000004321 | 405 |
| 868 | 3300003354 | JGI25160J50197_1000019 | JGI25160J50197_1000019157 | 405 |
| 869 | 3300003354 | JGI25160J50197_1000664 | JGI25160J50197_100066418 | 405 |
| 870 | 3300003354 | JGI25160J50197_1008485 | JGI25160J50197_10084853 | 405 |
| 871 | 3300003354 | JGI25160J50197_1012480 | JGI25160J50197_10124801 | 405 |
| 872 | 3300003374 | JGI25161J50226_1000003 | JGI25161J50226_1000003108 | 405 |
| 873 | 3300003374 | JGI25161J50226_1000467 | JGI25161J50226_100046715 | 405 |
| 874 | 3300003374 | JGI25161J50226_1000680 | JGI25161J50226_10006802 | 405 |
| 875 | 3300003374 | JGI25161J50226_1000904 | JGI25161J50226_10009047 | 405 |
| 876 | 3300003771 | Ga0055526_1000462 | Ga0055526_10004625 | 405 |
| 877 | 3300003771 | Ga0055526_1001096 | Ga0055526_100109610 | 405 |
| 878 | 3300003771 | Ga0055526_1003315 | Ga0055526_10033152 | 405 |
| 879 | 3300003771 | Ga0055526_1008997 | Ga0055526_10089974 | 405 |
| 880 | 3300003775 | Ga0055524_1001178 | Ga0055524_10011785 | 405 |
| 881 | 3300003775 | Ga0055524_1002226 | Ga0055524_10022262 | 405 |
| 882 | 3300003775 | Ga0055524_1003918 | Ga0055524_10039183 | 405 |
| 883 | 3300003781 | Ga0055536_1002723 | Ga0055536_10027233 | 405 |
| 884 | 3300003790 | Ga0055528_1000051 | Ga0055528_10000512 | 405 |
| 885 | 3300003790 | Ga0055528_1000448 | Ga0055528_100044821 | 405 |
| 886 | 3300003790 | Ga0055528_1006972 | Ga0055528_10069721 | 405 |
| 887 | 3300003790 | Ga0055528_1007775 | Ga0055528_10077754 | 405 |
| 888 | 3300003792 | Ga0055540_1002665 | Ga0055540_10026657 | 405 |
| 889 | 3300003794 | Ga0055531_10002882 | Ga0055531_100028827 | 405 |
| 890 | 3300003794 | Ga0055531_10003417 | Ga0055531_100034175 | 405 |
| 891 | 3300003856 | Ga0058692_1004482 | Ga0058692_10044822 | 405 |
| 892 | 3300004625 | Ga0055543_1000001 | Ga0055543_1000001114 | 405 |
| 893 | 3300004625 | Ga0055543_1000275 | Ga0055543_100027533 | 405 |
| 894 | 3300004625 | Ga0055543_1000867 | Ga0055543_10008672 | 405 |
| 895 | 3300004625 | Ga0055543_1000935 | Ga0055543_10009352 | 405 |
| 896 | 3300005262 | Ga0065165_1000149 | Ga0065165_100014937 | 405 |
| 897 | 3300005262 | Ga0065165_1000272 | Ga0065165_100027243 | 405 |
| 898 | 3300005262 | Ga0065165_1001907 | Ga0065165_10019073 | 405 |
| 899 | 3300005262 | Ga0065165_1008226 | Ga0065165_10082264 | 405 |
| 900 | 3300005355 | Ga0070671_100043803 | Ga0070671_1000438032 | 405 |
| 901 | 3300005367 | Ga0070667_100159462 | Ga0070667_1001594622 | 405 |
| 902 | 3300005455 | Ga0070663_100010806 | Ga0070663_1000108063 | 405 |
| 903 | 3300005548 | Ga0070665_100025262 | Ga0070665_1000252627 | 405 |
| 904 | 3300005548 | Ga0070665_100040711 | Ga0070665_1000407112 | 405 |
| 905 | 3300005548 | Ga0070665_100044244 | Ga0070665_1000442444 | 405 |
| 906 | 3300005614 | Ga0068856_100196996 | Ga0068856_1001969962 | 405 |
| 907 | 3300006038 | Ga0075365_10001830 | Ga0075365_100018302 | 405 |
| 908 | 3300006048 | Ga0075363_100012575 | Ga0075363_1000125753 | 405 |
| 909 | 3300006048 | Ga0075363_100020583 | Ga0075363_1000205831 | 405 |
| 910 | 3300006051 | Ga0075364_10001918 | Ga0075364_1000191812 | 405 |
| 911 | 3300006051 | Ga0075364_10035513 | Ga0075364_100355132 | 405 |
| 912 | 3300006177 | Ga0075362_10000297 | Ga0075362_100002973 | 405 |
| 913 | 3300006177 | Ga0075362_10052629 | Ga0075362_100526291 | 405 |
| 914 | 3300006186 | Ga0075369_10000735 | Ga0075369_100007353 | 405 |
| 915 | 3300006186 | Ga0075369_10008326 | Ga0075369_100083263 | 405 |
| 916 | 3300006186 | Ga0075369_10040288 | Ga0075369_100402882 | 405 |
| 917 | 3300006195 | Ga0075366_10010376 | Ga0075366_100103763 | 405 |
| 918 | 3300006195 | Ga0075366_10015206 | Ga0075366_100152062 | 405 |
| 919 | 3300006353 | Ga0075370_10028124 | Ga0075370_100281241 | 405 |
| 920 | 3300006946 | Ga0079104_1000129 | Ga0079104_100012999 | 405 |
| 921 | 3300006946 | Ga0079104_1010900 | Ga0079104_10109002 | 405 |
| 922 | 3300006948 | Ga0099826_10002926 | Ga0099826_100029262 | 405 |
| 923 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005106 | 405 |
| 924 | 3300009093 | Ga0105240_10047849 | Ga0105240_100478492 | 405 |
| 925 | 3300009177 | Ga0105248_10279957 | Ga0105248_102799572 | 405 |
| 926 | 3300009545 | Ga0105237_10001991 | Ga0105237_1000199110 | 405 |
| 927 | 3300009545 | Ga0105237_10045855 | Ga0105237_100458554 | 405 |
| 928 | 3300009551 | Ga0105238_10004648 | Ga0105238_100046483 | 405 |
| 929 | 3300009553 | Ga0105249_10042443 | Ga0105249_100424434 | 405 |
| 930 | 3300009765 | Ga0123341_1000001 | Ga0123341_1000001172 | 405 |
| 931 | 3300009766 | Ga0123342_1021352 | Ga0123342_10213526 | 405 |
| 932 | 3300009766 | Ga0123342_1023582 | Ga0123342_10235824 | 405 |
| 933 | 3300010375 | Ga0105239_10003100 | Ga0105239_100031004 | 405 |
| 934 | 3300013100 | Ga0157373_10005196 | Ga0157373_100051963 | 405 |
| 935 | 3300013102 | Ga0157371_10000015 | Ga0157371_10000015227 | 405 |
| 936 | 3300013104 | Ga0157370_10000309 | Ga0157370_1000030961 | 405 |
| 937 | 3300013104 | Ga0157370_10000665 | Ga0157370_1000066527 | 405 |
