F493647

General Info

Members Datasets Scaffolds Average Seq Length
1398 367 1398 181

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0954690|Ga0466967_0954690_225_776
Length 183
Sequence MGGSWADVLRAHGRGETARRIVEQLGACEAASLAFCRLLERWARGDATPATAGGRVAALRHAADRAETALAGLEEPLDRYLLELGTPELGGRRAEGRSWYGAPGAAELLDWDAVLRRAGVPVSSVRVAQAYLELAVLVRALEGLNAAARIDAPPDPASLWAGLFDLRENLLGRAADDLRALAA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
113 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
237 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
238 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
239 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 6.94
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001105 3300001991 Bacteria 3605
2 JGI25406J46586_10016842 3300003203 Bacteria 3035
3 Ga0070683_100087198 3300005329 Bacteria 2927
4 Ga0070683_100099853 3300005329 Bacteria 2732
5 Ga0070683_100192203 3300005329 Bacteria 1938
6 Ga0070683_100209255 3300005329 Bacteria 1853
7 Ga0070683_100942443 3300005329 Bacteria 828
8 Ga0070683_101086026 3300005329 Unclassified 769
9 Ga0070683_101634412 3300005329 Bacteria 619
10 Ga0070690_100201205 3300005330 Unclassified 1386
11 Ga0070690_100811597 3300005330 Bacteria 726
12 Ga0070670_100345969 3300005331 Bacteria 1305
13 Ga0070670_100412205 3300005331 Bacteria 1194
14 Ga0070677_10110196 3300005333 Bacteria 1228
15 Ga0068869_100050723 3300005334 Bacteria 3008
16 Ga0068869_100059469 3300005334 Bacteria 2798
17 Ga0068869_100252982 3300005334 Bacteria 1408
18 Ga0068869_100389749 3300005334 Bacteria 1143
19 Ga0068869_100641156 3300005334 Unclassified 901
20 Ga0070680_100012785 3300005336 Bacteria 6529
21 Ga0070680_100642697 3300005336 Unclassified 912
22 Ga0070680_101028409 3300005336 Bacteria 712
23 Ga0070682_100019293 3300005337 Bacteria 3997
24 Ga0070682_100027722 3300005337 Bacteria 3400
25 Ga0070682_100033173 3300005337 Bacteria 3135
26 Ga0070682_100054838 3300005337 Bacteria 2502
27 Ga0070682_100111123 3300005337 Bacteria 1827
28 Ga0070682_100597330 3300005337 Bacteria 871
29 Ga0068868_100008175 3300005338 Bacteria 7484
30 Ga0068868_100039766 3300005338 Bacteria 3656
31 Ga0068868_100172653 3300005338 Unclassified 1790
32 Ga0068868_100305642 3300005338 Bacteria 1352
33 Ga0070660_100001667 3300005339 Bacteria 15251
34 Ga0070660_100264429 3300005339 Bacteria 1405
35 Ga0070660_100312081 3300005339 Bacteria 1290
36 Ga0070689_100122536 3300005340 Bacteria 2078
37 Ga0070689_100194704 3300005340 Bacteria 1652
38 Ga0070689_100386113 3300005340 Bacteria 1181
39 Ga0070691_10013969 3300005341 Bacteria 3684
40 Ga0070691_10018963 3300005341 Bacteria 3170
41 Ga0070691_10292857 3300005341 Bacteria 887
42 Ga0070691_10380597 3300005341 Bacteria 791
43 Ga0070687_100033799 3300005343 Bacteria 2527
44 Ga0070687_100210561 3300005343 Bacteria 1184
45 Ga0070687_100720097 3300005343 Unclassified 699
46 Ga0070661_100009667 3300005344 Bacteria 6685
47 Ga0070661_100251397 3300005344 Bacteria 1364
48 Ga0070661_100452210 3300005344 Unclassified 1022
49 Ga0070692_10068493 3300005345 Bacteria 1886
50 Ga0070692_10215456 3300005345 Unclassified 1132
51 Ga0070692_10315986 3300005345 Unclassified 959
52 Ga0070668_100051365 3300005347 Bacteria 3176
53 Ga0070668_100098939 3300005347 Bacteria 2309
54 Ga0070668_100221262 3300005347 Bacteria 1561
55 Ga0070668_101192332 3300005347 Bacteria 690
56 Ga0070669_100193128 3300005353 Bacteria 1598
57 Ga0070669_100216478 3300005353 Unclassified 1513
58 Ga0070669_100523776 3300005353 Bacteria 986
59 Ga0070675_100022200 3300005354 Bacteria 5069
60 Ga0070675_100034064 3300005354 Bacteria 4131
61 Ga0070675_100102432 3300005354 Bacteria 2412
62 Ga0070675_100119986 3300005354 Bacteria 2233
63 Ga0070675_100411638 3300005354 Bacteria 1208
64 Ga0070671_100241442 3300005355 Bacteria 1534
65 Ga0070671_100409141 3300005355 Bacteria 1161
66 Ga0070671_100537724 3300005355 Unclassified 1007
67 Ga0070671_100547480 3300005355 Unclassified 998
68 Ga0070674_100013343 3300005356 Bacteria 5076
69 Ga0070674_100040093 3300005356 Bacteria 3166
70 Ga0070674_100102601 3300005356 Unclassified 2086
71 Ga0070674_100141819 3300005356 Bacteria 1804
72 Ga0070673_100039119 3300005364 Bacteria 3627
73 Ga0070673_100281517 3300005364 Unclassified 1459
74 Ga0070688_100019736 3300005365 Bacteria 3908
75 Ga0070688_100045630 3300005365 Bacteria 2709
76 Ga0070688_100070685 3300005365 Bacteria 2232
77 Ga0070688_100112567 3300005365 Unclassified 1812
78 Ga0070659_100034856 3300005366 Bacteria 3917
79 Ga0070659_100044838 3300005366 Bacteria 3463
80 Ga0070659_100045510 3300005366 Bacteria 3438
81 Ga0070659_100129526 3300005366 Bacteria 2048
82 Ga0070659_100609825 3300005366 Bacteria 938
83 Ga0070659_101404311 3300005366 Bacteria 621
84 Ga0070667_100180789 3300005367 Bacteria 1865
85 Ga0070667_100212832 3300005367 Bacteria 1718
86 Ga0070703_10004460 3300005406 Bacteria 3937
87 Ga0070709_10051370 3300005434 Bacteria 2587
88 Ga0070709_10100983 3300005434 Bacteria 1922
89 Ga0070709_10186155 3300005434 Unclassified 1461
90 Ga0070709_10452283 3300005434 Unclassified 968
91 Ga0070714_100083190 3300005435 Bacteria 2790
92 Ga0070714_100114301 3300005435 Bacteria 2394
93 Ga0070713_100014193 3300005436 Bacteria 5904
94 Ga0070713_100048583 3300005436 Bacteria 3495
95 Ga0070713_100119999 3300005436 Bacteria 2305
96 Ga0070713_100363807 3300005436 Unclassified 1344
97 Ga0070713_100526338 3300005436 Bacteria 1118
98 Ga0070710_10010488 3300005437 Bacteria 4553
99 Ga0070710_10045663 3300005437 Bacteria 2436
100 Ga0070710_10255762 3300005437 Bacteria 1127
101 Ga0070701_10013657 3300005438 Bacteria 3701
102 Ga0070701_10144113 3300005438 Unclassified 1365
103 Ga0070701_10476374 3300005438 Bacteria 806
104 Ga0070711_100065833 3300005439 Bacteria 2536
105 Ga0070711_100192773 3300005439 Unclassified 1567
106 Ga0070711_100212668 3300005439 Bacteria 1498
107 Ga0070711_100403877 3300005439 Bacteria 1109
108 Ga0070711_100619182 3300005439 Unclassified 905
109 Ga0070705_100009187 3300005440 Bacteria 4908
110 Ga0070705_100010477 3300005440 Bacteria 4642
111 Ga0070705_100170405 3300005440 Unclassified 1465
112 Ga0070705_100228218 3300005440 Bacteria 1293
113 Ga0070705_100410678 3300005440 Bacteria 1005
114 Ga0070700_100012955 3300005441 Bacteria 4674
115 Ga0070700_100032783 3300005441 Bacteria 3124
116 Ga0070700_100061823 3300005441 Bacteria 2364
117 Ga0070700_100124681 3300005441 Unclassified 1730
118 Ga0070700_100338340 3300005441 Bacteria 1111
119 Ga0070700_101485198 3300005441 Bacteria 575
120 Ga0070694_100022513 3300005444 Bacteria 4037
121 Ga0070694_100154282 3300005444 Unclassified 1680
122 Ga0070694_100180678 3300005444 Unclassified 1560
123 Ga0070694_101083561 3300005444 Bacteria 668
124 Ga0070694_101235702 3300005444 Unclassified 627
125 Ga0070708_100087980 3300005445 Bacteria 2823
126 Ga0070708_100089897 3300005445 Bacteria 2795
127 Ga0070708_100166717 3300005445 Unclassified 2055
128 Ga0070708_100267216 3300005445 Unclassified 1608
129 Ga0070708_100383814 3300005445 Bacteria 1325
130 Ga0070663_100090856 3300005455 Bacteria 2262
131 Ga0070663_100201914 3300005455 Bacteria 1552
132 Ga0070678_100005901 3300005456 Bacteria 7121
133 Ga0070678_100042584 3300005456 Bacteria 3228
134 Ga0070678_100054008 3300005456 Bacteria 2925
135 Ga0070678_100071558 3300005456 Bacteria 2596
136 Ga0070678_100109456 3300005456 Bacteria 2158
137 Ga0070678_100276993 3300005456 Bacteria 1417
138 Ga0070678_100406747 3300005456 Bacteria 1183
139 Ga0070678_101123791 3300005456 Bacteria 726
140 Ga0070662_100066789 3300005457 Bacteria 2639
141 Ga0070662_100091503 3300005457 Bacteria 2285
142 Ga0070681_10165761 3300005458 Bacteria 2132
143 Ga0070681_10901306 3300005458 Unclassified 803
144 Ga0068867_100007505 3300005459 Bacteria 7713
145 Ga0068867_100021791 3300005459 Bacteria 4575
146 Ga0068867_100068486 3300005459 Bacteria 2648
147 Ga0068867_100117199 3300005459 Bacteria 2053
148 Ga0068867_100376884 3300005459 Bacteria 1191
149 Ga0068867_100915699 3300005459 Bacteria 790
150 Ga0070685_10009852 3300005466 Bacteria 4956
151 Ga0070706_100088588 3300005467 Bacteria 2869
152 Ga0070706_100277003 3300005467 Bacteria 1565
153 Ga0070706_100277939 3300005467 Bacteria 1563
154 Ga0070707_100001795 3300005468 Bacteria 20644
155 Ga0070707_100004230 3300005468 Bacteria 13436
156 Ga0070707_100027973 3300005468 Bacteria 5364
157 Ga0070707_100052307 3300005468 Bacteria 3916
158 Ga0070707_100105121 3300005468 Bacteria 2738
159 Ga0070707_100248356 3300005468 Bacteria 1732
160 Ga0070707_100912570 3300005468 Bacteria 843
161 Ga0070698_100001447 3300005471 Bacteria 26354
162 Ga0070698_100069427 3300005471 Bacteria 3537
163 Ga0070698_100129423 3300005471 Bacteria 2480
164 Ga0070698_100143089 3300005471 Bacteria 2342
165 Ga0070698_100465325 3300005471 Unclassified 1200
166 Ga0070698_100607079 3300005471 Unclassified 1034
167 Ga0070698_101436395 3300005471 Unclassified 641
168 Ga0070699_100011630 3300005518 Bacteria 7597
169 Ga0070699_100081397 3300005518 Bacteria 2822
170 Ga0070699_100184916 3300005518 Bacteria 1850
171 Ga0070699_100220047 3300005518 Bacteria 1692
172 Ga0070699_100885596 3300005518 Unclassified 817
173 Ga0070699_100982330 3300005518 Bacteria 774
174 Ga0070679_100043371 3300005530 Bacteria 4480
175 Ga0070679_100200034 3300005530 Bacteria 1964
176 Ga0070684_100071000 3300005535 Bacteria 3065
177 Ga0070684_100141162 3300005535 Bacteria 2178
178 Ga0070684_100184992 3300005535 Bacteria 1894
179 Ga0070684_100678727 3300005535 Unclassified 960
180 Ga0070697_100086250 3300005536 Bacteria 2590
181 Ga0070697_100177970 3300005536 Bacteria 1802
182 Ga0070697_100223390 3300005536 Unclassified 1605
183 Ga0070697_100614787 3300005536 Bacteria 956
184 Ga0070697_101038720 3300005536 Bacteria 729
185 Ga0068853_100055007 3300005539 Bacteria 3430
186 Ga0068853_100063755 3300005539 Bacteria 3192
187 Ga0068853_100592866 3300005539 Unclassified 1052
188 Ga0070672_100015250 3300005543 Bacteria 5465
189 Ga0070672_100027902 3300005543 Bacteria 4216
190 Ga0070672_100092523 3300005543 Bacteria 2441
191 Ga0070672_100419917 3300005543 Bacteria 1149
192 Ga0070672_100695546 3300005543 Bacteria 890
193 Ga0070672_101621894 3300005543 Bacteria 581
194 Ga0070686_100178888 3300005544 Bacteria 1505
195 Ga0070686_100209029 3300005544 Bacteria 1403
196 Ga0070695_100010707 3300005545 Bacteria 5480
197 Ga0070696_100005157 3300005546 Bacteria 8732
198 Ga0070696_100008087 3300005546 Bacteria 7029
199 Ga0070696_100113833 3300005546 Bacteria 1950
200 Ga0070696_100165229 3300005546 Bacteria 1633
201 Ga0070696_100276350 3300005546 Unclassified 1279
202 Ga0070696_100436588 3300005546 Bacteria 1031
203 Ga0070693_100049742 3300005547 Bacteria 2393
204 Ga0070693_100060899 3300005547 Bacteria 2192
205 Ga0070693_100335202 3300005547 Bacteria 1031
206 Ga0070665_100375138 3300005548 Bacteria 1429
207 Ga0070665_100388204 3300005548 Bacteria 1404
208 Ga0070665_100452366 3300005548 Bacteria 1294
209 Ga0070665_101129387 3300005548 Bacteria 795
210 Ga0070704_100007474 3300005549 Bacteria 6505
211 Ga0070704_100013760 3300005549 Bacteria 5034
212 Ga0070704_100066632 3300005549 Bacteria 2597
213 Ga0070704_100478592 3300005549 Bacteria 1077
214 Ga0070704_100623968 3300005549 Bacteria 949
215 Ga0068855_100174394 3300005563 Bacteria 2434
216 Ga0068855_100844591 3300005563 Bacteria 971
217 Ga0070664_100011426 3300005564 Bacteria 7204
218 Ga0070664_100019658 3300005564 Bacteria 5558
219 Ga0070664_100057656 3300005564 Bacteria 3301
220 Ga0070664_100227753 3300005564 Bacteria 1670
221 Ga0068857_100149603 3300005577 Bacteria 2114
222 Ga0068857_100245555 3300005577 Bacteria 1640
223 Ga0068854_100027948 3300005578 Bacteria 3892
224 Ga0068854_100031648 3300005578 Bacteria 3677
225 Ga0068854_100042761 3300005578 Bacteria 3208
226 Ga0068854_100314513 3300005578 Bacteria 1271
227 Ga0068856_100060971 3300005614 Bacteria 3726
228 Ga0068856_100146626 3300005614 Bacteria 2368
229 Ga0068856_100378939 3300005614 Unclassified 1434
230 Ga0068856_100795310 3300005614 Bacteria 965
231 Ga0070702_100009140 3300005615 Bacteria 4837
232 Ga0070702_100098532 3300005615 Bacteria 1788
233 Ga0070702_100199790 3300005615 Bacteria 1322
234 Ga0070702_100524975 3300005615 Bacteria 874
235 Ga0070702_100563312 3300005615 Unclassified 848
236 Ga0070702_100609002 3300005615 Unclassified 820
237 Ga0070702_100840131 3300005615 Bacteria 714
238 Ga0068852_100011455 3300005616 Bacteria 6677
239 Ga0068852_100155347 3300005616 Bacteria 2131
240 Ga0068852_100167655 3300005616 Bacteria 2056
241 Ga0068859_100165112 3300005617 Bacteria 2294
242 Ga0068859_101225231 3300005617 Unclassified 827
243 Ga0068864_100128463 3300005618 Bacteria 2274
244 Ga0068864_101703538 3300005618 Bacteria 635
245 Ga0068866_10016416 3300005718 Bacteria 3310
246 Ga0068866_10021745 3300005718 Bacteria 2959
247 Ga0068861_100006721 3300005719 Bacteria 7857
248 Ga0068861_100024148 3300005719 Bacteria 4393
249 Ga0068861_100048810 3300005719 Bacteria 3202
250 Ga0068861_100223812 3300005719 Bacteria 1592
251 Ga0068851_10262522 3300005834 Unclassified 983
252 Ga0068870_10012045 3300005840 Bacteria 4029
253 Ga0068870_10023896 3300005840 Bacteria 3019
254 Ga0068870_10124592 3300005840 Bacteria 1488
255 Ga0068870_10294660 3300005840 Bacteria 1022
256 Ga0068870_10606058 3300005840 Bacteria 745
257 Ga0068863_100673485 3300005841 Bacteria 1027
258 Ga0068858_100591218 3300005842 Bacteria 1076
259 Ga0068860_100294452 3300005843 Bacteria 1589
260 Ga0068860_100390985 3300005843 Bacteria 1374
261 Ga0068862_100272318 3300005844 Bacteria 1549
262 Ga0081455_10045311 3300005937 Bacteria 3828
263 Ga0081538_10174544 3300005981 Bacteria 931
264 Ga0081539_10001472 3300005985 Bacteria 39944
265 Ga0081539_10001538 3300005985 Bacteria 38558
266 Ga0081539_10005611 3300005985 Bacteria 12634
267 Ga0081539_10034389 3300005985 Bacteria 3066
268 Ga0070717_10105832 3300006028 Unclassified 2395
269 Ga0070717_10182961 3300006028 Unclassified 1828
270 Ga0070717_10282522 3300006028 Bacteria 1472
271 Ga0070717_10304675 3300006028 Bacteria 1417
272 Ga0070717_10568832 3300006028 Bacteria 1027
273 Ga0075365_10103597 3300006038 Bacteria 1950
274 Ga0075363_100266330 3300006048 Bacteria 989
275 Ga0075364_10064418 3300006051 Bacteria 2406
276 Ga0075432_10001376 3300006058 Bacteria 7905
277 Ga0075432_10029232 3300006058 Bacteria 1902
278 Ga0075432_10094698 3300006058 Bacteria 1097
279 Ga0070715_10066346 3300006163 Unclassified 1600
280 Ga0070715_10172483 3300006163 Unclassified 1078
281 Ga0070716_100040087 3300006173 Bacteria 2604
282 Ga0070716_100433830 3300006173 Bacteria 953
283 Ga0070712_100071365 3300006175 Bacteria 2484
284 Ga0070712_100088451 3300006175 Bacteria 2263
285 Ga0070712_100226592 3300006175 Bacteria 1482
286 Ga0070712_100447637 3300006175 Bacteria 1075
287 Ga0070712_100765430 3300006175 Bacteria 827
288 Ga0075367_10248620 3300006178 Bacteria 1115
289 Ga0097621_100213081 3300006237 Bacteria 1681
290 Ga0097621_100929731 3300006237 Unclassified 811
291 Ga0068871_100021944 3300006358 Bacteria 4916
292 Ga0068871_100130449 3300006358 Bacteria 2131
293 Ga0068871_100706706 3300006358 Bacteria 924
294 Ga0075428_100001040 3300006844 Bacteria 29433
295 Ga0075428_100030965 3300006844 Bacteria 5916
296 Ga0075428_100276188 3300006844 Bacteria 1808
297 Ga0075428_100536640 3300006844 Bacteria 1251
298 Ga0075428_101793240 3300006844 Bacteria 639
299 Ga0075430_100000556 3300006846 Bacteria 28333
300 Ga0075430_100504086 3300006846 Bacteria 999
301 Ga0075431_100005728 3300006847 Bacteria 12281
302 Ga0075431_100054840 3300006847 Bacteria 4111
303 Ga0075431_100177108 3300006847 Bacteria 2190
304 Ga0075431_100199140 3300006847 Bacteria 2049
305 Ga0075431_100647751 3300006847 Bacteria 1037
306 Ga0075431_100957861 3300006847 Unclassified 824
307 Ga0075433_10022107 3300006852 Bacteria 5339
308 Ga0075433_10070690 3300006852 Bacteria 3068
309 Ga0075433_10090262 3300006852 Bacteria 2708
310 Ga0075433_10097079 3300006852 Bacteria 2608
311 Ga0075433_10252615 3300006852 Unclassified 1564
312 Ga0075434_100041253 3300006871 Bacteria 4573
313 Ga0075434_100420826 3300006871 Bacteria 1357
314 Ga0075434_100613303 3300006871 Bacteria 1107
315 Ga0075434_100776791 3300006871 Unclassified 974
316 Ga0075429_100019935 3300006880 Bacteria 5815
317 Ga0075429_100024499 3300006880 Bacteria 5235
318 Ga0075429_100340482 3300006880 Bacteria 1313
319 Ga0068865_100012037 3300006881 Bacteria 5437
320 Ga0068865_100046878 3300006881 Bacteria 2967
321 Ga0068865_100101365 3300006881 Bacteria 2108
322 Ga0068865_100161265 3300006881 Bacteria 1711
323 Ga0068865_100335818 3300006881 Unclassified 1220
324 Ga0075436_100008241 3300006914 Bacteria 7129
325 Ga0075436_100029703 3300006914 Bacteria 3759
326 Ga0075436_100034691 3300006914 Bacteria 3480
327 Ga0075436_100073834 3300006914 Bacteria 2361
328 Ga0097620_100165112 3300006931 Bacteria 2294
329 Ga0097620_101225132 3300006931 Unclassified 827
330 Ga0075435_100000503 3300007076 Bacteria 23827
331 Ga0075435_100045663 3300007076 Bacteria 3513
332 Ga0075435_100226521 3300007076 Bacteria 1588
333 Ga0075435_100274268 3300007076 Bacteria 1439
334 Ga0075435_100352311 3300007076 Bacteria 1262
335 Ga0075435_100399976 3300007076 Bacteria 1181
336 Ga0105240_10412370 3300009093 Bacteria 1519
337 Ga0111539_10026459 3300009094 Bacteria 7092
338 Ga0111539_10073562 3300009094 Bacteria 4029
339 Ga0111539_10193607 3300009094 Bacteria 2372
340 Ga0111539_10210839 3300009094 Bacteria 2264
341 Ga0111539_10215472 3300009094 Bacteria 2237
342 Ga0111539_10502427 3300009094 Bacteria 1412
343 Ga0105245_10004320 3300009098 Bacteria 12577
344 Ga0105245_10017299 3300009098 Bacteria 6290
345 Ga0105245_10111124 3300009098 Bacteria 2548
346 Ga0105245_10166005 3300009098 Bacteria 2099
347 Ga0105245_10184936 3300009098 Bacteria 1993
348 Ga0105245_10210615 3300009098 Bacteria 1871
349 Ga0105245_10239450 3300009098 Bacteria 1758
350 Ga0105245_10404064 3300009098 Bacteria 1366
351 Ga0105245_10434033 3300009098 Bacteria 1319
352 Ga0105245_10591200 3300009098 Bacteria 1135
353 Ga0105245_10669037 3300009098 Bacteria 1069
354 Ga0105245_11340276 3300009098 Bacteria 765
355 Ga0105247_10191178 3300009101 Bacteria 1370
356 Ga0105247_10228505 3300009101 Bacteria 1262
357 Ga0114129_10004322 3300009147 Bacteria 20093
358 Ga0114129_10006705 3300009147 Bacteria 16351
359 Ga0114129_10017331 3300009147 Bacteria 10254
360 Ga0114129_10074602 3300009147 Bacteria 4725
361 Ga0114129_10077421 3300009147 Bacteria 4626
362 Ga0114129_10140984 3300009147 Bacteria 3304
363 Ga0114129_10306131 3300009147 Bacteria 2116
364 Ga0114129_10306306 3300009147 Bacteria 2116
365 Ga0114129_10414613 3300009147 Bacteria 1773
366 Ga0114129_10498457 3300009147 Bacteria 1591
367 Ga0114129_10947710 3300009147 Unclassified 1087
368 Ga0114129_10962794 3300009147 Bacteria 1077
369 Ga0114129_12071458 3300009147 Bacteria 687
370 Ga0114129_12140019 3300009147 Unclassified 674
371 Ga0105243_10008208 3300009148 Bacteria 8021
372 Ga0105243_10012983 3300009148 Bacteria 6293
373 Ga0105243_10064043 3300009148 Bacteria 2948
374 Ga0105243_10086679 3300009148 Bacteria 2569
375 Ga0105243_10146540 3300009148 Bacteria 2020
376 Ga0105243_10251756 3300009148 Unclassified 1577
377 Ga0105243_10331371 3300009148 Bacteria 1390
378 Ga0105243_10348436 3300009148 Bacteria 1359
379 Ga0105243_10807082 3300009148 Bacteria 925
380 Ga0105243_11220118 3300009148 Bacteria 766
381 Ga0105241_10007928 3300009174 Bacteria 7809
382 Ga0105241_10017330 3300009174 Bacteria 5291
383 Ga0105242_10011989 3300009176 Bacteria 6675
384 Ga0105242_10046892 3300009176 Bacteria 3507
385 Ga0105242_10086822 3300009176 Bacteria 2626