| 938 | 3300013249 | Ga0171463_1011 | Ga0171463_1011209 | 405 |
| 939 | 3300015690 | Ga0183363_1143 | Ga0183363_11437 | 405 |
| 940 | 3300021320 | Ga0214544_1000024 | Ga0214544_1000024117 | 405 |
| 941 | 3300021321 | Ga0214542_1000015 | Ga0214542_1000015102 | 405 |
| 942 | 3300021321 | Ga0214542_1026484 | Ga0214542_10264843 | 405 |
| 943 | 3300021327 | Ga0214543_1000011 | Ga0214543_1000011304 | 405 |
| 944 | 3300022739 | Ga0228711_1000528 | Ga0228711_10005285 | 405 |
| 945 | 3300022740 | Ga0228710_1000006 | Ga0228710_1000006140 | 405 |
| 946 | 3300025207 | Ga0209760_102358 | Ga0209760_1023581 | 405 |
| 947 | 3300025208 | Ga0209436_100039 | Ga0209436_10003963 | 405 |
| 948 | 3300025208 | Ga0209436_100390 | Ga0209436_1003904 | 405 |
| 949 | 3300025208 | Ga0209436_109217 | Ga0209436_1092172 | 405 |
| 950 | 3300025228 | Ga0209672_101326 | Ga0209672_1013264 | 405 |
| 951 | 3300025230 | Ga0209563_104361 | Ga0209563_1043612 | 405 |
| 952 | 3300025233 | Ga0209437_100153 | Ga0209437_10015381 | 405 |
| 953 | 3300025233 | Ga0209437_100201 | Ga0209437_10020146 | 405 |
| 954 | 3300025245 | Ga0207425_1000010 | Ga0207425_1000010267 | 405 |
| 955 | 3300025245 | Ga0207425_1001043 | Ga0207425_10010434 | 405 |
| 956 | 3300025245 | Ga0207425_1006562 | Ga0207425_10065624 | 405 |
| 957 | 3300025245 | Ga0207425_1011258 | Ga0207425_10112583 | 405 |
| 958 | 3300025245 | Ga0207425_1020406 | Ga0207425_10204061 | 405 |
| 959 | 3300025253 | Ga0209677_101154 | Ga0209677_1011543 | 405 |
| 960 | 3300025258 | Ga0209129_1000034 | Ga0209129_100003474 | 405 |
| 961 | 3300025258 | Ga0209129_1000470 | Ga0209129_100047016 | 405 |
| 962 | 3300025258 | Ga0209129_1000947 | Ga0209129_10009478 | 405 |
| 963 | 3300025258 | Ga0209129_1001001 | Ga0209129_100100113 | 405 |
| 964 | 3300025258 | Ga0209129_1002822 | Ga0209129_10028225 | 405 |
| 965 | 3300025258 | Ga0209129_1003476 | Ga0209129_10034763 | 405 |
| 966 | 3300025261 | Ga0209233_1000129 | Ga0209233_1000129138 | 405 |
| 967 | 3300025261 | Ga0209233_1000175 | Ga0209233_100017570 | 405 |
| 968 | 3300025261 | Ga0209233_1000226 | Ga0209233_100022627 | 405 |
| 969 | 3300025261 | Ga0209233_1000248 | Ga0209233_100024833 | 405 |
| 970 | 3300025273 | Ga0209673_1000230 | Ga0209673_100023028 | 405 |
| 971 | 3300025273 | Ga0209673_1001478 | Ga0209673_100147816 | 405 |
| 972 | 3300025273 | Ga0209673_1002170 | Ga0209673_100217011 | 405 |
| 973 | 3300025273 | Ga0209673_1003247 | Ga0209673_10032478 | 405 |
| 974 | 3300025273 | Ga0209673_1005149 | Ga0209673_10051496 | 405 |
| 975 | 3300025273 | Ga0209673_1009980 | Ga0209673_10099802 | 405 |
| 976 | 3300025273 | Ga0209673_1024873 | Ga0209673_10248732 | 405 |
| 977 | 3300025284 | Ga0209130_1000006 | Ga0209130_100000687 | 405 |
| 978 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007510 | 405 |
| 979 | 3300025284 | Ga0209130_1000012 | Ga0209130_1000012314 | 405 |
| 980 | 3300025292 | Ga0209676_1002948 | Ga0209676_10029487 | 405 |
| 981 | 3300025294 | Ga0209025_1000022 | Ga0209025_1000022315 | 405 |
| 982 | 3300025294 | Ga0209025_1000033 | Ga0209025_1000033347 | 405 |
| 983 | 3300025294 | Ga0209025_1000097 | Ga0209025_1000097141 | 405 |
| 984 | 3300025294 | Ga0209025_1007667 | Ga0209025_10076675 | 405 |
| 985 | 3300025294 | Ga0209025_1011412 | Ga0209025_10114125 | 405 |
| 986 | 3300025294 | Ga0209025_1013526 | Ga0209025_10135264 | 405 |
| 987 | 3300025294 | Ga0209025_1058870 | Ga0209025_10588702 | 405 |
| 988 | 3300025295 | Ga0209564_1000373 | Ga0209564_100037317 | 405 |
| 989 | 3300025295 | Ga0209564_1000740 | Ga0209564_100074027 | 405 |
| 990 | 3300025295 | Ga0209564_1001522 | Ga0209564_100152217 | 405 |
| 991 | 3300025295 | Ga0209564_1007164 | Ga0209564_10071643 | 405 |
| 992 | 3300025297 | Ga0209758_1000080 | Ga0209758_1000080206 | 405 |
| 993 | 3300025297 | Ga0209758_1000520 | Ga0209758_100052053 | 405 |
| 994 | 3300025297 | Ga0209758_1000633 | Ga0209758_100063356 | 405 |
| 995 | 3300025297 | Ga0209758_1000822 | Ga0209758_100082210 | 405 |
| 996 | 3300025297 | Ga0209758_1001240 | Ga0209758_100124010 | 405 |
| 997 | 3300025297 | Ga0209758_1001887 | Ga0209758_10018877 | 405 |
| 998 | 3300025297 | Ga0209758_1005650 | Ga0209758_10056507 | 405 |
| 999 | 3300025297 | Ga0209758_1019549 | Ga0209758_10195492 | 405 |
| 1000 | 3300025297 | Ga0209758_1025829 | Ga0209758_10258292 | 405 |
| 1001 | 3300025298 | Ga0209050_1004383 | Ga0209050_10043833 | 405 |
| 1002 | 3300025298 | Ga0209050_1011067 | Ga0209050_10110671 | 405 |
| 1003 | 3300025299 | Ga0209256_1000319 | Ga0209256_100031950 | 405 |
| 1004 | 3300025299 | Ga0209256_1001551 | Ga0209256_100155128 | 405 |
| 1005 | 3300025299 | Ga0209256_1002545 | Ga0209256_10025459 | 405 |
| 1006 | 3300025299 | Ga0209256_1009788 | Ga0209256_10097882 | 405 |
| 1007 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003950 | 405 |
| 1008 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010673 | 405 |
| 1009 | 3300025302 | Ga0207426_1000094 | Ga0207426_1000094138 | 405 |
| 1010 | 3300025302 | Ga0207426_1000111 | Ga0207426_1000111151 | 405 |
| 1011 | 3300025302 | Ga0207426_1000853 | Ga0207426_100085319 | 405 |
| 1012 | 3300025303 | Ga0209051_1000166 | Ga0209051_100016651 | 405 |
| 1013 | 3300025303 | Ga0209051_1003640 | Ga0209051_10036403 | 405 |
| 1014 | 3300025303 | Ga0209051_1011805 | Ga0209051_10118052 | 405 |
| 1015 | 3300025303 | Ga0209051_1039818 | Ga0209051_10398182 | 405 |
| 1016 | 3300025304 | Ga0209257_1001307 | Ga0209257_10013077 | 405 |
| 1017 | 3300025304 | Ga0209257_1003894 | Ga0209257_10038943 | 405 |
| 1018 | 3300025304 | Ga0209257_1005270 | Ga0209257_10052705 | 405 |
| 1019 | 3300025304 | Ga0209257_1026675 | Ga0209257_10266752 | 405 |
| 1020 | 3300025903 | Ga0207680_10068849 | Ga0207680_100688492 | 405 |
| 1021 | 3300025904 | Ga0207647_10056612 | Ga0207647_100566122 | 405 |
| 1022 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011809 | 405 |
| 1023 | 3300025914 | Ga0207671_10000276 | Ga0207671_1000027613 | 405 |
| 1024 | 3300025914 | Ga0207671_10084009 | Ga0207671_100840093 | 405 |
| 1025 | 3300025924 | Ga0207694_10018118 | Ga0207694_100181186 | 405 |
| 1026 | 3300025931 | Ga0207644_10051817 | Ga0207644_100518172 | 405 |
| 1027 | 3300025972 | Ga0207668_10125634 | Ga0207668_101256341 | 405 |
| 1028 | 3300025981 | Ga0207640_10060572 | Ga0207640_100605723 | 405 |
| 1029 | 3300026067 | Ga0207678_10138722 | Ga0207678_101387221 | 405 |
| 1030 | 3300026142 | Ga0207698_10110899 | Ga0207698_101108992 | 405 |
| 1031 | 3300027111 | Ga0209281_1000036 | Ga0209281_1000036150 | 405 |
| 1032 | 3300027111 | Ga0209281_1000047 | Ga0209281_100004792 | 405 |
| 1033 | 3300027111 | Ga0209281_1000268 | Ga0209281_100026853 | 405 |
| 1034 | 3300027111 | Ga0209281_1000578 | Ga0209281_100057833 | 405 |
| 1035 | 3300027312 | Ga0209371_1000382 | Ga0209371_100038236 | 405 |
| 1036 | 3300027312 | Ga0209371_1001444 | Ga0209371_10014447 | 405 |
| 1037 | 3300027666 | Ga0209282_1000026 | Ga0209282_1000026134 | 405 |
| 1038 | 3300027666 | Ga0209282_1000095 | Ga0209282_100009562 | 405 |
| 1039 | 3300027866 | Ga0209813_10005272 | Ga0209813_100052724 | 405 |
| 1040 | 3300027866 | Ga0209813_10031440 | Ga0209813_100314402 | 405 |
| 1041 | 3300028379 | Ga0268266_10025145 | Ga0268266_100251457 | 405 |
| 1042 | 3300028379 | Ga0268266_10030382 | Ga0268266_100303822 | 405 |
| 1043 | 3300028379 | Ga0268266_10170832 | Ga0268266_101708322 | 405 |
| 1044 | 3300028794 | Ga0307515_10000274 | Ga0307515_1000027465 | 405 |
| 1045 | 3300028794 | Ga0307515_10000656 | Ga0307515_1000065664 | 405 |
| 1046 | 3300028794 | Ga0307515_10036369 | Ga0307515_100363692 | 405 |
| 1047 | 3300028794 | Ga0307515_10040065 | Ga0307515_100400653 | 405 |
| 1048 | 3300030500 | Ga0268256_1002533 | Ga0268256_10025332 | 405 |
| 1049 | 3300031456 | Ga0307513_10003280 | Ga0307513_1000328014 | 405 |
| 1050 | 3300031456 | Ga0307513_10010898 | Ga0307513_100108987 | 405 |
| 1051 | 3300031548 | Ga0307408_100032605 | Ga0307408_1000326053 | 405 |
| 1052 | 3300031731 | Ga0307405_10002526 | Ga0307405_100025263 | 405 |
| 1053 | 3300031731 | Ga0307405_10193754 | Ga0307405_101937541 | 405 |
| 1054 | 3300031901 | Ga0307406_10058516 | Ga0307406_100585162 | 405 |
| 1055 | 3300031911 | Ga0307412_10002014 | Ga0307412_100020149 | 405 |
| 1056 | 3300031967 | Ga0315914_1000008 | Ga0315914_1000008139 | 405 |
| 1057 | 3300033430 | Ga0315913_1000137 | Ga0315913_100013739 | 405 |
| 1058 | 3300033464 | Ga0315915_1000014 | Ga0315915_100001437 | 405 |
| 1059 | 3300035695 | Ga0373927_0002192 | Ga0373927_0002192_10808_12025 | 405 |
| 1060 | 3300037068 | Ga0373925_0016473 | Ga0373925_0016473_1517_2734 | 405 |
| 1061 | 3300037312 | Ga0395899_0203361 | Ga0395899_0203361_127_1356 | 405 |
| 1062 | 3300037466 | Ga0395898_0043866 | Ga0395898_0043866_978_2207 | 405 |
| 1063 | 3300037471 | Ga0395905_0000700 | Ga0395905_0000700_17510_18727 | 405 |
| 1064 | 3300037471 | Ga0395905_0093994 | Ga0395905_0093994_28_1245 | 405 |
| 1065 | 3300037471 | Ga0395905_0164691 | Ga0395905_0164691_646_1875 | 405 |
| 1066 | 3300038443 | Ga0395901_0080673 | Ga0395901_0080673_2008_3225 | 405 |
| 1067 | 3300041404 | Ga0439436_0028385 | Ga0439436_0028385_208_1425 | 405 |
| 1068 | 3300041413 | Ga0439465_0004501 | Ga0439465_0004501_646_1863 | 405 |
| 1069 | 3300041441 | Ga0451787_319395 | Ga0451787_319395_1923_3140 | 405 |
| 1070 | 3300041458 | Ga0451798_0610660 | Ga0451798_0610660_458_1675 | 405 |
| 1071 | 3300041496 | Ga0451839_0405469 | Ga0451839_0405469_1833_3050 | 405 |
| 1072 | 3300041501 | Ga0451845_0331327 | Ga0451845_0331327_663_1880 | 405 |
| 1073 | 3300041509 | Ga0451843_0429565 | Ga0451843_0429565_753_1970 | 405 |
| 1074 | 3300042007 | Ga0439449_0015080 | Ga0439449_0015080_992_2209 | 405 |
| 1075 | 3300042007 | Ga0439449_0037976 | Ga0439449_0037976_427_1644 | 405 |
| 1076 | 3300044683 | Ga0466965_0076334 | Ga0466965_0076334_447_1676 | 405 |
| 1077 | 3300044684 | Ga0466966_0097048 | Ga0466966_0097048_420_1637 | 405 |
| 1078 | 3300044765 | Ga0466970_0004213 | Ga0466970_0004213_1280_2497 | 405 |
| 1079 | 3300044842 | Ga0466957_0111140 | Ga0466957_0111140_283_1500 | 405 |