386 Ga0105242_10146870 3300009176 Bacteria 2052
387 Ga0105242_10154684 3300009176 Bacteria 2002
388 Ga0105242_10158271 3300009176 Bacteria 1980
389 Ga0105242_10188738 3300009176 Bacteria 1823
390 Ga0105242_10266906 3300009176 Unclassified 1548
391 Ga0105242_10310861 3300009176 Bacteria 1442
392 Ga0105242_10841664 3300009176 Unclassified 912
393 Ga0105242_10941018 3300009176 Bacteria 867
394 Ga0105242_11172519 3300009176 Bacteria 786
395 Ga0105248_10033638 3300009177 Bacteria 5728
396 Ga0105248_10205264 3300009177 Bacteria 2221
397 Ga0105248_10283016 3300009177 Unclassified 1867
398 Ga0105248_10357604 3300009177 Unclassified 1644
399 Ga0105248_10550647 3300009177 Bacteria 1301
400 Ga0105248_11032823 3300009177 Bacteria 929
401 Ga0105248_11952868 3300009177 Bacteria 666
402 Ga0105238_10025270 3300009551 Bacteria 6053
403 Ga0105249_10038260 3300009553 Bacteria 4353
404 Ga0105249_10040780 3300009553 Bacteria 4218
405 Ga0105249_10063845 3300009553 Bacteria 3384
406 Ga0105249_10304505 3300009553 Unclassified 1600
407 Ga0105249_11399161 3300009553 Bacteria 771
408 Ga0105239_10069767 3300010375 Bacteria 3860
409 Ga0105239_10183736 3300010375 Bacteria 2340
410 Ga0105239_10281572 3300010375 Unclassified 1872
411 Ga0105239_10864568 3300010375 Unclassified 1037
412 Ga0105239_11844453 3300010375 Bacteria 701
413 Ga0105246_10032307 3300011119 Bacteria 3470
414 Ga0105246_10033002 3300011119 Bacteria 3438
415 Ga0105246_10128705 3300011119 Bacteria 1888
416 Ga0105246_10195639 3300011119 Bacteria 1568
417 Ga0105246_11648557 3300011119 Unclassified 608
418 Ga0157319_1008034 3300012497 Unclassified 798
419 Ga0157316_1005208 3300012510 Bacteria 1019
420 Ga0157373_10146991 3300013100 Bacteria 1658
421 Ga0157369_10032688 3300013105 Bacteria 5719
422 Ga0157374_10048435 3300013296 Bacteria 3943
423 Ga0157374_10421366 3300013296 Bacteria 1334
424 Ga0157378_11104973 3300013297 Unclassified 830
425 Ga0157378_11269649 3300013297 Bacteria 777
426 Ga0157378_11496009 3300013297 Bacteria 720
427 Ga0163162_10019305 3300013306 Bacteria 6684
428 Ga0163162_10116894 3300013306 Unclassified 2768
429 Ga0163162_11014172 3300013306 Unclassified 939
430 Ga0163162_11793982 3300013306 Unclassified 701
431 Ga0157372_10054775 3300013307 Bacteria 4451
432 Ga0157372_10202152 3300013307 Bacteria 2301
433 Ga0157372_10726845 3300013307 Unclassified 1155
434 Ga0157372_11051743 3300013307 Bacteria 942
435 Ga0157375_10007198 3300013308 Bacteria 9726
436 Ga0157375_10053582 3300013308 Bacteria 3970
437 Ga0157375_10116060 3300013308 Bacteria 2781
438 Ga0157375_10248559 3300013308 Bacteria 1939
439 Ga0157375_10391746 3300013308 Bacteria 1556
440 Ga0157375_10405250 3300013308 Bacteria 1530
441 Ga0157375_10411000 3300013308 Unclassified 1519
442 Ga0157375_10766202 3300013308 Bacteria 1115
443 Ga0163163_10082304 3300014325 Bacteria 3222
444 Ga0163163_10235367 3300014325 Bacteria 1881
445 Ga0163163_10791967 3300014325 Unclassified 1011
446 Ga0163163_11470136 3300014325 Bacteria 743
447 Ga0163163_11858359 3300014325 Bacteria 662
448 Ga0157380_10002268 3300014326 Bacteria 12923
449 Ga0157380_10060279 3300014326 Bacteria 3032
450 Ga0157380_10063036 3300014326 Bacteria 2971
451 Ga0157380_11254226 3300014326 Bacteria 787
452 Ga0157380_11448590 3300014326 Bacteria 738
453 Ga0157380_11986413 3300014326 Bacteria 643
454 Ga0182008_10064026 3300014497 Bacteria 1810
455 Ga0157377_10002275 3300014745 Bacteria 8439
456 Ga0157377_10009150 3300014745 Bacteria 4851
457 Ga0157377_10012537 3300014745 Bacteria 4266
458 Ga0157377_10037383 3300014745 Bacteria 2674
459 Ga0157377_10042368 3300014745 Bacteria 2528
460 Ga0157377_10158982 3300014745 Unclassified 1403
461 Ga0157377_10659051 3300014745 Unclassified 754
462 Ga0157377_11057600 3300014745 Unclassified 619
463 Ga0157379_10028697 3300014968 Bacteria 4948
464 Ga0157379_10358295 3300014968 Bacteria 1336
465 Ga0157376_10065611 3300014969 Bacteria 3066
466 Ga0157376_10184995 3300014969 Bacteria 1907
467 Ga0157376_10317768 3300014969 Unclassified 1479
468 Ga0157376_12279930 3300014969 Unclassified 581
469 Ga0163161_10039994 3300017792 Bacteria 3367
470 Ga0163161_10055118 3300017792 Bacteria 2886
471 Ga0163161_10119147 3300017792 Bacteria 1982
472 Ga0163161_10158949 3300017792 Bacteria 1722
473 Ga0207653_10002394 3300025885 Bacteria 5974
474 Ga0207692_10009830 3300025898 Bacteria 4009
475 Ga0207692_10115823 3300025898 Bacteria 1494
476 Ga0207692_10604370 3300025898 Unclassified 705
477 Ga0207642_10010621 3300025899 Bacteria 3255
478 Ga0207642_10421215 3300025899 Bacteria 803
479 Ga0207688_10001531 3300025901 Bacteria 12141
480 Ga0207688_10010132 3300025901 Bacteria 5127
481 Ga0207688_10023095 3300025901 Bacteria 3403
482 Ga0207688_10050061 3300025901 Bacteria 2337
483 Ga0207688_10102546 3300025901 Bacteria 1654
484 Ga0207680_10050837 3300025903 Bacteria 2476
485 Ga0207647_10100639 3300025904 Bacteria 1715
486 Ga0207685_10014890 3300025905 Bacteria 2448
487 Ga0207685_10041020 3300025905 Unclassified 1729
488 Ga0207699_10018414 3300025906 Bacteria 3700
489 Ga0207699_10024394 3300025906 Bacteria 3307
490 Ga0207699_10039701 3300025906 Bacteria 2706
491 Ga0207699_10060058 3300025906 Unclassified 2281
492 Ga0207699_10506069 3300025906 Bacteria 872
493 Ga0207645_10017582 3300025907 Bacteria 4715
494 Ga0207643_10017837 3300025908 Bacteria 3886
495 Ga0207643_10048187 3300025908 Bacteria 2413
496 Ga0207643_10048720 3300025908 Unclassified 2400
497 Ga0207643_10156958 3300025908 Bacteria 1367
498 Ga0207705_10701264 3300025909 Bacteria 787
499 Ga0207684_10065034 3300025910 Bacteria 3097
500 Ga0207684_10095441 3300025910 Bacteria 2537
501 Ga0207684_10153852 3300025910 Bacteria 1979
502 Ga0207684_10241163 3300025910 Bacteria 1559
503 Ga0207684_10767414 3300025910 Bacteria 816
504 Ga0207654_10089088 3300025911 Bacteria 1876
505 Ga0207707_10131323 3300025912 Bacteria 2190
506 Ga0207707_10379811 3300025912 Bacteria 1215
507 Ga0207695_10351515 3300025913 Bacteria 1361
508 Ga0207671_10348894 3300025914 Bacteria 1173
509 Ga0207693_10000417 3300025915 Bacteria 38685
510 Ga0207693_10005105 3300025915 Bacteria 11005
511 Ga0207693_10011308 3300025915 Bacteria 7225
512 Ga0207693_10015889 3300025915 Bacteria 6026
513 Ga0207693_10245509 3300025915 Bacteria 1405
514 Ga0207663_10016308 3300025916 Bacteria 4116
515 Ga0207663_10149030 3300025916 Bacteria 1639
516 Ga0207663_10315221 3300025916 Bacteria 1173
517 Ga0207663_10360180 3300025916 Unclassified 1103
518 Ga0207660_10100821 3300025917 Bacteria 2156
519 Ga0207660_10351847 3300025917 Bacteria 1181
520 Ga0207660_10504397 3300025917 Unclassified 982
521 Ga0207662_10014690 3300025918 Bacteria 4396
522 Ga0207662_10025648 3300025918 Bacteria 3395
523 Ga0207662_10049355 3300025918 Bacteria 2497
524 Ga0207657_10005691 3300025919 Bacteria 13005
525 Ga0207649_10043879 3300025920 Bacteria 2736
526 Ga0207649_10199975 3300025920 Bacteria 1411
527 Ga0207649_10205688 3300025920 Bacteria 1393
528 Ga0207649_10537573 3300025920 Bacteria 893
529 Ga0207652_10017280 3300025921 Bacteria 5902
530 Ga0207652_10267923 3300025921 Bacteria 1540
531 Ga0207646_10001294 3300025922 Bacteria 31152
532 Ga0207646_10044646 3300025922 Bacteria 3978
533 Ga0207646_10138189 3300025922 Bacteria 2194
534 Ga0207646_10207330 3300025922 Bacteria 1770
535 Ga0207646_10278584 3300025922 Unclassified 1511
536 Ga0207646_10348332 3300025922 Bacteria 1339
537 Ga0207646_10540825 3300025922 Bacteria 1048
538 Ga0207681_10328903 3300025923 Bacteria 1218
539 Ga0207681_10524250 3300025923 Unclassified 973
540 Ga0207681_10957710 3300025923 Unclassified 718
541 Ga0207650_10025258 3300025925 Bacteria 4231
542 Ga0207650_10169172 3300025925 Bacteria 1736
543 Ga0207650_10737305 3300025925 Unclassified 833
544 Ga0207650_11144874 3300025925 Bacteria 662
545 Ga0207659_10050391 3300025926 Bacteria 2957
546 Ga0207659_10089733 3300025926 Bacteria 2293
547 Ga0207659_10089910 3300025926 Bacteria 2291
548 Ga0207659_10566470 3300025926 Bacteria 966
549 Ga0207659_10862801 3300025926 Bacteria 778
550 Ga0207687_10029148 3300025927 Bacteria 3711
551 Ga0207687_10033598 3300025927 Bacteria 3480
552 Ga0207687_10241800 3300025927 Bacteria 1431
553 Ga0207687_10248538 3300025927 Unclassified 1413
554 Ga0207687_10338024 3300025927 Bacteria 1223
555 Ga0207687_10485231 3300025927 Bacteria 1029
556 Ga0207687_10769733 3300025927 Bacteria 820
557 Ga0207700_10000006 3300025928 Bacteria 348187
558 Ga0207700_10364956 3300025928 Bacteria 1260
559 Ga0207664_10032906 3300025929 Bacteria 3978
560 Ga0207664_10069422 3300025929 Bacteria 2833
561 Ga0207664_10081836 3300025929 Bacteria 2628
562 Ga0207664_10138307 3300025929 Bacteria 2057
563 Ga0207644_10102965 3300025931 Bacteria 2148
564 Ga0207690_10035164 3300025932 Bacteria 3234
565 Ga0207690_10059966 3300025932 Bacteria 2580
566 Ga0207690_10068507 3300025932 Bacteria 2438
567 Ga0207690_10406643 3300025932 Unclassified 1086
568 Ga0207690_10894671 3300025932 Bacteria 736
569 Ga0207706_10005943 3300025933 Bacteria 11353
570 Ga0207706_10053545 3300025933 Bacteria 3562
571 Ga0207706_10224683 3300025933 Bacteria 1643
572 Ga0207686_10088752 3300025934 Bacteria 2036
573 Ga0207686_10108402 3300025934 Bacteria 1868
574 Ga0207686_10175045 3300025934 Bacteria 1517
575 Ga0207686_10294666 3300025934 Bacteria 1203
576 Ga0207709_10011798 3300025935 Bacteria 4818
577 Ga0207709_10013862 3300025935 Bacteria 4450
578 Ga0207709_10316109 3300025935 Bacteria 1167
579 Ga0207709_10374585 3300025935 Unclassified 1081
580 Ga0207709_10376799 3300025935 Unclassified 1079
581 Ga0207709_10628492 3300025935 Bacteria 853
582 Ga0207709_10698286 3300025935 Bacteria 812
583 Ga0207670_10247136 3300025936 Bacteria 1377
584 Ga0207670_10372694 3300025936 Unclassified 1135
585 Ga0207669_10007607 3300025937 Bacteria 5027
586 Ga0207669_10031854 3300025937 Bacteria 2952
587 Ga0207669_10067527 3300025937 Bacteria 2229
588 Ga0207669_10144226 3300025937 Bacteria 1658
589 Ga0207669_10252379 3300025937 Bacteria 1314
590 Ga0207669_10262975 3300025937 Bacteria 1291
591 Ga0207704_10150393 3300025938 Bacteria 1642
592 Ga0207704_10168067 3300025938 Bacteria 1569
593 Ga0207704_10498534 3300025938 Unclassified 981
594 Ga0207704_10983709 3300025938 Bacteria 713
595 Ga0207665_10006848 3300025939 Bacteria 7543
596 Ga0207665_10009283 3300025939 Bacteria 6458
597 Ga0207665_10106000 3300025939 Bacteria 1969
598 Ga0207665_10291331 3300025939 Bacteria 1218
599 Ga0207691_10002178 3300025940 Bacteria 19152
600 Ga0207691_10005171 3300025940 Bacteria 12595
601 Ga0207691_10012051 3300025940 Bacteria 8294
602 Ga0207691_10149046 3300025940 Bacteria 2058
603 Ga0207691_10184656 3300025940 Bacteria 1821
604 Ga0207691_10256493 3300025940 Bacteria 1508
605 Ga0207691_10546882 3300025940 Bacteria 982
606 Ga0207691_10601781 3300025940 Bacteria 930
607 Ga0207711_10095239 3300025941 Bacteria 2625
608 Ga0207711_10181454 3300025941 Unclassified 1914
609 Ga0207711_10549956 3300025941 Bacteria 1077
610 Ga0207689_10081801 3300025942 Bacteria 2655
611 Ga0207689_10203476 3300025942 Unclassified 1635
612 Ga0207689_10442118 3300025942 Unclassified 1086
613 Ga0207661_10010773 3300025944 Bacteria 6592
614 Ga0207661_10026539 3300025944 Bacteria 4414
615 Ga0207661_10056702 3300025944 Bacteria 3146
616 Ga0207661_10169960 3300025944 Bacteria 1897
617 Ga0207661_10261690 3300025944 Bacteria 1541
618 Ga0207661_11120639 3300025944 Unclassified 724
619 Ga0207661_11218171 3300025944 Bacteria 692
620 Ga0207679_10071992 3300025945 Bacteria 2609
621 Ga0207679_10241941 3300025945 Unclassified 1529
622 Ga0207679_10672149 3300025945 Unclassified 938
623 Ga0207667_11025680 3300025949 Bacteria 811
624 Ga0207712_10100427 3300025961 Bacteria 2150
625 Ga0207712_10773305 3300025961 Bacteria 843
626 Ga0207668_10038488 3300025972 Unclassified 3211
627 Ga0207668_10318501 3300025972 Unclassified 1290
628 Ga0207668_10325467 3300025972 Unclassified 1277
629 Ga0207668_10342707 3300025972 Bacteria 1247
630 Ga0207640_10033438 3300025981 Bacteria 3199
631 Ga0207640_10102878 3300025981 Bacteria 2007
632 Ga0207640_10167420 3300025981 Bacteria 1633
633 Ga0207658_10051180 3300025986 Bacteria 3043
634 Ga0207677_10143069 3300026023 Unclassified 1834
635 Ga0207677_10194598 3300026023 Bacteria 1607
636 Ga0207677_10246526 3300026023 Unclassified 1448
637 Ga0207677_10336582 3300026023 Unclassified 1259
638 Ga0207677_10489928 3300026023 Bacteria 1061
639 Ga0207677_10612011 3300026023 Bacteria 957
640 Ga0207639_10230620 3300026041 Bacteria 1604
641 Ga0207639_10381890 3300026041 Bacteria 1265
642 Ga0207639_10413027 3300026041 Bacteria 1218
643 Ga0207639_10758411 3300026041 Unclassified 902
644 Ga0207678_10038256 3300026067 Bacteria 4169
645 Ga0207678_10476614 3300026067 Bacteria 1086
646 Ga0207708_10004014 3300026075 Bacteria 10826
647 Ga0207708_10004621 3300026075 Bacteria 10133
648 Ga0207708_10030010 3300026075 Bacteria 4123
649 Ga0207708_10031188 3300026075 Bacteria 4045
650 Ga0207708_10049928 3300026075 Bacteria 3185
651 Ga0207708_10359347 3300026075 Bacteria 1197
652 Ga0207708_10737943 3300026075 Bacteria 844
653 Ga0207702_10045233 3300026078 Bacteria 3703
654 Ga0207702_10335244 3300026078 Bacteria 1444
655 Ga0207702_10409975 3300026078 Bacteria 1308
656 Ga0207702_10459723 3300026078 Bacteria 1236
657 Ga0207702_10732037 3300026078 Bacteria 976
658 Ga0207641_10604688 3300026088 Bacteria 1074
659 Ga0207648_10000136 3300026089 Bacteria 73368
660 Ga0207648_10006619 3300026089 Bacteria 11511
661 Ga0207648_10026492 3300026089 Bacteria 5151
662 Ga0207648_10051017 3300026089 Bacteria 3616
663 Ga0207648_10134800 3300026089 Bacteria 2175
664 Ga0207648_10144093 3300026089 Bacteria 2101
665 Ga0207648_10229142 3300026089 Bacteria 1652
666 Ga0207648_10755152 3300026089 Bacteria 903
667 Ga0207648_10878806 3300026089 Bacteria 837
668 Ga0207676_10026992 3300026095 Bacteria 4273
669 Ga0207676_10049997 3300026095 Bacteria 3257
670 Ga0207676_11283295 3300026095 Bacteria 727
671 Ga0207674_10017754 3300026116 Bacteria 7756
672 Ga0207674_10180224 3300026116 Bacteria 2064
673 Ga0207674_10475891 3300026116 Bacteria 1207
674 Ga0207674_11559286 3300026116 Bacteria 629
675 Ga0207675_100024292 3300026118 Bacteria 5636
676 Ga0207675_100025627 3300026118 Bacteria 5488
677 Ga0207675_100085800 3300026118 Bacteria 2955
678 Ga0207675_100174830 3300026118 Bacteria 2054
679 Ga0207675_100334432 3300026118 Bacteria 1481
680 Ga0207683_10008656 3300026121 Bacteria 8703
681 Ga0207683_10013282 3300026121 Bacteria 7021
682 Ga0207683_10050019 3300026121 Bacteria 3660
683 Ga0207683_10067451 3300026121 Bacteria 3156
684 Ga0207683_10069717 3300026121 Bacteria 3105
685 Ga0207683_10086744 3300026121 Bacteria 2783
686 Ga0207683_10135462 3300026121 Bacteria 2217
687 Ga0207683_10205363 3300026121 Bacteria 1792
688 Ga0207683_10855880 3300026121 Unclassified 844
689 Ga0207698_10061193 3300026142 Bacteria 2933
690 Ga0207698_10440794 3300026142 Unclassified 1255
691 Ga0207698_10531650 3300026142 Bacteria 1149
692 Ga0207698_11192611 3300026142 Unclassified 775
693 Ga0207428_10000572 3300027907 Bacteria 43607
694 Ga0207428_10016659 3300027907 Bacteria 6320
695 Ga0207428_10331686 3300027907 Unclassified 1122
696 Ga0207428_10406229 3300027907 Bacteria 997
697 Ga0207428_10500892 3300027907 Bacteria 882
698 Ga0207428_10649874 3300027907 Unclassified 757
699 Ga0268266_10390455 3300028379 Bacteria 1314
700 Ga0268266_10822170 3300028379 Bacteria 898
701 Ga0268266_10976270 3300028379 Bacteria 820
702 Ga0268266_11012725 3300028379 Unclassified 804
703 Ga0268265_10331853 3300028380 Bacteria 1382
704 Ga0268265_10498272 3300028380 Bacteria 1147
705 Ga0268264_10210484 3300028381 Bacteria 1785
706 Ga0268264_10351043 3300028381 Unclassified 1404
707 Ga0268264_10473455 3300028381 Bacteria 1217
708 Ga0265318_10093240 3300028577 Bacteria 1109
709 Ga0265336_10058115 3300028666 Bacteria 1161
710 Ga0265338_10005613 3300028800 Bacteria 16301
711 Ga0265332_10069550 3300031238 Bacteria 1500
712 Ga0265325_10098574 3300031241 Bacteria 1433
713 Ga0265339_10006130 3300031249 Bacteria 7931
714 Ga0265316_10070974 3300031344 Bacteria 2685
715 Ga0307408_100215377 3300031548 Bacteria 1564
716 Ga0307408_100588551 3300031548 Bacteria 987
717 Ga0307408_100613650 3300031548 Unclassified 968
718 Ga0265314_10027580 3300031711 Bacteria 4251
719 Ga0265342_10116565 3300031712 Bacteria 1507
720 Ga0307410_10590755 3300031852 Bacteria 925
721 Ga0307406_10490236 3300031901 Bacteria 994
722 Ga0307407_11040006 3300031903 Bacteria 634
723 Ga0307409_100235014 3300031995 Bacteria 1664
724 Ga0307409_100632912 3300031995 Unclassified 1061
725 Ga0307409_101144841 3300031995 Unclassified 800
726 Ga0307416_100029222 3300032002 Bacteria 4114
727 Ga0307416_100092672 3300032002 Bacteria 2600
728 Ga0307416_100112348 3300032002 Bacteria 2404
729 Ga0307416_101977902 3300032002 Bacteria 686
730 Ga0373948_0000639 3300034817 Bacteria 4516
731 Ga0373948_0059486 3300034817 Bacteria 836
732 Ga0373950_0008031 3300034818 Bacteria 1650
733 Ga0373958_0002939 3300034819 Bacteria 2431
734 Ga0373959_0002675 3300034820 Bacteria 2828
735 Ga0373938_0001421 3300034957 Bacteria 3832
736 Ga0373928_0001412 3300035084 Bacteria 4688
737 Ga0373929_0002216 3300035085 Bacteria 3599
738 Ga0373940_0005175 3300035088 Bacteria 2809
739 Ga0373949_0001071 3300035090 Bacteria 8366
740 Ga0373949_0047526 3300035090 Bacteria 1073
741 Ga0373951_0006145 3300035091 Bacteria 2756
742 Ga0373951_0015933 3300035091 Bacteria 1695
743 Ga0373952_0005981 3300035092 Bacteria 2240
744 Ga0373932_0003703 3300035112 Bacteria 3651
745 Ga0373932_0226878 3300035112 Bacteria 673
746 Ga0373939_0069300 3300035114 Bacteria 1144
747 Ga0373939_0105214 3300035114 Bacteria 974
748 Ga0373941_0018408 3300035115 Bacteria 1929
749 Ga0373960_0054343 3300035121 Bacteria 1197
750 Ga0373943_0127025 3300035170 Bacteria 1361
751 Ga0373943_0289159 3300035170 Unclassified 928
752 Ga0373942_0004537 3300035207 Bacteria 3219
753 Ga0373942_0047606 3300035207 Bacteria 1192
754 Ga0373961_0008386 3300035241 Bacteria 2512
755 Ga0373962_0000515 3300035242 Bacteria 8625
756 Ga0373962_0188070 3300035242 Bacteria 694
757 Ga0373931_0005933 3300035691 Bacteria 5679
758 Ga0373931_0203930 3300035691 Bacteria 1183
759 Ga0373937_0559913 3300036401 Bacteria 1086
760 Ga0395899_0010605 3300037312 Bacteria 7062
761 Ga0395899_0028406 3300037312 Bacteria 4212
762 Ga0395899_0086805 3300037312 Bacteria 2272
763 Ga0395899_0146927 3300037312 Bacteria 1673
764 Ga0395899_0184498 3300037312 Bacteria 1463
765 Ga0395900_0000847 3300037418 Bacteria 40260
766 Ga0395900_0001036 3300037418 Bacteria 35631
767 Ga0395900_0034795 3300037418 Bacteria 5189
768 Ga0395900_0052889 3300037418 Bacteria 4180
769 Ga0395900_0055191 3300037418 Bacteria 4091
770 Ga0395900_0071636 3300037418 Bacteria 3563
771 Ga0395900_0145562 3300037418 Bacteria 2423
772 Ga0395900_0264247 3300037418 Bacteria 1717
773 Ga0395900_0980290 3300037418 Bacteria 766
774 Ga0395900_1135559 3300037418 Unclassified 698
775 Ga0395900_1186394 3300037418 Bacteria 679
776 Ga0395898_0001318 3300037466 Bacteria 36063
777 Ga0395898_0002877 3300037466 Bacteria 19647
778 Ga0395898_0003008 3300037466 Bacteria 19112
779 Ga0395898_0018533 3300037466 Bacteria 7095
780 Ga0395898_0028519 3300037466 Bacteria 5593
781 Ga0395898_0035668 3300037466 Bacteria 4943
782 Ga0395898_0044571 3300037466 Bacteria 4365
783 Ga0395898_0052471 3300037466 Bacteria 3984
784 Ga0395898_0069507 3300037466 Bacteria 3407
785 Ga0395898_0096403 3300037466 Bacteria 2841
786 Ga0395898_0190782 3300037466 Unclassified 1958
787 Ga0395898_0259227 3300037466 Bacteria 1658
788 Ga0395898_0666510 3300037466 Bacteria 982
789 Ga0395898_0836402 3300037466 Bacteria 860
790 Ga0395905_0000636 3300037471 Bacteria 46887