| 1080 | 3300046459 | Ga0495629_0039145 | Ga0495629_0039145_80_1297 | 405 |
| 1081 | 3300046460 | Ga0495638_0000687 | Ga0495638_0000687_29746_30963 | 405 |
| 1082 | 3300046460 | Ga0495638_0010851 | Ga0495638_0010851_74_1291 | 405 |
| 1083 | 3300046462 | Ga0495651_0043436 | Ga0495651_0043436_942_2159 | 405 |
| 1084 | 3300046471 | Ga0495650_0048953 | Ga0495650_0048953_162_1379 | 405 |
| 1085 | 3300046474 | Ga0495605_0000460 | Ga0495605_0000460_5685_6902 | 405 |
| 1086 | 3300046492 | Ga0495585_0011038 | Ga0495585_0011038_331_1548 | 405 |
| 1087 | 3300046492 | Ga0495585_0046508 | Ga0495585_0046508_390_1607 | 405 |
| 1088 | 3300046506 | Ga0495583_0013238 | Ga0495583_0013238_400_1617 | 405 |
| 1089 | 3300046507 | Ga0495606_0000959 | Ga0495606_0000959_31347_32564 | 405 |
| 1090 | 3300046507 | Ga0495606_0077124 | Ga0495606_0077124_767_1984 | 405 |
| 1091 | 3300046512 | Ga0495610_0007814 | Ga0495610_0007814_333_1550 | 405 |
| 1092 | 3300046513 | Ga0495616_0055894 | Ga0495616_0055894_120_1337 | 405 |
| 1093 | 3300046516 | Ga0495628_0045009 | Ga0495628_0045009_878_2095 | 405 |
| 1094 | 3300046518 | Ga0495631_0013261 | Ga0495631_0013261_410_1627 | 405 |
| 1095 | 3300046519 | Ga0495632_0002325 | Ga0495632_0002325_4240_5457 | 405 |
| 1096 | 3300046519 | Ga0495632_0066771 | Ga0495632_0066771_197_1414 | 405 |
| 1097 | 3300046522 | Ga0495643_0006856 | Ga0495643_0006856_6151_7368 | 405 |
| 1098 | 3300046522 | Ga0495643_0030079 | Ga0495643_0030079_669_1886 | 405 |
| 1099 | 3300046522 | Ga0495643_0031760 | Ga0495643_0031760_696_1913 | 405 |
| 1100 | 3300046558 | Ga0495633_0020647 | Ga0495633_0020647_650_1867 | 405 |
| 1101 | 3300046616 | Ga0495668_0005947 | Ga0495668_0005947_5604_6821 | 405 |
| 1102 | 3300046660 | Ga0495625_0010879 | Ga0495625_0010879_1352_2569 | 405 |
| 1103 | 3300046674 | Ga0495588_0001225 | Ga0495588_0001225_835_2052 | 405 |
| 1104 | 3300046675 | Ga0495657_0041037 | Ga0495657_0041037_1147_2364 | 405 |
| 1105 | 3300046694 | Ga0495649_0052616 | Ga0495649_0052616_249_1466 | 405 |
| 1106 | 3300046810 | Ga0495660_0030040 | Ga0495660_0030040_575_1792 | 405 |
| 1107 | 3300046810 | Ga0495660_0056170 | Ga0495660_0056170_386_1603 | 405 |
| 1108 | 3300047320 | Ga0495672_0034276 | Ga0495672_0034276_1074_2291 | 405 |
| 1109 | 3300047470 | Ga0495681_0042887 | Ga0495681_0042887_366_1583 | 405 |
| 1110 | 3300047472 | Ga0495686_0000989 | Ga0495686_0000989_26120_27337 | 405 |
| 1111 | 3300047472 | Ga0495686_0019154 | Ga0495686_0019154_112_1329 | 405 |
| 1112 | 3300047472 | Ga0495686_0047323 | Ga0495686_0047323_245_1462 | 405 |
| 1113 | 3300047472 | Ga0495686_0089945 | Ga0495686_0089945_318_1535 | 405 |
| 1114 | 3300048903 | Ga0496100_0074167 | Ga0496100_0074167_626_1843 | 405 |
| 1115 | 3300048905 | Ga0496102_0094757 | Ga0496102_0094757_1067_2284 | 405 |
| 1116 | 3300048906 | Ga0496103_0005774 | Ga0496103_0005774_760_1977 | 405 |
| 1117 | 3300048909 | Ga0496106_0007752 | Ga0496106_0007752_5736_6953 | 405 |
| 1118 | 3300048909 | Ga0496106_0208759 | Ga0496106_0208759_53_1270 | 405 |
| 1119 | 3300048910 | Ga0496107_0114642 | Ga0496107_0114642_491_1708 | 405 |
| 1120 | 3300048914 | Ga0496111_0186323 | Ga0496111_0186323_144_1361 | 405 |
| 1121 | 3300048917 | Ga0496114_0156867 | Ga0496114_0156867_182_1399 | 405 |
| 1122 | 3300048919 | Ga0496116_0003692 | Ga0496116_0003692_5910_7127 | 405 |
| 1123 | 3300048919 | Ga0496116_0011986 | Ga0496116_0011986_5883_7100 | 405 |
| 1124 | 3300048919 | Ga0496116_0013279 | Ga0496116_0013279_5346_6563 | 405 |
| 1125 | 3300048919 | Ga0496116_0045233 | Ga0496116_0045233_596_1813 | 405 |
| 1126 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_893056_894273 | 405 |
| 1127 | 3300048920 | Ga0496117_0001684 | Ga0496117_0001684_4759_5976 | 405 |
| 1128 | 3300048920 | Ga0496117_0013916 | Ga0496117_0013916_19_1236 | 405 |
| 1129 | 3300048920 | Ga0496117_0031949 | Ga0496117_0031949_799_2016 | 405 |
| 1130 | 3300048920 | Ga0496117_0078894 | Ga0496117_0078894_15_1232 | 405 |
| 1131 | 3300048920 | Ga0496117_0094613 | Ga0496117_0094613_346_1563 | 405 |
| 1132 | 3300048921 | Ga0496118_0000460 | Ga0496118_0000460_19489_20706 | 405 |
| 1133 | 3300048921 | Ga0496118_0000756 | Ga0496118_0000756_24820_26037 | 405 |
| 1134 | 3300048921 | Ga0496118_0004327 | Ga0496118_0004327_8215_9432 | 405 |
| 1135 | 3300048922 | Ga0496119_0009961 | Ga0496119_0009961_5741_6958 | 405 |
| 1136 | 3300048922 | Ga0496119_0012100 | Ga0496119_0012100_4026_5252 | 405 |
| 1137 | 3300048922 | Ga0496119_0037445 | Ga0496119_0037445_402_1619 | 405 |
| 1138 | 3300048922 | Ga0496119_0055707 | Ga0496119_0055707_602_1819 | 405 |
| 1139 | 3300048923 | Ga0496120_0000078 | Ga0496120_0000078_89623_90840 | 405 |
| 1140 | 3300048923 | Ga0496120_0001824 | Ga0496120_0001824_10161_11390 | 405 |
| 1141 | 3300048923 | Ga0496120_0005495 | Ga0496120_0005495_5664_6881 | 405 |
| 1142 | 3300048923 | Ga0496120_0010777 | Ga0496120_0010777_80_1297 | 405 |
| 1143 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_1181257_1182474 | 405 |
| 1144 | 3300048924 | Ga0496121_0000182 | Ga0496121_0000182_115951_117168 | 405 |
| 1145 | 3300048924 | Ga0496121_0001247 | Ga0496121_0001247_25590_26807 | 405 |
| 1146 | 3300048924 | Ga0496121_0010224 | Ga0496121_0010224_5543_6760 | 405 |
| 1147 | 3300048924 | Ga0496121_0029857 | Ga0496121_0029857_820_2037 | 405 |
| 1148 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_199489_200706 | 405 |
| 1149 | 3300048925 | Ga0496122_0004590 | Ga0496122_0004590_8540_9757 | 405 |
| 1150 | 3300048925 | Ga0496122_0012559 | Ga0496122_0012559_2163_3380 | 405 |
| 1151 | 3300048925 | Ga0496122_0013836 | Ga0496122_0013836_5520_6737 | 405 |
| 1152 | 3300048925 | Ga0496122_0037942 | Ga0496122_0037942_1796_3022 | 405 |
| 1153 | 3300048925 | Ga0496122_0044491 | Ga0496122_0044491_2051_3268 | 405 |
| 1154 | 3300048925 | Ga0496122_0045680 | Ga0496122_0045680_935_2152 | 405 |
| 1155 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_203220_204437 | 405 |
| 1156 | 3300048926 | Ga0496123_0007000 | Ga0496123_0007000_9490_10707 | 405 |
| 1157 | 3300048926 | Ga0496123_0012058 | Ga0496123_0012058_5297_6514 | 405 |
| 1158 | 3300048926 | Ga0496123_0012459 | Ga0496123_0012459_1025_2242 | 405 |
| 1159 | 3300048926 | Ga0496123_0056256 | Ga0496123_0056256_541_1758 | 405 |
| 1160 | 3300048927 | Ga0496124_0000112 | Ga0496124_0000112_84111_85328 | 405 |
| 1161 | 3300048927 | Ga0496124_0008314 | Ga0496124_0008314_7607_8824 | 405 |
| 1162 | 3300048927 | Ga0496124_0012622 | Ga0496124_0012622_5757_6974 | 405 |
| 1163 | 3300048927 | Ga0496124_0015634 | Ga0496124_0015634_1049_2266 | 405 |
| 1164 | 3300048927 | Ga0496124_0024327 | Ga0496124_0024327_553_1770 | 405 |
| 1165 | 3300048927 | Ga0496124_0070150 | Ga0496124_0070150_1093_2310 | 405 |
| 1166 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1339478_1340695 | 405 |
| 1167 | 3300048928 | Ga0496125_0004146 | Ga0496125_0004146_2779_3996 | 405 |
| 1168 | 3300048928 | Ga0496125_0015487 | Ga0496125_0015487_3308_4525 | 405 |
| 1169 | 3300048928 | Ga0496125_0040643 | Ga0496125_0040643_128_1345 | 405 |
| 1170 | 3300048929 | Ga0496126_0045426 | Ga0496126_0045426_2798_4027 | 405 |
| 1171 | 3300048929 | Ga0496126_0052378 | Ga0496126_0052378_536_1762 | 405 |
| 1172 | 3300048929 | Ga0496126_0054169 | Ga0496126_0054169_1375_2592 | 405 |
| 1173 | 3300048929 | Ga0496126_0099260 | Ga0496126_0099260_544_1761 | 405 |
| 1174 | 3300048929 | Ga0496126_0185095 | Ga0496126_0185095_17_1234 | 405 |
| 1175 | 3300049568 | Ga0501031_0068405 | Ga0501031_0068405_1071_2288 | 405 |
| 1176 | 3300049569 | Ga0501032_0000201 | Ga0501032_0000201_45243_46475 | 405 |
| 1177 | 3300049569 | Ga0501032_0020787 | Ga0501032_0020787_2222_3439 | 405 |
| 1178 | 3300049569 | Ga0501032_0026712 | Ga0501032_0026712_1643_2866 | 405 |
| 1179 | 3300049570 | Ga0501033_0000132 | Ga0501033_0000132_71187_72419 | 405 |
| 1180 | 3300049570 | Ga0501033_0000201 | Ga0501033_0000201_1985_3202 | 405 |
| 1181 | 3300049570 | Ga0501033_0003702 | Ga0501033_0003702_9916_11139 | 405 |
| 1182 | 3300049571 | Ga0501034_0000005 | Ga0501034_0000005_320841_322073 | 405 |
| 1183 | 3300049571 | Ga0501034_0048119 | Ga0501034_0048119_93_1310 | 405 |
| 1184 | 3300049571 | Ga0501034_0153522 | Ga0501034_0153522_844_2076 | 405 |
| 1185 | 3300049571 | Ga0501034_0198266 | Ga0501034_0198266_674_1891 | 405 |
| 1186 | 3300049571 | Ga0501034_0200040 | Ga0501034_0200040_474_1691 | 405 |
| 1187 | 3300049572 | Ga0501036_0000005 | Ga0501036_0000005_199709_200941 | 405 |
| 1188 | 3300049573 | Ga0501037_0000045 | Ga0501037_0000045_70588_71820 | 405 |
| 1189 | 3300049573 | Ga0501037_0000753 | Ga0501037_0000753_9982_11205 | 405 |
| 1190 | 3300049573 | Ga0501037_0052335 | Ga0501037_0052335_442_1665 | 405 |
| 1191 | 3300049573 | Ga0501037_0054337 | Ga0501037_0054337_1400_2617 | 405 |
| 1192 | 3300049574 | Ga0501038_0000001 | Ga0501038_0000001_320841_322073 | 405 |
| 1193 | 3300049574 | Ga0501038_0167685 | Ga0501038_0167685_389_1612 | 405 |
| 1194 | 3300049574 | Ga0501038_0180847 | Ga0501038_0180847_211_1428 | 405 |
| 1195 | 3300049575 | Ga0501039_0000007 | Ga0501039_0000007_175102_176334 | 405 |
| 1196 | 3300049576 | Ga0501040_0076234 | Ga0501040_0076234_132_1364 | 405 |
| 1197 | 3300049578 | Ga0501042_0019271 | Ga0501042_0019271_1116_2348 | 405 |
| 1198 | 3300049579 | Ga0501043_0000031 | Ga0501043_0000031_126325_127548 | 405 |
| 1199 | 3300049579 | Ga0501043_0003831 | Ga0501043_0003831_1900_3132 | 405 |
| 1200 | 3300049579 | Ga0501043_0039104 | Ga0501043_0039104_899_2116 | 405 |
| 1201 | 3300049579 | Ga0501043_0107789 | Ga0501043_0107789_43_1266 | 405 |
| 1202 | 3300049579 | Ga0501043_0166819 | Ga0501043_0166819_413_1636 | 405 |
| 1203 | 3300049580 | Ga0501046_0134546 | Ga0501046_0134546_184_1416 | 405 |
| 1204 | 3300049581 | Ga0501047_0029467 | Ga0501047_0029467_304_1536 | 405 |
| 1205 | 3300049581 | Ga0501047_0042680 | Ga0501047_0042680_1832_3055 | 405 |
| 1206 | 3300049581 | Ga0501047_0130942 | Ga0501047_0130942_861_2078 | 405 |