791 Ga0395905_0005583 3300037471 Bacteria 12815
792 Ga0395905_0009466 3300037471 Bacteria 9518
793 Ga0395905_0034589 3300037471 Bacteria 4745
794 Ga0395905_0050998 3300037471 Bacteria 3875
795 Ga0395905_0062017 3300037471 Bacteria 3497
796 Ga0395905_0078344 3300037471 Bacteria 3097
797 Ga0395905_0182761 3300037471 Bacteria 1969
798 Ga0395905_0193205 3300037471 Bacteria 1909
799 Ga0395905_0221625 3300037471 Unclassified 1770
800 Ga0395905_0280923 3300037471 Bacteria 1551
801 Ga0395905_1209549 3300037471 Unclassified 659
802 Ga0395901_0000760 3300038443 Bacteria 36166
803 Ga0395901_0004963 3300038443 Bacteria 13426
804 Ga0395901_0005724 3300038443 Bacteria 12587
805 Ga0395901_0008335 3300038443 Bacteria 10476
806 Ga0395901_0011601 3300038443 Bacteria 8928
807 Ga0395901_0015432 3300038443 Bacteria 7779
808 Ga0395901_0022219 3300038443 Bacteria 6500
809 Ga0395901_0032403 3300038443 Bacteria 5392
810 Ga0395901_0036250 3300038443 Bacteria 5097
811 Ga0395901_0048871 3300038443 Bacteria 4394
812 Ga0395901_0054544 3300038443 Bacteria 4155
813 Ga0395901_0073689 3300038443 Bacteria 3561
814 Ga0395901_0089840 3300038443 Bacteria 3214
815 Ga0395901_0093447 3300038443 Bacteria 3149
816 Ga0395901_0117859 3300038443 Bacteria 2790
817 Ga0395901_0145032 3300038443 Bacteria 2496
818 Ga0395901_0146014 3300038443 Bacteria 2486
819 Ga0395901_0190619 3300038443 Unclassified 2150
820 Ga0395901_0308146 3300038443 Bacteria 1640
821 Ga0395901_0360748 3300038443 Bacteria 1498
822 Ga0395901_0372544 3300038443 Bacteria 1470
823 Ga0395901_0473103 3300038443 Unclassified 1279
824 Ga0395901_1150579 3300038443 Bacteria 744
825 Ga0395901_1591423 3300038443 Bacteria 607
826 Ga0242420_013248 3300038996 Unclassified 1404
827 Ga0436360_0539564 3300039438 Bacteria 712
828 Ga0439439_0000856 3300041406 Bacteria 5594
829 Ga0439453_0000752 3300041408 Bacteria 3776
830 Ga0439461_0001922 3300041410 Bacteria 3277
831 Ga0439461_0014936 3300041410 Unclassified 1483
832 Ga0451800_0711459 3300041459 Bacteria 901
833 Ga0451853_0314994 3300041512 Archaea 613
834 Ga0451853_0511288 3300041512 Bacteria 1757
835 Ga0451853_0865558 3300041512 Bacteria 1110
836 Ga0451853_1815271 3300041512 Bacteria 854
837 Ga0439431_0006609 3300041997 Bacteria 2570
838 Ga0439433_0001743 3300041999 Bacteria 4516
839 Ga0439456_091110 3300042013 Unclassified 685
840 Ga0439462_0003942 3300042015 Bacteria 3591
841 Ga0450914_012474 3300042118 Bacteria 852
842 Ga0450920_008348 3300042122 Bacteria 1892
843 Ga0450920_066685 3300042122 Unclassified 730
844 Ga0450923_060214 3300042125 Bacteria 827
845 Ga0439446_0010197 3300042156 Bacteria 2528
846 Ga0439446_0026841 3300042156 Bacteria 1651
847 Ga0439435_0061505 3300042436 Bacteria 1095
848 Ga0466972_0103746 3300044658 Bacteria 1345
849 Ga0466964_0005703 3300044706 Bacteria 4633
850 Ga0466968_0041052 3300044735 Bacteria 1952
851 Ga0466968_0293281 3300044735 Bacteria 781
852 Ga0466960_0097127 3300044901 Bacteria 1511
853 Ga0466960_0380105 3300044901 Bacteria 810
854 Ga0451576_0423530 3300045051 Bacteria 1397
855 Ga0466967_0157580 3300045976 Bacteria 2128
856 Ga0466967_0954690 3300045976 Bacteria 853
857 Ga0495617_086535 3300046452 Bacteria 1025
858 Ga0495603_0014070 3300046455 Bacteria 4839
859 Ga0495629_0192884 3300046459 Bacteria 1410
860 Ga0495641_0014033 3300046461 Bacteria 4359
861 Ga0495641_0144584 3300046461 Bacteria 1063
862 Ga0495580_0137729 3300046472 Bacteria 1693
863 Ga0495582_0080390 3300046473 Bacteria 1810
864 Ga0495582_0326679 3300046473 Unclassified 883
865 Ga0495582_0366705 3300046473 Unclassified 830
866 Ga0495582_0369320 3300046473 Bacteria 826
867 Ga0495605_0097257 3300046474 Bacteria 1357
868 Ga0495605_0290233 3300046474 Unclassified 694
869 Ga0495664_0180513 3300046477 Bacteria 1280
870 Ga0495664_0287979 3300046477 Bacteria 992
871 Ga0495584_0019214 3300046491 Bacteria 3471
872 Ga0495584_0048543 3300046491 Bacteria 2140
873 Ga0495584_0157107 3300046491 Bacteria 1156
874 Ga0495584_0230813 3300046491 Unclassified 941
875 Ga0495584_0320375 3300046491 Bacteria 787
876 Ga0495584_0432024 3300046491 Unclassified 670
877 Ga0495594_0191491 3300046499 Bacteria 1165
878 Ga0495596_0100412 3300046500 Bacteria 1123
879 Ga0495596_0230298 3300046500 Bacteria 719
880 Ga0495607_0264796 3300046501 Bacteria 822
881 Ga0495616_0065717 3300046513 Unclassified 1766
882 Ga0495630_0010068 3300046517 Bacteria 6812
883 Ga0495630_0068665 3300046517 Bacteria 2666
884 Ga0495631_0106484 3300046518 Bacteria 1206
885 Ga0495644_0057018 3300046523 Bacteria 1468
886 Ga0495644_0190659 3300046523 Unclassified 789
887 Ga0495644_0231059 3300046523 Bacteria 716
888 Ga0495663_0100272 3300046525 Bacteria 953
889 Ga0495652_0429474 3300046529 Bacteria 929
890 Ga0495665_0144804 3300046531 Bacteria 1241
891 Ga0495640_0377981 3300046533 Bacteria 872
892 Ga0495587_0411843 3300046536 Bacteria 751
893 Ga0495598_0047295 3300046537 Bacteria 1282
894 Ga0495598_0343828 3300046537 Unclassified 573
895 Ga0495609_0042950 3300046538 Bacteria 2030
896 Ga0495609_0169712 3300046538 Bacteria 922
897 Ga0495609_0199564 3300046538 Bacteria 837
898 Ga0495609_0204671 3300046538 Bacteria 824
899 Ga0495609_0314546 3300046538 Unclassified 636
900 Ga0495645_0329557 3300046543 Bacteria 989
901 Ga0495667_0440401 3300046559 Bacteria 819
902 Ga0495656_0019427 3300046615 Bacteria 2623
903 Ga0495668_0499173 3300046616 Bacteria 671
904 Ga0495611_0252844 3300046648 Bacteria 817
905 Ga0495635_0064504 3300046663 Bacteria 2514
906 Ga0495659_0056777 3300046664 Bacteria 1437
907 Ga0495659_0065020 3300046664 Bacteria 1356
908 Ga0495661_0356668 3300046665 Bacteria 719
909 Ga0495588_0065579 3300046674 Bacteria 1884
910 Ga0495588_0105818 3300046674 Bacteria 1480
911 Ga0495588_0247069 3300046674 Bacteria 941
912 Ga0495647_0183028 3300046681 Bacteria 912
913 Ga0495670_0121322 3300046691 Unclassified 1358
914 Ga0495670_0262579 3300046691 Bacteria 922
915 Ga0495671_0122961 3300046692 Bacteria 1266
916 Ga0495589_0048071 3300046794 Bacteria 2113
917 Ga0495589_0097567 3300046794 Bacteria 1424
918 Ga0495589_0326705 3300046794 Bacteria 708
919 Ga0495589_0341787 3300046794 Unclassified 690
920 Ga0495589_0412974 3300046794 Unclassified 619
921 Ga0495581_0001189 3300047315 Bacteria 14280
922 Ga0495581_0360653 3300047315 Bacteria 848
923 Ga0495636_0110951 3300047318 Bacteria 1207
924 Ga0495674_0168834 3300047319 Bacteria 1827
925 Ga0495674_0598924 3300047319 Bacteria 873
926 Ga0495676_0052776 3300047321 Bacteria 3243
927 Ga0495676_0290438 3300047321 Bacteria 1105
928 Ga0495680_0018765 3300047322 Bacteria 5862
929 Ga0495680_0551969 3300047322 Bacteria 776
930 Ga0495677_0078690 3300047445 Bacteria 1234
931 Ga0495593_0234102 3300047673 Unclassified 921
932 Ga0495614_0246913 3300048089 Unclassified 816
933 Ga0496100_0009322 3300048903 Bacteria 5514
934 Ga0496100_0036997 3300048903 Bacteria 3082
935 Ga0496101_0019404 3300048904 Bacteria 4641
936 Ga0496101_0054433 3300048904 Bacteria 2889
937 Ga0496101_0077471 3300048904 Bacteria 2450
938 Ga0496101_0212438 3300048904 Bacteria 1499
939 Ga0496101_0243481 3300048904 Unclassified 1400
940 Ga0496101_0393748 3300048904 Bacteria 1091
941 Ga0496102_0049638 3300048905 Bacteria 3818
942 Ga0496102_0080963 3300048905 Bacteria 2993
943 Ga0496102_0239263 3300048905 Bacteria 1712
944 Ga0496102_0361072 3300048905 Bacteria 1367
945 Ga0496102_0408627 3300048905 Bacteria 1276
946 Ga0496103_0012797 3300048906 Bacteria 4975
947 Ga0496103_0146771 3300048906 Unclassified 1510
948 Ga0496104_0019949 3300048907 Bacteria 6139
949 Ga0496104_0046813 3300048907 Bacteria 4075
950 Ga0496104_0085506 3300048907 Bacteria 3010
951 Ga0496104_0252479 3300048907 Unclassified 1676
952 Ga0496104_0394021 3300048907 Bacteria 1297
953 Ga0496104_0426409 3300048907 Bacteria 1238
954 Ga0496104_0428931 3300048907 Bacteria 1234
955 Ga0496105_0007278 3300048908 Bacteria 8551
956 Ga0496105_0010819 3300048908 Bacteria 7186
957 Ga0496105_0046475 3300048908 Bacteria 3583
958 Ga0496105_0255394 3300048908 Bacteria 1419
959 Ga0496106_0002316 3300048909 Bacteria 14197
960 Ga0496106_0210910 3300048909 Bacteria 1547
961 Ga0496106_0253254 3300048909 Bacteria 1408
962 Ga0496107_0048266 3300048910 Bacteria 3066
963 Ga0496107_0270925 3300048910 Unclassified 1264
964 Ga0496108_0000998 3300048911 Bacteria 22097
965 Ga0496108_0022210 3300048911 Bacteria 5217
966 Ga0496108_0023416 3300048911 Bacteria 5082
967 Ga0496108_0131547 3300048911 Bacteria 2151
968 Ga0496108_0133895 3300048911 Bacteria 2131
969 Ga0496109_0001842 3300048912 Bacteria 17582
970 Ga0496109_0011427 3300048912 Bacteria 7632
971 Ga0496109_0032977 3300048912 Bacteria 4659
972 Ga0496109_0108278 3300048912 Bacteria 2583
973 Ga0496109_0139930 3300048912 Bacteria 2263
974 Ga0496109_0368181 3300048912 Bacteria 1357
975 Ga0496109_0471107 3300048912 Unclassified 1186
976 Ga0496109_1098729 3300048912 Bacteria 732
977 Ga0496109_1568166 3300048912 Unclassified 593
978 Ga0496110_0022265 3300048913 Bacteria 5378
979 Ga0496110_0038598 3300048913 Bacteria 4156
980 Ga0496110_0041569 3300048913 Bacteria 4012
981 Ga0496110_0054430 3300048913 Bacteria 3520
982 Ga0496110_0076284 3300048913 Bacteria 2980
983 Ga0496110_0077479 3300048913 Bacteria 2958
984 Ga0496110_0130183 3300048913 Bacteria 2271
985 Ga0496110_0183343 3300048913 Bacteria 1901
986 Ga0496110_0201425 3300048913 Unclassified 1809
987 Ga0496110_0491275 3300048913 Bacteria 1118
988 Ga0496110_0727959 3300048913 Bacteria 894
989 Ga0496110_0869161 3300048913 Unclassified 807
990 Ga0496111_0006340 3300048914 Bacteria 7671
991 Ga0496111_0013081 3300048914 Bacteria 5635
992 Ga0496111_0025509 3300048914 Bacteria 4171
993 Ga0496111_0050435 3300048914 Bacteria 3002
994 Ga0496111_0059184 3300048914 Bacteria 2775
995 Ga0496111_0070842 3300048914 Bacteria 2537
996 Ga0496111_0400356 3300048914 Bacteria 1014
997 Ga0496111_0415255 3300048914 Bacteria 994
998 Ga0496111_0616110 3300048914 Bacteria 794
999 Ga0496111_0619435 3300048914 Bacteria 791
1000 Ga0496112_0000822 3300048915 Bacteria 22028
1001 Ga0496112_0010044 3300048915 Bacteria 8570
1002 Ga0496112_0052528 3300048915 Bacteria 4000
1003 Ga0496112_0093922 3300048915 Bacteria 2970
1004 Ga0496112_0120324 3300048915 Bacteria 2595
1005 Ga0496112_0145617 3300048915 Bacteria 2337
1006 Ga0496112_0529067 3300048915 Unclassified 1113
1007 Ga0496112_1031021 3300048915 Unclassified 742
1008 Ga0496113_0022663 3300048916 Bacteria 4446
1009 Ga0496113_0061407 3300048916 Bacteria 2836
1010 Ga0496113_0076319 3300048916 Bacteria 2560
1011 Ga0496113_0170681 3300048916 Unclassified 1723
1012 Ga0496113_0307014 3300048916 Bacteria 1271
1013 Ga0496113_0564380 3300048916 Bacteria 912
1014 Ga0496113_0641292 3300048916 Unclassified 850
1015 Ga0496113_1187801 3300048916 Bacteria 596
1016 Ga0496114_0014754 3300048917 Bacteria 6280
1017 Ga0496114_0019981 3300048917 Bacteria 5434
1018 Ga0496114_0065454 3300048917 Bacteria 3045
1019 Ga0496114_0092945 3300048917 Bacteria 2564
1020 Ga0496114_0158726 3300048917 Unclassified 1965
1021 Ga0496114_0255085 3300048917 Bacteria 1543
1022 Ga0496114_0282757 3300048917 Bacteria 1463
1023 Ga0496114_0466380 3300048917 Bacteria 1118
1024 Ga0496114_0593938 3300048917 Bacteria 976
1025 Ga0496114_1764814 3300048917 Bacteria 507
1026 Ga0496115_0009424 3300048918 Bacteria 7255
1027 Ga0496115_0013675 3300048918 Bacteria 6144
1028 Ga0496115_0303286 3300048918 Bacteria 1308
1029 Ga0501031_0000646 3300049568 Bacteria 20687
1030 Ga0501031_0010436 3300049568 Bacteria 6050
1031 Ga0501031_0019573 3300049568 Bacteria 4409
1032 Ga0501031_0025680 3300049568 Bacteria 3842
1033 Ga0501031_0052345 3300049568 Bacteria 2660
1034 Ga0501031_0070636 3300049568 Bacteria 2274
1035 Ga0501031_0121490 3300049568 Bacteria 1706
1036 Ga0501031_0259121 3300049568 Bacteria 1130
1037 Ga0501031_0269914 3300049568 Bacteria 1105
1038 Ga0501031_0339335 3300049568 Bacteria 973
1039 Ga0501031_0526203 3300049568 Bacteria 762
1040 Ga0501032_0006506 3300049569 Bacteria 8586
1041 Ga0501032_0019837 3300049569 Bacteria 4694
1042 Ga0501032_0127194 3300049569 Bacteria 1682
1043 Ga0501032_0153293 3300049569 Bacteria 1515
1044 Ga0501032_0451787 3300049569 Bacteria 823
1045 Ga0501032_0538726 3300049569 Bacteria 745
1046 Ga0501033_0037662 3300049570 Bacteria 3619
1047 Ga0501033_0042708 3300049570 Bacteria 3379
1048 Ga0501033_0045852 3300049570 Bacteria 3252
1049 Ga0501033_0059827 3300049570 Bacteria 2813
1050 Ga0501033_0095464 3300049570 Bacteria 2173
1051 Ga0501033_0150686 3300049570 Bacteria 1678
1052 Ga0501033_0224570 3300049570 Bacteria 1336
1053 Ga0501034_0139283 3300049571 Bacteria 2406
1054 Ga0501036_0012366 3300049572 Bacteria 7069
1055 Ga0501036_0015689 3300049572 Bacteria 6327
1056 Ga0501036_0016175 3300049572 Bacteria 6231
1057 Ga0501036_0024729 3300049572 Bacteria 5063
1058 Ga0501036_0029682 3300049572 Bacteria 4619
1059 Ga0501036_0045195 3300049572 Bacteria 3731
1060 Ga0501036_0066937 3300049572 Bacteria 3039
1061 Ga0501036_0098725 3300049572 Bacteria 2469
1062 Ga0501037_0013580 3300049573 Bacteria 5999
1063 Ga0501037_0014812 3300049573 Bacteria 5737
1064 Ga0501037_0025128 3300049573 Bacteria 4401
1065 Ga0501037_0025133 3300049573 Bacteria 4401
1066 Ga0501037_0049205 3300049573 Bacteria 3087
1067 Ga0501038_0011133 3300049574 Bacteria 8214
1068 Ga0501038_0013472 3300049574 Bacteria 7455
1069 Ga0501038_0036299 3300049574 Bacteria 4326
1070 Ga0501038_0044922 3300049574 Bacteria 3836
1071 Ga0501038_0070967 3300049574 Bacteria 2955
1072 Ga0501038_0145587 3300049574 Bacteria 1934
1073 Ga0501038_0185780 3300049574 Bacteria 1675
1074 Ga0501038_0194009 3300049574 Unclassified 1633
1075 Ga0501039_0012817 3300049575 Bacteria 6409
1076 Ga0501039_0018566 3300049575 Bacteria 5339
1077 Ga0501039_0021961 3300049575 Bacteria 4897
1078 Ga0501039_0031924 3300049575 Bacteria 4060
1079 Ga0501039_0032709 3300049575 Bacteria 4010
1080 Ga0501039_0064068 3300049575 Bacteria 2849
1081 Ga0501039_0108646 3300049575 Bacteria 2168
1082 Ga0501039_0110736 3300049575 Bacteria 2146
1083 Ga0501039_0246439 3300049575 Bacteria 1405
1084 Ga0501039_0269249 3300049575 Unclassified 1339
1085 Ga0501039_0572706 3300049575 Unclassified 886
1086 Ga0501039_0736928 3300049575 Bacteria 770
1087 Ga0501040_0003335 3300049576 Bacteria 10380
1088 Ga0501040_0004118 3300049576 Bacteria 9459
1089 Ga0501040_0007444 3300049576 Bacteria 7090
1090 Ga0501040_0015206 3300049576 Bacteria 5084
1091 Ga0501040_0021186 3300049576 Bacteria 4337
1092 Ga0501040_0040458 3300049576 Bacteria 3172
1093 Ga0501040_0062429 3300049576 Bacteria 2563
1094 Ga0501040_0144703 3300049576 Bacteria 1675
1095 Ga0501040_0179473 3300049576 Unclassified 1501
1096 Ga0501040_0180918 3300049576 Bacteria 1495
1097 Ga0501040_0220337 3300049576 Bacteria 1350
1098 Ga0501040_0329499 3300049576 Bacteria 1092
1099 Ga0501040_0601488 3300049576 Bacteria 794
1100 Ga0501040_0637919 3300049576 Bacteria 770
1101 Ga0501041_0001059 3300049577 Bacteria 15049
1102 Ga0501041_0001234 3300049577 Bacteria 14020
1103 Ga0501041_0016173 3300049577 Bacteria 4433
1104 Ga0501041_0020649 3300049577 Bacteria 3939
1105 Ga0501041_0024836 3300049577 Bacteria 3599
1106 Ga0501041_0034729 3300049577 Bacteria 3053
1107 Ga0501041_0035308 3300049577 Bacteria 3029
1108 Ga0501041_0261234 3300049577 Bacteria 1089
1109 Ga0501042_0000940 3300049578 Bacteria 16400
1110 Ga0501042_0013240 3300049578 Bacteria 5613
1111 Ga0501042_0021235 3300049578 Bacteria 4521
1112 Ga0501042_0051961 3300049578 Bacteria 2923
1113 Ga0501042_0080443 3300049578 Bacteria 2334
1114 Ga0501042_0184585 3300049578 Bacteria 1504
1115 Ga0501042_0189661 3300049578 Bacteria 1483
1116 Ga0501042_0538906 3300049578 Unclassified 848
1117 Ga0501042_0842358 3300049578 Unclassified 668
1118 Ga0501043_0044096 3300049579 Bacteria 3506
1119 Ga0501043_0048010 3300049579 Bacteria 3356
1120 Ga0501043_0160264 3300049579 Bacteria 1758
1121 Ga0501043_0472046 3300049579 Bacteria 940
1122 Ga0501046_0016180 3300049580 Bacteria 6252
1123 Ga0501046_0021562 3300049580 Bacteria 5317
1124 Ga0501046_0021848 3300049580 Bacteria 5275
1125 Ga0501046_0044355 3300049580 Bacteria 3536
1126 Ga0501046_0148924 3300049580 Unclassified 1766
1127 Ga0501046_0248865 3300049580 Bacteria 1309
1128 Ga0501046_0372453 3300049580 Unclassified 1034
1129 Ga0501046_0452392 3300049580 Bacteria 923
1130 Ga0501047_0059931 3300049581 Bacteria 3675
1131 Ga0501048_0005490 3300049582 Bacteria 9648
1132 Ga0501048_0010054 3300049582 Bacteria 7078
1133 Ga0501048_0018347 3300049582 Bacteria 5147
1134 Ga0501048_0020044 3300049582 Bacteria 4905
1135 Ga0501048_0027629 3300049582 Bacteria 4121
1136 Ga0501048_0040217 3300049582 Bacteria 3351
1137 Ga0501048_0082022 3300049582 Bacteria 2275
1138 Ga0501048_0088093 3300049582 Bacteria 2189
1139 Ga0501048_0199860 3300049582 Bacteria 1417
1140 Ga0501048_0886166 3300049582 Bacteria 642
1141 Ga0501067_0017522 3300049583 Bacteria 3963
1142 Ga0501067_0033688 3300049583 Bacteria 2842
1143 Ga0501067_0069600 3300049583 Bacteria 1948
1144 Ga0501067_0159117 3300049583 Bacteria 1258
1145 Ga0501067_0371212 3300049583 Bacteria 798
1146 Ga0501068_0002833 3300049584 Bacteria 9220
1147 Ga0501068_0011161 3300049584 Bacteria 5063
1148 Ga0501068_0025298 3300049584 Bacteria 3491
1149 Ga0501068_0074919 3300049584 Bacteria 2069
1150 Ga0501068_0087845 3300049584 Bacteria 1915
1151 Ga0501068_0146038 3300049584 Bacteria 1485
1152 Ga0501068_0158516 3300049584 Unclassified 1426
1153 Ga0501068_0166673 3300049584 Unclassified 1389
1154 Ga0501068_0663803 3300049584 Unclassified 681
1155 Ga0501069_0006210 3300049585 Bacteria 6243
1156 Ga0501069_0008405 3300049585 Bacteria 5424
1157 Ga0501069_0036976 3300049585 Bacteria 2693
1158 Ga0501069_0087433 3300049585 Bacteria 1761
1159 Ga0501069_0261008 3300049585 Bacteria 1011
1160 Ga0501069_0350832 3300049585 Unclassified 870
1161 Ga0501070_0034601 3300049586 Bacteria 4222
1162 Ga0501070_0034789 3300049586 Bacteria 4211
1163 Ga0501070_0067314 3300049586 Bacteria 2966
1164 Ga0501070_0084819 3300049586 Bacteria 2622
1165 Ga0501070_0144855 3300049586 Bacteria 1961
1166 Ga0501070_0382551 3300049586 Unclassified 1140
1167 Ga0501071_0001222 3300049587 Bacteria 14517
1168 Ga0501071_0007933 3300049587 Bacteria 7003
1169 Ga0501071_0008106 3300049587 Bacteria 6928
1170 Ga0501071_0017269 3300049587 Bacteria 4973
1171 Ga0501071_0027969 3300049587 Bacteria 3969
1172 Ga0501071_0041871 3300049587 Bacteria 3280
1173 Ga0501071_0043958 3300049587 Bacteria 3204
1174 Ga0501071_0099193 3300049587 Bacteria 2146
1175 Ga0501071_0135226 3300049587 Bacteria 1834
1176 Ga0501071_0186491 3300049587 Bacteria 1555
1177 Ga0501071_0537290 3300049587 Bacteria 897
1178 Ga0501072_0002909 3300049588 Bacteria 12886
1179 Ga0501072_0007444 3300049588 Bacteria 8305
1180 Ga0501072_0012523 3300049588 Bacteria 6485
1181 Ga0501072_0013557 3300049588 Bacteria 6238
1182 Ga0501072_0022877 3300049588 Bacteria 4851
1183 Ga0501072_0029825 3300049588 Bacteria 4262
1184 Ga0501072_0032618 3300049588 Bacteria 4080
1185 Ga0501072_0047280 3300049588 Bacteria 3389
1186 Ga0501072_0081119 3300049588 Bacteria 2571
1187 Ga0501072_0087746 3300049588 Bacteria 2469
1188 Ga0501072_0183734 3300049588 Bacteria 1668
1189 Ga0501072_0274357 3300049588 Bacteria 1341
1190 Ga0501072_0442177 3300049588 Bacteria 1030
1191 Ga0501072_0598439 3300049588 Unclassified 869
1192 Ga0501073_0015734 3300049589 Bacteria 5482
1193 Ga0501073_0176056 3300049589 Unclassified 1481
1194 Ga0501073_0206829 3300049589 Bacteria 1356
1195 Ga0501073_0215685 3300049589 Bacteria 1326
1196 Ga0501074_0009783 3300049590 Bacteria 6963
1197 Ga0501074_0017414 3300049590 Bacteria 5213
1198 Ga0501074_0017426 3300049590 Bacteria 5211
1199 Ga0501074_0037578 3300049590 Bacteria 3509