| 1207 | 3300049581 | Ga0501047_0242965 | Ga0501047_0242965_131_1354 | 405 |
| 1208 | 3300049582 | Ga0501048_0031346 | Ga0501048_0031346_2542_3774 | 405 |
| 1209 | 3300049585 | Ga0501069_0000362 | Ga0501069_0000362_10372_11595 | 405 |
| 1210 | 3300049585 | Ga0501069_0035239 | Ga0501069_0035239_490_1713 | 405 |
| 1211 | 3300049586 | Ga0501070_0001857 | Ga0501070_0001857_1144_2367 | 405 |
| 1212 | 3300049586 | Ga0501070_0014344 | Ga0501070_0014344_127_1359 | 405 |
| 1213 | 3300049586 | Ga0501070_0018593 | Ga0501070_0018593_2638_3861 | 405 |
| 1214 | 3300049586 | Ga0501070_0024134 | Ga0501070_0024134_1776_2999 | 405 |
| 1215 | 3300049586 | Ga0501070_0115186 | Ga0501070_0115186_261_1484 | 405 |
| 1216 | 3300049586 | Ga0501070_0163009 | Ga0501070_0163009_122_1345 | 405 |
| 1217 | 3300049587 | Ga0501071_0060948 | Ga0501071_0060948_751_1974 | 405 |
| 1218 | 3300049589 | Ga0501073_0006987 | Ga0501073_0006987_6710_7933 | 405 |
| 1219 | 3300049589 | Ga0501073_0012864 | Ga0501073_0012864_2590_3813 | 405 |
| 1220 | 3300049589 | Ga0501073_0039895 | Ga0501073_0039895_829_2061 | 405 |
| 1221 | 3300049590 | Ga0501074_0002910 | Ga0501074_0002910_923_2146 | 405 |
| 1222 | 3300049590 | Ga0501074_0108661 | Ga0501074_0108661_572_1804 | 405 |
| 1223 | 3300049742 | Ga0501080_0006230 | Ga0501080_0006230_9385_10617 | 405 |
| 1224 | 3300049742 | Ga0501080_0054526 | Ga0501080_0054526_712_1935 | 405 |
| 1225 | 3300049742 | Ga0501080_0123188 | Ga0501080_0123188_130_1353 | 405 |
| 1226 | 3300049744 | Ga0501083_0001104 | Ga0501083_0001104_10044_11267 | 405 |
| 1227 | 3300049744 | Ga0501083_0121982 | Ga0501083_0121982_351_1568 | 405 |
| 1228 | 3300049822 | Ga0501035_0000008 | Ga0501035_0000008_266720_267952 | 405 |
| 1229 | 3300049822 | Ga0501035_0000036 | Ga0501035_0000036_27929_29152 | 405 |
| 1230 | 3300049822 | Ga0501035_0003084 | Ga0501035_0003084_716_1939 | 405 |
| 1231 | 3300049822 | Ga0501035_0003178 | Ga0501035_0003178_2589_3806 | 405 |
| 1232 | 3300049822 | Ga0501035_0005364 | Ga0501035_0005364_4133_5356 | 405 |
| 1233 | 3300049822 | Ga0501035_0029020 | Ga0501035_0029020_2063_3286 | 405 |
| 1234 | 3300049822 | Ga0501035_0099670 | Ga0501035_0099670_463_1686 | 405 |
| 1235 | 3300049823 | Ga0501044_0000001 | Ga0501044_0000001_96015_97247 | 405 |
| 1236 | 3300049823 | Ga0501044_0000011 | Ga0501044_0000011_136643_137866 | 405 |
| 1237 | 3300049823 | Ga0501044_0004154 | Ga0501044_0004154_13293_14516 | 405 |
| 1238 | 3300049823 | Ga0501044_0017912 | Ga0501044_0017912_887_2110 | 405 |
| 1239 | 3300049823 | Ga0501044_0050351 | Ga0501044_0050351_1984_3207 | 405 |
| 1240 | 3300049824 | Ga0501045_0016743 | Ga0501045_0016743_3352_4584 | 405 |
| 1241 | 3300050489 | nmdc:mga03683_10679_c1 | nmdc:mga03683_10679_c1_1495_2712 | 405 |
| 1242 | 3300050489 | nmdc:mga03683_903_c1 | nmdc:mga03683_903_c1_2226_3443 | 405 |
| 1243 | 3300050491 | nmdc:mga00v17_222_c2 | nmdc:mga00v17_222_c2_4584_5801 | 405 |
| 1244 | 3300050491 | nmdc:mga00v17_80_c1 | nmdc:mga00v17_80_c1_24390_25607 | 405 |
| 1245 | 3300050492 | nmdc:mga0yw44_1395_c1 | nmdc:mga0yw44_1395_c1_6097_7317 | 405 |
| 1246 | 3300050493 | nmdc:mga0k408_12079_c1 | nmdc:mga0k408_12079_c1_811_2028 | 405 |
| 1247 | 3300050496 | nmdc:mga07m45_6227_c1 | nmdc:mga07m45_6227_c1_1957_3174 | 405 |
| 1248 | 3300050516 | nmdc:mga0sz30_20665_c1 | nmdc:mga0sz30_20665_c1_1013_2230 | 405 |
| 1249 | 3300050516 | nmdc:mga0sz30_27106_c1 | nmdc:mga0sz30_27106_c1_241_1458 | 405 |
| 1250 | 3300050516 | nmdc:mga0sz30_8434_c1 | nmdc:mga0sz30_8434_c1_1749_2966 | 405 |
| 1251 | 3300053083 | Ga0495655_0008142 | Ga0495655_0008142_700_1920 | 405 |
| 1252 | 3300053086 | Ga0500578_0181128 | Ga0500578_0181128_16_1233 | 405 |
| 1253 | 3300053111 | Ga0500572_003721 | Ga0500572_003721_1752_2969 | 405 |
| 1254 | 3300053118 | Ga0500594_0000647 | Ga0500594_0000647_5142_6359 | 405 |
| 1255 | 3300053122 | Ga0500608_021456 | Ga0500608_021456_1059_2276 | 405 |
| 1256 | 3300053125 | Ga0500618_000871 | Ga0500618_000871_9296_10513 | 405 |
| 1257 | 3300053125 | Ga0500618_004612 | Ga0500618_004612_2663_3880 | 405 |
| 1258 | 3300053125 | Ga0500618_020318 | Ga0500618_020318_44_1261 | 405 |
| 1259 | 3300053134 | Ga0500658_0001748 | Ga0500658_0001748_2757_3974 | 405 |
| 1260 | 3300053134 | Ga0500658_0008813 | Ga0500658_0008813_915_2132 | 405 |
| 1261 | 3300053137 | Ga0500561_0000062 | Ga0500561_0000062_14782_15999 | 405 |
| 1262 | 3300053139 | Ga0500568_0000212 | Ga0500568_0000212_42020_43237 | 405 |
| 1263 | 3300053139 | Ga0500568_0001356 | Ga0500568_0001356_5290_6507 | 405 |
| 1264 | 3300053139 | Ga0500568_0004459 | Ga0500568_0004459_809_2026 | 405 |
| 1265 | 3300053139 | Ga0500568_0041443 | Ga0500568_0041443_504_1721 | 405 |
| 1266 | 3300053148 | Ga0500590_014477 | Ga0500590_014477_886_2103 | 405 |
| 1267 | 3300053151 | Ga0500604_0019893 | Ga0500604_0019893_632_1849 | 405 |
| 1268 | 3300053153 | Ga0500616_0000647 | Ga0500616_0000647_18681_19898 | 405 |
| 1269 | 3300053153 | Ga0500616_0005012 | Ga0500616_0005012_2513_3730 | 405 |