1200 Ga0501074_0053639 3300049590 Bacteria 2908
1201 Ga0501074_0077651 3300049590 Bacteria 2383
1202 Ga0501074_0077832 3300049590 Bacteria 2380
1203 Ga0501074_0156578 3300049590 Bacteria 1627
1204 Ga0501074_0424496 3300049590 Bacteria 943
1205 Ga0501075_0004323 3300049591 Bacteria 9611
1206 Ga0501075_0007446 3300049591 Bacteria 7591
1207 Ga0501075_0017350 3300049591 Bacteria 5200
1208 Ga0501075_0024684 3300049591 Bacteria 4412
1209 Ga0501075_0031404 3300049591 Bacteria 3942
1210 Ga0501075_0035983 3300049591 Bacteria 3693
1211 Ga0501075_0036130 3300049591 Bacteria 3687
1212 Ga0501075_0056586 3300049591 Bacteria 2952
1213 Ga0501075_0067573 3300049591 Bacteria 2699
1214 Ga0501075_0077248 3300049591 Bacteria 2519
1215 Ga0501075_0102421 3300049591 Bacteria 2174
1216 Ga0501075_0176748 3300049591 Bacteria 1629
1217 Ga0501075_0321961 3300049591 Bacteria 1178
1218 Ga0501076_0004640 3300049592 Bacteria 9791
1219 Ga0501076_0004835 3300049592 Bacteria 9614
1220 Ga0501076_0009425 3300049592 Bacteria 7209
1221 Ga0501076_0010541 3300049592 Bacteria 6860
1222 Ga0501076_0020907 3300049592 Bacteria 5012
1223 Ga0501076_0033507 3300049592 Bacteria 4010
1224 Ga0501076_0041591 3300049592 Bacteria 3616
1225 Ga0501076_0050510 3300049592 Bacteria 3290
1226 Ga0501076_0199330 3300049592 Bacteria 1634
1227 Ga0501076_0421629 3300049592 Bacteria 1098
1228 Ga0501076_0630999 3300049592 Bacteria 884
1229 Ga0501077_0002287 3300049593 Bacteria 11537
1230 Ga0501077_0004462 3300049593 Bacteria 8501
1231 Ga0501077_0005011 3300049593 Bacteria 8032
1232 Ga0501077_0005140 3300049593 Bacteria 7947
1233 Ga0501077_0019388 3300049593 Bacteria 4302
1234 Ga0501077_0042015 3300049593 Bacteria 2909
1235 Ga0501077_0060235 3300049593 Bacteria 2409
1236 Ga0501077_0085210 3300049593 Bacteria 2003
1237 Ga0501077_0111123 3300049593 Bacteria 1737
1238 Ga0501077_0114179 3300049593 Bacteria 1712
1239 Ga0501077_0172829 3300049593 Unclassified 1373
1240 Ga0501077_0201839 3300049593 Bacteria 1263
1241 Ga0501077_0229083 3300049593 Bacteria 1181
1242 Ga0501077_0370348 3300049593 Unclassified 915
1243 Ga0501079_0004606 3300049741 Bacteria 10220
1244 Ga0501079_0017281 3300049741 Bacteria 5507
1245 Ga0501079_0017486 3300049741 Bacteria 5475
1246 Ga0501079_0030219 3300049741 Bacteria 4163
1247 Ga0501079_0044340 3300049741 Bacteria 3432
1248 Ga0501079_0070889 3300049741 Bacteria 2692
1249 Ga0501079_0091120 3300049741 Bacteria 2362
1250 Ga0501079_0094641 3300049741 Bacteria 2314
1251 Ga0501079_0135359 3300049741 Bacteria 1918
1252 Ga0501079_0149075 3300049741 Bacteria 1823
1253 Ga0501079_0810685 3300049741 Unclassified 737
1254 Ga0501080_0004371 3300049742 Bacteria 12551
1255 Ga0501080_0008354 3300049742 Bacteria 9374
1256 Ga0501080_0009822 3300049742 Bacteria 8745
1257 Ga0501080_0034876 3300049742 Bacteria 4699
1258 Ga0501080_0049787 3300049742 Bacteria 3900
1259 Ga0501080_0093327 3300049742 Bacteria 2795
1260 Ga0501080_0100386 3300049742 Bacteria 2685
1261 Ga0501080_0275579 3300049742 Bacteria 1530
1262 Ga0501080_1210110 3300049742 Unclassified 649
1263 Ga0501081_0000907 3300049743 Bacteria 17610
1264 Ga0501081_0005947 3300049743 Bacteria 7898
1265 Ga0501081_0008500 3300049743 Bacteria 6671
1266 Ga0501081_0014132 3300049743 Bacteria 5260
1267 Ga0501081_0020761 3300049743 Bacteria 4380
1268 Ga0501081_0059912 3300049743 Bacteria 2636
1269 Ga0501081_0114986 3300049743 Bacteria 1912
1270 Ga0501081_0166026 3300049743 Bacteria 1592
1271 Ga0501081_0183423 3300049743 Bacteria 1514
1272 Ga0501081_0263379 3300049743 Bacteria 1260
1273 Ga0501081_0328851 3300049743 Bacteria 1124
1274 Ga0501081_0484170 3300049743 Bacteria 921
1275 Ga0501081_0640075 3300049743 Bacteria 797
1276 Ga0501083_0008763 3300049744 Bacteria 7137
1277 Ga0501083_0033968 3300049744 Bacteria 3489
1278 Ga0501083_0040888 3300049744 Bacteria 3146
1279 Ga0501083_0046993 3300049744 Bacteria 2918
1280 Ga0501083_0149130 3300049744 Unclassified 1531
1281 Ga0501083_0430690 3300049744 Bacteria 858
1282 Ga0501035_0011545 3300049822 Bacteria 8187
1283 Ga0501035_0018184 3300049822 Bacteria 6473
1284 Ga0501035_0043900 3300049822 Bacteria 4027
1285 Ga0501035_0049784 3300049822 Bacteria 3755
1286 Ga0501035_0091308 3300049822 Bacteria 2680
1287 Ga0501035_0141660 3300049822 Bacteria 2090
1288 Ga0501044_0044646 3300049823 Bacteria 4598
1289 Ga0501044_0151927 3300049823 Bacteria 2297
1290 Ga0501044_0247555 3300049823 Bacteria 1725
1291 Ga0501044_0490875 3300049823 Bacteria 1130
1292 Ga0501044_1018948 3300049823 Bacteria 699
1293 Ga0501045_0004691 3300049824 Bacteria 9439
1294 Ga0501045_0006079 3300049824 Bacteria 8361
1295 Ga0501045_0010957 3300049824 Bacteria 6350
1296 Ga0501045_0011834 3300049824 Bacteria 6130
1297 Ga0501045_0017791 3300049824 Bacteria 5047
1298 Ga0501045_0018358 3300049824 Bacteria 4975
1299 Ga0501045_0030595 3300049824 Bacteria 3897
1300 Ga0501045_0030626 3300049824 Bacteria 3895
1301 Ga0501045_0090267 3300049824 Bacteria 2264
1302 Ga0501045_0120845 3300049824 Bacteria 1945
1303 Ga0501045_1242579 3300049824 Bacteria 543
1304 nmdc:mga03n38_105438_c2 3300050490 Bacteria 989
1305 nmdc:mga03n38_137162_c2 3300050490 Bacteria 698
1306 nmdc:mga00v17_8060_c1 3300050491 Bacteria 5655
1307 nmdc:mga0yw44_19307_c1 3300050492 Bacteria 3756
1308 nmdc:mga0yw44_801467_c1 3300050492 Bacteria 640
1309 nmdc:mga05p37_152772_c1 3300050507 Bacteria 2823
1310 nmdc:mga05p37_156715_c1 3300050507 Bacteria 2782
1311 nmdc:mga05p37_191441_c1 3300050507 Bacteria 2293
1312 nmdc:mga05p37_233945_c1 3300050507 Bacteria 2213
1313 nmdc:mga05p37_273727_c1 3300050507 Bacteria 2016
1314 nmdc:mga05p37_327041_c1 3300050507 Bacteria 1812
1315 nmdc:mga05p37_36848_c1 3300050507 Bacteria 5999
1316 nmdc:mga05p37_51270_c1 3300050507 Bacteria 5075
1317 nmdc:mga05p37_5520_c1 3300050507 Bacteria 14853
1318 nmdc:mga05p37_72895_c1 3300050507 Bacteria 4226
1319 nmdc:mga05p37_901944_c1 3300050507 Bacteria 953
1320 nmdc:mga05p37_9884_c1 3300050507 Bacteria 11320
1321 nmdc:mga09592_11925_c1 3300050508 Bacteria 7071
1322 nmdc:mga09592_312262_c1 3300050508 Bacteria 1362
1323 nmdc:mga09592_473343_c1 3300050508 Bacteria 1080
1324 nmdc:mga0qj67_12271_c1 3300050509 Bacteria 6454
1325 nmdc:mga0qj67_512245_c1 3300050509 Bacteria 964
1326 nmdc:mga06r32_209711_c1 3300050510 Bacteria 1936
1327 nmdc:mga06r32_60278_c1 3300050510 Bacteria 3652
1328 nmdc:mga08y16_1146260_c1 3300050511 Bacteria 750
1329 nmdc:mga08y16_115410_c1 3300050511 Bacteria 2796
1330 nmdc:mga08y16_165444_c1 3300050511 Bacteria 2298
1331 nmdc:mga08y16_205539_c1 3300050511 Bacteria 2040
1332 nmdc:mga08y16_20885_c1 3300050511 Bacteria 6914
1333 nmdc:mga08y16_313818_c1 3300050511 Bacteria 1615
1334 nmdc:mga08y16_434331_c1 3300050511 Bacteria 1341
1335 nmdc:mga08y16_785691_c1 3300050511 Bacteria 946
1336 nmdc:mga08y16_8054_c1 3300050511 Bacteria 11028
1337 nmdc:mga0n895_128378_c1 3300050512 Bacteria 2560
1338 nmdc:mga0n895_439485_c1 3300050512 Bacteria 1318
1339 nmdc:mga0n895_503432_c1 3300050512 Bacteria 1220
1340 nmdc:mga0n895_81501_c1 3300050512 Bacteria 3225
1341 nmdc:mga0rr50_10436_c1 3300050513 Bacteria 5892
1342 nmdc:mga0rr50_164191_c1 3300050513 Bacteria 1805
1343 nmdc:mga0rr50_168745_c1 3300050513 Bacteria 1782
1344 nmdc:mga0rr50_444420_c1 3300050513 Bacteria 1099
1345 nmdc:mga0rr50_585328_c1 3300050513 Bacteria 951
1346 nmdc:mga0rr50_820176_c1 3300050513 Unclassified 794
1347 nmdc:mga08x19_131519_c1 3300050514 Bacteria 1684
1348 nmdc:mga08x19_150706_c1 3300050514 Bacteria 1575
1349 nmdc:mga08x19_459621_c1 3300050514 Bacteria 896
1350 nmdc:mga08x19_50799_c1 3300050514 Bacteria 2661
1351 nmdc:mga0a205_101561_c1 3300050515 Bacteria 2775
1352 nmdc:mga0a205_121816_c1 3300050515 Bacteria 2508
1353 nmdc:mga0a205_141762_c1 3300050515 Bacteria 2303
1354 nmdc:mga0a205_19494_c1 3300050515 Bacteria 6396
1355 Ga0495601_0015979 3300053077 Bacteria 4542
1356 Ga0495601_0211602 3300053077 Unclassified 1267
1357 Ga0495595_0031868 3300053084 Bacteria 2371
1358 Ga0495619_0082552 3300053085 Bacteria 2166
1359 Ga0501084_0000144 3300054114 Bacteria 54020
1360 Ga0501084_0022872 3300054114 Bacteria 5216
1361 Ga0501084_0025544 3300054114 Bacteria 4927
1362 Ga0501084_0034741 3300054114 Bacteria 4215
1363 Ga0501084_0061331 3300054114 Bacteria 3148
1364 Ga0501084_0102175 3300054114 Bacteria 2407
1365 Ga0501084_0115603 3300054114 Bacteria 2255
1366 Ga0501084_0117270 3300054114 Bacteria 2238
1367 Ga0501084_0159718 3300054114 Bacteria 1901
1368 Ga0501084_0303231 3300054114 Bacteria 1349
1369 Ga0501084_0362611 3300054114 Bacteria 1225
1370 Ga0501084_0398675 3300054114 Bacteria 1163
1371 Ga0501084_0448605 3300054114 Bacteria 1091
1372 Ga0501084_0685974 3300054114 Unclassified 864
1373 Ga0501084_1216528 3300054114 Bacteria 632
1374 Ga0590077_008075 3300059426 Bacteria 2156
1375 Ga0501082_0003635 3300060353 Bacteria 13473
1376 Ga0501082_0007343 3300060353 Bacteria 9508
1377 Ga0501082_0038330 3300060353 Bacteria 4134
1378 Ga0501082_0050993 3300060353 Bacteria 3567
1379 Ga0501082_0062138 3300060353 Bacteria 3214
1380 Ga0501082_0165282 3300060353 Bacteria 1923
1381 Ga0501082_0222201 3300060353 Unclassified 1643
1382 Ga0501082_0285212 3300060353 Bacteria 1437
1383 Ga0501082_0393686 3300060353 Bacteria 1209
1384 Ga0501082_0485552 3300060353 Bacteria 1080
1385 Ga0501082_0499509 3300060353 Unclassified 1063
1386 Ga0501082_0549006 3300060353 Unclassified 1011
1387 Ga0501082_0769365 3300060353 Bacteria 843
1388 Ga0501082_1296292 3300060353 Bacteria 636
1389 Ga0530510_0004416 3300061734 Bacteria 9736
1390 Ga0530510_0006550 3300061734 Bacteria 8113
1391 Ga0530510_0008034 3300061734 Bacteria 7361
1392 Ga0530510_0037591 3300061734 Bacteria 3493
1393 Ga0530510_0044430 3300061734 Bacteria 3210
1394 Ga0530510_0076539 3300061734 Bacteria 2431
1395 Ga0530510_0144804 3300061734 Bacteria 1752
1396 Ga0530510_0507264 3300061734 Bacteria 914
1397 Ga0530510_0698804 3300061734 Bacteria 773
1398 Ga0530510_0780611 3300061734 Unclassified 729

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0836402 Ga0395898_0836402_201_674 157
2 3300038443 Ga0395901_0011601 Ga0395901_0011601_3332_3805 157
3 3300042118 Ga0450914_012474 Ga0450914_012474_339_812 157
4 3300046533 Ga0495640_0377981 Ga0495640_0377981_12_485 157
5 3300048912 Ga0496109_1098729 Ga0496109_1098729_238_711 157
6 3300048917 Ga0496114_1764814 Ga0496114_1764814_19_492 157
7 3300049578 Ga0501042_0842358 Ga0501042_0842358_26_499 157
8 3300049585 Ga0501069_0087433 Ga0501069_0087433_1267_1749 160
9 3300049824 Ga0501045_1242579 Ga0501045_1242579_20_505 161
10 3300048904 Ga0496101_0243481 Ga0496101_0243481_715_1203 162
11 3300046537 Ga0495598_0343828 Ga0495598_0343828_34_546 170
12 3300046648 Ga0495611_0252844 Ga0495611_0252844_268_780 170
13 3300046794 Ga0495589_0341787 Ga0495589_0341787_148_660 170
14 3300046794 Ga0495589_0412974 Ga0495589_0412974_74_586 170
15 3300025910 Ga0207684_10153852 Ga0207684_101538523 171
16 3300035170 Ga0373943_0289159 Ga0373943_0289159_34_549 171
17 3300046517 Ga0495630_0010068 Ga0495630_0010068_5845_6360 171
18 3300046523 Ga0495644_0231059 Ga0495644_0231059_20_535 171
19 3300009177 Ga0105248_10283016 Ga0105248_102830162 172
20 3300014326 Ga0157380_11448590 Ga0157380_114485902 172
21 3300025910 Ga0207684_10767414 Ga0207684_107674142 172
22 3300025927 Ga0207687_10338024 Ga0207687_103380241 172
23 3300034817 Ga0373948_0000639 Ga0373948_0000639_2022_2540 172
24 3300034818 Ga0373950_0008031 Ga0373950_0008031_740_1258 172
25 3300034819 Ga0373958_0002939 Ga0373958_0002939_1428_1946 172
26 3300034820 Ga0373959_0002675 Ga0373959_0002675_474_992 172
27 3300034957 Ga0373938_0001421 Ga0373938_0001421_1071_1589 172
28 3300035084 Ga0373928_0001412 Ga0373928_0001412_1908_2426 172
29 3300035085 Ga0373929_0002216 Ga0373929_0002216_1319_1837 172
30 3300035088 Ga0373940_0005175 Ga0373940_0005175_798_1316 172
31 3300035090 Ga0373949_0001071 Ga0373949_0001071_5071_5589 172
32 3300035091 Ga0373951_0006145 Ga0373951_0006145_2060_2578 172
33 3300035092 Ga0373952_0005981 Ga0373952_0005981_1498_2016 172
34 3300035112 Ga0373932_0003703 Ga0373932_0003703_1555_2073 172
35 3300035114 Ga0373939_0105214 Ga0373939_0105214_260_778 172
36 3300035115 Ga0373941_0018408 Ga0373941_0018408_442_960 172
37 3300035121 Ga0373960_0054343 Ga0373960_0054343_549_1067 172
38 3300035207 Ga0373942_0004537 Ga0373942_0004537_516_1034 172
39 3300035241 Ga0373961_0008386 Ga0373961_0008386_288_806 172
40 3300035242 Ga0373962_0000515 Ga0373962_0000515_6660_7178 172
41 3300035691 Ga0373931_0005933 Ga0373931_0005933_310_828 172
42 3300039438 Ga0436360_0539564 Ga0436360_0539564_29_550 172
43 3300048903 Ga0496100_0036997 Ga0496100_0036997_342_860 172
44 3300048904 Ga0496101_0019404 Ga0496101_0019404_2096_2614 172
45 3300048906 Ga0496103_0012797 Ga0496103_0012797_1022_1540 172
46 3300048907 Ga0496104_0085506 Ga0496104_0085506_1971_2489 172
47 3300048908 Ga0496105_0010819 Ga0496105_0010819_5115_5633 172
48 3300048909 Ga0496106_0002316 Ga0496106_0002316_8305_8823 172
49 3300048910 Ga0496107_0048266 Ga0496107_0048266_1022_1540 172
50 3300048912 Ga0496109_1568166 Ga0496109_1568166_33_551 172
51 3300048913 Ga0496110_0076284 Ga0496110_0076284_796_1314 172
52 3300048914 Ga0496111_0050435 Ga0496111_0050435_750_1268 172
53 3300048915 Ga0496112_0120324 Ga0496112_0120324_213_731 172
54 3300048916 Ga0496113_0564380 Ga0496113_0564380_182_700 172
55 3300048917 Ga0496114_0019981 Ga0496114_0019981_3203_3721 172
56 3300048917 Ga0496114_0158726 Ga0496114_0158726_1369_1887 172
57 3300048918 Ga0496115_0013675 Ga0496115_0013675_1178_1696 172
58 3300049570 Ga0501033_0037662 Ga0501033_0037662_471_1040 172
59 3300049572 Ga0501036_0045195 Ga0501036_0045195_584_1153 172
60 3300049574 Ga0501038_0011133 Ga0501038_0011133_7456_8025 172
61 3300049575 Ga0501039_0031924 Ga0501039_0031924_2570_3139 172
62 3300049577 Ga0501041_0020649 Ga0501041_0020649_3371_3925 172
63 3300049578 Ga0501042_0013240 Ga0501042_0013240_2465_3034 172
64 3300049584 Ga0501068_0074919 Ga0501068_0074919_1114_1683 172
65 3300049585 Ga0501069_0036976 Ga0501069_0036976_15_569 172
66 3300049588 Ga0501072_0029825 Ga0501072_0029825_2580_3149 172
67 3300049589 Ga0501073_0015734 Ga0501073_0015734_2936_3505 172
68 3300049592 Ga0501076_0033507 Ga0501076_0033507_317_886 172
69 3300049742 Ga0501080_1210110 Ga0501080_1210110_14_532 172
70 3300050507 nmdc:mga05p37_191441_c1 nmdc:mga05p37_191441_c1_1723_2241 172
71 3300050513 nmdc:mga0rr50_168745_c1 nmdc:mga0rr50_168745_c1_243_761 172
72 3300050514 nmdc:mga08x19_150706_c1 nmdc:mga08x19_150706_c1_595_1113 172
73 3300050515 nmdc:mga0a205_101561_c1 nmdc:mga0a205_101561_c1_2102_2620 172
74 3300060353 Ga0501082_0499509 Ga0501082_0499509_20_538 172
75 3300060353 Ga0501082_1296292 Ga0501082_1296292_101_619 172
76 3300049583 Ga0501067_0017522 Ga0501067_0017522_1803_2339 175
77 3300049583 Ga0501067_0069600 Ga0501067_0069600_853_1389 175
78 3300049583 Ga0501067_0159117 Ga0501067_0159117_551_1087 175
79 3300049584 Ga0501068_0011161 Ga0501068_0011161_4195_4731 175
80 3300049585 Ga0501069_0008405 Ga0501069_0008405_2038_2574 175
81 3300061734 Ga0530510_0008034 Ga0530510_0008034_3524_4060 175
82 3300005439 Ga0070711_100403877 Ga0070711_1004038772 176
83 3300006175 Ga0070712_100071365 Ga0070712_1000713651 176
84 3300007076 Ga0075435_100399976 Ga0075435_1003999762 176
85 3300009147 Ga0114129_10498457 Ga0114129_104984573 176
86 3300025915 Ga0207693_10011308 Ga0207693_100113088 176
87 3300025916 Ga0207663_10315221 Ga0207663_103152212 176
88 3300050507 nmdc:mga05p37_901944_c1 nmdc:mga05p37_901944_c1_256_807 176
89 3300061734 Ga0530510_0698804 Ga0530510_0698804_47_577 176
90 3300005330 Ga0070690_100201205 Ga0070690_1002012052 177
91 3300005337 Ga0070682_100019293 Ga0070682_1000192933 177
92 3300005338 Ga0068868_100172653 Ga0068868_1001726532 177
93 3300005339 Ga0070660_100312081 Ga0070660_1003120812 177
94 3300005341 Ga0070691_10292857 Ga0070691_102928572 177
95 3300005345 Ga0070692_10315986 Ga0070692_103159861 177
96 3300005353 Ga0070669_100216478 Ga0070669_1002164782 177
97 3300005354 Ga0070675_100411638 Ga0070675_1004116382 177
98 3300005355 Ga0070671_100547480 Ga0070671_1005474802 177
99 3300005356 Ga0070674_100013343 Ga0070674_1000133434 177
100 3300005365 Ga0070688_100112567 Ga0070688_1001125672 177
101 3300005366 Ga0070659_100044838 Ga0070659_1000448383 177
102 3300005367 Ga0070667_100212832 Ga0070667_1002128322 177
103 3300005434 Ga0070709_10100983 Ga0070709_101009832 177
104 3300005436 Ga0070713_100119999 Ga0070713_1001199991 177
105 3300005437 Ga0070710_10010488 Ga0070710_100104883 177
106 3300005438 Ga0070701_10144113 Ga0070701_101441132 177
107 3300005438 Ga0070701_10476374 Ga0070701_104763742 177
108 3300005439 Ga0070711_100192773 Ga0070711_1001927732 177
109 3300005440 Ga0070705_100228218 Ga0070705_1002282182 177
110 3300005441 Ga0070700_100124681 Ga0070700_1001246812 177
111 3300005444 Ga0070694_100154282 Ga0070694_1001542822 177
112 3300005445 Ga0070708_100166717 Ga0070708_1001667173 177
113 3300005455 Ga0070663_100090856 Ga0070663_1000908562 177
114 3300005456 Ga0070678_100276993 Ga0070678_1002769932 177
115 3300005456 Ga0070678_101123791 Ga0070678_1011237911 177
116 3300005458 Ga0070681_10901306 Ga0070681_109013062 177
117 3300005459 Ga0068867_100117199 Ga0068867_1001171992 177
118 3300005467 Ga0070706_100277939 Ga0070706_1002779392 177
119 3300005468 Ga0070707_100001795 Ga0070707_1000017959 177
120 3300005468 Ga0070707_100027973 Ga0070707_1000279734 177
121 3300005468 Ga0070707_100052307 Ga0070707_1000523073 177
122 3300005468 Ga0070707_100105121 Ga0070707_1001051212 177
123 3300005471 Ga0070698_100001447 Ga0070698_10000144727 177
124 3300005471 Ga0070698_100069427 Ga0070698_1000694272 177
125 3300005471 Ga0070698_100143089 Ga0070698_1001430892 177
126 3300005518 Ga0070699_100011630 Ga0070699_1000116302 177
127 3300005518 Ga0070699_100885596 Ga0070699_1008855961 177
128 3300005536 Ga0070697_100614787 Ga0070697_1006147872 177
129 3300005543 Ga0070672_100027902 Ga0070672_1000279022 177
130 3300005543 Ga0070672_100695546 Ga0070672_1006955462 177
131 3300005546 Ga0070696_100008087 Ga0070696_1000080876 177
132 3300005547 Ga0070693_100335202 Ga0070693_1003352022 177
133 3300005549 Ga0070704_100066632 Ga0070704_1000666322 177
134 3300005549 Ga0070704_100478592 Ga0070704_1004785922 177
135 3300005614 Ga0068856_100060971 Ga0068856_1000609712 177
136 3300005614 Ga0068856_100378939 Ga0068856_1003789392 177
137 3300005615 Ga0070702_100098532 Ga0070702_1000985322 177
138 3300005615 Ga0070702_100563312 Ga0070702_1005633122 177
139 3300005617 Ga0068859_100165112 Ga0068859_1001651121 177
140 3300005718 Ga0068866_10016416 Ga0068866_100164163 177
141 3300005719 Ga0068861_100223812 Ga0068861_1002238122 177
142 3300005842 Ga0068858_100591218 Ga0068858_1005912182 177
143 3300005843 Ga0068860_100294452 Ga0068860_1002944522 177
144 3300005981 Ga0081538_10174544 Ga0081538_101745442 177
145 3300005985 Ga0081539_10034389 Ga0081539_100343892 177
146 3300006028 Ga0070717_10182961 Ga0070717_101829613 177
147 3300006028 Ga0070717_10304675 Ga0070717_103046751 177
148 3300006048 Ga0075363_100266330 Ga0075363_1002663302 177
149 3300006058 Ga0075432_10029232 Ga0075432_100292322 177
150 3300006175 Ga0070712_100088451 Ga0070712_1000884512 177
151 3300006358 Ga0068871_100021944 Ga0068871_1000219443 177
152 3300006844 Ga0075428_100276188 Ga0075428_1002761882 177
153 3300006846 Ga0075430_100504086 Ga0075430_1005040862 177
154 3300006847 Ga0075431_100054840 Ga0075431_1000548405 177
155 3300006847 Ga0075431_100199140 Ga0075431_1001991402 177
156 3300006852 Ga0075433_10022107 Ga0075433_100221073 177
157 3300006871 Ga0075434_100776791 Ga0075434_1007767912 177
158 3300006880 Ga0075429_100340482 Ga0075429_1003404822 177
159 3300006881 Ga0068865_100012037 Ga0068865_1000120372 177
160 3300006914 Ga0075436_100008241 Ga0075436_1000082413 177
161 3300006931 Ga0097620_100165112 Ga0097620_1001651122 177
162 3300007076 Ga0075435_100000503 Ga0075435_1000005039 177
163 3300009094 Ga0111539_10215472 Ga0111539_102154723 177
164 3300009098 Ga0105245_10004320 Ga0105245_100043208 177
165 3300009098 Ga0105245_10404064 Ga0105245_104040642 177
166 3300009098 Ga0105245_10434033 Ga0105245_104340332 177
167 3300009101 Ga0105247_10191178 Ga0105247_101911781 177
168 3300009147 Ga0114129_10004322 Ga0114129_1000432213 177
169 3300009147 Ga0114129_10306131 Ga0114129_103061312 177
170 3300009147 Ga0114129_10962794 Ga0114129_109627942 177
171 3300009147 Ga0114129_12140019 Ga0114129_121400191 177
172 3300009148 Ga0105243_10086679 Ga0105243_100866792 177
173 3300009148 Ga0105243_10807082 Ga0105243_108070822 177
174 3300009148 Ga0105243_11220118 Ga0105243_112201182 177
175 3300009174 Ga0105241_10007928 Ga0105241_100079282 177
176 3300009176 Ga0105242_10154684 Ga0105242_101546842 177
177 3300009176 Ga0105242_10158271 Ga0105242_101582712 177
178 3300009176 Ga0105242_10841664 Ga0105242_108416642 177
179 3300009177 Ga0105248_10357604 Ga0105248_103576042 177
180 3300009177 Ga0105248_11952868 Ga0105248_119528681 177
181 3300009553 Ga0105249_10304505 Ga0105249_103045052 177
182 3300010375 Ga0105239_10281572 Ga0105239_102815722 177
183 3300013296 Ga0157374_10048435 Ga0157374_100484354 177
184 3300013297 Ga0157378_11104973 Ga0157378_111049732 177
185 3300013306 Ga0163162_10019305 Ga0163162_100193055 177
186 3300013308 Ga0157375_10007198 Ga0157375_100071989 177
187 3300014325 Ga0163163_10791967 Ga0163163_107919672 177
188 3300014326 Ga0157380_10060279 Ga0157380_100602792 177
189 3300014745 Ga0157377_10009150 Ga0157377_100091503 177
190 3300014969 Ga0157376_10065611 Ga0157376_100656113 177
191 3300014969 Ga0157376_10317768 Ga0157376_103177682 177
192 3300017792 Ga0163161_10158949 Ga0163161_101589492 177
193 3300025898 Ga0207692_10009830 Ga0207692_100098303 177
194 3300025898 Ga0207692_10604370 Ga0207692_106043702 177
195 3300025899 Ga0207642_10010621 Ga0207642_100106212 177
196 3300025903 Ga0207680_10050837 Ga0207680_100508372 177
197 3300025904 Ga0207647_10100639 Ga0207647_101006392 177
198 3300025906 Ga0207699_10506069 Ga0207699_105060691 177
199 3300025910 Ga0207684_10241163 Ga0207684_102411632 177
200 3300025912 Ga0207707_10379811 Ga0207707_103798112 177
201 3300025915 Ga0207693_10005105 Ga0207693_100051058 177
202 3300025918 Ga0207662_10025648 Ga0207662_100256484 177
203 3300025922 Ga0207646_10001294 Ga0207646_1000129423 177
204 3300025922 Ga0207646_10044646 Ga0207646_100446463 177
205 3300025922 Ga0207646_10278584 Ga0207646_102785842 177
206 3300025927 Ga0207687_10241800 Ga0207687_102418002 177
207 3300025927 Ga0207687_10485231 Ga0207687_104852312 177
208 3300025928 Ga0207700_10364956 Ga0207700_103649561 177
209 3300025931 Ga0207644_10102965 Ga0207644_101029651 177
210 3300025932 Ga0207690_10406643 Ga0207690_104066432 177
211 3300025935 Ga0207709_10011798 Ga0207709_100117982 177
212 3300025935 Ga0207709_10698286 Ga0207709_106982861 177
213 3300025937 Ga0207669_10031854 Ga0207669_100318542 177
214 3300025938 Ga0207704_10168067 Ga0207704_101680672 177
215 3300025938 Ga0207704_10498534 Ga0207704_104985341 177
216 3300025940 Ga0207691_10012051 Ga0207691_100120516 177
217 3300025940 Ga0207691_10601781 Ga0207691_106017812 177
218 3300025941 Ga0207711_10095239 Ga0207711_100952393 177
219 3300025972 Ga0207668_10325467 Ga0207668_103254672 177
220 3300025986 Ga0207658_10051180 Ga0207658_100511803 177
221 3300026023 Ga0207677_10143069 Ga0207677_101430692 177
222 3300026041 Ga0207639_10381890 Ga0207639_103818902 177
223 3300026067 Ga0207678_10038256 Ga0207678_100382564 177
224 3300026075 Ga0207708_10004621 Ga0207708_100046213 177
225 3300026078 Ga0207702_10335244 Ga0207702_103352442 177
226 3300026078 Ga0207702_10459723 Ga0207702_104597232 177
227 3300026089 Ga0207648_10000136 Ga0207648_1000013647 177
228 3300026118 Ga0207675_100174830 Ga0207675_1001748302 177
229 3300026121 Ga0207683_10050019 Ga0207683_100500192 177
230 3300026142 Ga0207698_10531650 Ga0207698_105316502 177
231 3300027907 Ga0207428_10649874 Ga0207428_106498741 177
232 3300028381 Ga0268264_10351043 Ga0268264_103510432 177
233 3300031903 Ga0307407_11040006 Ga0307407_110400061 177
234 3300032002 Ga0307416_100029222 Ga0307416_1000292224 177
235 3300035170 Ga0373943_0127025 Ga0373943_0127025_378_932 177
236 3300037312 Ga0395899_0010605 Ga0395899_0010605_3932_4486 177
237 3300037312 Ga0395899_0028406 Ga0395899_0028406_955_1509 177
238 3300037312 Ga0395899_0086805 Ga0395899_0086805_1486_2040 177
239 3300037312 Ga0395899_0146927 Ga0395899_0146927_361_915 177
240 3300037418 Ga0395900_0000847 Ga0395900_0000847_33161_33715 177
241 3300037418 Ga0395900_0001036 Ga0395900_0001036_10057_10611 177
242 3300037418 Ga0395900_0052889 Ga0395900_0052889_367_921 177
243 3300037418 Ga0395900_0055191 Ga0395900_0055191_1814_2368 177
244 3300037418 Ga0395900_0071636 Ga0395900_0071636_2437_2991 177
245 3300037418 Ga0395900_0980290 Ga0395900_0980290_194_748 177
246 3300037466 Ga0395898_0001318 Ga0395898_0001318_24414_24968 177
247 3300037466 Ga0395898_0002877 Ga0395898_0002877_12320_12874 177
248 3300037466 Ga0395898_0003008 Ga0395898_0003008_11976_12530 177
249 3300037466 Ga0395898_0028519 Ga0395898_0028519_2357_2911 177
250 3300037466 Ga0395898_0035668 Ga0395898_0035668_3699_4253 177
251 3300037466 Ga0395898_0069507 Ga0395898_0069507_1668_2222 177
252 3300037466 Ga0395898_0096403 Ga0395898_0096403_348_902 177
253 3300037466 Ga0395898_0190782 Ga0395898_0190782_126_680 177
254 3300037471 Ga0395905_0000636 Ga0395905_0000636_23253_23807 177
255 3300037471 Ga0395905_0005583 Ga0395905_0005583_7783_8337 177
256 3300037471 Ga0395905_0009466 Ga0395905_0009466_5970_6524 177
257 3300037471 Ga0395905_0034589 Ga0395905_0034589_457_1011 177
258 3300037471 Ga0395905_0062017 Ga0395905_0062017_2094_2648 177
259 3300037471 Ga0395905_0078344 Ga0395905_0078344_746_1300 177
260 3300037471 Ga0395905_1209549 Ga0395905_1209549_95_649 177
261 3300038443 Ga0395901_0000760 Ga0395901_0000760_30230_30784 177
262 3300038443 Ga0395901_0005724 Ga0395901_0005724_9141_9695 177
263 3300038443 Ga0395901_0008335 Ga0395901_0008335_5444_5998 177
264 3300038443 Ga0395901_0015432 Ga0395901_0015432_112_666 177
265 3300038443 Ga0395901_0022219 Ga0395901_0022219_2503_3057 177
266 3300038443 Ga0395901_0036250 Ga0395901_0036250_1962_2495 177
267 3300038443 Ga0395901_0073689 Ga0395901_0073689_2185_2739 177
268 3300038443 Ga0395901_0089840 Ga0395901_0089840_1821_2375 177
269 3300038443 Ga0395901_0473103 Ga0395901_0473103_368_901 177
270 3300038443 Ga0395901_1150579 Ga0395901_1150579_168_722 177
271 3300041512 Ga0451853_0314994 Ga0451853_0314994_13_567 177
272 3300041512 Ga0451853_0865558 Ga0451853_0865558_425_979 177
273 3300045976 Ga0466967_0954690 Ga0466967_0954690_225_776 177
274 3300046452 Ga0495617_086535 Ga0495617_086535_134_688 177
275 3300046459 Ga0495629_0192884 Ga0495629_0192884_34_588 177
276 3300046461 Ga0495641_0014033 Ga0495641_0014033_131_685 177
277 3300046472 Ga0495580_0137729 Ga0495580_0137729_408_962 177
278 3300046473 Ga0495582_0369320 Ga0495582_0369320_73_627 177
279 3300046474 Ga0495605_0097257 Ga0495605_0097257_753_1307 177
280 3300046491 Ga0495584_0019214 Ga0495584_0019214_1549_2103 177
281 3300046499 Ga0495594_0191491 Ga0495594_0191491_242_796 177
282 3300046500 Ga0495596_0100412 Ga0495596_0100412_546_1100 177
283 3300046501 Ga0495607_0264796 Ga0495607_0264796_180_734 177
284 3300046513 Ga0495616_0065717 Ga0495616_0065717_84_638 177
285 3300046518 Ga0495631_0106484 Ga0495631_0106484_68_622 177
286 3300046531 Ga0495665_0144804 Ga0495665_0144804_121_675 177
287 3300046537 Ga0495598_0047295 Ga0495598_0047295_124_678 177
288 3300046538 Ga0495609_0042950 Ga0495609_0042950_1256_1810 177
289 3300046538 Ga0495609_0169712 Ga0495609_0169712_191_781 177
290 3300046615 Ga0495656_0019427 Ga0495656_0019427_1784_2338 177
291 3300046616 Ga0495668_0499173 Ga0495668_0499173_68_622 177
292 3300046664 Ga0495659_0056777 Ga0495659_0056777_583_1137 177
293 3300046665 Ga0495661_0356668 Ga0495661_0356668_11_565 177
294 3300046674 Ga0495588_0105818 Ga0495588_0105818_522_1076 177
295 3300046674 Ga0495588_0247069 Ga0495588_0247069_263_817 177
296 3300046681 Ga0495647_0183028 Ga0495647_0183028_56_610 177
297 3300046691 Ga0495670_0121322 Ga0495670_0121322_739_1293 177
298 3300046692 Ga0495671_0122961 Ga0495671_0122961_307_861 177
299 3300046794 Ga0495589_0048071 Ga0495589_0048071_569_1123 177
300 3300046794 Ga0495589_0097567 Ga0495589_0097567_50_604 177
301 3300046794 Ga0495589_0326705 Ga0495589_0326705_31_585 177
302 3300047315 Ga0495581_0001189 Ga0495581_0001189_11628_12182 177
303 3300047315 Ga0495581_0360653 Ga0495581_0360653_191_745 177
304 3300047318 Ga0495636_0110951 Ga0495636_0110951_41_595 177
305 3300047321 Ga0495676_0052776 Ga0495676_0052776_944_1498 177
306 3300047321 Ga0495676_0290438 Ga0495676_0290438_130_684 177
307 3300048089 Ga0495614_0246913 Ga0495614_0246913_34_588 177
308 3300048903 Ga0496100_0009322 Ga0496100_0009322_552_1106 177
309 3300048904 Ga0496101_0054433 Ga0496101_0054433_78_632 177
310 3300048904 Ga0496101_0212438 Ga0496101_0212438_796_1350 177
311 3300048905 Ga0496102_0049638 Ga0496102_0049638_3148_3702 177
312 3300048905 Ga0496102_0361072 Ga0496102_0361072_97_651 177
313 3300048906 Ga0496103_0146771 Ga0496103_0146771_755_1309 177
314 3300048907 Ga0496104_0019949 Ga0496104_0019949_5002_5556 177
315 3300048907 Ga0496104_0252479 Ga0496104_0252479_682_1236 177
316 3300048907 Ga0496104_0394021 Ga0496104_0394021_505_1059 177
317 3300048908 Ga0496105_0007278 Ga0496105_0007278_4247_4801 177
318 3300048908 Ga0496105_0046475 Ga0496105_0046475_2026_2580 177
319 3300048910 Ga0496107_0270925 Ga0496107_0270925_371_925 177
320 3300048911 Ga0496108_0000998 Ga0496108_0000998_5045_5599 177
321 3300048911 Ga0496108_0022210 Ga0496108_0022210_1433_1987 177
322 3300048912 Ga0496109_0001842 Ga0496109_0001842_9727_10281 177
323 3300048912 Ga0496109_0011427 Ga0496109_0011427_822_1376 177
324 3300048912 Ga0496109_0139930 Ga0496109_0139930_1006_1560 177
325 3300048913 Ga0496110_0022265 Ga0496110_0022265_420_974 177
326 3300048913 Ga0496110_0201425 Ga0496110_0201425_525_1079 177
327 3300048913 Ga0496110_0727959 Ga0496110_0727959_82_636 177
328 3300048914 Ga0496111_0006340 Ga0496111_0006340_2396_2950 177
329 3300048914 Ga0496111_0013081 Ga0496111_0013081_4261_4815 177
330 3300048914 Ga0496111_0619435 Ga0496111_0619435_74_628 177
331 3300048915 Ga0496112_0010044 Ga0496112_0010044_3464_4018 177
332 3300048915 Ga0496112_0093922 Ga0496112_0093922_1274_1828 177
333 3300048915 Ga0496112_0145617 Ga0496112_0145617_233_787 177
334 3300048915 Ga0496112_0529067 Ga0496112_0529067_78_632 177
335 3300048916 Ga0496113_0022663 Ga0496113_0022663_2990_3544 177
336 3300048916 Ga0496113_0076319 Ga0496113_0076319_1849_2403 177
337 3300048917 Ga0496114_0014754 Ga0496114_0014754_1537_2091 177
338 3300048917 Ga0496114_0065454 Ga0496114_0065454_784_1338 177
339 3300048917 Ga0496114_0255085 Ga0496114_0255085_491_1045 177
340 3300048918 Ga0496115_0009424 Ga0496115_0009424_1843_2397 177
341 3300048918 Ga0496115_0303286 Ga0496115_0303286_98_652 177
342 3300049568 Ga0501031_0121490 Ga0501031_0121490_426_959 177
343 3300049568 Ga0501031_0526203 Ga0501031_0526203_138_671 177
344 3300049569 Ga0501032_0451787 Ga0501032_0451787_254_787 177
345 3300049570 Ga0501033_0045852 Ga0501033_0045852_119_652 177
346 3300049572 Ga0501036_0024729 Ga0501036_0024729_3566_4099 177
347 3300049573 Ga0501037_0014812 Ga0501037_0014812_2491_3024 177
348 3300049574 Ga0501038_0070967 Ga0501038_0070967_2307_2840 177
349 3300049575 Ga0501039_0110736 Ga0501039_0110736_858_1391 177
350 3300049575 Ga0501039_0572706 Ga0501039_0572706_185_718 177
351 3300049576 Ga0501040_0062429 Ga0501040_0062429_1235_1768 177
352 3300049577 Ga0501041_0001059 Ga0501041_0001059_13304_13837 177
353 3300049578 Ga0501042_0184585 Ga0501042_0184585_956_1489 177
354 3300049578 Ga0501042_0189661 Ga0501042_0189661_133_666 177
355 3300049579 Ga0501043_0048010 Ga0501043_0048010_1995_2528 177
356 3300049580 Ga0501046_0044355 Ga0501046_0044355_565_1098 177
357 3300049582 Ga0501048_0027629 Ga0501048_0027629_2341_2874 177
358 3300049583 Ga0501067_0033688 Ga0501067_0033688_1100_1633 177
359 3300049584 Ga0501068_0002833 Ga0501068_0002833_2039_2572 177
360 3300049585 Ga0501069_0261008 Ga0501069_0261008_466_999 177
361 3300049586 Ga0501070_0034789 Ga0501070_0034789_2644_3177 177
362 3300049587 Ga0501071_0135226 Ga0501071_0135226_624_1157 177
363 3300049587 Ga0501071_0186491 Ga0501071_0186491_517_1050 177
364 3300049588 Ga0501072_0013557 Ga0501072_0013557_2645_3178 177
365 3300049588 Ga0501072_0081119 Ga0501072_0081119_498_1031 177
366 3300049588 Ga0501072_0183734 Ga0501072_0183734_233_766 177
367 3300049588 Ga0501072_0274357 Ga0501072_0274357_448_981 177
368 3300049589 Ga0501073_0206829 Ga0501073_0206829_779_1312 177
369 3300049590 Ga0501074_0009783 Ga0501074_0009783_3333_3866 177
370 3300049591 Ga0501075_0035983 Ga0501075_0035983_2542_3075 177
371 3300049592 Ga0501076_0004835 Ga0501076_0004835_6510_7043 177
372 3300049592 Ga0501076_0050510 Ga0501076_0050510_1177_1710 177
373 3300049593 Ga0501077_0060235 Ga0501077_0060235_744_1277 177
374 3300049593 Ga0501077_0085210 Ga0501077_0085210_316_849 177
375 3300049593 Ga0501077_0111123 Ga0501077_0111123_851_1384 177
376 3300049593 Ga0501077_0370348 Ga0501077_0370348_206_739 177
377 3300049741 Ga0501079_0094641 Ga0501079_0094641_1038_1571 177
378 3300049741 Ga0501079_0135359 Ga0501079_0135359_1247_1780 177
379 3300049742 Ga0501080_0004371 Ga0501080_0004371_8830_9363 177
380 3300049743 Ga0501081_0020761 Ga0501081_0020761_971_1504 177
381 3300049743 Ga0501081_0183423 Ga0501081_0183423_251_784 177
382 3300049743 Ga0501081_0328851 Ga0501081_0328851_59_592 177
383 3300049744 Ga0501083_0008763 Ga0501083_0008763_3530_4063 177
384 3300049822 Ga0501035_0043900 Ga0501035_0043900_1822_2355 177
385 3300049823 Ga0501044_0151927 Ga0501044_0151927_84_617 177
386 3300049823 Ga0501044_1018948 Ga0501044_1018948_67_600 177
387 3300049824 Ga0501045_0006079 Ga0501045_0006079_2852_3385 177
388 3300049824 Ga0501045_0030626 Ga0501045_0030626_2563_3096 177
389 3300049824 Ga0501045_0090267 Ga0501045_0090267_688_1221 177
390 3300050490 nmdc:mga03n38_105438_c2 nmdc:mga03n38_105438_c2_348_902 177
391 3300050492 nmdc:mga0yw44_19307_c1 nmdc:mga0yw44_19307_c1_3167_3721 177
392 3300050507 nmdc:mga05p37_273727_c1 nmdc:mga05p37_273727_c1_1253_1786 177
393 3300050507 nmdc:mga05p37_36848_c1 nmdc:mga05p37_36848_c1_4707_5261 177
394 3300050508 nmdc:mga09592_473343_c1 nmdc:mga09592_473343_c1_155_688 177
395 3300050509 nmdc:mga0qj67_512245_c1 nmdc:mga0qj67_512245_c1_50_583 177
396 3300050510 nmdc:mga06r32_209711_c1 nmdc:mga06r32_209711_c1_1047_1601 177
397 3300050511 nmdc:mga08y16_785691_c1 nmdc:mga08y16_785691_c1_244_777 177
398 3300050512 nmdc:mga0n895_81501_c1 nmdc:mga0n895_81501_c1_735_1289 177
399 3300050513 nmdc:mga0rr50_820176_c1 nmdc:mga0rr50_820176_c1_40_594 177
400 3300050514 nmdc:mga08x19_131519_c1 nmdc:mga08x19_131519_c1_185_739 177
401 3300050514 nmdc:mga08x19_459621_c1 nmdc:mga08x19_459621_c1_107_661 177
402 3300050515 nmdc:mga0a205_19494_c1 nmdc:mga0a205_19494_c1_3747_4301 177
403 3300054114 Ga0501084_0102175 Ga0501084_0102175_116_649 177
404 3300054114 Ga0501084_0115603 Ga0501084_0115603_1298_1831 177
405 3300054114 Ga0501084_0159718 Ga0501084_0159718_762_1295 177
406 3300054114 Ga0501084_0685974 Ga0501084_0685974_56_589 177
407 3300061734 Ga0530510_0144804 Ga0530510_0144804_965_1498 177
408 3300061734 Ga0530510_0780611 Ga0530510_0780611_84_617 177
409 3300001991 JGI24743J22301_10001105 JGI24743J22301_100011054 178
410 3300003203 JGI25406J46586_10016842 JGI25406J46586_100168421 178
411 3300005329 Ga0070683_100087198 Ga0070683_1000871983 178
412 3300005329 Ga0070683_100099853 Ga0070683_1000998532 178
413 3300005329 Ga0070683_100192203 Ga0070683_1001922032 178
414 3300005329 Ga0070683_100209255 Ga0070683_1002092552 178
415 3300005329 Ga0070683_100942443 Ga0070683_1009424431 178
416 3300005329 Ga0070683_101086026 Ga0070683_1010860261 178
417 3300005329 Ga0070683_101634412 Ga0070683_1016344121 178
418 3300005330 Ga0070690_100811597 Ga0070690_1008115971 178
419 3300005331 Ga0070670_100345969 Ga0070670_1003459691 178
420 3300005331 Ga0070670_100412205 Ga0070670_1004122052 178
421 3300005333 Ga0070677_10110196 Ga0070677_101101962 178
422 3300005334 Ga0068869_100050723 Ga0068869_1000507232 178
423 3300005334 Ga0068869_100059469 Ga0068869_1000594693 178
424 3300005334 Ga0068869_100252982 Ga0068869_1002529822 178
425 3300005334 Ga0068869_100389749 Ga0068869_1003897492 178
426 3300005334 Ga0068869_100641156 Ga0068869_1006411562 178
427 3300005336 Ga0070680_100012785 Ga0070680_1000127855 178
428 3300005336 Ga0070680_100642697 Ga0070680_1006426971 178
429 3300005336 Ga0070680_101028409 Ga0070680_1010284091 178
430 3300005337 Ga0070682_100027722 Ga0070682_1000277222 178
431 3300005337 Ga0070682_100033173 Ga0070682_1000331732 178
432 3300005337 Ga0070682_100054838 Ga0070682_1000548382 178
433 3300005337 Ga0070682_100111123 Ga0070682_1001111232 178
434 3300005337 Ga0070682_100597330 Ga0070682_1005973301 178
435 3300005338 Ga0068868_100008175 Ga0068868_1000081757 178
436 3300005338 Ga0068868_100039766 Ga0068868_1000397662 178
437 3300005338 Ga0068868_100305642 Ga0068868_1003056422 178
438 3300005339 Ga0070660_100001667 Ga0070660_10000166714 178
439 3300005339 Ga0070660_100264429 Ga0070660_1002644292 178
440 3300005340 Ga0070689_100122536 Ga0070689_1001225362 178
441 3300005340 Ga0070689_100194704 Ga0070689_1001947042 178
442 3300005340 Ga0070689_100386113 Ga0070689_1003861132 178
443 3300005341 Ga0070691_10013969 Ga0070691_100139695 178
444 3300005341 Ga0070691_10018963 Ga0070691_100189633 178
445 3300005341 Ga0070691_10380597 Ga0070691_103805971 178
446 3300005343 Ga0070687_100033799 Ga0070687_1000337992 178
447 3300005343 Ga0070687_100210561 Ga0070687_1002105612 178
448 3300005343 Ga0070687_100720097 Ga0070687_1007200971 178
449 3300005344 Ga0070661_100009667 Ga0070661_1000096678 178
450 3300005344 Ga0070661_100251397 Ga0070661_1002513971 178
451 3300005344 Ga0070661_100452210 Ga0070661_1004522101 178
452 3300005345 Ga0070692_10068493 Ga0070692_100684932 178
453 3300005345 Ga0070692_10215456 Ga0070692_102154561 178
454 3300005347 Ga0070668_100051365 Ga0070668_1000513652 178
455 3300005347 Ga0070668_100098939 Ga0070668_1000989392 178
456 3300005347 Ga0070668_100221262 Ga0070668_1002212621 178
457 3300005347 Ga0070668_101192332 Ga0070668_1011923321 178
458 3300005353 Ga0070669_100193128 Ga0070669_1001931282 178
459 3300005353 Ga0070669_100523776 Ga0070669_1005237762 178
460 3300005354 Ga0070675_100022200 Ga0070675_1000222006 178
461 3300005354 Ga0070675_100034064 Ga0070675_1000340644 178
462 3300005354 Ga0070675_100102432 Ga0070675_1001024324 178
463 3300005354 Ga0070675_100119986 Ga0070675_1001199862 178
464 3300005355 Ga0070671_100241442 Ga0070671_1002414422 178
465 3300005355 Ga0070671_100409141 Ga0070671_1004091412 178
466 3300005355 Ga0070671_100537724 Ga0070671_1005377242 178
467 3300005356 Ga0070674_100040093 Ga0070674_1000400932 178
468 3300005356 Ga0070674_100102601 Ga0070674_1001026012 178
469 3300005356 Ga0070674_100141819 Ga0070674_1001418192 178
470 3300005364 Ga0070673_100039119 Ga0070673_1000391194 178
471 3300005364 Ga0070673_100281517 Ga0070673_1002815171 178
472 3300005365 Ga0070688_100019736 Ga0070688_1000197365 178