| 1270 | 3300053153 | Ga0500616_0032687 | Ga0500616_0032687_1561_2778 | 405 |
| 1271 | 3300053156 | Ga0500622_0000158 | Ga0500622_0000158_35163_36380 | 405 |
| 1272 | 3300053156 | Ga0500622_0000178 | Ga0500622_0000178_56676_57893 | 405 |
| 1273 | 3300053157 | Ga0500624_000357 | Ga0500624_000357_11445_12662 | 405 |
| 1274 | 3300053158 | Ga0500627_0004905 | Ga0500627_0004905_2888_4105 | 405 |
| 1275 | 3300053161 | Ga0500634_0001576 | Ga0500634_0001576_972_2189 | 405 |
| 1276 | 3300053161 | Ga0500634_0054472 | Ga0500634_0054472_710_1927 | 405 |
| 1277 | 3300053177 | Ga0500636_0000019 | Ga0500636_0000019_67715_68932 | 405 |
| 1278 | 3300053177 | Ga0500636_0001577 | Ga0500636_0001577_5640_6857 | 405 |
| 1279 | 3300060353 | Ga0501082_0035934 | Ga0501082_0035934_971_2188 | 405 |
| 1280 | iso_pu_bacteria | 2513237090 | 2513610946 | 405 |
| 1281 | iso_pu_bacteria | 2599185301 | 2599938336 | 405 |
| 1282 | iso_pu_bacteria | 2643221550 | 2643774223 | 405 |
| 1283 | iso_pu_bacteria | 2643221551 | 2643775802 | 405 |
| 1284 | iso_pu_bacteria | 2643221555 | 2643794249 | 405 |
| 1285 | iso_pu_bacteria | 2643221564 | 2643837563 | 405 |
| 1286 | iso_pu_bacteria | 2693429783 | 2694629830 | 405 |
| 1287 | iso_pu_bacteria | 2693429784 | 2694636297 | 405 |
| 1288 | iso_pu_bacteria | 2847670302 | 2847675956 | 405 |
| 1289 | iso_pu_bacteria | 2856314179 | 2856314486 | 405 |
| 1290 | iso_pu_bacteria | 2856364286 | 2856370526 | 405 |
| 1291 | iso_pu_bacteria | 2857349434 | 2857350651 | 405 |
| 1292 | iso_pu_bacteria | 2869285874 | 2869291747 | 405 |
| 1293 | iso_pu_bacteria | 2871429161 | 2871434957 | 405 |
| 1294 | iso_pu_bacteria | 2871474448 | 2871475968 | 405 |
| 1295 | iso_pu_bacteria | 2871488783 | 2871495599 | 405 |
| 1296 | iso_pu_bacteria | 2874146452 | 2874149347 | 405 |
| 1297 | iso_pu_bacteria | 2874155637 | 2874157610 | 405 |
| 1298 | iso_pu_bacteria | 2876413966 | 2876415813 | 405 |
| 1299 | iso_pu_bacteria | 2878035449 | 2878040027 | 405 |
| 1300 | iso_pu_bacteria | 2878745973 | 2878752091 | 405 |
| 1301 | iso_pu_bacteria | 2878753008 | 2878757806 | 405 |
| 1302 | iso_pu_bacteria | 2878788777 | 2878794735 | 405 |
| 1303 | iso_pu_bacteria | 2881155292 | 2881155691 | 405 |
| 1304 | iso_pu_bacteria | 2881845957 | 2881849269 | 405 |
| 1305 | iso_pu_bacteria | 2881853255 | 2881855473 | 405 |
| 1306 | iso_pu_bacteria | 2881861095 | 2881868776 | 405 |
| 1307 | iso_pu_bacteria | 2882632389 | 2882638670 | 405 |
| 1308 | iso_pu_bacteria | 2882912400 | 2882918682 | 405 |
| 1309 | iso_pu_bacteria | 2885318864 | 2885325266 | 405 |
| 1310 | iso_pu_bacteria | 2885342637 | 2885348661 | 405 |
| 1311 | iso_pu_bacteria | 2885350715 | 2885353670 | 405 |
| 1312 | iso_pu_bacteria | 2888350351 | 2888356176 | 405 |
| 1313 | iso_pu_bacteria | 2889010040 | 2889011105 | 405 |
| 1314 | iso_pu_bacteria | 2889016732 | 2889017170 | 405 |
| 1315 | iso_pu_bacteria | 2903492973 | 2903493351 | 405 |
| 1316 | iso_pu_bacteria | 2903492973 | 2903506523 | 405 |
| 1317 | iso_pu_bacteria | 2906308376 | 2906314485 | 405 |
| 1318 | iso_pu_bacteria | 2906321335 | 2906327653 | 405 |
| 1319 | iso_pu_bacteria | 2906354277 | 2906359712 | 405 |
| 1320 | iso_pu_bacteria | 2906414383 | 2906414440 | 405 |
| 1321 | iso_pu_bacteria | 2922130491 | 2922135047 | 405 |
| 1322 | iso_pu_bacteria | 2922185730 | 2922189210 | 405 |
| 1323 | iso_pu_bacteria | 2924784321 | 2924785699 | 405 |
| 1324 | iso_pu_bacteria | 2937813078 | 2937816212 | 405 |
| 1325 | iso_pu_bacteria | 2937843397 | 2937846094 | 405 |
| 1326 | iso_pu_bacteria | 2938014810 | 2938020937 | 405 |
| 1327 | iso_pu_bacteria | 2958100919 | 2958101548 | 405 |
| 1328 | iso_pu_bacteria | 2958130278 | 2958136145 | 405 |
| 1329 | iso_pu_bacteria | 2958172287 | 2958176684 | 405 |
| 1330 | iso_pu_bacteria | 2958179912 | 2958185613 | 405 |
| 1331 | iso_pu_bacteria | 2961077736 | 2961083990 | 405 |
| 1332 | iso_pu_bacteria | 2961127735 | 2961128657 | 405 |
| 1333 | iso_pu_bacteria | 2961170736 | 2961174349 | 405 |
| 1334 | iso_pu_bacteria | 2965119406 | 2965125690 | 405 |
| 1335 | iso_pu_bacteria | 2967996073 | 2968000339 | 405 |
| 1336 | iso_pu_bacteria | 2968003550 | 2968003776 | 405 |
| 1337 | iso_pu_bacteria | 2968117919 | 2968121105 | 405 |
| 1338 | iso_pu_bacteria | 2970503327 | 2970506936 | 405 |
| 1339 | iso_pu_bacteria | 2977821940 | 2977822338 | 405 |
| 1340 | iso_pu_bacteria | 2977828996 | 2977833759 | 405 |
| 1341 | iso_pu_bacteria | 2977843712 | 2977846448 | 405 |
| 1342 | iso_pu_bacteria | 2977942078 | 2977947644 | 405 |
| 1343 | iso_pu_bacteria | 2977971508 | 2977973660 | 405 |
| 1344 | iso_pu_bacteria | 2979710463 | 2979711677 | 405 |
| 1345 | iso_pu_bacteria | 2979742915 | 2979751385 | 405 |
| 1346 | iso_pu_bacteria | 2979808191 | 2979812131 | 405 |
| 1347 | iso_pu_bacteria | 2987636660 | 2987637835 | 405 |
| 1348 | iso_pu_bacteria | 2987652177 | 2987653857 | 405 |
| 1349 | iso_pu_bacteria | 2996336353 | 2996336565 | 405 |
| 1350 | iso_pu_bacteria | 3004203850 | 3004205843 | 405 |
| 1351 | iso_pu_bacteria | 8004374579 | 8004379317 | 405 |