473 3300005365 Ga0070688_100045630 Ga0070688_1000456302 178
474 3300005365 Ga0070688_100070685 Ga0070688_1000706852 178
475 3300005366 Ga0070659_100034856 Ga0070659_1000348562 178
476 3300005366 Ga0070659_100045510 Ga0070659_1000455103 178
477 3300005366 Ga0070659_100129526 Ga0070659_1001295262 178
478 3300005366 Ga0070659_100609825 Ga0070659_1006098251 178
479 3300005366 Ga0070659_101404311 Ga0070659_1014043111 178
480 3300005367 Ga0070667_100180789 Ga0070667_1001807892 178
481 3300005406 Ga0070703_10004460 Ga0070703_100044602 178
482 3300005434 Ga0070709_10051370 Ga0070709_100513703 178
483 3300005434 Ga0070709_10186155 Ga0070709_101861552 178
484 3300005434 Ga0070709_10452283 Ga0070709_104522831 178
485 3300005435 Ga0070714_100083190 Ga0070714_1000831902 178
486 3300005435 Ga0070714_100114301 Ga0070714_1001143012 178
487 3300005436 Ga0070713_100014193 Ga0070713_1000141934 178
488 3300005436 Ga0070713_100048583 Ga0070713_1000485832 178
489 3300005436 Ga0070713_100363807 Ga0070713_1003638072 178
490 3300005436 Ga0070713_100526338 Ga0070713_1005263381 178
491 3300005437 Ga0070710_10045663 Ga0070710_100456633 178
492 3300005437 Ga0070710_10255762 Ga0070710_102557622 178
493 3300005438 Ga0070701_10013657 Ga0070701_100136572 178
494 3300005439 Ga0070711_100065833 Ga0070711_1000658332 178
495 3300005439 Ga0070711_100212668 Ga0070711_1002126682 178
496 3300005439 Ga0070711_100619182 Ga0070711_1006191821 178
497 3300005440 Ga0070705_100009187 Ga0070705_1000091873 178
498 3300005440 Ga0070705_100010477 Ga0070705_1000104772 178
499 3300005440 Ga0070705_100170405 Ga0070705_1001704052 178
500 3300005440 Ga0070705_100410678 Ga0070705_1004106782 178
501 3300005441 Ga0070700_100012955 Ga0070700_1000129554 178
502 3300005441 Ga0070700_100032783 Ga0070700_1000327832 178
503 3300005441 Ga0070700_100061823 Ga0070700_1000618232 178
504 3300005441 Ga0070700_100338340 Ga0070700_1003383402 178
505 3300005441 Ga0070700_101485198 Ga0070700_1014851981 178
506 3300005444 Ga0070694_100022513 Ga0070694_1000225133 178
507 3300005444 Ga0070694_100180678 Ga0070694_1001806781 178
508 3300005444 Ga0070694_101083561 Ga0070694_1010835611 178
509 3300005444 Ga0070694_101235702 Ga0070694_1012357021 178
510 3300005445 Ga0070708_100087980 Ga0070708_1000879803 178
511 3300005445 Ga0070708_100089897 Ga0070708_1000898972 178
512 3300005445 Ga0070708_100267216 Ga0070708_1002672163 178
513 3300005445 Ga0070708_100383814 Ga0070708_1003838141 178
514 3300005455 Ga0070663_100201914 Ga0070663_1002019142 178
515 3300005456 Ga0070678_100005901 Ga0070678_1000059013 178
516 3300005456 Ga0070678_100042584 Ga0070678_1000425842 178
517 3300005456 Ga0070678_100054008 Ga0070678_1000540082 178
518 3300005456 Ga0070678_100071558 Ga0070678_1000715581 178
519 3300005456 Ga0070678_100109456 Ga0070678_1001094562 178
520 3300005456 Ga0070678_100406747 Ga0070678_1004067472 178
521 3300005457 Ga0070662_100066789 Ga0070662_1000667893 178
522 3300005457 Ga0070662_100091503 Ga0070662_1000915033 178
523 3300005458 Ga0070681_10165761 Ga0070681_101657611 178
524 3300005459 Ga0068867_100007505 Ga0068867_1000075053 178
525 3300005459 Ga0068867_100021791 Ga0068867_1000217914 178
526 3300005459 Ga0068867_100068486 Ga0068867_1000684862 178
527 3300005459 Ga0068867_100376884 Ga0068867_1003768842 178
528 3300005459 Ga0068867_100915699 Ga0068867_1009156992 178
529 3300005466 Ga0070685_10009852 Ga0070685_100098521 178
530 3300005467 Ga0070706_100088588 Ga0070706_1000885882 178
531 3300005467 Ga0070706_100277003 Ga0070706_1002770032 178
532 3300005468 Ga0070707_100004230 Ga0070707_1000042302 178
533 3300005468 Ga0070707_100248356 Ga0070707_1002483561 178
534 3300005468 Ga0070707_100912570 Ga0070707_1009125702 178
535 3300005471 Ga0070698_100129423 Ga0070698_1001294232 178
536 3300005471 Ga0070698_100465325 Ga0070698_1004653252 178
537 3300005471 Ga0070698_100607079 Ga0070698_1006070792 178
538 3300005471 Ga0070698_101436395 Ga0070698_1014363951 178
539 3300005518 Ga0070699_100081397 Ga0070699_1000813972 178
540 3300005518 Ga0070699_100184916 Ga0070699_1001849161 178
541 3300005518 Ga0070699_100220047 Ga0070699_1002200472 178
542 3300005518 Ga0070699_100982330 Ga0070699_1009823301 178
543 3300005530 Ga0070679_100043371 Ga0070679_1000433712 178
544 3300005530 Ga0070679_100200034 Ga0070679_1002000342 178
545 3300005535 Ga0070684_100071000 Ga0070684_1000710003 178
546 3300005535 Ga0070684_100141162 Ga0070684_1001411622 178
547 3300005535 Ga0070684_100184992 Ga0070684_1001849922 178
548 3300005535 Ga0070684_100678727 Ga0070684_1006787272 178
549 3300005536 Ga0070697_100086250 Ga0070697_1000862502 178
550 3300005536 Ga0070697_100177970 Ga0070697_1001779702 178
551 3300005536 Ga0070697_100223390 Ga0070697_1002233902 178
552 3300005536 Ga0070697_101038720 Ga0070697_1010387201 178
553 3300005539 Ga0068853_100055007 Ga0068853_1000550074 178
554 3300005539 Ga0068853_100063755 Ga0068853_1000637552 178
555 3300005539 Ga0068853_100592866 Ga0068853_1005928662 178
556 3300005543 Ga0070672_100015250 Ga0070672_1000152507 178
557 3300005543 Ga0070672_100092523 Ga0070672_1000925233 178
558 3300005543 Ga0070672_100419917 Ga0070672_1004199172 178
559 3300005543 Ga0070672_101621894 Ga0070672_1016218941 178
560 3300005544 Ga0070686_100178888 Ga0070686_1001788882 178
561 3300005544 Ga0070686_100209029 Ga0070686_1002090291 178
562 3300005545 Ga0070695_100010707 Ga0070695_1000107072 178
563 3300005546 Ga0070696_100005157 Ga0070696_1000051571 178
564 3300005546 Ga0070696_100113833 Ga0070696_1001138332 178
565 3300005546 Ga0070696_100165229 Ga0070696_1001652292 178
566 3300005546 Ga0070696_100276350 Ga0070696_1002763502 178
567 3300005546 Ga0070696_100436588 Ga0070696_1004365882 178
568 3300005547 Ga0070693_100049742 Ga0070693_1000497422 178
569 3300005547 Ga0070693_100060899 Ga0070693_1000608992 178
570 3300005548 Ga0070665_100375138 Ga0070665_1003751382 178
571 3300005548 Ga0070665_100388204 Ga0070665_1003882041 178
572 3300005548 Ga0070665_100452366 Ga0070665_1004523662 178
573 3300005548 Ga0070665_101129387 Ga0070665_1011293871 178
574 3300005549 Ga0070704_100007474 Ga0070704_1000074742 178
575 3300005549 Ga0070704_100013760 Ga0070704_1000137601 178
576 3300005549 Ga0070704_100623968 Ga0070704_1006239681 178
577 3300005563 Ga0068855_100174394 Ga0068855_1001743942 178
578 3300005563 Ga0068855_100844591 Ga0068855_1008445912 178
579 3300005564 Ga0070664_100011426 Ga0070664_1000114264 178
580 3300005564 Ga0070664_100019658 Ga0070664_1000196582 178
581 3300005564 Ga0070664_100057656 Ga0070664_1000576562 178
582 3300005564 Ga0070664_100227753 Ga0070664_1002277531 178
583 3300005577 Ga0068857_100149603 Ga0068857_1001496032 178
584 3300005577 Ga0068857_100245555 Ga0068857_1002455552 178
585 3300005578 Ga0068854_100027948 Ga0068854_1000279482 178
586 3300005578 Ga0068854_100031648 Ga0068854_1000316482 178
587 3300005578 Ga0068854_100042761 Ga0068854_1000427611 178
588 3300005578 Ga0068854_100314513 Ga0068854_1003145132 178
589 3300005614 Ga0068856_100146626 Ga0068856_1001466261 178
590 3300005614 Ga0068856_100795310 Ga0068856_1007953102 178
591 3300005615 Ga0070702_100009140 Ga0070702_1000091406 178
592 3300005615 Ga0070702_100199790 Ga0070702_1001997901 178
593 3300005615 Ga0070702_100524975 Ga0070702_1005249752 178
594 3300005615 Ga0070702_100609002 Ga0070702_1006090022 178
595 3300005615 Ga0070702_100840131 Ga0070702_1008401311 178
596 3300005616 Ga0068852_100011455 Ga0068852_1000114558 178
597 3300005616 Ga0068852_100155347 Ga0068852_1001553473 178
598 3300005616 Ga0068852_100167655 Ga0068852_1001676552 178
599 3300005617 Ga0068859_101225231 Ga0068859_1012252311 178
600 3300005618 Ga0068864_100128463 Ga0068864_1001284632 178
601 3300005618 Ga0068864_101703538 Ga0068864_1017035381 178
602 3300005718 Ga0068866_10021745 Ga0068866_100217452 178
603 3300005719 Ga0068861_100006721 Ga0068861_1000067213 178
604 3300005719 Ga0068861_100024148 Ga0068861_1000241485 178
605 3300005719 Ga0068861_100048810 Ga0068861_1000488102 178
606 3300005834 Ga0068851_10262522 Ga0068851_102625222 178
607 3300005840 Ga0068870_10012045 Ga0068870_100120454 178
608 3300005840 Ga0068870_10023896 Ga0068870_100238963 178
609 3300005840 Ga0068870_10124592 Ga0068870_101245922 178
610 3300005840 Ga0068870_10294660 Ga0068870_102946601 178
611 3300005840 Ga0068870_10606058 Ga0068870_106060582 178
612 3300005841 Ga0068863_100673485 Ga0068863_1006734851 178
613 3300005843 Ga0068860_100390985 Ga0068860_1003909852 178
614 3300005844 Ga0068862_100272318 Ga0068862_1002723182 178
615 3300005937 Ga0081455_10045311 Ga0081455_100453113 178
616 3300005985 Ga0081539_10001472 Ga0081539_1000147227 178
617 3300005985 Ga0081539_10001538 Ga0081539_1000153817 178
618 3300005985 Ga0081539_10005611 Ga0081539_100056118 178
619 3300006028 Ga0070717_10105832 Ga0070717_101058323 178
620 3300006028 Ga0070717_10282522 Ga0070717_102825221 178
621 3300006028 Ga0070717_10568832 Ga0070717_105688322 178
622 3300006038 Ga0075365_10103597 Ga0075365_101035971 178
623 3300006051 Ga0075364_10064418 Ga0075364_100644182 178
624 3300006058 Ga0075432_10001376 Ga0075432_100013767 178
625 3300006058 Ga0075432_10094698 Ga0075432_100946982 178
626 3300006163 Ga0070715_10066346 Ga0070715_100663462 178
627 3300006163 Ga0070715_10172483 Ga0070715_101724831 178
628 3300006173 Ga0070716_100040087 Ga0070716_1000400872 178
629 3300006173 Ga0070716_100433830 Ga0070716_1004338302 178
630 3300006175 Ga0070712_100226592 Ga0070712_1002265922 178
631 3300006175 Ga0070712_100447637 Ga0070712_1004476372 178
632 3300006175 Ga0070712_100765430 Ga0070712_1007654302 178
633 3300006178 Ga0075367_10248620 Ga0075367_102486202 178
634 3300006237 Ga0097621_100213081 Ga0097621_1002130812 178
635 3300006237 Ga0097621_100929731 Ga0097621_1009297311 178
636 3300006358 Ga0068871_100130449 Ga0068871_1001304492 178
637 3300006358 Ga0068871_100706706 Ga0068871_1007067062 178
638 3300006844 Ga0075428_100001040 Ga0075428_1000010404 178
639 3300006844 Ga0075428_100030965 Ga0075428_1000309654 178
640 3300006844 Ga0075428_100536640 Ga0075428_1005366402 178
641 3300006844 Ga0075428_101793240 Ga0075428_1017932401 178
642 3300006846 Ga0075430_100000556 Ga0075430_1000005567 178
643 3300006847 Ga0075431_100005728 Ga0075431_10000572811 178
644 3300006847 Ga0075431_100177108 Ga0075431_1001771082 178
645 3300006847 Ga0075431_100647751 Ga0075431_1006477512 178
646 3300006847 Ga0075431_100957861 Ga0075431_1009578612 178
647 3300006852 Ga0075433_10070690 Ga0075433_100706902 178
648 3300006852 Ga0075433_10090262 Ga0075433_100902621 178
649 3300006852 Ga0075433_10097079 Ga0075433_100970792 178
650 3300006852 Ga0075433_10252615 Ga0075433_102526152 178
651 3300006871 Ga0075434_100041253 Ga0075434_1000412533 178
652 3300006871 Ga0075434_100420826 Ga0075434_1004208262 178
653 3300006871 Ga0075434_100613303 Ga0075434_1006133031 178
654 3300006880 Ga0075429_100019935 Ga0075429_1000199355 178
655 3300006880 Ga0075429_100024499 Ga0075429_1000244997 178
656 3300006881 Ga0068865_100046878 Ga0068865_1000468783 178
657 3300006881 Ga0068865_100101365 Ga0068865_1001013652 178
658 3300006881 Ga0068865_100161265 Ga0068865_1001612652 178
659 3300006881 Ga0068865_100335818 Ga0068865_1003358182 178
660 3300006914 Ga0075436_100029703 Ga0075436_1000297032 178
661 3300006914 Ga0075436_100034691 Ga0075436_1000346912 178
662 3300006914 Ga0075436_100073834 Ga0075436_1000738343 178
663 3300006931 Ga0097620_101225132 Ga0097620_1012251321 178
664 3300007076 Ga0075435_100045663 Ga0075435_1000456632 178
665 3300007076 Ga0075435_100226521 Ga0075435_1002265212 178
666 3300007076 Ga0075435_100274268 Ga0075435_1002742681 178
667 3300007076 Ga0075435_100352311 Ga0075435_1003523112 178
668 3300009093 Ga0105240_10412370 Ga0105240_104123702 178
669 3300009094 Ga0111539_10026459 Ga0111539_100264599 178
670 3300009094 Ga0111539_10073562 Ga0111539_100735625 178
671 3300009094 Ga0111539_10193607 Ga0111539_101936072 178
672 3300009094 Ga0111539_10210839 Ga0111539_102108393 178
673 3300009094 Ga0111539_10502427 Ga0111539_105024272 178
674 3300009098 Ga0105245_10017299 Ga0105245_100172991 178
675 3300009098 Ga0105245_10111124 Ga0105245_101111244 178
676 3300009098 Ga0105245_10166005 Ga0105245_101660052 178
677 3300009098 Ga0105245_10184936 Ga0105245_101849362 178
678 3300009098 Ga0105245_10210615 Ga0105245_102106152 178
679 3300009098 Ga0105245_10239450 Ga0105245_102394503 178
680 3300009098 Ga0105245_10591200 Ga0105245_105912001 178
681 3300009098 Ga0105245_10669037 Ga0105245_106690372 178
682 3300009098 Ga0105245_11340276 Ga0105245_113402762 178
683 3300009101 Ga0105247_10228505 Ga0105247_102285052 178
684 3300009147 Ga0114129_10006705 Ga0114129_100067057 178
685 3300009147 Ga0114129_10017331 Ga0114129_100173315 178
686 3300009147 Ga0114129_10074602 Ga0114129_100746022 178
687 3300009147 Ga0114129_10077421 Ga0114129_100774216 178
688 3300009147 Ga0114129_10140984 Ga0114129_101409842 178
689 3300009147 Ga0114129_10306306 Ga0114129_103063062 178
690 3300009147 Ga0114129_10414613 Ga0114129_104146132 178
691 3300009147 Ga0114129_10947710 Ga0114129_109477102 178
692 3300009147 Ga0114129_12071458 Ga0114129_120714581 178
693 3300009148 Ga0105243_10008208 Ga0105243_100082088 178
694 3300009148 Ga0105243_10012983 Ga0105243_100129837 178
695 3300009148 Ga0105243_10064043 Ga0105243_100640433 178
696 3300009148 Ga0105243_10146540 Ga0105243_101465402 178
697 3300009148 Ga0105243_10251756 Ga0105243_102517563 178
698 3300009148 Ga0105243_10331371 Ga0105243_103313712 178
699 3300009148 Ga0105243_10348436 Ga0105243_103484362 178
700 3300009174 Ga0105241_10017330 Ga0105241_100173303 178
701 3300009176 Ga0105242_10011989 Ga0105242_100119892 178
702 3300009176 Ga0105242_10046892 Ga0105242_100468922 178
703 3300009176 Ga0105242_10086822 Ga0105242_100868222 178
704 3300009176 Ga0105242_10146870 Ga0105242_101468702 178
705 3300009176 Ga0105242_10188738 Ga0105242_101887382 178
706 3300009176 Ga0105242_10266906 Ga0105242_102669062 178
707 3300009176 Ga0105242_10310861 Ga0105242_103108612 178
708 3300009176 Ga0105242_10941018 Ga0105242_109410182 178
709 3300009176 Ga0105242_11172519 Ga0105242_111725191 178
710 3300009177 Ga0105248_10033638 Ga0105248_100336382 178
711 3300009177 Ga0105248_10205264 Ga0105248_102052642 178
712 3300009177 Ga0105248_10550647 Ga0105248_105506471 178
713 3300009177 Ga0105248_11032823 Ga0105248_110328232 178
714 3300009551 Ga0105238_10025270 Ga0105238_100252702 178
715 3300009553 Ga0105249_10038260 Ga0105249_100382603 178
716 3300009553 Ga0105249_10040780 Ga0105249_100407804 178
717 3300009553 Ga0105249_10063845 Ga0105249_100638452 178
718 3300009553 Ga0105249_11399161 Ga0105249_113991611 178
719 3300010375 Ga0105239_10069767 Ga0105239_100697672 178
720 3300010375 Ga0105239_10183736 Ga0105239_101837362 178
721 3300010375 Ga0105239_10864568 Ga0105239_108645682 178
722 3300010375 Ga0105239_11844453 Ga0105239_118444531 178
723 3300011119 Ga0105246_10032307 Ga0105246_100323072 178
724 3300011119 Ga0105246_10033002 Ga0105246_100330021 178
725 3300011119 Ga0105246_10128705 Ga0105246_101287052 178
726 3300011119 Ga0105246_10195639 Ga0105246_101956392 178
727 3300011119 Ga0105246_11648557 Ga0105246_116485571 178
728 3300012497 Ga0157319_1008034 Ga0157319_10080342 178
729 3300012510 Ga0157316_1005208 Ga0157316_10052082 178
730 3300013100 Ga0157373_10146991 Ga0157373_101469912 178
731 3300013105 Ga0157369_10032688 Ga0157369_100326886 178
732 3300013296 Ga0157374_10421366 Ga0157374_104213662 178
733 3300013297 Ga0157378_11269649 Ga0157378_112696491 178
734 3300013297 Ga0157378_11496009 Ga0157378_114960092 178
735 3300013306 Ga0163162_10116894 Ga0163162_101168941 178
736 3300013306 Ga0163162_11014172 Ga0163162_110141722 178
737 3300013306 Ga0163162_11793982 Ga0163162_117939821 178
738 3300013307 Ga0157372_10054775 Ga0157372_100547752 178
739 3300013307 Ga0157372_10202152 Ga0157372_102021522 178
740 3300013307 Ga0157372_10726845 Ga0157372_107268451 178
741 3300013307 Ga0157372_11051743 Ga0157372_110517432 178
742 3300013308 Ga0157375_10053582 Ga0157375_100535822 178
743 3300013308 Ga0157375_10116060 Ga0157375_101160602 178
744 3300013308 Ga0157375_10248559 Ga0157375_102485592 178
745 3300013308 Ga0157375_10391746 Ga0157375_103917462 178
746 3300013308 Ga0157375_10405250 Ga0157375_104052502 178
747 3300013308 Ga0157375_10411000 Ga0157375_104110002 178
748 3300013308 Ga0157375_10766202 Ga0157375_107662022 178
749 3300014325 Ga0163163_10082304 Ga0163163_100823042 178
750 3300014325 Ga0163163_10235367 Ga0163163_102353672 178
751 3300014325 Ga0163163_11470136 Ga0163163_114701362 178
752 3300014325 Ga0163163_11858359 Ga0163163_118583591 178
753 3300014326 Ga0157380_10002268 Ga0157380_1000226811 178
754 3300014326 Ga0157380_10063036 Ga0157380_100630362 178
755 3300014326 Ga0157380_11254226 Ga0157380_112542261 178
756 3300014326 Ga0157380_11986413 Ga0157380_119864131 178
757 3300014497 Ga0182008_10064026 Ga0182008_100640262 178
758 3300014745 Ga0157377_10002275 Ga0157377_100022752 178
759 3300014745 Ga0157377_10012537 Ga0157377_100125372 178
760 3300014745 Ga0157377_10037383 Ga0157377_100373832 178
761 3300014745 Ga0157377_10042368 Ga0157377_100423683 178
762 3300014745 Ga0157377_10158982 Ga0157377_101589822 178
763 3300014745 Ga0157377_10659051 Ga0157377_106590511 178
764 3300014745 Ga0157377_11057600 Ga0157377_110576001 178
765 3300014968 Ga0157379_10028697 Ga0157379_100286973 178
766 3300014968 Ga0157379_10358295 Ga0157379_103582952 178
767 3300014969 Ga0157376_10184995 Ga0157376_101849951 178
768 3300014969 Ga0157376_12279930 Ga0157376_122799301 178
769 3300017792 Ga0163161_10039994 Ga0163161_100399945 178
770 3300017792 Ga0163161_10055118 Ga0163161_100551182 178
771 3300017792 Ga0163161_10119147 Ga0163161_101191472 178
772 3300025885 Ga0207653_10002394 Ga0207653_100023943 178
773 3300025898 Ga0207692_10115823 Ga0207692_101158231 178
774 3300025899 Ga0207642_10421215 Ga0207642_104212151 178
775 3300025901 Ga0207688_10001531 Ga0207688_100015317 178
776 3300025901 Ga0207688_10010132 Ga0207688_100101325 178
777 3300025901 Ga0207688_10023095 Ga0207688_100230952 178
778 3300025901 Ga0207688_10050061 Ga0207688_100500612 178
779 3300025901 Ga0207688_10102546 Ga0207688_101025462 178
780 3300025905 Ga0207685_10014890 Ga0207685_100148902 178
781 3300025905 Ga0207685_10041020 Ga0207685_100410203 178
782 3300025906 Ga0207699_10018414 Ga0207699_100184142 178
783 3300025906 Ga0207699_10024394 Ga0207699_100243942 178
784 3300025906 Ga0207699_10039701 Ga0207699_100397012 178
785 3300025906 Ga0207699_10060058 Ga0207699_100600582 178
786 3300025907 Ga0207645_10017582 Ga0207645_100175822 178
787 3300025908 Ga0207643_10017837 Ga0207643_100178374 178
788 3300025908 Ga0207643_10048187 Ga0207643_100481872 178
789 3300025908 Ga0207643_10048720 Ga0207643_100487202 178
790 3300025908 Ga0207643_10156958 Ga0207643_101569582 178
791 3300025909 Ga0207705_10701264 Ga0207705_107012642 178
792 3300025910 Ga0207684_10065034 Ga0207684_100650342 178
793 3300025910 Ga0207684_10095441 Ga0207684_100954412 178
794 3300025911 Ga0207654_10089088 Ga0207654_100890882 178
795 3300025912 Ga0207707_10131323 Ga0207707_101313233 178
796 3300025913 Ga0207695_10351515 Ga0207695_103515152 178
797 3300025914 Ga0207671_10348894 Ga0207671_103488942 178
798 3300025915 Ga0207693_10000417 Ga0207693_100004173 178
799 3300025915 Ga0207693_10015889 Ga0207693_100158893 178
800 3300025915 Ga0207693_10245509 Ga0207693_102455093 178
801 3300025916 Ga0207663_10016308 Ga0207663_100163082 178
802 3300025916 Ga0207663_10149030 Ga0207663_101490302 178
803 3300025916 Ga0207663_10360180 Ga0207663_103601802 178
804 3300025917 Ga0207660_10100821 Ga0207660_101008212 178
805 3300025917 Ga0207660_10351847 Ga0207660_103518472 178
806 3300025917 Ga0207660_10504397 Ga0207660_105043972 178
807 3300025918 Ga0207662_10014690 Ga0207662_100146903 178
808 3300025918 Ga0207662_10049355 Ga0207662_100493553 178
809 3300025919 Ga0207657_10005691 Ga0207657_100056919 178
810 3300025920 Ga0207649_10043879 Ga0207649_100438794 178
811 3300025920 Ga0207649_10199975 Ga0207649_101999752 178
812 3300025920 Ga0207649_10205688 Ga0207649_102056882 178
813 3300025920 Ga0207649_10537573 Ga0207649_105375731 178
814 3300025921 Ga0207652_10017280 Ga0207652_100172803 178
815 3300025921 Ga0207652_10267923 Ga0207652_102679232 178
816 3300025922 Ga0207646_10138189 Ga0207646_101381891 178
817 3300025922 Ga0207646_10207330 Ga0207646_102073302 178
818 3300025922 Ga0207646_10348332 Ga0207646_103483321 178
819 3300025922 Ga0207646_10540825 Ga0207646_105408252 178
820 3300025923 Ga0207681_10328903 Ga0207681_103289032 178
821 3300025923 Ga0207681_10524250 Ga0207681_105242502 178
822 3300025923 Ga0207681_10957710 Ga0207681_109577101 178
823 3300025925 Ga0207650_10025258 Ga0207650_100252582 178
824 3300025925 Ga0207650_10169172 Ga0207650_101691722 178
825 3300025925 Ga0207650_10737305 Ga0207650_107373052 178
826 3300025925 Ga0207650_11144874 Ga0207650_111448742 178
827 3300025926 Ga0207659_10050391 Ga0207659_100503914 178
828 3300025926 Ga0207659_10089733 Ga0207659_100897332 178
829 3300025926 Ga0207659_10089910 Ga0207659_100899102 178
830 3300025926 Ga0207659_10566470 Ga0207659_105664702 178
831 3300025926 Ga0207659_10862801 Ga0207659_108628012 178
832 3300025927 Ga0207687_10029148 Ga0207687_100291482 178
833 3300025927 Ga0207687_10033598 Ga0207687_100335984 178
834 3300025927 Ga0207687_10248538 Ga0207687_102485382 178
835 3300025927 Ga0207687_10769733 Ga0207687_107697332 178
836 3300025928 Ga0207700_10000006 Ga0207700_10000006211 178
837 3300025929 Ga0207664_10032906 Ga0207664_100329063 178
838 3300025929 Ga0207664_10069422 Ga0207664_100694223 178
839 3300025929 Ga0207664_10081836 Ga0207664_100818362 178
840 3300025929 Ga0207664_10138307 Ga0207664_101383072 178
841 3300025932 Ga0207690_10035164 Ga0207690_100351642 178
842 3300025932 Ga0207690_10059966 Ga0207690_100599662 178
843 3300025932 Ga0207690_10068507 Ga0207690_100685073 178
844 3300025932 Ga0207690_10894671 Ga0207690_108946711 178
845 3300025933 Ga0207706_10005943 Ga0207706_100059438 178
846 3300025933 Ga0207706_10053545 Ga0207706_100535453 178
847 3300025933 Ga0207706_10224683 Ga0207706_102246832 178
848 3300025934 Ga0207686_10088752 Ga0207686_100887522 178
849 3300025934 Ga0207686_10108402 Ga0207686_101084022 178
850 3300025934 Ga0207686_10175045 Ga0207686_101750452 178
851 3300025934 Ga0207686_10294666 Ga0207686_102946662 178
852 3300025935 Ga0207709_10013862 Ga0207709_100138624 178
853 3300025935 Ga0207709_10316109 Ga0207709_103161092 178
854 3300025935 Ga0207709_10374585 Ga0207709_103745851 178
855 3300025935 Ga0207709_10376799 Ga0207709_103767992 178
856 3300025935 Ga0207709_10628492 Ga0207709_106284922 178
857 3300025936 Ga0207670_10247136 Ga0207670_102471362 178
858 3300025936 Ga0207670_10372694 Ga0207670_103726942 178
859 3300025937 Ga0207669_10007607 Ga0207669_100076073 178
860 3300025937 Ga0207669_10067527 Ga0207669_100675272 178
861 3300025937 Ga0207669_10144226 Ga0207669_101442262 178
862 3300025937 Ga0207669_10252379 Ga0207669_102523792 178
863 3300025937 Ga0207669_10262975 Ga0207669_102629752 178
864 3300025938 Ga0207704_10150393 Ga0207704_101503933 178
865 3300025938 Ga0207704_10983709 Ga0207704_109837091 178
866 3300025939 Ga0207665_10006848 Ga0207665_100068486 178
867 3300025939 Ga0207665_10009283 Ga0207665_100092833 178
868 3300025939 Ga0207665_10106000 Ga0207665_101060002 178
869 3300025939 Ga0207665_10291331 Ga0207665_102913312 178
870 3300025940 Ga0207691_10002178 Ga0207691_1000217813 178
871 3300025940 Ga0207691_10005171 Ga0207691_100051714 178
872 3300025940 Ga0207691_10149046 Ga0207691_101490462 178
873 3300025940 Ga0207691_10184656 Ga0207691_101846562 178
874 3300025940 Ga0207691_10256493 Ga0207691_102564933 178
875 3300025940 Ga0207691_10546882 Ga0207691_105468822 178
876 3300025941 Ga0207711_10181454 Ga0207711_101814542 178
877 3300025941 Ga0207711_10549956 Ga0207711_105499562 178
878 3300025942 Ga0207689_10081801 Ga0207689_100818012 178
879 3300025942 Ga0207689_10203476 Ga0207689_102034762 178
880 3300025942 Ga0207689_10442118 Ga0207689_104421182 178
881 3300025944 Ga0207661_10010773 Ga0207661_100107737 178
882 3300025944 Ga0207661_10026539 Ga0207661_100265393 178
883 3300025944 Ga0207661_10056702 Ga0207661_100567025 178
884 3300025944 Ga0207661_10169960 Ga0207661_101699603 178
885 3300025944 Ga0207661_10261690 Ga0207661_102616902 178
886 3300025944 Ga0207661_11120639 Ga0207661_111206391 178
887 3300025944 Ga0207661_11218171 Ga0207661_112181712 178
888 3300025945 Ga0207679_10071992 Ga0207679_100719923 178
889 3300025945 Ga0207679_10241941 Ga0207679_102419412 178
890 3300025945 Ga0207679_10672149 Ga0207679_106721492 178
891 3300025949 Ga0207667_11025680 Ga0207667_110256801 178
892 3300025961 Ga0207712_10100427 Ga0207712_101004272 178
893 3300025961 Ga0207712_10773305 Ga0207712_107733052 178
894 3300025972 Ga0207668_10038488 Ga0207668_100384883 178
895 3300025972 Ga0207668_10318501 Ga0207668_103185012 178
896 3300025972 Ga0207668_10342707 Ga0207668_103427072 178
897 3300025981 Ga0207640_10033438 Ga0207640_100334383 178
898 3300025981 Ga0207640_10102878 Ga0207640_101028782 178
899 3300025981 Ga0207640_10167420 Ga0207640_101674202 178
900 3300026023 Ga0207677_10194598 Ga0207677_101945982 178
901 3300026023 Ga0207677_10246526 Ga0207677_102465262 178
902 3300026023 Ga0207677_10336582 Ga0207677_103365822 178
903 3300026023 Ga0207677_10489928 Ga0207677_104899282 178
904 3300026023 Ga0207677_10612011 Ga0207677_106120112 178
905 3300026041 Ga0207639_10230620 Ga0207639_102306202 178
906 3300026041 Ga0207639_10413027 Ga0207639_104130272 178
907 3300026041 Ga0207639_10758411 Ga0207639_107584112 178
908 3300026067 Ga0207678_10476614 Ga0207678_104766142 178
909 3300026075 Ga0207708_10004014 Ga0207708_100040149 178
910 3300026075 Ga0207708_10030010 Ga0207708_100300104 178
911 3300026075 Ga0207708_10031188 Ga0207708_100311882 178
912 3300026075 Ga0207708_10049928 Ga0207708_100499283 178
913 3300026075 Ga0207708_10359347 Ga0207708_103593473 178
914 3300026075 Ga0207708_10737943 Ga0207708_107379432 178
915 3300026078 Ga0207702_10045233 Ga0207702_100452332 178
916 3300026078 Ga0207702_10409975 Ga0207702_104099752 178
917 3300026078 Ga0207702_10732037 Ga0207702_107320372 178
918 3300026088 Ga0207641_10604688 Ga0207641_106046881 178
919 3300026089 Ga0207648_10006619 Ga0207648_1000661911 178
920 3300026089 Ga0207648_10026492 Ga0207648_100264925 178
921 3300026089 Ga0207648_10051017 Ga0207648_100510173 178
922 3300026089 Ga0207648_10134800 Ga0207648_101348001 178
923 3300026089 Ga0207648_10144093 Ga0207648_101440934 178
924 3300026089 Ga0207648_10229142 Ga0207648_102291423 178
925 3300026089 Ga0207648_10755152 Ga0207648_107551522 178
926 3300026089 Ga0207648_10878806 Ga0207648_108788062 178
927 3300026095 Ga0207676_10026992 Ga0207676_100269925 178
928 3300026095 Ga0207676_10049997 Ga0207676_100499972 178
929 3300026095 Ga0207676_11283295 Ga0207676_112832952 178
930 3300026116 Ga0207674_10017754 Ga0207674_100177544 178
931 3300026116 Ga0207674_10180224 Ga0207674_101802244 178
932 3300026116 Ga0207674_10475891 Ga0207674_104758912 178
933 3300026116 Ga0207674_11559286 Ga0207674_115592861 178
934 3300026118 Ga0207675_100024292 Ga0207675_1000242922 178
935 3300026118 Ga0207675_100025627 Ga0207675_1000256272 178
936 3300026118 Ga0207675_100085800 Ga0207675_1000858003 178
937 3300026118 Ga0207675_100334432 Ga0207675_1003344322 178
938 3300026121 Ga0207683_10008656 Ga0207683_100086562 178
939 3300026121 Ga0207683_10013282 Ga0207683_100132823 178
940 3300026121 Ga0207683_10067451 Ga0207683_100674513 178
941 3300026121 Ga0207683_10069717 Ga0207683_100697173 178
942 3300026121 Ga0207683_10086744 Ga0207683_100867442 178
943 3300026121 Ga0207683_10135462 Ga0207683_101354623 178
944 3300026121 Ga0207683_10205363 Ga0207683_102053632 178
945 3300026121 Ga0207683_10855880 Ga0207683_108558802 178
946 3300026142 Ga0207698_10061193 Ga0207698_100611932 178
947 3300026142 Ga0207698_10440794 Ga0207698_104407942 178
948 3300026142 Ga0207698_11192611 Ga0207698_111926112 178
949 3300027907 Ga0207428_10000572 Ga0207428_1000057221 178
950 3300027907 Ga0207428_10016659 Ga0207428_100166596 178
951 3300027907 Ga0207428_10331686 Ga0207428_103316862 178
952 3300027907 Ga0207428_10406229 Ga0207428_104062292 178
953 3300027907 Ga0207428_10500892 Ga0207428_105008922 178
954 3300028379 Ga0268266_10390455 Ga0268266_103904552 178
955 3300028379 Ga0268266_10822170 Ga0268266_108221702 178
956 3300028379 Ga0268266_10976270 Ga0268266_109762702 178
957 3300028379 Ga0268266_11012725 Ga0268266_110127251 178
958 3300028380 Ga0268265_10331853 Ga0268265_103318533 178
959 3300028380 Ga0268265_10498272 Ga0268265_104982722 178
960 3300028381 Ga0268264_10210484 Ga0268264_102104842 178
961 3300028381 Ga0268264_10473455 Ga0268264_104734552 178
962 3300028577 Ga0265318_10093240 Ga0265318_100932402 178
963 3300028666 Ga0265336_10058115 Ga0265336_100581152 178
964 3300028800 Ga0265338_10005613 Ga0265338_100056138 178
965 3300031238 Ga0265332_10069550 Ga0265332_100695501 178
966 3300031241 Ga0265325_10098574 Ga0265325_100985741 178
967 3300031249 Ga0265339_10006130 Ga0265339_100061305 178
968 3300031344 Ga0265316_10070974 Ga0265316_100709742 178
969 3300031548 Ga0307408_100215377 Ga0307408_1002153771 178
970 3300031548 Ga0307408_100588551 Ga0307408_1005885512 178
971 3300031548 Ga0307408_100613650 Ga0307408_1006136501 178
972 3300031711 Ga0265314_10027580 Ga0265314_100275804 178
973 3300031712 Ga0265342_10116565 Ga0265342_101165652 178
974 3300031852 Ga0307410_10590755 Ga0307410_105907552 178
975 3300031901 Ga0307406_10490236 Ga0307406_104902362 178
976 3300031995 Ga0307409_100235014 Ga0307409_1002350142 178
977 3300031995 Ga0307409_100632912 Ga0307409_1006329121 178
978 3300031995 Ga0307409_101144841 Ga0307409_1011448411 178
979 3300032002 Ga0307416_100092672 Ga0307416_1000926722 178
980 3300032002 Ga0307416_100112348 Ga0307416_1001123482 178
981 3300032002 Ga0307416_101977902 Ga0307416_1019779021 178
982 3300034817 Ga0373948_0059486 Ga0373948_0059486_194_730 178
983 3300035090 Ga0373949_0047526 Ga0373949_0047526_19_555 178
984 3300035091 Ga0373951_0015933 Ga0373951_0015933_646_1182 178
985 3300035112 Ga0373932_0226878 Ga0373932_0226878_37_600 178
986 3300035114 Ga0373939_0069300 Ga0373939_0069300_367_903 178
987 3300035207 Ga0373942_0047606 Ga0373942_0047606_347_883 178
988 3300035242 Ga0373962_0188070 Ga0373962_0188070_93_629 178
989 3300035691 Ga0373931_0203930 Ga0373931_0203930_120_656 178
990 3300036401 Ga0373937_0559913 Ga0373937_0559913_200_748 178
991 3300037312 Ga0395899_0184498 Ga0395899_0184498_626_1186 178
992 3300037418 Ga0395900_0034795 Ga0395900_0034795_2442_2999 178
993 3300037418 Ga0395900_0145562 Ga0395900_0145562_639_1199 178
994 3300037418 Ga0395900_0264247 Ga0395900_0264247_262_798 178
995 3300037418 Ga0395900_1135559 Ga0395900_1135559_23_577 178
996 3300037418 Ga0395900_1186394 Ga0395900_1186394_35_589 178
997 3300037466 Ga0395898_0018533 Ga0395898_0018533_610_1164 178
998 3300037466 Ga0395898_0044571 Ga0395898_0044571_3738_4298 178
999 3300037466 Ga0395898_0052471 Ga0395898_0052471_793_1353 178
1000 3300037466 Ga0395898_0259227 Ga0395898_0259227_32_592 178
1001 3300037466 Ga0395898_0666510 Ga0395898_0666510_128_685 178
1002 3300037471 Ga0395905_0050998 Ga0395905_0050998_221_778 178
1003 3300037471 Ga0395905_0182761 Ga0395905_0182761_373_930 178
1004 3300037471 Ga0395905_0193205 Ga0395905_0193205_1061_1597 178
1005 3300037471 Ga0395905_0221625 Ga0395905_0221625_1173_1733 178
1006 3300037471 Ga0395905_0280923 Ga0395905_0280923_283_837 178
1007 3300038443 Ga0395901_0004963 Ga0395901_0004963_7990_8547 178
1008 3300038443 Ga0395901_0032403 Ga0395901_0032403_3671_4231 178
1009 3300038443 Ga0395901_0048871 Ga0395901_0048871_3625_4185 178
1010 3300038443 Ga0395901_0054544 Ga0395901_0054544_918_1478 178
1011 3300038443 Ga0395901_0093447 Ga0395901_0093447_1906_2442 178
1012 3300038443 Ga0395901_0117859 Ga0395901_0117859_15_572 178
1013 3300038443 Ga0395901_0145032 Ga0395901_0145032_1181_1744 178
1014 3300038443 Ga0395901_0146014 Ga0395901_0146014_17_571 178
1015 3300038443 Ga0395901_0190619 Ga0395901_0190619_611_1165 178
1016 3300038443 Ga0395901_0308146 Ga0395901_0308146_736_1290 178
1017 3300038443 Ga0395901_0360748 Ga0395901_0360748_61_618 178
1018 3300038443 Ga0395901_0372544 Ga0395901_0372544_573_1130 178
1019 3300038443 Ga0395901_1591423 Ga0395901_1591423_18_581 178
1020 3300038996 Ga0242420_013248 Ga0242420_013248_550_1107 178
1021 3300041406 Ga0439439_0000856 Ga0439439_0000856_860_1396 178
1022 3300041408 Ga0439453_0000752 Ga0439453_0000752_1958_2518 178
1023 3300041410 Ga0439461_0001922 Ga0439461_0001922_2356_2892 178
1024 3300041410 Ga0439461_0014936 Ga0439461_0014936_337_873 178
1025 3300041459 Ga0451800_0711459 Ga0451800_0711459_85_639 178
1026 3300041512 Ga0451853_0511288 Ga0451853_0511288_327_884 178
1027 3300041512 Ga0451853_1815271 Ga0451853_1815271_257_811 178
1028 3300041997 Ga0439431_0006609 Ga0439431_0006609_994_1530 178
1029 3300041999 Ga0439433_0001743 Ga0439433_0001743_1266_1802 178
1030 3300042013 Ga0439456_091110 Ga0439456_091110_87_647 178
1031 3300042015 Ga0439462_0003942 Ga0439462_0003942_694_1230 178
1032 3300042122 Ga0450920_008348 Ga0450920_008348_412_978 178
1033 3300042122 Ga0450920_066685 Ga0450920_066685_131_706 178
1034 3300042125 Ga0450923_060214 Ga0450923_060214_17_583 178
1035 3300042156 Ga0439446_0010197 Ga0439446_0010197_469_1020 178
1036 3300042156 Ga0439446_0026841 Ga0439446_0026841_224_760 178
1037 3300042436 Ga0439435_0061505 Ga0439435_0061505_236_772 178
1038 3300044658 Ga0466972_0103746 Ga0466972_0103746_397_951 178
1039 3300044706 Ga0466964_0005703 Ga0466964_0005703_369_923 178
1040 3300044735 Ga0466968_0041052 Ga0466968_0041052_424_978 178
1041 3300044735 Ga0466968_0293281 Ga0466968_0293281_139_696 178
1042 3300044901 Ga0466960_0097127 Ga0466960_0097127_326_880 178
1043 3300044901 Ga0466960_0380105 Ga0466960_0380105_99_653 178
1044 3300045051 Ga0451576_0423530 Ga0451576_0423530_514_1071 178
1045 3300045976 Ga0466967_0157580 Ga0466967_0157580_1392_1946 178
1046 3300046455 Ga0495603_0014070 Ga0495603_0014070_2544_3080 178
1047 3300046461 Ga0495641_0144584 Ga0495641_0144584_321_875 178
1048 3300046473 Ga0495582_0080390 Ga0495582_0080390_13_549 178
1049 3300046473 Ga0495582_0326679 Ga0495582_0326679_207_761 178
1050 3300046473 Ga0495582_0366705 Ga0495582_0366705_212_772 178
1051 3300046474 Ga0495605_0290233 Ga0495605_0290233_26_580 178
1052 3300046477 Ga0495664_0180513 Ga0495664_0180513_568_1122 178
1053 3300046477 Ga0495664_0287979 Ga0495664_0287979_116_667 178
1054 3300046491 Ga0495584_0048543 Ga0495584_0048543_240_776 178
1055 3300046491 Ga0495584_0157107 Ga0495584_0157107_377_916 178
1056 3300046491 Ga0495584_0230813 Ga0495584_0230813_376_930 178
1057 3300046491 Ga0495584_0320375 Ga0495584_0320375_166_720 178
1058 3300046491 Ga0495584_0432024 Ga0495584_0432024_71_628 178
1059 3300046500 Ga0495596_0230298 Ga0495596_0230298_88_678 178
1060 3300046517 Ga0495630_0068665 Ga0495630_0068665_2086_2640 178
1061 3300046523 Ga0495644_0057018 Ga0495644_0057018_149_685 178
1062 3300046523 Ga0495644_0190659 Ga0495644_0190659_111_665 178
1063 3300046525 Ga0495663_0100272 Ga0495663_0100272_136_672 178
1064 3300046529 Ga0495652_0429474 Ga0495652_0429474_83_640 178
1065 3300046536 Ga0495587_0411843 Ga0495587_0411843_116_670 178
1066 3300046538 Ga0495609_0199564 Ga0495609_0199564_50_604 178
1067 3300046538 Ga0495609_0204671 Ga0495609_0204671_102_656 178
1068 3300046538 Ga0495609_0314546 Ga0495609_0314546_41_595 178
1069 3300046543 Ga0495645_0329557 Ga0495645_0329557_20_577 178
1070 3300046559 Ga0495667_0440401 Ga0495667_0440401_74_625 178
1071 3300046663 Ga0495635_0064504 Ga0495635_0064504_1417_1971 178
1072 3300046664 Ga0495659_0065020 Ga0495659_0065020_227_781 178
1073 3300046674 Ga0495588_0065579 Ga0495588_0065579_196_732 178
1074 3300046691 Ga0495670_0262579 Ga0495670_0262579_348_908 178
1075 3300047319 Ga0495674_0168834 Ga0495674_0168834_14_568 178
1076 3300047319 Ga0495674_0598924 Ga0495674_0598924_163_714 178
1077 3300047322 Ga0495680_0018765 Ga0495680_0018765_1638_2192 178
1078 3300047322 Ga0495680_0551969 Ga0495680_0551969_129_689 178
1079 3300047445 Ga0495677_0078690 Ga0495677_0078690_383_919 178
1080 3300047673 Ga0495593_0234102 Ga0495593_0234102_95_649 178
1081 3300048904 Ga0496101_0077471 Ga0496101_0077471_1809_2345 178
1082 3300048904 Ga0496101_0393748 Ga0496101_0393748_149_685 178
1083 3300048905 Ga0496102_0080963 Ga0496102_0080963_1711_2265 178
1084 3300048905 Ga0496102_0239263 Ga0496102_0239263_781_1317 178
1085 3300048905 Ga0496102_0408627 Ga0496102_0408627_511_1065 178
1086 3300048907 Ga0496104_0046813 Ga0496104_0046813_1998_2534 178
1087 3300048907 Ga0496104_0426409 Ga0496104_0426409_352_906 178
1088 3300048907 Ga0496104_0428931 Ga0496104_0428931_544_1101 178
1089 3300048908 Ga0496105_0255394 Ga0496105_0255394_461_997 178
1090 3300048909 Ga0496106_0210910 Ga0496106_0210910_628_1164 178
1091 3300048909 Ga0496106_0253254 Ga0496106_0253254_744_1280 178
1092 3300048911 Ga0496108_0023416 Ga0496108_0023416_1595_2131 178
1093 3300048911 Ga0496108_0131547 Ga0496108_0131547_20_559 178
1094 3300048911 Ga0496108_0133895 Ga0496108_0133895_261_797 178
1095 3300048912 Ga0496109_0032977 Ga0496109_0032977_949_1485 178
1096 3300048912 Ga0496109_0108278 Ga0496109_0108278_1648_2202 178
1097 3300048912 Ga0496109_0368181 Ga0496109_0368181_549_1085 178
1098 3300048912 Ga0496109_0471107 Ga0496109_0471107_130_684 178
1099 3300048913 Ga0496110_0038598 Ga0496110_0038598_2050_2586 178
1100 3300048913 Ga0496110_0041569 Ga0496110_0041569_1401_1943 178
1101 3300048913 Ga0496110_0054430 Ga0496110_0054430_2752_3309 178
1102 3300048913 Ga0496110_0077479 Ga0496110_0077479_1599_2138 178
1103 3300048913 Ga0496110_0130183 Ga0496110_0130183_1065_1622 178
1104 3300048913 Ga0496110_0183343 Ga0496110_0183343_784_1344 178
1105 3300048913 Ga0496110_0491275 Ga0496110_0491275_288_842 178
1106 3300048913 Ga0496110_0869161 Ga0496110_0869161_227_787 178
1107 3300048914 Ga0496111_0025509 Ga0496111_0025509_667_1209 178
1108 3300048914 Ga0496111_0059184 Ga0496111_0059184_541_1077 178
1109 3300048914 Ga0496111_0070842 Ga0496111_0070842_1229_1783 178
1110 3300048914 Ga0496111_0400356 Ga0496111_0400356_260_817 178
1111 3300048914 Ga0496111_0415255 Ga0496111_0415255_367_903 178
1112 3300048914 Ga0496111_0616110 Ga0496111_0616110_230_784 178
1113 3300048915 Ga0496112_0000822 Ga0496112_0000822_17028_17588 178
1114 3300048915 Ga0496112_0052528 Ga0496112_0052528_3069_3605 178
1115 3300048915 Ga0496112_1031021 Ga0496112_1031021_71_607 178
1116 3300048916 Ga0496113_0061407 Ga0496113_0061407_1549_2085 178
1117 3300048916 Ga0496113_0170681 Ga0496113_0170681_781_1338 178
1118 3300048916 Ga0496113_0307014 Ga0496113_0307014_367_903 178
1119 3300048916 Ga0496113_0641292 Ga0496113_0641292_116_667 178
1120 3300048916 Ga0496113_1187801 Ga0496113_1187801_15_569 178
1121 3300048917 Ga0496114_0092945 Ga0496114_0092945_48_584 178
1122 3300048917 Ga0496114_0282757 Ga0496114_0282757_528_1082 178
1123 3300048917 Ga0496114_0466380 Ga0496114_0466380_348_902 178
1124 3300048917 Ga0496114_0593938 Ga0496114_0593938_241_777 178
1125 3300049568 Ga0501031_0000646 Ga0501031_0000646_1973_2509 178
1126 3300049568 Ga0501031_0010436 Ga0501031_0010436_4845_5381 178
1127 3300049568 Ga0501031_0019573 Ga0501031_0019573_285_824 178
1128 3300049568 Ga0501031_0025680 Ga0501031_0025680_1032_1601 178
1129 3300049568 Ga0501031_0052345 Ga0501031_0052345_742_1278 178
1130 3300049568 Ga0501031_0070636 Ga0501031_0070636_83_619 178
1131 3300049568 Ga0501031_0259121 Ga0501031_0259121_279_815 178
1132 3300049568 Ga0501031_0269914 Ga0501031_0269914_404_961 178
1133 3300049568 Ga0501031_0339335 Ga0501031_0339335_230_766 178
1134 3300049569 Ga0501032_0006506 Ga0501032_0006506_4737_5276 178
1135 3300049569 Ga0501032_0019837 Ga0501032_0019837_3489_4025 178
1136 3300049569 Ga0501032_0127194 Ga0501032_0127194_1041_1610 178
1137 3300049569 Ga0501032_0153293 Ga0501032_0153293_649_1185 178
1138 3300049569 Ga0501032_0538726 Ga0501032_0538726_37_573 178
1139 3300049570 Ga0501033_0042708 Ga0501033_0042708_1826_2362 178
1140 3300049570 Ga0501033_0059827 Ga0501033_0059827_2151_2687 178
1141 3300049570 Ga0501033_0095464 Ga0501033_0095464_1445_1981 178
1142 3300049570 Ga0501033_0150686 Ga0501033_0150686_691_1227 178
1143 3300049570 Ga0501033_0224570 Ga0501033_0224570_778_1314 178
1144 3300049571 Ga0501034_0139283 Ga0501034_0139283_1689_2258 178
1145 3300049572 Ga0501036_0012366 Ga0501036_0012366_1501_2037 178
1146 3300049572 Ga0501036_0015689 Ga0501036_0015689_3454_3990 178
1147 3300049572 Ga0501036_0016175 Ga0501036_0016175_2441_2977 178
1148 3300049572 Ga0501036_0029682 Ga0501036_0029682_1939_2478 178
1149 3300049572 Ga0501036_0066937 Ga0501036_0066937_1169_1726 178
1150 3300049572 Ga0501036_0098725 Ga0501036_0098725_1112_1648 178
1151 3300049573 Ga0501037_0013580 Ga0501037_0013580_2932_3468 178
1152 3300049573 Ga0501037_0025128 Ga0501037_0025128_800_1369 178
1153 3300049573 Ga0501037_0025133 Ga0501037_0025133_361_900 178
1154 3300049573 Ga0501037_0049205 Ga0501037_0049205_1104_1640 178
1155 3300049574 Ga0501038_0013472 Ga0501038_0013472_1801_2337 178
1156 3300049574 Ga0501038_0036299 Ga0501038_0036299_3605_4144 178
1157 3300049574 Ga0501038_0044922 Ga0501038_0044922_1070_1606 178
1158 3300049574 Ga0501038_0145587 Ga0501038_0145587_714_1250 178
1159 3300049574 Ga0501038_0185780 Ga0501038_0185780_932_1468 178
1160 3300049574 Ga0501038_0194009 Ga0501038_0194009_459_995 178
1161 3300049575 Ga0501039_0012817 Ga0501039_0012817_5381_5920 178
1162 3300049575 Ga0501039_0018566 Ga0501039_0018566_883_1419 178
1163 3300049575 Ga0501039_0021961 Ga0501039_0021961_464_1000 178
1164 3300049575 Ga0501039_0032709 Ga0501039_0032709_2855_3391 178
1165 3300049575 Ga0501039_0064068 Ga0501039_0064068_1297_1833 178
1166 3300049575 Ga0501039_0108646 Ga0501039_0108646_711_1247 178
1167 3300049575 Ga0501039_0246439 Ga0501039_0246439_641_1177 178
1168 3300049575 Ga0501039_0269249 Ga0501039_0269249_134_673 178
1169 3300049575 Ga0501039_0736928 Ga0501039_0736928_73_612 178
1170 3300049576 Ga0501040_0003335 Ga0501040_0003335_2887_3426 178
1171 3300049576 Ga0501040_0004118 Ga0501040_0004118_5464_6000 178
1172 3300049576 Ga0501040_0007444 Ga0501040_0007444_4617_5153 178
1173 3300049576 Ga0501040_0015206 Ga0501040_0015206_1114_1683 178
1174 3300049576 Ga0501040_0021186 Ga0501040_0021186_766_1302 178
1175 3300049576 Ga0501040_0040458 Ga0501040_0040458_2583_3119 178
1176 3300049576 Ga0501040_0144703 Ga0501040_0144703_905_1462 178
1177 3300049576 Ga0501040_0179473 Ga0501040_0179473_579_1118 178
1178 3300049576 Ga0501040_0180918 Ga0501040_0180918_432_971 178
1179 3300049576 Ga0501040_0220337 Ga0501040_0220337_582_1139 178
1180 3300049576 Ga0501040_0329499 Ga0501040_0329499_491_1027 178
1181 3300049576 Ga0501040_0601488 Ga0501040_0601488_94_630 178
1182 3300049576 Ga0501040_0637919 Ga0501040_0637919_201_737 178
1183 3300049577 Ga0501041_0001234 Ga0501041_0001234_8951_9487 178
1184 3300049577 Ga0501041_0016173 Ga0501041_0016173_2167_2703 178
1185 3300049577 Ga0501041_0024836 Ga0501041_0024836_463_999 178
1186 3300049577 Ga0501041_0034729 Ga0501041_0034729_373_912 178
1187 3300049577 Ga0501041_0035308 Ga0501041_0035308_2360_2896 178
1188 3300049577 Ga0501041_0261234 Ga0501041_0261234_406_963 178
1189 3300049578 Ga0501042_0000940 Ga0501042_0000940_6381_6917 178
1190 3300049578 Ga0501042_0021235 Ga0501042_0021235_806_1345 178
1191 3300049578 Ga0501042_0051961 Ga0501042_0051961_2318_2854 178
1192 3300049578 Ga0501042_0080443 Ga0501042_0080443_250_807 178
1193 3300049578 Ga0501042_0538906 Ga0501042_0538906_107_646 178
1194 3300049579 Ga0501043_0044096 Ga0501043_0044096_852_1391 178
1195 3300049579 Ga0501043_0160264 Ga0501043_0160264_885_1421 178
1196 3300049579 Ga0501043_0472046 Ga0501043_0472046_123_659 178
1197 3300049580 Ga0501046_0016180 Ga0501046_0016180_5684_6238 178
1198 3300049580 Ga0501046_0021562 Ga0501046_0021562_1239_1775 178
1199 3300049580 Ga0501046_0021848 Ga0501046_0021848_523_1062 178
1200 3300049580 Ga0501046_0148924 Ga0501046_0148924_1008_1544 178
1201 3300049580 Ga0501046_0248865 Ga0501046_0248865_298_834 178
1202 3300049580 Ga0501046_0372453 Ga0501046_0372453_377_913 178
1203 3300049580 Ga0501046_0452392 Ga0501046_0452392_203_760 178
1204 3300049581 Ga0501047_0059931 Ga0501047_0059931_2329_2898 178
1205 3300049582 Ga0501048_0005490 Ga0501048_0005490_2934_3470 178
1206 3300049582 Ga0501048_0010054 Ga0501048_0010054_1722_2258 178
1207 3300049582 Ga0501048_0018347 Ga0501048_0018347_4227_4763 178
1208 3300049582 Ga0501048_0020044 Ga0501048_0020044_176_712 178
1209 3300049582 Ga0501048_0040217 Ga0501048_0040217_2598_3134 178
1210 3300049582 Ga0501048_0082022 Ga0501048_0082022_687_1223 178
1211 3300049582 Ga0501048_0088093 Ga0501048_0088093_871_1410 178
1212 3300049582 Ga0501048_0199860 Ga0501048_0199860_749_1306 178
1213 3300049582 Ga0501048_0886166 Ga0501048_0886166_34_570 178
1214 3300049583 Ga0501067_0371212 Ga0501067_0371212_75_611 178
1215 3300049584 Ga0501068_0025298 Ga0501068_0025298_1959_2498 178
1216 3300049584 Ga0501068_0087845 Ga0501068_0087845_155_712 178
1217 3300049584 Ga0501068_0146038 Ga0501068_0146038_387_923 178
1218 3300049584 Ga0501068_0158516 Ga0501068_0158516_628_1167 178
1219 3300049584 Ga0501068_0166673 Ga0501068_0166673_89_625 178
1220 3300049584 Ga0501068_0663803 Ga0501068_0663803_134_670 178
1221 3300049585 Ga0501069_0006210 Ga0501069_0006210_4576_5115 178
1222 3300049585 Ga0501069_0350832 Ga0501069_0350832_148_684 178
1223 3300049586 Ga0501070_0034601 Ga0501070_0034601_1080_1649 178
1224 3300049586 Ga0501070_0067314 Ga0501070_0067314_2012_2548 178
1225 3300049586 Ga0501070_0084819 Ga0501070_0084819_1563_2102 178
1226 3300049586 Ga0501070_0144855 Ga0501070_0144855_1247_1783 178
1227 3300049586 Ga0501070_0382551 Ga0501070_0382551_54_590 178
1228 3300049587 Ga0501071_0001222 Ga0501071_0001222_10489_11025 178
1229 3300049587 Ga0501071_0007933 Ga0501071_0007933_5438_5974 178
1230 3300049587 Ga0501071_0008106 Ga0501071_0008106_3054_3590 178
1231 3300049587 Ga0501071_0017269 Ga0501071_0017269_4406_4942 178
1232 3300049587 Ga0501071_0027969 Ga0501071_0027969_2932_3471 178
1233 3300049587 Ga0501071_0041871 Ga0501071_0041871_860_1399 178
1234 3300049587 Ga0501071_0043958 Ga0501071_0043958_210_746 178
1235 3300049587 Ga0501071_0099193 Ga0501071_0099193_550_1086 178
1236 3300049587 Ga0501071_0537290 Ga0501071_0537290_172_708 178
1237 3300049588 Ga0501072_0002909 Ga0501072_0002909_10163_10702 178
1238 3300049588 Ga0501072_0007444 Ga0501072_0007444_1075_1611 178
1239 3300049588 Ga0501072_0012523 Ga0501072_0012523_5564_6100 178
1240 3300049588 Ga0501072_0022877 Ga0501072_0022877_1490_2026 178
1241 3300049588 Ga0501072_0032618 Ga0501072_0032618_621_1157 178
1242 3300049588 Ga0501072_0047280 Ga0501072_0047280_2371_2907 178
1243 3300049588 Ga0501072_0087746 Ga0501072_0087746_1273_1812 178
1244 3300049588 Ga0501072_0442177 Ga0501072_0442177_77_616 178
1245 3300049588 Ga0501072_0598439 Ga0501072_0598439_260_817 178
1246 3300049589 Ga0501073_0176056 Ga0501073_0176056_84_620 178
1247 3300049589 Ga0501073_0215685 Ga0501073_0215685_320_856 178
1248 3300049590 Ga0501074_0017414 Ga0501074_0017414_3600_4139 178
1249 3300049590 Ga0501074_0017426 Ga0501074_0017426_321_857 178
1250 3300049590 Ga0501074_0037578 Ga0501074_0037578_2537_3073 178
1251 3300049590 Ga0501074_0053639 Ga0501074_0053639_533_1069 178
1252 3300049590 Ga0501074_0077651 Ga0501074_0077651_1421_1957 178
1253 3300049590 Ga0501074_0077832 Ga0501074_0077832_1812_2366 178
1254 3300049590 Ga0501074_0156578 Ga0501074_0156578_165_701 178
1255 3300049590 Ga0501074_0424496 Ga0501074_0424496_79_615 178
1256 3300049591 Ga0501075_0004323 Ga0501075_0004323_28_564 178
1257 3300049591 Ga0501075_0007446 Ga0501075_0007446_2369_2905 178
1258 3300049591 Ga0501075_0017350 Ga0501075_0017350_3745_4284 178
1259 3300049591 Ga0501075_0024684 Ga0501075_0024684_3080_3637 178
1260 3300049591 Ga0501075_0031404 Ga0501075_0031404_2895_3431 178
1261 3300049591 Ga0501075_0036130 Ga0501075_0036130_2773_3309 178
1262 3300049591 Ga0501075_0056586 Ga0501075_0056586_1049_1585 178
1263 3300049591 Ga0501075_0067573 Ga0501075_0067573_1154_1693 178
1264 3300049591 Ga0501075_0077248 Ga0501075_0077248_363_932 178
1265 3300049591 Ga0501075_0102421 Ga0501075_0102421_1554_2090 178
1266 3300049591 Ga0501075_0176748 Ga0501075_0176748_64_600 178
1267 3300049591 Ga0501075_0321961 Ga0501075_0321961_129_686 178
1268 3300049592 Ga0501076_0004640 Ga0501076_0004640_4885_5421 178
1269 3300049592 Ga0501076_0009425 Ga0501076_0009425_1176_1712 178
1270 3300049592 Ga0501076_0010541 Ga0501076_0010541_2300_2836 178
1271 3300049592 Ga0501076_0020907 Ga0501076_0020907_3019_3576 178
1272 3300049592 Ga0501076_0041591 Ga0501076_0041591_2153_2689 178
1273 3300049592 Ga0501076_0199330 Ga0501076_0199330_378_935 178
1274 3300049592 Ga0501076_0421629 Ga0501076_0421629_459_998 178
1275 3300049592 Ga0501076_0630999 Ga0501076_0630999_166_702 178
1276 3300049593 Ga0501077_0002287 Ga0501077_0002287_7052_7588 178
1277 3300049593 Ga0501077_0004462 Ga0501077_0004462_841_1380 178
1278 3300049593 Ga0501077_0005011 Ga0501077_0005011_2329_2865 178
1279 3300049593 Ga0501077_0005140 Ga0501077_0005140_2211_2747 178
1280 3300049593 Ga0501077_0019388 Ga0501077_0019388_2870_3412 178
1281 3300049593 Ga0501077_0042015 Ga0501077_0042015_133_669 178
1282 3300049593 Ga0501077_0114179 Ga0501077_0114179_252_788 178
1283 3300049593 Ga0501077_0172829 Ga0501077_0172829_79_618 178
1284 3300049593 Ga0501077_0201839 Ga0501077_0201839_664_1203 178
1285 3300049593 Ga0501077_0229083 Ga0501077_0229083_120_677 178
1286 3300049741 Ga0501079_0004606 Ga0501079_0004606_5802_6338 178
1287 3300049741 Ga0501079_0017281 Ga0501079_0017281_2963_3499 178
1288 3300049741 Ga0501079_0017486 Ga0501079_0017486_3892_4428 178
1289 3300049741 Ga0501079_0030219 Ga0501079_0030219_3361_3897 178
1290 3300049741 Ga0501079_0044340 Ga0501079_0044340_2299_2835 178
1291 3300049741 Ga0501079_0070889 Ga0501079_0070889_537_1076 178
1292 3300049741 Ga0501079_0091120 Ga0501079_0091120_1699_2235 178
1293 3300049741 Ga0501079_0149075 Ga0501079_0149075_505_1044 178
1294 3300049741 Ga0501079_0810685 Ga0501079_0810685_185_721 178
1295 3300049742 Ga0501080_0008354 Ga0501080_0008354_8171_8710 178
1296 3300049742 Ga0501080_0009822 Ga0501080_0009822_3870_4406 178
1297 3300049742 Ga0501080_0034876 Ga0501080_0034876_2454_3023 178
1298 3300049742 Ga0501080_0049787 Ga0501080_0049787_2176_2712 178
1299 3300049742 Ga0501080_0093327 Ga0501080_0093327_1711_2247 178
1300 3300049742 Ga0501080_0100386 Ga0501080_0100386_1844_2380 178
1301 3300049742 Ga0501080_0275579 Ga0501080_0275579_790_1326 178
1302 3300049743 Ga0501081_0000907 Ga0501081_0000907_7570_8106 178
1303 3300049743 Ga0501081_0005947 Ga0501081_0005947_4370_4906 178
1304 3300049743 Ga0501081_0008500 Ga0501081_0008500_3729_4265 178
1305 3300049743 Ga0501081_0014132 Ga0501081_0014132_2951_3490 178
1306 3300049743 Ga0501081_0059912 Ga0501081_0059912_1584_2120 178
1307 3300049743 Ga0501081_0114986 Ga0501081_0114986_123_659 178
1308 3300049743 Ga0501081_0166026 Ga0501081_0166026_661_1230 178
1309 3300049743 Ga0501081_0263379 Ga0501081_0263379_606_1145 178
1310 3300049743 Ga0501081_0484170 Ga0501081_0484170_241_777 178
1311 3300049743 Ga0501081_0640075 Ga0501081_0640075_43_579 178
1312 3300049744 Ga0501083_0033968 Ga0501083_0033968_1949_2518 178
1313 3300049744 Ga0501083_0040888 Ga0501083_0040888_1544_2080 178
1314 3300049744 Ga0501083_0046993 Ga0501083_0046993_1768_2307 178
1315 3300049744 Ga0501083_0149130 Ga0501083_0149130_886_1422 178
1316 3300049744 Ga0501083_0430690 Ga0501083_0430690_171_707 178
1317 3300049822 Ga0501035_0011545 Ga0501035_0011545_1767_2303 178
1318 3300049822 Ga0501035_0018184 Ga0501035_0018184_3172_3741 178
1319 3300049822 Ga0501035_0049784 Ga0501035_0049784_1418_1954 178
1320 3300049822 Ga0501035_0091308 Ga0501035_0091308_288_827 178
1321 3300049822 Ga0501035_0141660 Ga0501035_0141660_631_1167 178
1322 3300049823 Ga0501044_0044646 Ga0501044_0044646_14_568 178
1323 3300049823 Ga0501044_0247555 Ga0501044_0247555_222_758 178
1324 3300049823 Ga0501044_0490875 Ga0501044_0490875_506_1045 178
1325 3300049824 Ga0501045_0004691 Ga0501045_0004691_3565_4101 178
1326 3300049824 Ga0501045_0010957 Ga0501045_0010957_1067_1603 178
1327 3300049824 Ga0501045_0011834 Ga0501045_0011834_504_1040 178
1328 3300049824 Ga0501045_0017791 Ga0501045_0017791_2189_2725 178
1329 3300049824 Ga0501045_0018358 Ga0501045_0018358_3573_4112 178
1330 3300049824 Ga0501045_0030595 Ga0501045_0030595_1339_1896 178
1331 3300049824 Ga0501045_0120845 Ga0501045_0120845_884_1420 178
1332 3300050490 nmdc:mga03n38_137162_c2 nmdc:mga03n38_137162_c2_152_688 178
1333 3300050491 nmdc:mga00v17_8060_c1 nmdc:mga00v17_8060_c1_3434_3970 178
1334 3300050492 nmdc:mga0yw44_801467_c1 nmdc:mga0yw44_801467_c1_28_564 178
1335 3300050507 nmdc:mga05p37_152772_c1 nmdc:mga05p37_152772_c1_2005_2562 178
1336 3300050507 nmdc:mga05p37_156715_c1 nmdc:mga05p37_156715_c1_1229_1768 178
1337 3300050507 nmdc:mga05p37_233945_c1 nmdc:mga05p37_233945_c1_1090_1626 178
1338 3300050507 nmdc:mga05p37_327041_c1 nmdc:mga05p37_327041_c1_1039_1596 178
1339 3300050507 nmdc:mga05p37_51270_c1 nmdc:mga05p37_51270_c1_4397_4936 178
1340 3300050507 nmdc:mga05p37_5520_c1 nmdc:mga05p37_5520_c1_6400_6936 178
1341 3300050507 nmdc:mga05p37_72895_c1 nmdc:mga05p37_72895_c1_668_1207 178
1342 3300050507 nmdc:mga05p37_9884_c1 nmdc:mga05p37_9884_c1_3326_3880 178
1343 3300050508 nmdc:mga09592_11925_c1 nmdc:mga09592_11925_c1_3148_3684 178
1344 3300050508 nmdc:mga09592_312262_c1 nmdc:mga09592_312262_c1_679_1218 178
1345 3300050509 nmdc:mga0qj67_12271_c1 nmdc:mga0qj67_12271_c1_4524_5060 178
1346 3300050510 nmdc:mga06r32_60278_c1 nmdc:mga06r32_60278_c1_25_561 178
1347 3300050511 nmdc:mga08y16_1146260_c1 nmdc:mga08y16_1146260_c1_139_696 178
1348 3300050511 nmdc:mga08y16_115410_c1 nmdc:mga08y16_115410_c1_2128_2664 178
1349 3300050511 nmdc:mga08y16_165444_c1 nmdc:mga08y16_165444_c1_907_1449 178
1350 3300050511 nmdc:mga08y16_205539_c1 nmdc:mga08y16_205539_c1_184_741 178
1351 3300050511 nmdc:mga08y16_20885_c1 nmdc:mga08y16_20885_c1_33_590 178
1352 3300050511 nmdc:mga08y16_313818_c1 nmdc:mga08y16_313818_c1_482_1018 178
1353 3300050511 nmdc:mga08y16_434331_c1 nmdc:mga08y16_434331_c1_467_1006 178
1354 3300050511 nmdc:mga08y16_8054_c1 nmdc:mga08y16_8054_c1_7361_7897 178
1355 3300050512 nmdc:mga0n895_128378_c1 nmdc:mga0n895_128378_c1_408_965 178
1356 3300050512 nmdc:mga0n895_439485_c1 nmdc:mga0n895_439485_c1_427_966 178
1357 3300050512 nmdc:mga0n895_503432_c1 nmdc:mga0n895_503432_c1_507_1064 178
1358 3300050513 nmdc:mga0rr50_10436_c1 nmdc:mga0rr50_10436_c1_2258_2815 178
1359 3300050513 nmdc:mga0rr50_164191_c1 nmdc:mga0rr50_164191_c1_1083_1640 178
1360 3300050513 nmdc:mga0rr50_444420_c1 nmdc:mga0rr50_444420_c1_113_667 178
1361 3300050513 nmdc:mga0rr50_585328_c1 nmdc:mga0rr50_585328_c1_66_605 178
1362 3300050514 nmdc:mga08x19_50799_c1 nmdc:mga08x19_50799_c1_32_589 178
1363 3300050515 nmdc:mga0a205_121816_c1 nmdc:mga0a205_121816_c1_262_819 178
1364 3300050515 nmdc:mga0a205_141762_c1 nmdc:mga0a205_141762_c1_1342_1878 178
1365 3300053077 Ga0495601_0015979 Ga0495601_0015979_1480_2031 178
1366 3300053077 Ga0495601_0211602 Ga0495601_0211602_337_897 178
1367 3300053084 Ga0495595_0031868 Ga0495595_0031868_1484_2038 178
1368 3300053085 Ga0495619_0082552 Ga0495619_0082552_1578_2132 178
1369 3300054114 Ga0501084_0000144 Ga0501084_0000144_9585_10121 178
1370 3300054114 Ga0501084_0022872 Ga0501084_0022872_3738_4277 178
1371 3300054114 Ga0501084_0025544 Ga0501084_0025544_3265_3801 178
1372 3300054114 Ga0501084_0034741 Ga0501084_0034741_1076_1612 178
1373 3300054114 Ga0501084_0061331 Ga0501084_0061331_15_569 178
1374 3300054114 Ga0501084_0117270 Ga0501084_0117270_286_822 178
1375 3300054114 Ga0501084_0303231 Ga0501084_0303231_62_619 178
1376 3300054114 Ga0501084_0362611 Ga0501084_0362611_659_1195 178
1377 3300054114 Ga0501084_0398675 Ga0501084_0398675_116_655 178
1378 3300054114 Ga0501084_0448605 Ga0501084_0448605_62_598 178
1379 3300054114 Ga0501084_1216528 Ga0501084_1216528_34_573 178
1380 3300059426 Ga0590077_008075 Ga0590077_008075_181_720 178
1381 3300060353 Ga0501082_0003635 Ga0501082_0003635_7275_7811 178
1382 3300060353 Ga0501082_0007343 Ga0501082_0007343_3724_4263 178
1383 3300060353 Ga0501082_0038330 Ga0501082_0038330_439_975 178
1384 3300060353 Ga0501082_0050993 Ga0501082_0050993_419_988 178
1385 3300060353 Ga0501082_0062138 Ga0501082_0062138_2128_2664 178
1386 3300060353 Ga0501082_0165282 Ga0501082_0165282_451_990 178
1387 3300060353 Ga0501082_0222201 Ga0501082_0222201_394_930 178
1388 3300060353 Ga0501082_0285212 Ga0501082_0285212_571_1107 178
1389 3300060353 Ga0501082_0393686 Ga0501082_0393686_151_687 178
1390 3300060353 Ga0501082_0485552 Ga0501082_0485552_209_745 178
1391 3300060353 Ga0501082_0549006 Ga0501082_0549006_278_835 178
1392 3300060353 Ga0501082_0769365 Ga0501082_0769365_218_757 178
1393 3300061734 Ga0530510_0004416 Ga0530510_0004416_5791_6327 178
1394 3300061734 Ga0530510_0006550 Ga0530510_0006550_6387_6923 178
1395 3300061734 Ga0530510_0037591 Ga0530510_0037591_2279_2815 178
1396 3300061734 Ga0530510_0044430 Ga0530510_0044430_2580_3149 178
1397 3300061734 Ga0530510_0076539 Ga0530510_0076539_571_1107 178
1398 3300061734 Ga0530510_0507264 Ga0530510_0507264_141_677 178

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vme-assembly2.cif.gz_U human escrt-i heterotetramer headpiece 0.8508 13 73
3mxz-assembly1.cif.gz_A crystal structure of tubulin folding cofactor a from arabidopsis thaliana 0.6834 14 79
6vme-assembly2.cif.gz_U human escrt-i heterotetramer headpiece 0.5051 13 73
8ftx-assembly1.cif.gz_A flgn-flij fusion complex 0.4551 1 139
2dnx-assembly1.cif.gz_A solution structure of rsgi ruh-063, an n-terminal domain of syntaxin 12 from human cdna 0.4496 1 146
ID Description Score Start End Superfamily
4iggB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8005 17 79 1.10.287.160
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7717 13 82 1.10.287.160
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7528 13 82 1.10.287.160
4iggB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7253 17 79 1.10.287.160
3mxzA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6834 14 79 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A7W0SR42-F1-model_v4 DUF4254 domain-containing protein 0.9975 2 178
AF-A0A7W0SR42-F1-model_v4 DUF4254 domain-containing protein 0.9919 2 178
AF-A0A7V9CWL0-F1-model_v4 Uncharacterized protein 0.9627 28 178
AF-A0A7V9CWL0-F1-model_v4 Uncharacterized protein 0.9566 28 178
AF-A0A7Y5U717-F1-model_v4 Uncharacterized protein 0.8438 2 96

Feature Viewer

pLDDT pTM Quality
94.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map