| 1352 | iso_pu_bacteria | 8004387939 | 8004394527 | 405 |
| 1353 | iso_pu_bacteria | 8004633249 | 8004633418 | 405 |
| 1354 | iso_pu_bacteria | 8004640170 | 8004640341 | 405 |
| 1355 | iso_pu_bacteria | 8004714634 | 8004720747 | 405 |
| 1356 | 3300053140 | Ga0500573_0003702 | Ga0500573_0003702_530_1765 | 406 |
| 1357 | iso_pu_bacteria | 2643221718 | 2644654654 | 406 |
| 1358 | iso_pu_bacteria | 2984601300 | 2984603339 | 406 |
| 1359 | 3300046530 | Ga0495654_0001209 | Ga0495654_0001209_2218_3498 | 407 |
| 1360 | 3300053125 | Ga0500618_000510 | Ga0500618_000510_18121_19401 | 407 |
| 1361 | iso_pu_bacteria | 3005416602 | 3005420478 | 407 |
| 1362 | iso_pu_bacteria | 8005314921 | 8005317429 | 407 |
| 1363 | 3300005331 | Ga0070670_100056538 | Ga0070670_1000565382 | 409 |
| 1364 | 3300021327 | Ga0214543_1000064 | Ga0214543_1000064142 | 409 |
| 1365 | 3300025206 | Ga0209435_100022 | Ga0209435_100022196 | 409 |
| 1366 | 3300025246 | Ga0209646_1000078 | Ga0209646_1000078196 | 409 |
| 1367 | 3300025250 | Ga0209026_1000065 | Ga0209026_1000065196 | 409 |
| 1368 | 3300025256 | Ga0209759_1000055 | Ga0209759_1000055196 | 409 |
| 1369 | 3300025925 | Ga0207650_10065133 | Ga0207650_100651333 | 409 |
| 1370 | 3300031548 | Ga0307408_100025176 | Ga0307408_1000251761 | 409 |
| 1371 | 3300041406 | Ga0439439_0021574 | Ga0439439_0021574_191_1450 | 409 |
| 1372 | 3300046529 | Ga0495652_0066969 | Ga0495652_0066969_362_1624 | 409 |
| 1373 | 3300046660 | Ga0495625_0039680 | Ga0495625_0039680_822_2081 | 409 |
| 1374 | 3300048919 | Ga0496116_0000061 | Ga0496116_0000061_73890_75152 | 409 |
| 1375 | 3300048921 | Ga0496118_0044985 | Ga0496118_0044985_178_1446 | 409 |
| 1376 | 3300048926 | Ga0496123_0095531 | Ga0496123_0095531_121_1383 | 409 |
| 1377 | 3300048927 | Ga0496124_0208734 | Ga0496124_0208734_21_1283 | 409 |
| 1378 | 3300048929 | Ga0496126_0000397 | Ga0496126_0000397_33691_34953 | 409 |
| 1379 | iso_pu_bacteria | 2510917022 | 2511132483 | 409 |
| 1380 | iso_pu_bacteria | 2582581307 | 2585272906 | 409 |
| 1381 | iso_pu_bacteria | 2585427531 | 2585558186 | 409 |
| 1382 | iso_pu_bacteria | 2585427609 | 2585904826 | 409 |
| 1383 | iso_pu_bacteria | 2585428125 | 2587980058 | 409 |
| 1384 | iso_pu_bacteria | 8005658619 | 8005659163 | 409 |
| 1385 | iso_pu_bacteria | 8024486573 | 8024492423 | 409 |
| 1386 | 3300006353 | Ga0075370_10014017 | Ga0075370_100140175 | 411 |
| 1387 | iso_pu_bacteria | 643692032 | 643825568 | 414 |
| 1388 | 3300001979 | JGI24740J21852_10000001 | JGI24740J21852_10000001172 | 418 |
| 1389 | 3300002704 | JGI25155J39150_1000011 | JGI25155J39150_100001114 | 418 |
| 1390 | 3300002705 | JGI25156J39149_1000027 | JGI25156J39149_100002714 | 418 |
| 1391 | 3300002737 | JGI25162J39368_1000963 | JGI25162J39368_10009632 | 418 |
| 1392 | 3300002741 | JGI25157J39369_1000010 | JGI25157J39369_1000010197 | 418 |
| 1393 | 3300003214 | JGI25165J46597_1000900 | JGI25165J46597_100090015 | 418 |
| 1394 | 3300003214 | JGI25165J46597_1001027 | JGI25165J46597_100102719 | 418 |
| 1395 | 3300048922 | Ga0496119_0021313 | Ga0496119_0021313_1235_2491 | 418 |
| 1396 | 3300048925 | Ga0496122_0031709 | Ga0496122_0031709_786_2042 | 418 |
| 1397 | 3300048927 | Ga0496124_0029389 | Ga0496124_0029389_2114_3370 | 418 |
| 1398 | 3300048928 | Ga0496125_0097657 | Ga0496125_0097657_457_1713 | 418 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dqb-assembly1.cif.gz_B | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.8967 | 27 | 411 |
| 2dqb-assembly1.cif.gz_E | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.8852 | 27 | 411 |
| 2dqb-assembly1.cif.gz_C | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.8809 | 20 | 411 |
| 2dqb-assembly1.cif.gz_D | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.8802 | 24 | 411 |
| 2dqb-assembly1.cif.gz_F | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.8791 | 20 | 411 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dqbE00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8838 | 27 | 411 | 1.10.3210.10 |
| 2dqbE00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8513 | 27 | 411 | 1.10.3210.10 |
| af_P9WNY7_7_418_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7369 | 27 | 403 | 1.10.3210.10 |
| af_Q58554_1_263_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6885 | 57 | 410 | 1.10.3210.10 |
| af_P9WNY7_7_418_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6776 | 27 | 403 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MTS3-F1-model_v4 | Deoxyguanosinetriphosphate triphosphohydrolase | 0.9907 | 253 | 336 |
GO:0016787
|
| AF-A0A529FL15-F1-model_v4 | Deoxyguanosinetriphosphate triphosphohydrolase | 0.9741 | 256 | 418 |
GO:0016787
|
| AF-A0A3S1E6P1-F1-model_v4 | Deoxyguanosinetriphosphate triphosphohydrolase | 0.9677 | 234 | 418 |
GO:0016787
|
| AF-A0A519YBG0-F1-model_v4 | deleted | 0.9665 | 245 | 418 |
|
| AF-A0A529X4X1-F1-model_v4 | Deoxyguanosinetriphosphate triphosphohydrolase | 0.966 | 207 | 418 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar