F493482

General Info

Members Datasets Scaffolds Average Seq Length
1377 395 2754 115

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10025323|Ga0105243_100253233
Length 137
Sequence MTQNVETAPAARTLRDMAASAEPARTMLPVHQAGQCSVAATGEIVGSKWTVLIVHDLSEGPRRFTELEHACAGISPRTLAERLRWLEAEGIVVRRSYAESPPRVEYELTDKGDALKPIIDEMRRFGHEWLGCDVHSA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
207 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
256 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
257 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
258 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
261 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
262 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
263 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
264 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
265 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
269 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 6.03
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10025323 3300009148 Bacteria 4532
2 JGI24747J21853_1031309 3300001978 Bacteria 609
3 JGI24743J22301_10006625 3300001991 Bacteria 1982
4 JGI24743J22301_10052076 3300001991 Unclassified 835
5 JGI24743J22301_10072539 3300001991 Bacteria 719
6 JGI24738J21930_10017112 3300002075 Bacteria 1526
7 JGI24033J26618_1017366 3300002155 Unclassified 900
8 JGI24034J26672_10025166 3300002239 Bacteria 951
9 JGI24751J29686_10111242 3300002459 Bacteria 574
10 JGI25406J46586_10013282 3300003203 Bacteria 3543
11 Ga0058862_11948148 3300004803 Bacteria 549
12 Ga0070658_10154985 3300005327 Bacteria 1920
13 Ga0070658_10191527 3300005327 Bacteria 1723
14 Ga0070676_10069255 3300005328 Bacteria 2114
15 Ga0070676_10129842 3300005328 Bacteria 1592
16 Ga0070676_10431802 3300005328 Bacteria 922
17 Ga0070676_10583319 3300005328 Bacteria 804
18 Ga0070683_100001405 3300005329 Bacteria 18499
19 Ga0070683_100019032 3300005329 Bacteria 6092
20 Ga0070683_100030770 3300005329 Bacteria 4877
21 Ga0070683_100158958 3300005329 Bacteria 2144
22 Ga0070683_100197316 3300005329 Bacteria 1911
23 Ga0070683_100237391 3300005329 Bacteria 1734
24 Ga0070683_100387842 3300005329 Bacteria 1331
25 Ga0070683_100534476 3300005329 Bacteria 1121
26 Ga0070683_102427233 3300005329 Unclassified 502
27 Ga0070690_100123873 3300005330 Bacteria 1738
28 Ga0070690_100169633 3300005330 Bacteria 1501
29 Ga0070670_100009289 3300005331 Bacteria 8398
30 Ga0070670_100015080 3300005331 Bacteria 6632
31 Ga0070670_100081538 3300005331 Bacteria 2779
32 Ga0070677_10559961 3300005333 Bacteria 628
33 Ga0068869_100019754 3300005334 Bacteria 4610
34 Ga0068869_100890976 3300005334 Bacteria 769
35 Ga0070680_100009539 3300005336 Bacteria 7455
36 Ga0070680_100021512 3300005336 Bacteria 5127
37 Ga0070680_100050228 3300005336 Bacteria 3401
38 Ga0070680_100244669 3300005336 Bacteria 1516
39 Ga0070682_100012429 3300005337 Bacteria 4883
40 Ga0070682_100023546 3300005337 Bacteria 3656
41 Ga0070682_100121130 3300005337 Bacteria 1757
42 Ga0070682_100232193 3300005337 Bacteria 1319
43 Ga0070682_100905053 3300005337 Bacteria 725
44 Ga0070682_101400430 3300005337 Archaea 598
45 Ga0068868_100065936 3300005338 Bacteria 2877
46 Ga0068868_100113491 3300005338 Bacteria 2203
47 Ga0068868_100187850 3300005338 Bacteria 1717
48 Ga0068868_100349631 3300005338 Bacteria 1266
49 Ga0068868_100621575 3300005338 Bacteria 959
50 Ga0068868_100725116 3300005338 Bacteria 891
51 Ga0070660_100002717 3300005339 Bacteria 12155
52 Ga0070660_100028904 3300005339 Bacteria 4151
53 Ga0070660_100033834 3300005339 Bacteria 3856
54 Ga0070660_100099843 3300005339 Bacteria 2299
55 Ga0070660_100131256 3300005339 Bacteria 2005
56 Ga0070660_100180917 3300005339 Bacteria 1706
57 Ga0070689_100003852 3300005340 Bacteria 10052
58 Ga0070689_100122934 3300005340 Bacteria 2074
59 Ga0070689_100157203 3300005340 Bacteria 1836
60 Ga0070691_10003135 3300005341 Bacteria 7402
61 Ga0070691_10030728 3300005341 Bacteria 2517
62 Ga0070687_100064372 3300005343 Bacteria 1948
63 Ga0070687_100111875 3300005343 Unclassified 1547
64 Ga0070661_100004092 3300005344 Bacteria 10049
65 Ga0070661_100073769 3300005344 Bacteria 2512
66 Ga0070661_100466461 3300005344 Unclassified 1006
67 Ga0070692_10000917 3300005345 Bacteria 9982
68 Ga0070692_10015220 3300005345 Bacteria 3634
69 Ga0070692_10042146 3300005345 Bacteria 2342
70 Ga0070692_10375824 3300005345 Bacteria 890
71 Ga0070668_100093049 3300005347 Bacteria 2379
72 Ga0070668_100099110 3300005347 Bacteria 2307
73 Ga0070668_100391319 3300005347 Unclassified 1185
74 Ga0070675_100013579 3300005354 Bacteria 6404
75 Ga0070675_100064339 3300005354 Bacteria 3032
76 Ga0070675_101173522 3300005354 Unclassified 707
77 Ga0070671_100138274 3300005355 Bacteria 2054
78 Ga0070671_100183393 3300005355 Bacteria 1772
79 Ga0070671_100382069 3300005355 Unclassified 1204
80 Ga0070671_101839761 3300005355 Bacteria 538
81 Ga0070674_100006249 3300005356 Bacteria 6934
82 Ga0070674_100017624 3300005356 Bacteria 4498
83 Ga0070674_100060431 3300005356 Bacteria 2641
84 Ga0070674_100137826 3300005356 Bacteria 1828
85 Ga0070674_100151478 3300005356 Bacteria 1751
86 Ga0070674_100738264 3300005356 Bacteria 845
87 Ga0070674_100879113 3300005356 Bacteria 779
88 Ga0070674_101402457 3300005356 Bacteria 626
89 Ga0070673_100018469 3300005364 Bacteria 4982
90 Ga0070673_100039084 3300005364 Bacteria 3628
91 Ga0070673_100228655 3300005364 Bacteria 1613
92 Ga0070688_100035677 3300005365 Bacteria 3021
93 Ga0070688_100046950 3300005365 Bacteria 2676
94 Ga0070659_100005769 3300005366 Bacteria 8911
95 Ga0070659_100020421 3300005366 Bacteria 5031
96 Ga0070659_100030033 3300005366 Bacteria 4204
97 Ga0070659_100076580 3300005366 Bacteria 2667
98 Ga0070659_100082947 3300005366 Bacteria 2561
99 Ga0070659_100636536 3300005366 Bacteria 919
100 Ga0070667_100181378 3300005367 Bacteria 1862
101 Ga0070709_10095271 3300005434 Bacteria 1971
102 Ga0070714_100032641 3300005435 Bacteria 4347
103 Ga0070713_100129371 3300005436 Bacteria 2225
104 Ga0070701_10038796 3300005438 Bacteria 2413
105 Ga0070701_10039581 3300005438 Bacteria 2392
106 Ga0070701_10746602 3300005438 Bacteria 662
107 Ga0070705_100934122 3300005440 Bacteria 700
108 Ga0070700_100114821 3300005441 Bacteria 1796
109 Ga0070700_100213931 3300005441 Bacteria 1362
110 Ga0070700_100535784 3300005441 Bacteria 907
111 Ga0070694_100144022 3300005444 Bacteria 1734
112 Ga0070694_100215822 3300005444 Bacteria 1437
113 Ga0070694_100267002 3300005444 Bacteria 1300
114 Ga0070694_100288694 3300005444 Bacteria 1253
115 Ga0070708_100113488 3300005445 Bacteria 2492
116 Ga0070708_100701405 3300005445 Bacteria 953
117 Ga0070708_101029493 3300005445 Bacteria 772
118 Ga0070708_101049714 3300005445 Bacteria 764
119 Ga0070663_100091921 3300005455 Bacteria 2249
120 Ga0070663_100378909 3300005455 Bacteria 1152
121 Ga0070663_100503284 3300005455 Unclassified 1006
122 Ga0070678_100020509 3300005456 Bacteria 4338
123 Ga0070678_100036136 3300005456 Bacteria 3456
124 Ga0070678_100046431 3300005456 Bacteria 3114
125 Ga0070678_100503227 3300005456 Unclassified 1069
126 Ga0070678_101656125 3300005456 Bacteria 601
127 Ga0070662_100011454 3300005457 Bacteria 5852
128 Ga0070662_100047899 3300005457 Bacteria 3077
129 Ga0070662_100115846 3300005457 Bacteria 2047
130 Ga0070662_101415533 3300005457 Bacteria 599
131 Ga0070681_10033554 3300005458 Bacteria 5152
132 Ga0070681_10088761 3300005458 Bacteria 3043
133 Ga0070681_10384719 3300005458 Bacteria 1314
134 Ga0068867_100007801 3300005459 Bacteria 7570
135 Ga0068867_100027137 3300005459 Bacteria 4114
136 Ga0068867_100084350 3300005459 Bacteria 2400
137 Ga0068867_100206789 3300005459 Bacteria 1574
138 Ga0068867_100526444 3300005459 Bacteria 1020
139 Ga0068867_100562592 3300005459 Bacteria 989
140 Ga0070685_10004165 3300005466 Bacteria 7297
141 Ga0070685_10016935 3300005466 Bacteria 3891
142 Ga0070685_10031326 3300005466 Bacteria 2970
143 Ga0070706_100047233 3300005467 Bacteria 3972
144 Ga0070707_100027798 3300005468 Bacteria 5381
145 Ga0070707_100258432 3300005468 Unclassified 1694
146 Ga0070707_101081671 3300005468 Bacteria 768
147 Ga0070698_100079986 3300005471 Bacteria 3264
148 Ga0070698_100416419 3300005471 Bacteria 1278
149 Ga0070698_100451343 3300005471 Bacteria 1221
150 Ga0070699_100005200 3300005518 Bacteria 11442
151 Ga0070699_100155093 3300005518 Bacteria 2026
152 Ga0070699_100252609 3300005518 Bacteria 1575
153 Ga0070699_100536889 3300005518 Bacteria 1064
154 Ga0070679_100078953 3300005530 Bacteria 3280
155 Ga0070679_100081458 3300005530 Bacteria 3226
156 Ga0070679_100102120 3300005530 Bacteria 2854
157 Ga0070679_100115819 3300005530 Bacteria 2665
158 Ga0070679_100193876 3300005530 Unclassified 1999
159 Ga0070679_100324007 3300005530 Bacteria 1490
160 Ga0070679_101266688 3300005530 Bacteria 683
161 Ga0070684_100012224 3300005535 Bacteria 6871
162 Ga0070684_100030097 3300005535 Bacteria 4610
163 Ga0070684_100033606 3300005535 Bacteria 4381
164 Ga0070684_100047104 3300005535 Bacteria 3736
165 Ga0070684_100047834 3300005535 Bacteria 3708
166 Ga0070684_100104616 3300005535 Bacteria 2532
167 Ga0070684_100169758 3300005535 Bacteria 1981
168 Ga0070684_100304565 3300005535 Bacteria 1462
169 Ga0070684_100533209 3300005535 Unclassified 1088
170 Ga0070684_100598596 3300005535 Bacteria 1025
171 Ga0070697_100612367 3300005536 Bacteria 957
172 Ga0070697_100664615 3300005536 Unclassified 918
173 Ga0070697_101531841 3300005536 Bacteria 596
174 Ga0068853_100030585 3300005539 Bacteria 4549
175 Ga0068853_100043247 3300005539 Bacteria 3854
176 Ga0068853_100476837 3300005539 Bacteria 1176
177 Ga0068853_100645724 3300005539 Bacteria 1007
178 Ga0070672_100016503 3300005543 Bacteria 5288
179 Ga0070672_100031054 3300005543 Bacteria 4018
180 Ga0070672_100041035 3300005543 Bacteria 3554
181 Ga0070672_100715872 3300005543 Unclassified 877
182 Ga0070672_101408373 3300005543 Unclassified 624
183 Ga0070686_100026827 3300005544 Bacteria 3480
184 Ga0070686_100141771 3300005544 Bacteria 1674
185 Ga0070686_100176280 3300005544 Bacteria 1516
186 Ga0070695_100301139 3300005545 Bacteria 1185
187 Ga0070695_100307007 3300005545 Bacteria 1175
188 Ga0070695_100763506 3300005545 Bacteria 772
189 Ga0070696_100626699 3300005546 Bacteria 869
190 Ga0070693_100015948 3300005547 Bacteria 3879
191 Ga0070693_100054589 3300005547 Bacteria 2298
192 Ga0070693_100106136 3300005547 Bacteria 1719
193 Ga0070693_101149608 3300005547 Bacteria 594
194 Ga0070665_100023124 3300005548 Bacteria 6262
195 Ga0070665_100278994 3300005548 Bacteria 1673
196 Ga0070704_100048900 3300005549 Bacteria 2962
197 Ga0070704_100078313 3300005549 Bacteria 2425
198 Ga0070704_100870360 3300005549 Bacteria 809
199 Ga0068855_100174806 3300005563 Bacteria 2430
200 Ga0068855_100622971 3300005563 Bacteria 1161
201 Ga0068855_101332101 3300005563 Bacteria 742
202 Ga0070664_100016770 3300005564 Bacteria 6011
203 Ga0070664_100019661 3300005564 Bacteria 5558
204 Ga0070664_100613081 3300005564 Bacteria 1010
205 Ga0070664_101232699 3300005564 Bacteria 706
206 Ga0068857_100013490 3300005577 Bacteria 7118
207 Ga0068857_100378601 3300005577 Bacteria 1314
208 Ga0068857_100573238 3300005577 Unclassified 1065
209 Ga0068854_100192654 3300005578 Bacteria 1598
210 Ga0068854_100253860 3300005578 Bacteria 1405
211 Ga0068856_100013469 3300005614 Bacteria 7914
212 Ga0068856_100060165 3300005614 Bacteria 3752
213 Ga0068856_100229082 3300005614 Bacteria 1874
214 Ga0068856_101242312 3300005614 Viruses 761
215 Ga0070702_100008487 3300005615 Bacteria 4979
216 Ga0070702_100012133 3300005615 Bacteria 4306
217 Ga0070702_100092102 3300005615 Bacteria 1840
218 Ga0070702_100863935 3300005615 Bacteria 705
219 Ga0068852_100097305 3300005616 Bacteria 2647
220 Ga0068852_100564459 3300005616 Bacteria 1140
221 Ga0068852_100609234 3300005616 Bacteria 1097
222 Ga0068859_100033061 3300005617 Bacteria 5195
223 Ga0068864_100012769 3300005618 Bacteria 6943
224 Ga0068864_100039006 3300005618 Bacteria 4058
225 Ga0068864_100512999 3300005618 Unclassified 1155
226 Ga0068866_10003279 3300005718 Bacteria 6652
227 Ga0068866_10014812 3300005718 Bacteria 3452
228 Ga0068866_10050978 3300005718 Bacteria 2104
229 Ga0068866_10141841 3300005718 Unclassified 1380
230 Ga0068866_10260137 3300005718 Bacteria 1066
231 Ga0068861_100048189 3300005719 Bacteria 3220
232 Ga0068861_100094098 3300005719 Bacteria 2371
233 Ga0068861_100245563 3300005719 Bacteria 1525
234 Ga0068861_100280246 3300005719 Unclassified 1435
235 Ga0068851_10015652 3300005834 Bacteria 3617
236 Ga0068851_10037325 3300005834 Bacteria 2435
237 Ga0068851_10522985 3300005834 Bacteria 714
238 Ga0068870_10002280 3300005840 Bacteria 7967
239 Ga0068870_10014111 3300005840 Bacteria 3768
240 Ga0068870_10020026 3300005840 Bacteria 3252
241 Ga0068870_10082875 3300005840 Bacteria 1777
242 Ga0068870_10425617 3300005840 Bacteria 870
243 Ga0068870_10893650 3300005840 Bacteria 627
244 Ga0068863_100343255 3300005841 Bacteria 1453
245 Ga0068863_101952968 3300005841 Bacteria 597
246 Ga0068863_102200928 3300005841 Bacteria 561
247 Ga0068858_100031628 3300005842 Bacteria 4916
248 Ga0068858_100108309 3300005842 Bacteria 2594
249 Ga0068858_100809234 3300005842 Unclassified 914
250 Ga0068860_100180416 3300005843 Bacteria 2040
251 Ga0068860_100224189 3300005843 Bacteria 1826
252 Ga0068862_100636004 3300005844 Bacteria 1028
253 Ga0068862_101032690 3300005844 Bacteria 814
254 Ga0068862_101909718 3300005844 Bacteria 604
255 Ga0081455_10002152 3300005937 Bacteria 23499
256 Ga0081455_10047017 3300005937 Bacteria 3740
257 Ga0081455_10133409 3300005937 Bacteria 1938
258 Ga0081455_10179722 3300005937 Unclassified 1603
259 Ga0081455_10187366 3300005937 Bacteria 1562
260 Ga0081455_10196766 3300005937 Bacteria 1513
261 Ga0081455_10405094 3300005937 Bacteria 945
262 Ga0081455_10602559 3300005937 Bacteria 716
263 Ga0081455_10757500 3300005937 Unclassified 613
264 Ga0081540_1002321 3300005983 Bacteria 15592
265 Ga0081540_1031707 3300005983 Bacteria 2899
266 Ga0081539_10000216 3300005985 Bacteria 134976
267 Ga0081539_10000477 3300005985 Bacteria 84784
268 Ga0081539_10072272 3300005985 Bacteria 1844
269 Ga0075365_10210994 3300006038 Bacteria 1361
270 Ga0075365_10288063 3300006038 Bacteria 1156
271 Ga0075365_11345489 3300006038 Bacteria 502
272 Ga0075363_100029161 3300006048 Bacteria 2846
273 Ga0075364_10170931 3300006051 Bacteria 1469
274 Ga0075432_10018044 3300006058 Bacteria 2407
275 Ga0075432_10024469 3300006058 Bacteria 2069
276 Ga0075432_10047999 3300006058 Bacteria 1501
277 Ga0075432_10450664 3300006058 Unclassified 565
278 Ga0070715_10111678 3300006163 Bacteria 1290
279 Ga0070712_100013595 3300006175 Bacteria 5204
280 Ga0070712_100058885 3300006175 Bacteria 2703
281 Ga0075362_10530563 3300006177 Bacteria 604
282 Ga0097621_100011148 3300006237 Bacteria 6614
283 Ga0097621_100099488 3300006237 Bacteria 2444
284 Ga0097621_100738175 3300006237 Bacteria 909
285 Ga0075370_10222779 3300006353 Bacteria 1115
286 Ga0068871_100020551 3300006358 Bacteria 5060
287 Ga0068871_100107339 3300006358 Bacteria 2345
288 Ga0068871_100454719 3300006358 Unclassified 1148
289 Ga0068871_102096404 3300006358 Unclassified 539
290 Ga0075428_100021129 3300006844 Bacteria 7209
291 Ga0075428_100093526 3300006844 Bacteria 3278
292 Ga0075428_100323134 3300006844 Bacteria 1658
293 Ga0075428_100332370 3300006844 Bacteria 1632
294 Ga0075428_100881229 3300006844 Bacteria 950
295 Ga0075428_101315789 3300006844 Bacteria 760
296 Ga0075428_102167997 3300006844 Unclassified 574
297 Ga0075430_100018650 3300006846 Bacteria 5905
298 Ga0075431_100046111 3300006847 Bacteria 4494
299 Ga0075431_100150296 3300006847 Bacteria 2398
300 Ga0075431_100201326 3300006847 Bacteria 2037
301 Ga0075431_100645521 3300006847 Bacteria 1039
302 Ga0075433_10118026 3300006852 Bacteria 2355
303 Ga0075433_10270457 3300006852 Bacteria 1506
304 Ga0075433_10324135 3300006852 Unclassified 1363
305 Ga0075433_10372833 3300006852 Bacteria 1260
306 Ga0075433_10377534 3300006852 Bacteria 1252
307 Ga0075433_10395328 3300006852 Bacteria 1220
308 Ga0075433_10451589 3300006852 Bacteria 1133
309 Ga0075434_100070475 3300006871 Bacteria 3486
310 Ga0075434_100355004 3300006871 Unclassified 1487
311 Ga0075434_100413709 3300006871 Bacteria 1369
312 Ga0075434_100866148 3300006871 Bacteria 919
313 Ga0075434_101467019 3300006871 Unclassified 692
314 Ga0075429_100010926 3300006880 Bacteria 7855
315 Ga0075429_100030337 3300006880 Bacteria 4696
316 Ga0075429_100067941 3300006880 Bacteria 3102
317 Ga0075429_100527580 3300006880 Bacteria 1035
318 Ga0068865_100003153 3300006881 Bacteria 9868
319 Ga0068865_100010036 3300006881 Bacteria 5890
320 Ga0068865_100015979 3300006881 Bacteria 4794
321 Ga0068865_100051631 3300006881 Bacteria 2847
322 Ga0068865_100074599 3300006881 Bacteria 2416
323 Ga0068865_100177956 3300006881 Bacteria 1636
324 Ga0068865_100257253 3300006881 Bacteria 1381
325 Ga0068865_100824311 3300006881 Bacteria 802
326 Ga0075436_100030852 3300006914 Bacteria 3689
327 Ga0075436_100899977 3300006914 Unclassified 662
328 Ga0097620_100033061 3300006931 Bacteria 5195
329 Ga0075435_100023363 3300007076 Bacteria 4781
330 Ga0075435_100184243 3300007076 Bacteria 1765
331 Ga0105244_10195536 3300009036 Bacteria 955
332 Ga0105240_10430523 3300009093 Bacteria 1480
333 Ga0111539_10028825 3300009094 Bacteria 6770
334 Ga0111539_10035537 3300009094 Bacteria 6032
335 Ga0111539_10380814 3300009094 Bacteria 1643
336 Ga0111539_10426431 3300009094 Bacteria 1545
337 Ga0111539_10458036 3300009094 Bacteria 1485
338 Ga0111539_10553146 3300009094 Bacteria 1340
339 Ga0111539_11063406 3300009094 Unclassified 940
340 Ga0111539_11102737 3300009094 Bacteria 922
341 Ga0111539_12968849 3300009094 Bacteria 548
342 Ga0111539_13512423 3300009094 Unclassified 503
343 Ga0105245_10000865 3300009098 Bacteria 27482
344 Ga0105245_10005696 3300009098 Bacteria 10943
345 Ga0105245_10041836 3300009098 Bacteria 4086
346 Ga0105245_10051897 3300009098 Bacteria 3677
347 Ga0105245_10073898 3300009098 Bacteria 3101
348 Ga0105245_10156839 3300009098 Bacteria 2156
349 Ga0105245_10303962 3300009098 Bacteria 1566
350 Ga0105245_10382829 3300009098 Bacteria 1401
351 Ga0105245_10457848 3300009098 Bacteria 1285
352 Ga0105245_10618879 3300009098 Unclassified 1111
353 Ga0105245_10940392 3300009098 Bacteria 907
354 Ga0105245_11762507 3300009098 Bacteria 672
355 Ga0105247_10015667 3300009101 Bacteria 4538
356 Ga0114129_10017864 3300009147 Bacteria 10099
357 Ga0114129_10030517 3300009147 Bacteria 7627
358 Ga0114129_10114533 3300009147 Bacteria 3718
359 Ga0114129_10115187 3300009147 Bacteria 3706
360 Ga0114129_10302540 3300009147 Bacteria 2131
361 Ga0114129_10363336 3300009147 Bacteria 1915
362 Ga0114129_10476383 3300009147 Bacteria 1634
363 Ga0114129_10841008 3300009147 Bacteria 1168
364 Ga0114129_10864412 3300009147 Bacteria 1149
365 Ga0114129_11106428 3300009147 Bacteria 992
366 Ga0114129_11517850 3300009147 Bacteria 823
367 Ga0105243_10010340 3300009148 Bacteria 7087
368 Ga0105243_10019868 3300009148 Bacteria 5095
369 Ga0105243_10020472 3300009148 Bacteria 5015
370 Ga0105243_10040453 3300009148 Bacteria 3641
371 Ga0105243_10239865 3300009148 Unclassified 1613
372 Ga0105243_11534396 3300009148 Bacteria 691
373 Ga0105243_12672455 3300009148 Unclassified 539
374 Ga0105241_10125672 3300009174 Bacteria 2070
375 Ga0105241_10445680 3300009174 Bacteria 1144
376 Ga0105242_10004020 3300009176 Bacteria 11432
377 Ga0105242_10008513 3300009176 Bacteria 7877
378 Ga0105242_10019399 3300009176 Bacteria 5327
379 Ga0105242_10067739 3300009176 Bacteria 2952
380 Ga0105242_10285111 3300009176 Unclassified 1502
381 Ga0105242_10365803 3300009176 Unclassified 1336
382 Ga0105242_10935468 3300009176 Bacteria 870
383 Ga0105242_11071049 3300009176 Bacteria 818
384 Ga0105242_11794508 3300009176 Unclassified 652
385 Ga0105248_10020638 3300009177 Bacteria 7301
386 Ga0105248_10056569 3300009177 Bacteria 4401
387 Ga0105248_10066880 3300009177 Bacteria 4035
388 Ga0105248_10335881 3300009177 Unclassified 1701
389 Ga0105248_11233844 3300009177 Bacteria 845
390 Ga0105237_10185040 3300009545 Bacteria 2083
391 Ga0105238_10533963 3300009551 Unclassified 1176
392 Ga0105238_10618239 3300009551 Bacteria 1092
393 Ga0105238_12068732 3300009551 Bacteria 603
394 Ga0105249_10089242 3300009553 Bacteria 2880
395 Ga0105249_10105026 3300009553 Bacteria 2663
396 Ga0105249_10262139 3300009553 Bacteria 1718
397 Ga0105239_10008794 3300010375 Bacteria 11428
398 Ga0105239_10040473 3300010375 Bacteria 5106
399 Ga0105239_10241430 3300010375 Bacteria 2028
400 Ga0105239_10650258 3300010375 Bacteria 1204
401 Ga0105239_10726171 3300010375 Bacteria 1136
402 Ga0105239_11229853 3300010375 Bacteria 863
403 Ga0105239_11738416 3300010375 Unclassified 722
404 Ga0105239_11860739 3300010375 Bacteria 698
405 Ga0105239_12803543 3300010375 Unclassified 569
406 Ga0105246_10004814 3300011119 Bacteria 8222
407 Ga0105246_10068066 3300011119 Bacteria 2496
408 Ga0105246_10068186 3300011119 Bacteria 2494
409 Ga0105246_10188289 3300011119 Bacteria 1595
410 Ga0105246_10452831 3300011119 Bacteria 1079
411 Ga0105246_12318081 3300011119 Unclassified 525
412 Ga0157325_1014658 3300012485 Bacteria 632
413 Ga0157373_10081338 3300013100 Bacteria 2283
414 Ga0157373_10969842 3300013100 Archaea 633
415 Ga0157371_10033070 3300013102 Bacteria 3718
416 Ga0157371_10133271 3300013102 Bacteria 1768
417 Ga0157371_10292857 3300013102 Bacteria 1177
418 Ga0157369_10015732 3300013105 Bacteria 8525
419 Ga0157369_11351306 3300013105 Unclassified 726
420 Ga0157369_11705710 3300013105 Bacteria 640
421 Ga0157374_10033250 3300013296 Bacteria 4705
422 Ga0157374_11945346 3300013296 Bacteria 614
423 Ga0157378_10169648 3300013297 Bacteria 2046
424 Ga0157378_10716846 3300013297 Unclassified 1021
425 Ga0157378_11175632 3300013297 Bacteria 806
426 Ga0163162_10242880 3300013306 Bacteria 1932
427 Ga0163162_10266149 3300013306 Bacteria 1846
428 Ga0163162_10449533 3300013306 Bacteria 1420
429 Ga0163162_12176262 3300013306 Bacteria 637
430 Ga0157372_10005778 3300013307 Bacteria 13177
431 Ga0157372_10016713 3300013307 Bacteria 7876
432 Ga0157372_10431391 3300013307 Bacteria 1536
433 Ga0157372_10922020 3300013307 Bacteria 1013
434 Ga0157375_10002706 3300013308 Bacteria 15333
435 Ga0157375_10021156 3300013308 Bacteria 5958
436 Ga0157375_10062886 3300013308 Bacteria 3690
437 Ga0157375_10108931 3300013308 Bacteria 2865
438 Ga0157375_10416814 3300013308 Bacteria 1509
439 Ga0157375_10472117 3300013308 Unclassified 1420
440 Ga0157375_10702129 3300013308 Unclassified 1165
441 Ga0157375_12043383 3300013308 Unclassified 681
442 Ga0163163_10167410 3300014325 Bacteria 2244
443 Ga0163163_10242090 3300014325 Bacteria 1854
444 Ga0163163_10272801 3300014325 Bacteria 1742
445 Ga0163163_10336208 3300014325 Bacteria 1565
446 Ga0163163_10486289 3300014325 Bacteria 1296
447 Ga0163163_10609764 3300014325 Unclassified 1155
448 Ga0163163_11389123 3300014325 Unclassified 764
449 Ga0157380_10029906 3300014326 Bacteria 4167
450 Ga0157380_10042173 3300014326 Bacteria 3565
451 Ga0157380_10105103 3300014326 Bacteria 2360
452 Ga0157380_10209134 3300014326 Bacteria 1737
453 Ga0157380_11382979 3300014326 Bacteria 754
454 Ga0157380_11874534 3300014326 Bacteria 660
455 Ga0182008_10001466 3300014497 Bacteria 15780
456 Ga0182008_10122262 3300014497 Bacteria 1294
457 Ga0182008_10220222 3300014497 Bacteria 971
458 Ga0157377_10002959 3300014745 Bacteria 7598
459 Ga0157377_10022631 3300014745 Bacteria 3321
460 Ga0157377_10028581 3300014745 Bacteria 3002
461 Ga0157377_10185563 3300014745 Bacteria 1311
462 Ga0157377_10239673 3300014745 Unclassified 1170
463 Ga0157377_10268121 3300014745 Bacteria 1114
464 Ga0157377_10795888 3300014745 Bacteria 696
465 Ga0157377_10879466 3300014745 Unclassified 668
466 Ga0157379_10074306 3300014968 Bacteria 3043
467 Ga0157379_10102275 3300014968 Bacteria 2572
468 Ga0157376_10082624 3300014969 Bacteria 2761
469 Ga0157376_10112317 3300014969 Bacteria 2400
470 Ga0157376_10135284 3300014969 Bacteria 2205
471 Ga0157376_10521871 3300014969 Unclassified 1171
472 Ga0157376_11400437 3300014969 Bacteria 731
473 Ga0182007_10004451 3300015262 Bacteria 6349
474 Ga0182005_1218142 3300015265 Bacteria 579
475 Ga0163161_10072570 3300017792 Bacteria 2520
476 Ga0163161_10595678 3300017792 Bacteria 911
477 Ga0163161_11781222 3300017792 Bacteria 547
478 Ga0163161_11808438 3300017792 Unclassified 543
479 Ga0197907_11367132 3300020069 Bacteria 623
480 Ga0206356_11323765 3300020070 Bacteria 817
481 Ga0206356_11343203 3300020070 Bacteria 1406
482 Ga0206354_11018335 3300020081 Bacteria 923
483 Ga0206354_11270724 3300020081 Bacteria 1358
484 Ga0206353_10552488 3300020082 Bacteria 6068
485 Ga0206353_11117021 3300020082 Bacteria 1377
486 Ga0206353_11424935 3300020082 Bacteria 909
487 Ga0207656_10125709 3300025321 Bacteria 1198
488 Ga0207656_10226675 3300025321 Bacteria 910
489 Ga0207642_10425410 3300025899 Unclassified 800
490 Ga0207642_10446671 3300025899 Bacteria 783
491 Ga0207710_10082795 3300025900 Bacteria 1491
492 Ga0207688_10000816 3300025901 Bacteria 15597
493 Ga0207688_10009328 3300025901 Bacteria 5349
494 Ga0207688_10264938 3300025901 Bacteria 1044
495 Ga0207688_10322937 3300025901 Bacteria 947
496 Ga0207688_10818561 3300025901 Unclassified 590
497 Ga0207645_10033975 3300025907 Bacteria 3276
498 Ga0207645_10076212 3300025907 Bacteria 2148
499 Ga0207643_10002335 3300025908 Bacteria 10319
500 Ga0207643_10004431 3300025908 Bacteria 7549
501 Ga0207643_10039762 3300025908 Bacteria 2646
502 Ga0207643_10047409 3300025908 Bacteria 2431
503 Ga0207643_10104191 3300025908 Bacteria 1666
504 Ga0207643_10149942 3300025908 Bacteria 1397
505 Ga0207705_10934434 3300025909 Bacteria 671
506 Ga0207684_10336736 3300025910 Bacteria 1299
507 Ga0207654_10219739 3300025911 Bacteria 1260
508 Ga0207654_11122068 3300025911 Bacteria 573
509 Ga0207707_10061566 3300025912 Bacteria 3265
510 Ga0207707_10075947 3300025912 Bacteria 2932
511 Ga0207707_10088880 3300025912 Bacteria 2699
512 Ga0207707_10167632 3300025912 Bacteria 1919
513 Ga0207707_10518234 3300025912 Unclassified 1015
514 Ga0207707_11475315 3300025912 Archaea 540
515 Ga0207695_10709942 3300025913 Bacteria 886
516 Ga0207695_10796479 3300025913 Unclassified 825
517 Ga0207671_10373549 3300025914 Bacteria 1132
518 Ga0207693_10003543 3300025915 Bacteria 13334
519 Ga0207693_10128234 3300025915 Bacteria 1994
520 Ga0207663_10735133 3300025916 Unclassified 783
521 Ga0207660_10038385 3300025917 Bacteria 3343
522 Ga0207660_10173306 3300025917 Bacteria 1671
523 Ga0207660_10233050 3300025917 Bacteria 1448
524 Ga0207660_10564082 3300025917 Bacteria 926
525 Ga0207662_10021188 3300025918 Bacteria 3712
526 Ga0207662_10047572 3300025918 Bacteria 2541
527 Ga0207662_11261206 3300025918 Bacteria 525
528 Ga0207657_10001687 3300025919 Bacteria 23810
529 Ga0207657_10030201 3300025919 Bacteria 4922
530 Ga0207657_10032572 3300025919 Bacteria 4707
531 Ga0207657_10045985 3300025919 Bacteria 3826
532 Ga0207649_10160018 3300025920 Bacteria 1559
533 Ga0207652_10086827 3300025921 Bacteria 2743
534 Ga0207652_10274328 3300025921 Bacteria 1521
535 Ga0207652_10285055 3300025921 Bacteria 1490
536 Ga0207652_10339736 3300025921 Bacteria 1355
537 Ga0207652_10901234 3300025921 Bacteria 781
538 Ga0207646_10116968 3300025922 Bacteria 2394
539 Ga0207646_10300738 3300025922 Bacteria 1450
540 Ga0207646_11172626 3300025922 Bacteria 674
541 Ga0207681_10369374 3300025923 Bacteria 1152
542 Ga0207681_10890528 3300025923 Bacteria 745
543 Ga0207694_10426091 3300025924 Bacteria 1106
544 Ga0207694_10609311 3300025924 Bacteria 918
545 Ga0207694_10656596 3300025924 Bacteria 884
546 Ga0207650_10014285 3300025925 Bacteria 5517
547 Ga0207650_10038074 3300025925 Bacteria 3508
548 Ga0207650_10053525 3300025925 Bacteria 2992
549 Ga0207659_10026007 3300025926 Bacteria 3943
550 Ga0207659_10115188 3300025926 Bacteria 2050
551 Ga0207659_10467048 3300025926 Bacteria 1065
552 Ga0207659_11183424 3300025926 Bacteria 657
553 Ga0207659_11383087 3300025926 Unclassified 603
554 Ga0207687_10015021 3300025927 Bacteria 5072
555 Ga0207687_10040500 3300025927 Bacteria 3194
556 Ga0207687_10292385 3300025927 Bacteria 1310
557 Ga0207687_10348041 3300025927 Bacteria 1207
558 Ga0207687_10603712 3300025927 Bacteria 925
559 Ga0207687_10770019 3300025927 Unclassified 820
560 Ga0207687_11068832 3300025927 Bacteria 693
561 Ga0207664_10003682 3300025929 Bacteria 10275
562 Ga0207664_10680284 3300025929 Bacteria 925
563 Ga0207664_11390569 3300025929 Unclassified 622
564 Ga0207664_11396284 3300025929 Bacteria 621
565 Ga0207644_10086949 3300025931 Bacteria 2322
566 Ga0207644_10285440 3300025931 Bacteria 1326
567 Ga0207690_10066731 3300025932 Bacteria 2465
568 Ga0207690_10068632 3300025932 Bacteria 2436
569 Ga0207690_10198335 3300025932 Bacteria 1522
570 Ga0207690_10968534 3300025932 Bacteria 707
571 Ga0207706_10030464 3300025933 Bacteria 4812
572 Ga0207706_10041080 3300025933 Bacteria 4100
573 Ga0207706_10055817 3300025933 Bacteria 3482
574 Ga0207706_11425456 3300025933 Unclassified 568
575 Ga0207686_10046937 3300025934 Bacteria 2668
576 Ga0207686_10056842 3300025934 Bacteria 2461
577 Ga0207686_10102534 3300025934 Bacteria 1913
578 Ga0207686_10178773 3300025934 Unclassified 1503
579 Ga0207686_10530088 3300025934 Bacteria 918
580 Ga0207686_10745421 3300025934 Bacteria 781
581 Ga0207709_10013980 3300025935 Bacteria 4432
582 Ga0207709_10037019 3300025935 Bacteria 2897
583 Ga0207709_10199207 3300025935 Bacteria 1429
584 Ga0207709_10303820 3300025935 Unclassified 1188
585 Ga0207709_11314828 3300025935 Unclassified 598
586 Ga0207670_10091776 3300025936 Bacteria 2148
587 Ga0207670_10320098 3300025936 Bacteria 1220
588 Ga0207670_10542229 3300025936 Bacteria 949
589 Ga0207669_10007683 3300025937 Bacteria 5010
590 Ga0207669_10012223 3300025937 Bacteria 4215
591 Ga0207669_10107161 3300025937 Bacteria 1863
592 Ga0207669_10131920 3300025937 Bacteria 1718
593 Ga0207669_10283455 3300025937 Bacteria 1251
594 Ga0207669_10392902 3300025937 Bacteria 1084
595 Ga0207669_10485173 3300025937 Bacteria 986
596 Ga0207669_10607861 3300025937 Bacteria 889
597 Ga0207669_10705079 3300025937 Bacteria 830
598 Ga0207669_10789229 3300025937 Bacteria 787
599 Ga0207669_11770750 3300025937 Unclassified 528
600 Ga0207704_10049937 3300025938 Bacteria 2521
601 Ga0207704_10057714 3300025938 Bacteria 2386
602 Ga0207704_10112644 3300025938 Bacteria 1843
603 Ga0207704_10229714 3300025938 Bacteria 1379
604 Ga0207704_10591565 3300025938 Bacteria 907
605 Ga0207704_11369625 3300025938 Unclassified 606
606 Ga0207691_10009024 3300025940 Bacteria 9562
607 Ga0207691_10009851 3300025940 Bacteria 9170
608 Ga0207691_10025077 3300025940 Bacteria 5601
609 Ga0207691_10074503 3300025940 Bacteria 3062
610 Ga0207711_10081924 3300025941 Bacteria 2820
611 Ga0207711_10302897 3300025941 Unclassified 1474
612 Ga0207711_10350367 3300025941 Bacteria 1367
613 Ga0207711_10479490 3300025941 Bacteria 1159
614 Ga0207711_10595505 3300025941 Bacteria 1031
615 Ga0207689_10283512 3300025942 Bacteria 1372
616 Ga0207689_10601803 3300025942 Bacteria 925
617 Ga0207689_11237435 3300025942 Unclassified 628
618 Ga0207689_11473129 3300025942 Unclassified 569
619 Ga0207661_10064817 3300025944 Bacteria 2963
620 Ga0207661_10147292 3300025944 Bacteria 2032
621 Ga0207661_10153385 3300025944 Bacteria 1993
622 Ga0207661_10202435 3300025944 Bacteria 1746
623 Ga0207661_10458639 3300025944 Bacteria 1161
624 Ga0207679_10013388 3300025945 Bacteria 5376
625 Ga0207679_10181741 3300025945 Bacteria 1740
626 Ga0207679_10195758 3300025945 Bacteria 1684
627 Ga0207679_10376326 3300025945 Bacteria 1244
628 Ga0207679_10452887 3300025945 Bacteria 1138
629 Ga0207679_10869514 3300025945 Bacteria 824
630 Ga0207667_10030665 3300025949 Bacteria 5812
631 Ga0207667_10814154 3300025949 Bacteria 930
632 Ga0207651_10055080 3300025960 Bacteria 2729
633 Ga0207651_10207305 3300025960 Bacteria 1575
634 Ga0207651_10370720 3300025960 Bacteria 1211
635 Ga0207651_10799863 3300025960 Bacteria 836
636 Ga0207712_10646451 3300025961 Bacteria 919
637 Ga0207668_10082390 3300025972 Bacteria 2337
638 Ga0207668_10106093 3300025972 Bacteria 2098
639 Ga0207668_10112312 3300025972 Bacteria 2047
640 Ga0207668_11913950 3300025972 Bacteria 535
641 Ga0207640_10041421 3300025981 Bacteria 2929
642 Ga0207640_10260423 3300025981 Bacteria 1351
643 Ga0207658_10054357 3300025986 Bacteria 2963
644 Ga0207658_11380129 3300025986 Bacteria 645
645 Ga0207677_10020382 3300026023 Bacteria 4025
646 Ga0207677_10375507 3300026023 Bacteria 1198
647 Ga0207677_10858426 3300026023 Bacteria 816
648 Ga0207677_10867028 3300026023 Bacteria 812
649 Ga0207703_10124591 3300026035 Bacteria 2216
650 Ga0207639_10240992 3300026041 Bacteria 1572
651 Ga0207639_10254909 3300026041 Bacteria 1532
652 Ga0207639_10333113 3300026041 Bacteria 1351
653 Ga0207639_10473212 3300026041 Unclassified 1141
654 Ga0207639_12015725 3300026041 Unclassified 538
655 Ga0207678_10138725 3300026067 Bacteria 2075
656 Ga0207678_10241341 3300026067 Bacteria 1547
657 Ga0207678_10504675 3300026067 Bacteria 1055
658 Ga0207678_10601471 3300026067 Bacteria 964
659 Ga0207678_11329534 3300026067 Unclassified 636
660 Ga0207708_10003549 3300026075 Bacteria 11492
661 Ga0207708_10009415 3300026075 Bacteria 7233
662 Ga0207708_10148934 3300026075 Bacteria 1841
663 Ga0207708_10246883 3300026075 Bacteria 1437
664 Ga0207708_10793359 3300026075 Unclassified 815
665 Ga0207708_10830899 3300026075 Bacteria 797
666 Ga0207708_11768314 3300026075 Bacteria 542
667 Ga0207702_10036281 3300026078 Bacteria 4123
668 Ga0207702_10120898 3300026078 Bacteria 2344
669 Ga0207641_10093901 3300026088 Bacteria 2630
670 Ga0207641_10325861 3300026088 Bacteria 1458
671 Ga0207641_10687679 3300026088 Bacteria 1007
672 Ga0207648_10021040 3300026089 Bacteria 5870
673 Ga0207648_10080374 3300026089 Bacteria 2844
674 Ga0207648_10227688 3300026089 Bacteria 1658
675 Ga0207648_10295689 3300026089 Bacteria 1451
676 Ga0207648_10334740 3300026089 Bacteria 1362
677 Ga0207676_10028753 3300026095 Bacteria 4156
678 Ga0207676_10505943 3300026095 Bacteria 1148
679 Ga0207674_10074954 3300026116 Bacteria 3394
680 Ga0207674_10492048 3300026116 Bacteria 1185
681 Ga0207674_10543606 3300026116 Bacteria 1122
682 Ga0207674_10707244 3300026116 Bacteria 973
683 Ga0207674_10737592 3300026116 Bacteria 951
684 Ga0207674_11844099 3300026116 Bacteria 571
685 Ga0207675_100082828 3300026118 Bacteria 3009
686 Ga0207675_100140533 3300026118 Bacteria 2294
687 Ga0207675_100265643 3300026118 Unclassified 1664
688 Ga0207675_101140419 3300026118 Bacteria 800
689 Ga0207683_10008257 3300026121 Bacteria 8905
690 Ga0207683_10037163 3300026121 Bacteria 4241
691 Ga0207683_10039656 3300026121 Bacteria 4109
692 Ga0207683_10158422 3300026121 Bacteria 2045
693 Ga0207683_10164461 3300026121 Bacteria 2007
694 Ga0207683_10375927 3300026121 Bacteria 1306
695 Ga0207683_10417505 3300026121 Bacteria 1235
696 Ga0207683_11603830 3300026121 Unclassified 600
697 Ga0207698_10025840 3300026142 Bacteria 4144
698 Ga0207698_10066186 3300026142 Bacteria 2843
699 Ga0207698_10538372 3300026142 Bacteria 1142
700 Ga0207698_10643691 3300026142 Bacteria 1049
701 Ga0209998_10034288 3300027717 Bacteria 1134
702 Ga0209998_10075560 3300027717 Bacteria 810
703 Ga0207428_10001196 3300027907 Bacteria 27877
704 Ga0207428_10002858 3300027907 Bacteria 17124
705 Ga0207428_10003094 3300027907 Bacteria 16362
706 Ga0207428_10010613 3300027907 Bacteria 8219
707 Ga0207428_10022792 3300027907 Bacteria 5277
708 Ga0207428_10143221 3300027907 Bacteria 1823
709 Ga0207428_10547134 3300027907 Bacteria 837
710 Ga0268266_10079681 3300028379 Bacteria 2852
711 Ga0268266_10123673 3300028379 Bacteria 2305
712 Ga0268265_10019384 3300028380 Bacteria 4728
713 Ga0268265_10977271 3300028380 Bacteria 835
714 Ga0268264_10096769 3300028381 Bacteria 2557
715 Ga0268264_10186364 3300028381 Bacteria 1888
716 Ga0265337_1074129 3300028556 Bacteria 933
717 Ga0265337_1134499 3300028556 Bacteria 670
718 Ga0265319_1018074 3300028563 Bacteria 2667
719 Ga0265319_1023935 3300028563 Bacteria 2206
720 Ga0265334_10013253 3300028573 Bacteria 3453
721 Ga0265318_10010982 3300028577 Bacteria 3920
722 Ga0265318_10059198 3300028577 Bacteria 1429
723 Ga0265318_10267775 3300028577 Unclassified 623
724 Ga0265323_10027737 3300028653 Bacteria 2126
725 Ga0265322_10061912 3300028654 Bacteria 1061
726 Ga0265336_10094075 3300028666 Bacteria 893
727 Ga0265338_10002825 3300028800 Bacteria 25357
728 Ga0265338_10040946 3300028800 Bacteria 4341
729 Ga0265338_10056999 3300028800 Bacteria 3459
730 Ga0265338_10075267 3300028800 Bacteria 2866
731 Ga0265332_10010966 3300031238 Bacteria 4025
732 Ga0265320_10025656 3300031240 Bacteria 3095
733 Ga0265325_10017313 3300031241 Bacteria 4007
734 Ga0265325_10039449 3300031241 Bacteria 2487
735 Ga0265329_10014417 3300031242 Bacteria 2790
736 Ga0265329_10141505 3300031242 Bacteria 777
737 Ga0265340_10008842 3300031247 Bacteria 5425
738 Ga0265339_10108848 3300031249 Bacteria 1435
739 Ga0265331_10013454 3300031250 Bacteria 4398
740 Ga0265327_10015984 3300031251 Bacteria 4802
741 Ga0265327_10029446 3300031251 Bacteria 3123
742 Ga0265316_10032193 3300031344 Bacteria 4280
743 Ga0265316_10980405 3300031344 Archaea 588
744 Ga0265313_10019317 3300031595 Bacteria 3796
745 Ga0265313_10042770 3300031595 Bacteria 2222
746 Ga0265314_10026163 3300031711 Bacteria 4388
747 Ga0265314_10057812 3300031711 Bacteria 2660
748 Ga0265342_10144772 3300031712 Bacteria 1324
749 Ga0373930_0012507 3300034816 Bacteria 1550
750 Ga0373948_0014747 3300034817 Unclassified 1428
751 Ga0373958_0135882 3300034819 Bacteria 605
752 Ga0373959_0018800 3300034820 Bacteria 1303
753 Ga0373934_0007365 3300035086 Bacteria 4084
754 Ga0373949_0011197 3300035090 Bacteria 1973
755 Ga0373951_0106474 3300035091 Bacteria 750
756 Ga0373952_0210375 3300035092 Bacteria 573
757 Ga0373932_0125041 3300035112 Bacteria 861
758 Ga0373941_0005509 3300035115 Bacteria 2984
759 Ga0373953_0476330 3300035117 Unclassified 553
760 Ga0373954_0186210 3300035118 Bacteria 1019
761 Ga0373960_0046379 3300035121 Bacteria 1275
762 Ga0373943_0028124 3300035170 Bacteria 2648
763 Ga0373955_0054516 3300035172 Bacteria 2187
764 Ga0373942_0032748 3300035207 Bacteria 1382
765 Ga0373942_0054887 3300035207 Bacteria 1127
766 Ga0373961_0025852 3300035241 Bacteria 1600
767 Ga0373961_0157372 3300035241 Bacteria 778
768 Ga0373962_0017357 3300035242 Bacteria 1865
769 Ga0373924_0052199 3300035410 Bacteria 1697
770 Ga0373931_0066731 3300035691 Bacteria 1953
771 Ga0373931_0301673 3300035691 Bacteria 989
772 Ga0373931_0321633 3300035691 Bacteria 961
773 Ga0373933_0132028 3300035724 Bacteria 1571
774 Ga0373937_1173568 3300036401 Bacteria 716
775 Ga0395899_0119377 3300037312 Bacteria 1890
776 Ga0395899_0217119 3300037312 Bacteria 1326
777 Ga0395899_0314505 3300037312 Unclassified 1056
778 Ga0395899_0530947 3300037312 Bacteria 759
779 Ga0395900_0052851 3300037418 Bacteria 4182
780 Ga0395900_0244599 3300037418 Bacteria 1798
781 Ga0395900_0375606 3300037418 Unclassified 1390
782 Ga0395900_0525960 3300037418 Bacteria 1130
783 Ga0395900_0602637 3300037418 Bacteria 1039
784 Ga0395900_1051256 3300037418 Bacteria 733
785 Ga0395900_1191339 3300037418 Bacteria 677
786 Ga0395900_1224734 3300037418 Bacteria 666
787 Ga0395900_1631245 3300037418 Unclassified 556
788 Ga0395898_0004143 3300037466 Bacteria 15899
789 Ga0395898_0057869 3300037466 Bacteria 3775
790 Ga0395898_0116582 3300037466 Bacteria 2559
791 Ga0395898_0473016 3300037466 Bacteria 1192
792 Ga0395898_0594721 3300037466 Bacteria 1049
793 Ga0395898_1060610 3300037466 Bacteria 745
794 Ga0395898_1749150 3300037466 Unclassified 544
795 Ga0395898_1772148 3300037466 Unclassified 539
796 Ga0395905_0003900 3300037471 Bacteria 15734
797 Ga0395905_0032900 3300037471 Bacteria 4875
798 Ga0395905_0167044 3300037471 Bacteria 2068
799 Ga0395905_1327733 3300037471 Unclassified 623
800 Ga0395905_1467979 3300037471 Bacteria 586
801 Ga0395901_0001175 3300038443 Bacteria 27810
802 Ga0395901_0001894 3300038443 Bacteria 21606
803 Ga0395901_0099969 3300038443 Bacteria 3042
804 Ga0395901_0114319 3300038443 Bacteria 2835
805 Ga0395901_0487897 3300038443 Bacteria 1256
806 Ga0395901_0615013 3300038443 Bacteria 1094
807 Ga0395901_0990451 3300038443 Bacteria 817
808 Ga0395901_1978857 3300038443 Unclassified 529
809 Ga0439453_0065349 3300041408 Unclassified 761
810 Ga0451793_0140964 3300041452 Bacteria 904
811 Ga0451793_1117621 3300041452 Unclassified 809
812 Ga0451795_0186197 3300041456 Unclassified 840
813 Ga0451798_0170046 3300041458 Bacteria 754
814 Ga0451802_2063843 3300041460 Unclassified 588
815 Ga0451807_0366467 3300041486 Bacteria 1246
816 Ga0451835_1071592 3300041492 Bacteria 1630
817 Ga0451837_1771718 3300041494 Unclassified 550
818 Ga0451845_0377167 3300041501 Bacteria 612
819 Ga0451847_0626268 3300041503 Bacteria 579
820 Ga0451853_0503966 3300041512 Unclassified 661
821 Ga0451853_1439937 3300041512 Bacteria 915
822 Ga0439448_0063343 3300042005 Bacteria 1224
823 Ga0450920_111143 3300042122 Unclassified 572
824 Ga0450923_194098 3300042125 Unclassified 503
825 Ga0450902_065821 3300042137 Unclassified 629
826 Ga0450906_002797 3300042145 Bacteria 3804
827 Ga0450907_002290 3300042146 Bacteria 3708
828 Ga0439458_0110535 3300042157 Bacteria 718
829 Ga0439435_0142734 3300042436 Bacteria 764
830 Ga0439435_0223276 3300042436 Bacteria 627
831 Ga0439435_0293667 3300042436 Bacteria 555
832 Ga0439464_0065129 3300042439 Bacteria 1072
833 Ga0439464_0177517 3300042439 Bacteria 673
834 Ga0439440_0224842 3300042993 Bacteria 564
835 Ga0453683_1040393 3300044673 Unclassified 544
836 Ga0466966_0207824 3300044684 Bacteria 1184
837 Ga0466961_0666967 3300044693 Bacteria 624
838 Ga0466963_0245251 3300044694 Bacteria 1257
839 Ga0466963_0287439 3300044694 Bacteria 1156
840 Ga0466963_0321310 3300044694 Bacteria 1089
841 Ga0466963_0652258 3300044694 Unclassified 743
842 Ga0466964_0034636 3300044706 Bacteria 2015
843 Ga0466964_0518221 3300044706 Bacteria 643
844 Ga0466971_0095768 3300044719 Bacteria 1361
845 Ga0466971_0304871 3300044719 Bacteria 765
846 Ga0466968_0101672 3300044735 Bacteria 1284
847 Ga0466968_0149931 3300044735 Bacteria 1071
848 Ga0466970_0560701 3300044765 Bacteria 661
849 Ga0466957_0417883 3300044842 Bacteria 919
850 Ga0466957_0712018 3300044842 Bacteria 709
851 Ga0466959_0289215 3300045049 Bacteria 1124
852 Ga0451576_1016160 3300045051 Bacteria 869
853 Ga0466958_0170690 3300045836 Bacteria 1377
854 Ga0466958_0185582 3300045836 Bacteria 1321
855 Ga0466958_0598288 3300045836 Unclassified 717
856 Ga0466967_0000047 3300045976 Bacteria 43648
857 Ga0466967_0083772 3300045976 Bacteria 2884
858 Ga0466967_0161369 3300045976 Bacteria 2104
859 Ga0466967_0215087 3300045976 Bacteria 1824
860 Ga0466967_0272680 3300045976 Unclassified 1621
861 Ga0466967_0405542 3300045976 Bacteria 1327
862 Ga0466967_0489428 3300045976 Bacteria 1206
863 Ga0466967_0535907 3300045976 Bacteria 1151
864 Ga0466967_0582082 3300045976 Bacteria 1103
865 Ga0495592_0553975 3300046454 Bacteria 707
866 Ga0495603_0035829 3300046455 Bacteria 2980
867 Ga0495603_0073846 3300046455 Bacteria 2003
868 Ga0495603_0279380 3300046455 Bacteria 960
869 Ga0495603_0475192 3300046455 Unclassified 716
870 Ga0495603_0614567 3300046455 Unclassified 622
871 Ga0495603_0808555 3300046455 Unclassified 534
872 Ga0495641_0188497 3300046461 Bacteria 924
873 Ga0495641_0288069 3300046461 Bacteria 740
874 Ga0495651_0028264 3300046462 Bacteria 4371
875 Ga0495653_0029348 3300046463 Bacteria 4392
876 Ga0495582_0781134 3300046473 Unclassified 553
877 Ga0495584_0158577 3300046491 Bacteria 1150
878 Ga0495596_0270604 3300046500 Unclassified 660
879 Ga0495608_0003415 3300046511 Bacteria 11374
880 Ga0495628_0430286 3300046516 Bacteria 961
881 Ga0495630_0372191 3300046517 Bacteria 1094
882 Ga0495630_0412315 3300046517 Bacteria 1035
883 Ga0495637_0217763 3300046520 Bacteria 696
884 Ga0495643_0515435 3300046522 Unclassified 513
885 Ga0495644_0150018 3300046523 Bacteria 892
886 Ga0495640_0096177 3300046533 Bacteria 1949
887 Ga0495640_0257189 3300046533 Bacteria 1092
888 Ga0495587_0245230 3300046536 Bacteria 1008
889 Ga0495622_0257262 3300046557 Bacteria 767
890 Ga0495633_0447927 3300046558 Bacteria 583
891 Ga0495633_0498449 3300046558 Bacteria 549
892 Ga0495667_0099258 3300046559 Unclassified 1885
893 Ga0495667_0186580 3300046559 Bacteria 1330
894 Ga0495656_0825891 3300046615 Bacteria 501
895 Ga0495634_0202108 3300046642 Bacteria 1234
896 Ga0495634_0387686 3300046642 Bacteria 832
897 Ga0495635_0284772 3300046663 Bacteria 1110
898 Ga0495659_0429567 3300046664 Bacteria 573
899 Ga0495588_0305543 3300046674 Bacteria 837
900 Ga0495657_0175976 3300046675 Bacteria 1315
901 Ga0495646_0595845 3300046680 Bacteria 562
902 Ga0495658_0084809 3300046683 Bacteria 1866
903 Ga0495669_0155967 3300046684 Bacteria 1082
904 Ga0495669_0468321 3300046684 Unclassified 612
905 Ga0495613_0345113 3300046689 Bacteria 1023
906 Ga0495613_0751315 3300046689 Bacteria 639
907 Ga0495670_0205910 3300046691 Unclassified 1043
908 Ga0495671_0389084 3300046692 Bacteria 668
909 Ga0495589_0133893 3300046794 Bacteria 1189
910 Ga0495660_0372994 3300046810 Bacteria 630
911 Ga0495581_0327730 3300047315 Bacteria 894
912 Ga0495674_0034616 3300047319 Bacteria 4566
913 Ga0495674_0587126 3300047319 Bacteria 884
914 Ga0495676_0128272 3300047321 Bacteria 1835
915 Ga0495676_0410071 3300047321 Bacteria 898
916 Ga0495680_0030143 3300047322 Bacteria 4433
917 Ga0495680_0447692 3300047322 Bacteria 884
918 Ga0495675_0519850 3300047444 Bacteria 682
919 Ga0495677_0024931 3300047445 Bacteria 2170
920 Ga0495677_0410004 3300047445 Bacteria 536
921 Ga0495684_0829812 3300047471 Unclassified 601
922 Ga0495602_0255950 3300048088 Bacteria 1302
923 Ga0495602_1150795 3300048088 Unclassified 507
924 Ga0495626_0221376 3300048091 Unclassified 769
925 Ga0496100_0016868 3300048903 Bacteria 4297
926 Ga0496100_0076658 3300048903 Bacteria 2245
927 Ga0496100_0393818 3300048903 Unclassified 1054
928 Ga0496100_0452147 3300048903 Bacteria 985
929 Ga0496100_1139677 3300048903 Bacteria 615
930 Ga0496101_0040100 3300048904 Bacteria 3335
931 Ga0496101_0069709 3300048904 Bacteria 2573
932 Ga0496101_0221245 3300048904 Unclassified 1469
933 Ga0496101_0267798 3300048904 Bacteria 1333
934 Ga0496101_0377968 3300048904 Unclassified 1114
935 Ga0496101_0524279 3300048904 Bacteria 936
936 Ga0496101_1166398 3300048904 Bacteria 604
937 Ga0496102_0094521 3300048905 Bacteria 2770
938 Ga0496102_0162475 3300048905 Bacteria 2101
939 Ga0496102_0504034 3300048905 Unclassified 1133
940 Ga0496102_1373151 3300048905 Bacteria 626
941 Ga0496102_1668037 3300048905 Unclassified 555
942 Ga0496103_0041231 3300048906 Bacteria 2838
943 Ga0496103_0410328 3300048906 Bacteria 870
944 Ga0496104_0043681 3300048907 Bacteria 4209
945 Ga0496104_0069316 3300048907 Bacteria 3352
946 Ga0496104_0813958 3300048907 Bacteria 840
947 Ga0496104_1799970 3300048907 Unclassified 515
948 Ga0496105_0057142 3300048908 Bacteria 3222
949 Ga0496105_0281869 3300048908 Bacteria 1340
950 Ga0496105_0695404 3300048908 Unclassified 781
951 Ga0496105_0878244 3300048908 Unclassified 677
952 Ga0496105_1039787 3300048908 Viruses 611
953 Ga0496106_0050988 3300048909 Bacteria 3120
954 Ga0496106_0061387 3300048909 Bacteria 2851
955 Ga0496106_0527575 3300048909 Bacteria 948
956 Ga0496106_0674510 3300048909 Bacteria 825
957 Ga0496106_0703878 3300048909 Bacteria 805
958 Ga0496106_1153680 3300048909 Bacteria 606
959 Ga0496106_1176749 3300048909 Bacteria 599
960 Ga0496107_0020386 3300048910 Bacteria 4682
961 Ga0496107_0286648 3300048910 Unclassified 1226
962 Ga0496107_0675976 3300048910 Bacteria 760
963 Ga0496107_0928531 3300048910 Bacteria 634
964 Ga0496108_0008153 3300048911 Bacteria 8496
965 Ga0496108_0059292 3300048911 Bacteria 3218
966 Ga0496108_0123995 3300048911 Bacteria 2217
967 Ga0496108_0574805 3300048911 Bacteria 982
968 Ga0496108_0678092 3300048911 Bacteria 895
969 Ga0496109_0026615 3300048912 Bacteria 5159
970 Ga0496109_0072401 3300048912 Bacteria 3166
971 Ga0496109_0084777 3300048912 Bacteria 2924
972 Ga0496109_0112802 3300048912 Bacteria 2528
973 Ga0496109_0404795 3300048912 Bacteria 1289
974 Ga0496109_0431052 3300048912 Bacteria 1245
975 Ga0496109_0477626 3300048912 Bacteria 1177
976 Ga0496110_0024462 3300048913 Bacteria 5146
977 Ga0496110_0034274 3300048913 Bacteria 4397
978 Ga0496110_0038123 3300048913 Bacteria 4180
979 Ga0496110_0064213 3300048913 Bacteria 3244
980 Ga0496110_0521186 3300048913 Bacteria 1081
981 Ga0496110_0577812 3300048913 Bacteria 1020
982 Ga0496110_0639966 3300048913 Unclassified 963
983 Ga0496110_1048870 3300048913 Bacteria 723
984 Ga0496111_0008218 3300048914 Bacteria 6898
985 Ga0496111_0016469 3300048914 Bacteria 5093
986 Ga0496111_0055552 3300048914 Bacteria 2864
987 Ga0496111_0142828 3300048914 Bacteria 1774
988 Ga0496111_0658641 3300048914 Bacteria 764
989 Ga0496111_1040429 3300048914 Bacteria 585
990 Ga0496112_0083822 3300048915 Bacteria 3153
991 Ga0496112_0284341 3300048915 Bacteria 1600
992 Ga0496112_0336448 3300048915 Bacteria 1453
993 Ga0496112_0692825 3300048915 Bacteria 947
994 Ga0496113_0088351 3300048916 Bacteria 2384
995 Ga0496113_0357962 3300048916 Bacteria 1171
996 Ga0496113_1422783 3300048916 Bacteria 537
997 Ga0496114_0004408 3300048917 Bacteria 10918
998 Ga0496114_0061930 3300048917 Bacteria 3131
999 Ga0496114_0411326 3300048917 Bacteria 1198
1000 Ga0496114_0427260 3300048917 Bacteria 1174
1001 Ga0496115_0135596 3300048918 Bacteria 2030
1002 Ga0501031_0012038 3300049568 Bacteria 5641
1003 Ga0501031_0046419 3300049568 Bacteria 2832
1004 Ga0501031_0102930 3300049568 Bacteria 1863
1005 Ga0501031_0133062 3300049568 Bacteria 1625
1006 Ga0501031_0268790 3300049568 Bacteria 1107
1007 Ga0501031_0618238 3300049568 Bacteria 697
1008 Ga0501031_0772134 3300049568 Bacteria 616
1009 Ga0501032_0009312 3300049569 Bacteria 7112
1010 Ga0501032_0040718 3300049569 Bacteria 3157
1011 Ga0501032_0258716 3300049569 Archaea 1129
1012 Ga0501033_0021846 3300049570 Bacteria 4829
1013 Ga0501033_0036869 3300049570 Bacteria 3662
1014 Ga0501033_0325338 3300049570 Bacteria 1080
1015 Ga0501033_0738189 3300049570 Bacteria 668
1016 Ga0501034_0006648 3300049571 Bacteria 12406
1017 Ga0501034_0241853 3300049571 Bacteria 1751
1018 Ga0501036_0028893 3300049572 Bacteria 4686
1019 Ga0501036_0067807 3300049572 Bacteria 3019
1020 Ga0501036_0950110 3300049572 Bacteria 704
1021 Ga0501036_1054021 3300049572 Bacteria 665
1022 Ga0501036_1255580 3300049572 Bacteria 603
1023 Ga0501036_1264560 3300049572 Bacteria 600
1024 Ga0501036_1572774 3300049572 Bacteria 531
1025 Ga0501037_0025445 3300049573 Bacteria 4373
1026 Ga0501037_0093995 3300049573 Bacteria 2168
1027 Ga0501037_0336475 3300049573 Unclassified 1043
1028 Ga0501037_0642386 3300049573 Bacteria 710
1029 Ga0501037_0877976 3300049573 Bacteria 589
1030 Ga0501038_0014026 3300049574 Bacteria 7303
1031 Ga0501038_0022951 3300049574 Bacteria 5585
1032 Ga0501038_0099483 3300049574 Bacteria 2424
1033 Ga0501038_0104310 3300049574 Bacteria 2356
1034 Ga0501038_0107049 3300049574 Bacteria 2320
1035 Ga0501039_0017827 3300049575 Bacteria 5447
1036 Ga0501039_0020329 3300049575 Bacteria 5089
1037 Ga0501039_0044490 3300049575 Bacteria 3429
1038 Ga0501039_0069024 3300049575 Bacteria 2744
1039 Ga0501039_0187473 3300049575 Bacteria 1627
1040 Ga0501039_0310053 3300049575 Bacteria 1240
1041 Ga0501039_0332769 3300049575 Bacteria 1193
1042 Ga0501039_0342544 3300049575 Bacteria 1175
1043 Ga0501040_0025559 3300049576 Bacteria 3971
1044 Ga0501040_0034647 3300049576 Bacteria 3420
1045 Ga0501040_0060242 3300049576 Bacteria 2608
1046 Ga0501040_0104962 3300049576 Bacteria 1974
1047 Ga0501040_0154227 3300049576 Bacteria 1621
1048 Ga0501040_0237634 3300049576 Unclassified 1298
1049 Ga0501040_0241137 3300049576 Bacteria 1289
1050 Ga0501040_0272580 3300049576 Unclassified 1208
1051 Ga0501040_0597726 3300049576 Unclassified 797
1052 Ga0501041_0008903 3300049577 Bacteria 5906
1053 Ga0501041_0014526 3300049577 Bacteria 4676
1054 Ga0501041_0015210 3300049577 Bacteria 4569
1055 Ga0501041_0019270 3300049577 Bacteria 4073
1056 Ga0501041_0040061 3300049577 Bacteria 2843
1057 Ga0501041_0072764 3300049577 Bacteria 2112
1058 Ga0501041_0135766 3300049577 Bacteria 1533
1059 Ga0501041_0211426 3300049577 Bacteria 1217
1060 Ga0501042_0003538 3300049578 Bacteria 9829
1061 Ga0501042_0017606 3300049578 Bacteria 4931
1062 Ga0501042_0026539 3300049578 Bacteria 4069
1063 Ga0501042_0027078 3300049578 Bacteria 4030
1064 Ga0501042_0030894 3300049578 Bacteria 3788
1065 Ga0501042_0106781 3300049578 Bacteria 2015
1066 Ga0501042_0133533 3300049578 Bacteria 1789
1067 Ga0501042_0144127 3300049578 Bacteria 1718
1068 Ga0501042_0270108 3300049578 Bacteria 1228
1069 Ga0501042_0675095 3300049578 Bacteria 751
1070 Ga0501043_0034936 3300049579 Bacteria 3954
1071 Ga0501043_0042331 3300049579 Bacteria 3579
1072 Ga0501043_0118712 3300049579 Bacteria 2074
1073 Ga0501043_0276892 3300049579 Bacteria 1287
1074 Ga0501043_0672144 3300049579 Bacteria 759
1075 Ga0501046_0007807 3300049580 Bacteria 9387
1076 Ga0501046_0008573 3300049580 Bacteria 8897
1077 Ga0501046_0087294 3300049580 Bacteria 2404
1078 Ga0501046_0167359 3300049580 Unclassified 1651
1079 Ga0501046_0336084 3300049580 Bacteria 1098
1080 Ga0501046_0383796 3300049580 Bacteria 1016
1081 Ga0501046_0579556 3300049580 Bacteria 798
1082 Ga0501046_0788196 3300049580 Bacteria 666
1083 Ga0501046_0801238 3300049580 Bacteria 660
1084 Ga0501047_0126429 3300049581 Bacteria 2437
1085 Ga0501047_0196516 3300049581 Bacteria 1879
1086 Ga0501048_0017545 3300049582 Bacteria 5271
1087 Ga0501048_0034908 3300049582 Bacteria 3624
1088 Ga0501048_0039370 3300049582 Bacteria 3391
1089 Ga0501048_0044252 3300049582 Bacteria 3184
1090 Ga0501048_0055531 3300049582 Bacteria 2811
1091 Ga0501048_0153411 3300049582 Bacteria 1629
1092 Ga0501048_0345539 3300049582 Bacteria 1061
1093 Ga0501048_0401076 3300049582 Bacteria 980
1094 Ga0501048_1211490 3300049582 Unclassified 543
1095 Ga0501048_1273361 3300049582 Bacteria 529
1096 Ga0501067_0024919 3300049583 Bacteria 3317
1097 Ga0501067_0032625 3300049583 Bacteria 2891
1098 Ga0501067_0042129 3300049583 Bacteria 2535
1099 Ga0501067_0043714 3300049583 Bacteria 2489
1100 Ga0501067_0091319 3300049583 Bacteria 1690
1101 Ga0501067_0131387 3300049583 Bacteria 1393
1102 Ga0501067_0133302 3300049583 Bacteria 1383
1103 Ga0501067_0217198 3300049583 Bacteria 1065
1104 Ga0501067_0493225 3300049583 Archaea 685
1105 Ga0501067_0559982 3300049583 Bacteria 640
1106 Ga0501067_0671300 3300049583 Unclassified 582
1107 Ga0501067_0762400 3300049583 Unclassified 545
1108 Ga0501067_0798129 3300049583 Unclassified 532
1109 Ga0501068_0005150 3300049584 Bacteria 7128
1110 Ga0501068_0013672 3300049584 Bacteria 4622
1111 Ga0501068_0026897 3300049584 Bacteria 3394
1112 Ga0501068_0041966 3300049584 Bacteria 2750
1113 Ga0501068_0132097 3300049584 Bacteria 1562
1114 Ga0501068_0199924 3300049584 Bacteria 1267
1115 Ga0501068_0378843 3300049584 Bacteria 911
1116 Ga0501068_0407945 3300049584 Bacteria 876
1117 Ga0501068_0521056 3300049584 Bacteria 772
1118 Ga0501069_0008060 3300049585 Bacteria 5534
1119 Ga0501069_0012222 3300049585 Bacteria 4561
1120 Ga0501069_0029632 3300049585 Unclassified 3003
1121 Ga0501069_0041140 3300049585 Bacteria 2554
1122 Ga0501069_0074900 3300049585 Bacteria 1900
1123 Ga0501069_0121590 3300049585 Bacteria 1491
1124 Ga0501069_0240185 3300049585 Bacteria 1055
1125 Ga0501069_0458473 3300049585 Bacteria 758
1126 Ga0501069_0650322 3300049585 Archaea 634
1127 Ga0501069_0819646 3300049585 Bacteria 564
1128 Ga0501070_0005450 3300049586 Bacteria 10862
1129 Ga0501070_0024219 3300049586 Bacteria 5090
1130 Ga0501070_0042991 3300049586 Bacteria 3761
1131 Ga0501070_0121643 3300049586 Bacteria 2157
1132 Ga0501070_0767947 3300049586 Bacteria 759
1133 Ga0501070_0916381 3300049586 Bacteria 683
1134 Ga0501071_0004239 3300049587 Bacteria 9083
1135 Ga0501071_0016601 3300049587 Bacteria 5065
1136 Ga0501071_0024934 3300049587 Bacteria 4185
1137 Ga0501071_0044149 3300049587 Bacteria 3196
1138 Ga0501071_0111975 3300049587 Unclassified 2018
1139 Ga0501071_0116910 3300049587 Bacteria 1974
1140 Ga0501071_0179963 3300049587 Bacteria 1584
1141 Ga0501071_0211552 3300049587 Bacteria 1458
1142 Ga0501071_0293214 3300049587 Unclassified 1232
1143 Ga0501071_0486838 3300049587 Bacteria 946
1144 Ga0501071_0624281 3300049587 Bacteria 829
1145 Ga0501071_0787089 3300049587 Bacteria 733
1146 Ga0501071_0822950 3300049587 Bacteria 716
1147 Ga0501071_1507907 3300049587 Bacteria 519
1148 Ga0501072_0001651 3300049588 Bacteria 16651
1149 Ga0501072_0005423 3300049588 Bacteria 9707
1150 Ga0501072_0020822 3300049588 Bacteria 5083
1151 Ga0501072_0036004 3300049588 Bacteria 3879
1152 Ga0501072_0045724 3300049588 Bacteria 3443
1153 Ga0501072_0055072 3300049588 Bacteria 3135
1154 Ga0501072_0058860 3300049588 Bacteria 3028
1155 Ga0501072_0124428 3300049588 Bacteria 2054
1156 Ga0501072_0141336 3300049588 Bacteria 1919
1157 Ga0501072_0278708 3300049588 Bacteria 1330
1158 Ga0501072_0334331 3300049588 Unclassified 1203
1159 Ga0501072_0348745 3300049588 Unclassified 1175
1160 Ga0501072_0441587 3300049588 Bacteria 1031
1161 Ga0501072_0549802 3300049588 Bacteria 912
1162 Ga0501072_0745548 3300049588 Unclassified 768
1163 Ga0501072_0887041 3300049588 Bacteria 697
1164 Ga0501073_0009378 3300049589 Bacteria 7225
1165 Ga0501073_0012213 3300049589 Bacteria 6270
1166 Ga0501073_0013372 3300049589 Bacteria 5973
1167 Ga0501073_0045049 3300049589 Bacteria 3108
1168 Ga0501073_0217281 3300049589 Bacteria 1321
1169 Ga0501073_0362632 3300049589 Bacteria 1001
1170 Ga0501073_0670145 3300049589 Bacteria 716
1171 Ga0501074_0002358 3300049590 Bacteria 13147
1172 Ga0501074_0004166 3300049590 Bacteria 10326
1173 Ga0501074_0023088 3300049590 Bacteria 4523
1174 Ga0501074_0051706 3300049590 Bacteria 2965
1175 Ga0501074_0090902 3300049590 Bacteria 2186
1176 Ga0501074_0185834 3300049590 Bacteria 1482
1177 Ga0501074_0222392 3300049590 Bacteria 1344
1178 Ga0501074_0287260 3300049590 Bacteria 1169
1179 Ga0501075_0020051 3300049591 Bacteria 4856
1180 Ga0501075_0058875 3300049591 Bacteria 2893
1181 Ga0501075_0071665 3300049591 Bacteria 2619
1182 Ga0501075_0106452 3300049591 Bacteria 2131
1183 Ga0501075_0113984 3300049591 Bacteria 2055
1184 Ga0501075_0258925 3300049591 Bacteria 1326
1185 Ga0501075_0278682 3300049591 Unclassified 1274
1186 Ga0501075_0287171 3300049591 Bacteria 1253
1187 Ga0501075_0293146 3300049591 Bacteria 1239
1188 Ga0501075_0325920 3300049591 Unclassified 1170
1189 Ga0501075_0548482 3300049591 Bacteria 882
1190 Ga0501075_0700446 3300049591 Bacteria 772
1191 Ga0501076_0003936 3300049592 Bacteria 10478
1192 Ga0501076_0012716 3300049592 Bacteria 6300
1193 Ga0501076_0058483 3300049592 Bacteria 3064
1194 Ga0501076_0112320 3300049592 Bacteria 2203
1195 Ga0501076_0139566 3300049592 Bacteria 1968
1196 Ga0501076_0226924 3300049592 Bacteria 1527
1197 Ga0501076_0267670 3300049592 Bacteria 1399
1198 Ga0501076_0383920 3300049592 Bacteria 1154
1199 Ga0501076_0394058 3300049592 Bacteria 1138
1200 Ga0501076_0423574 3300049592 Unclassified 1095
1201 Ga0501076_0650545 3300049592 Bacteria 870
1202 Ga0501076_1372199 3300049592 Unclassified 581
1203 Ga0501076_1695491 3300049592 Unclassified 518
1204 Ga0501076_1708753 3300049592 Bacteria 516
1205 Ga0501077_0001226 3300049593 Bacteria 15492
1206 Ga0501077_0003639 3300049593 Bacteria 9273
1207 Ga0501077_0015474 3300049593 Bacteria 4803
1208 Ga0501077_0026652 3300049593 Bacteria 3668
1209 Ga0501077_0042129 3300049593 Bacteria 2905
1210 Ga0501077_0191286 3300049593 Unclassified 1300
1211 Ga0501077_0241160 3300049593 Unclassified 1149
1212 Ga0501077_0473322 3300049593 Bacteria 803
1213 Ga0501077_0480978 3300049593 Unclassified 796
1214 Ga0501077_0543895 3300049593 Unclassified 745
1215 Ga0501077_0590153 3300049593 Bacteria 713
1216 Ga0501077_0610053 3300049593 Archaea 701
1217 Ga0501077_1078606 3300049593 Bacteria 517
1218 Ga0501079_0003747 3300049741 Bacteria 11218
1219 Ga0501079_0051905 3300049741 Bacteria 3166
1220 Ga0501079_0066665 3300049741 Bacteria 2778
1221 Ga0501079_0082527 3300049741 Bacteria 2486
1222 Ga0501079_0086547 3300049741 Bacteria 2425
1223 Ga0501079_0092115 3300049741 Bacteria 2348
1224 Ga0501079_0128587 3300049741 Bacteria 1971
1225 Ga0501079_0195242 3300049741 Bacteria 1580
1226 Ga0501079_0756240 3300049741 Bacteria 765
1227 Ga0501079_1319198 3300049741 Unclassified 568
1228 Ga0501079_1353700 3300049741 Bacteria 560
1229 Ga0501080_0013674 3300049742 Bacteria 7473
1230 Ga0501080_0014355 3300049742 Bacteria 7293
1231 Ga0501080_0050842 3300049742 Bacteria 3856
1232 Ga0501080_0108758 3300049742 Bacteria 2569
1233 Ga0501080_0172991 3300049742 Bacteria 1991
1234 Ga0501080_0216392 3300049742 Bacteria 1754
1235 Ga0501080_0553682 3300049742 Unclassified 1024
1236 Ga0501081_0008544 3300049743 Bacteria 6654
1237 Ga0501081_0016971 3300049743 Bacteria 4811
1238 Ga0501081_0038237 3300049743 Bacteria 3277
1239 Ga0501081_0053405 3300049743 Bacteria 2790
1240 Ga0501081_0076239 3300049743 Bacteria 2341
1241 Ga0501081_0094034 3300049743 Bacteria 2111
1242 Ga0501081_0097443 3300049743 Bacteria 2075
1243 Ga0501081_0198350 3300049743 Bacteria 1455
1244 Ga0501081_0285514 3300049743 Bacteria 1209
1245 Ga0501081_1190889 3300049743 Unclassified 577
1246 Ga0501081_1392638 3300049743 Bacteria 532
1247 Ga0501083_0022414 3300049744 Bacteria 4384
1248 Ga0501083_0027169 3300049744 Bacteria 3950
1249 Ga0501083_0036063 3300049744 Bacteria 3375
1250 Ga0501083_0262384 3300049744 Unclassified 1124
1251 Ga0501083_0455414 3300049744 Bacteria 833
1252 Ga0501083_0891601 3300049744 Bacteria 579
1253 Ga0501035_0016223 3300049822 Bacteria 6874
1254 Ga0501035_0047583 3300049822 Bacteria 3849
1255 Ga0501035_0059885 3300049822 Bacteria 3391
1256 Ga0501035_0197842 3300049822 Bacteria 1725
1257 Ga0501035_0542707 3300049822 Bacteria 953
1258 Ga0501035_1397203 3300049822 Unclassified 537
1259 Ga0501044_0084672 3300049823 Bacteria 3204
1260 Ga0501044_0492730 3300049823 Bacteria 1127
1261 Ga0501044_1102259 3300049823 Bacteria 663
1262 Ga0501045_0000909 3300049824 Bacteria 19287
1263 Ga0501045_0009467 3300049824 Bacteria 6817
1264 Ga0501045_0039307 3300049824 Bacteria 3442
1265 Ga0501045_0042790 3300049824 Bacteria 3297
1266 Ga0501045_0053808 3300049824 Bacteria 2941
1267 Ga0501045_0098691 3300049824 Bacteria 2161
1268 Ga0501045_0413681 3300049824 Unclassified 1003
1269 Ga0501045_0630942 3300049824 Bacteria 792
1270 Ga0501045_0683172 3300049824 Bacteria 758
1271 Ga0501045_1237283 3300049824 Bacteria 544
1272 nmdc:mga03683_551052_c1 3300050489 Bacteria 561
1273 nmdc:mga03n38_17683_c1 3300050490 Bacteria 2797
1274 nmdc:mga00v17_110322_c1 3300050491 Bacteria 1745
1275 nmdc:mga00v17_960189_c1 3300050491 Unclassified 539
1276 nmdc:mga0yw44_403448_c1 3300050492 Bacteria 924
1277 nmdc:mga06z11_933129_c1 3300050494 Bacteria 529
1278 nmdc:mga05p37_100200_c1 3300050507 Bacteria 3568
1279 nmdc:mga05p37_104041_c1 3300050507 Bacteria 3493
1280 nmdc:mga05p37_12780_c1 3300050507 Bacteria 10034
1281 nmdc:mga05p37_1412827_c1 3300050507 Bacteria 700
1282 nmdc:mga05p37_172752_c1 3300050507 Bacteria 2635
1283 nmdc:mga05p37_2044102_c1 3300050507 Unclassified 540
1284 nmdc:mga05p37_266595_c1 3300050507 Bacteria 2048
1285 nmdc:mga05p37_43366_c1 3300050507 Bacteria 5534
1286 nmdc:mga05p37_480493_c1 3300050507 Bacteria 1431
1287 nmdc:mga05p37_493695_c1 3300050507 Bacteria 1407
1288 nmdc:mga05p37_62982_c1 3300050507 Bacteria 4565
1289 nmdc:mga09592_51272_c1 3300050508 Bacteria 3481
1290 nmdc:mga09592_543478_c1 3300050508 Bacteria 998
1291 nmdc:mga09592_558188_c1 3300050508 Bacteria 983
1292 nmdc:mga09592_574177_c1 3300050508 Unclassified 968
1293 nmdc:mga09592_667699_c1 3300050508 Bacteria 886
1294 nmdc:mga0qj67_4619_c1 3300050509 Bacteria 9990
1295 nmdc:mga0qj67_615726_c1 3300050509 Bacteria 868
1296 nmdc:mga06r32_142882_c1 3300050510 Bacteria 2370
1297 nmdc:mga06r32_149692_c1 3300050510 Bacteria 2312
1298 nmdc:mga06r32_32885_c1 3300050510 Bacteria 4883
1299 nmdc:mga06r32_594284_c1 3300050510 Bacteria 1078
1300 nmdc:mga06r32_67730_c1 3300050510 Bacteria 3447
1301 nmdc:mga08y16_104774_c1 3300050511 Bacteria 2944
1302 nmdc:mga08y16_1396842_c1 3300050511 Unclassified 663
1303 nmdc:mga08y16_154884_c1 3300050511 Bacteria 2382
1304 nmdc:mga08y16_23777_c1 3300050511 Bacteria 6470
1305 nmdc:mga08y16_553118_c1 3300050511 Bacteria 1164
1306 nmdc:mga08y16_86500_c1 3300050511 Bacteria 3267
1307 nmdc:mga08y16_89841_c1 3300050511 Bacteria 3201
1308 nmdc:mga08y16_978204_c1 3300050511 Bacteria 828
1309 nmdc:mga0n895_1308197_c1 3300050512 Bacteria 696
1310 nmdc:mga0n895_171743_c1 3300050512 Unclassified 2200
1311 nmdc:mga0n895_246130_c1 3300050512 Bacteria 1815
1312 nmdc:mga0n895_467662_c1 3300050512 Unclassified 1272
1313 nmdc:mga0n895_543103_c1 3300050512 Bacteria 1168
1314 nmdc:mga0n895_860670_c1 3300050512 Bacteria 894
1315 nmdc:mga0rr50_1044594_c1 3300050513 Unclassified 696
1316 nmdc:mga0rr50_109106_c1 3300050513 Bacteria 2188
1317 nmdc:mga0rr50_802966_c1 3300050513 Unclassified 803
1318 nmdc:mga0rr50_96285_c1 3300050513 Bacteria 2316
1319 nmdc:mga08x19_1025854_c1 3300050514 Unclassified 586
1320 nmdc:mga08x19_20397_c1 3300050514 Bacteria 4081
1321 nmdc:mga0a205_360825_c1 3300050515 Unclassified 1017
1322 nmdc:mga0a205_410423_c1 3300050515 Bacteria 1217
1323 nmdc:mga0a205_434145_c1 3300050515 Bacteria 1174
1324 nmdc:mga0a205_648689_c1 3300050515 Unclassified 907
1325 nmdc:mga0a205_814202_c1 3300050515 Bacteria 782
1326 nmdc:mga0a205_916989_c1 3300050515 Bacteria 723
1327 Ga0495612_0162607 3300053078 Bacteria 975
1328 Ga0495612_0182139 3300053078 Bacteria 923
1329 Ga0495595_0007348 3300053084 Bacteria 4510
1330 Ga0495595_0057451 3300053084 Bacteria 1815
1331 Ga0495619_0005609 3300053085 Bacteria 7962
1332 Ga0495619_0052504 3300053085 Bacteria 2695
1333 Ga0495619_0092743 3300053085 Bacteria 2046
1334 Ga0501084_0001727 3300054114 Bacteria 17332
1335 Ga0501084_0001938 3300054114 Bacteria 16527
1336 Ga0501084_0010553 3300054114 Bacteria 7640
1337 Ga0501084_0037373 3300054114 Bacteria 4057
1338 Ga0501084_0064394 3300054114 Bacteria 3068
1339 Ga0501084_0090175 3300054114 Bacteria 2573
1340 Ga0501084_0092310 3300054114 Bacteria 2542
1341 Ga0501084_0123387 3300054114 Bacteria 2179
1342 Ga0501084_0342470 3300054114 Bacteria 1263
1343 Ga0501084_0560275 3300054114 Bacteria 966
1344 Ga0501084_0573247 3300054114 Unclassified 954
1345 Ga0501084_0958367 3300054114 Unclassified 719
1346 Ga0501084_1186010 3300054114 Unclassified 641
1347 Ga0501084_1432745 3300054114 Bacteria 578
1348 Ga0587083_0222991 3300059505 Bacteria 549
1349 Ga0501082_0007325 3300060353 Bacteria 9523
1350 Ga0501082_0022432 3300060353 Bacteria 5437
1351 Ga0501082_0039044 3300060353 Bacteria 4095
1352 Ga0501082_0117020 3300060353 Bacteria 2309
1353 Ga0501082_0268810 3300060353 Unclassified 1484
1354 Ga0501082_0283158 3300060353 Bacteria 1443
1355 Ga0501082_0335404 3300060353 Unclassified 1317
1356 Ga0501082_0382357 3300060353 Bacteria 1228
1357 Ga0501082_0590593 3300060353 Bacteria 972
1358 Ga0501082_1051620 3300060353 Unclassified 712
1359 Ga0501082_1229887 3300060353 Bacteria 654
1360 Ga0501082_1329837 3300060353 Bacteria 628
1361 Ga0466962_0158490 3300061719 Bacteria 1100
1362 Ga0466962_0623646 3300061719 Unclassified 550
1363 Ga0530510_0009521 3300061734 Bacteria 6813
1364 Ga0530510_0032193 3300061734 Bacteria 3770
1365 Ga0530510_0045754 3300061734 Bacteria 3161
1366 Ga0530510_0049002 3300061734 Bacteria 3053
1367 Ga0530510_0050575 3300061734 Bacteria 3002
1368 Ga0530510_0099733 3300061734 Bacteria 2123
1369 Ga0530510_0385680 3300061734 Bacteria 1055
1370 Ga0530510_0392763 3300061734 Bacteria 1045
1371 Ga0530510_0396617 3300061734 Bacteria 1040
1372 Ga0530510_0517425 3300061734 Bacteria 905
1373 Ga0530510_0534651 3300061734 Bacteria 890
1374 Ga0530510_0548529 3300061734 Unclassified 878
1375 Ga0530510_0652251 3300061734 Unclassified 801
1376 Ga0530510_0866940 3300061734 Unclassified 690
1377 Ga0530510_1311350 3300061734 Unclassified 555
1378 Ga0105243_10025323
1379 JGI24747J21853_1031309
1380 JGI24743J22301_10006625
1381 JGI24743J22301_10052076
1382 JGI24743J22301_10072539
1383 JGI24738J21930_10017112
1384 JGI24033J26618_1017366
1385 JGI24034J26672_10025166
1386 JGI24751J29686_10111242
1387 JGI25406J46586_10013282
1388 Ga0058862_11948148
1389 Ga0070658_10154985
1390 Ga0070658_10191527
1391 Ga0070676_10069255
1392 Ga0070676_10129842
1393 Ga0070676_10431802
1394 Ga0070676_10583319
1395 Ga0070683_100001405
1396 Ga0070683_100019032
1397 Ga0070683_100030770
1398 Ga0070683_100158958
1399 Ga0070683_100197316
1400 Ga0070683_100237391
1401 Ga0070683_100387842
1402 Ga0070683_100534476
1403 Ga0070683_102427233
1404 Ga0070690_100123873
1405 Ga0070690_100169633
1406 Ga0070670_100009289
1407 Ga0070670_100015080
1408 Ga0070670_100081538
1409 Ga0070677_10559961
1410 Ga0068869_100019754
1411 Ga0068869_100890976
1412 Ga0070680_100009539
1413 Ga0070680_100021512
1414 Ga0070680_100050228
1415 Ga0070680_100244669
1416 Ga0070682_100012429
1417 Ga0070682_100023546
1418 Ga0070682_100121130
1419 Ga0070682_100232193
1420 Ga0070682_100905053
1421 Ga0070682_101400430
1422 Ga0068868_100065936
1423 Ga0068868_100113491
1424 Ga0068868_100187850
1425 Ga0068868_100349631
1426 Ga0068868_100621575
1427 Ga0068868_100725116
1428 Ga0070660_100002717
1429 Ga0070660_100028904
1430 Ga0070660_100033834
1431 Ga0070660_100099843
1432 Ga0070660_100131256
1433 Ga0070660_100180917
1434 Ga0070689_100003852
1435 Ga0070689_100122934
1436 Ga0070689_100157203
1437 Ga0070691_10003135
1438 Ga0070691_10030728
1439 Ga0070687_100064372
1440 Ga0070687_100111875
1441 Ga0070661_100004092
1442 Ga0070661_100073769
1443 Ga0070661_100466461
1444 Ga0070692_10000917
1445 Ga0070692_10015220
1446 Ga0070692_10042146
1447 Ga0070692_10375824
1448 Ga0070668_100093049
1449 Ga0070668_100099110
1450 Ga0070668_100391319
1451 Ga0070675_100013579
1452 Ga0070675_100064339
1453 Ga0070675_101173522
1454 Ga0070671_100138274
1455 Ga0070671_100183393
1456 Ga0070671_100382069
1457 Ga0070671_101839761
1458 Ga0070674_100006249
1459 Ga0070674_100017624
1460 Ga0070674_100060431
1461 Ga0070674_100137826
1462 Ga0070674_100151478
1463 Ga0070674_100738264
1464 Ga0070674_100879113
1465 Ga0070674_101402457
1466 Ga0070673_100018469
1467 Ga0070673_100039084
1468 Ga0070673_100228655
1469 Ga0070688_100035677
1470 Ga0070688_100046950
1471 Ga0070659_100005769
1472 Ga0070659_100020421
1473 Ga0070659_100030033
1474 Ga0070659_100076580
1475 Ga0070659_100082947
1476 Ga0070659_100636536
1477 Ga0070667_100181378
1478 Ga0070709_10095271
1479 Ga0070714_100032641
1480 Ga0070713_100129371
1481 Ga0070701_10038796
1482 Ga0070701_10039581
1483 Ga0070701_10746602
1484 Ga0070705_100934122
1485 Ga0070700_100114821
1486 Ga0070700_100213931
1487 Ga0070700_100535784
1488 Ga0070694_100144022
1489 Ga0070694_100215822
1490 Ga0070694_100267002
1491 Ga0070694_100288694
1492 Ga0070708_100113488
1493 Ga0070708_100701405
1494 Ga0070708_101029493
1495 Ga0070708_101049714
1496 Ga0070663_100091921
1497 Ga0070663_100378909
1498 Ga0070663_100503284
1499 Ga0070678_100020509
1500 Ga0070678_100036136
1501 Ga0070678_100046431
1502 Ga0070678_100503227
1503 Ga0070678_101656125
1504 Ga0070662_100011454
1505 Ga0070662_100047899
1506 Ga0070662_100115846
1507 Ga0070662_101415533
1508 Ga0070681_10033554
1509 Ga0070681_10088761
1510 Ga0070681_10384719
1511 Ga0068867_100007801
1512 Ga0068867_100027137
1513 Ga0068867_100084350
1514 Ga0068867_100206789
1515 Ga0068867_100526444
1516 Ga0068867_100562592
1517 Ga0070685_10004165
1518 Ga0070685_10016935
1519 Ga0070685_10031326
1520 Ga0070706_100047233
1521 Ga0070707_100027798
1522 Ga0070707_100258432
1523 Ga0070707_101081671
1524 Ga0070698_100079986
1525 Ga0070698_100416419
1526 Ga0070698_100451343
1527 Ga0070699_100005200
1528 Ga0070699_100155093
1529 Ga0070699_100252609
1530 Ga0070699_100536889
1531 Ga0070679_100078953
1532 Ga0070679_100081458
1533 Ga0070679_100102120
1534 Ga0070679_100115819
1535 Ga0070679_100193876
1536 Ga0070679_100324007
1537 Ga0070679_101266688
1538 Ga0070684_100012224
1539 Ga0070684_100030097
1540 Ga0070684_100033606
1541 Ga0070684_100047104
1542 Ga0070684_100047834
1543 Ga0070684_100104616
1544 Ga0070684_100169758
1545 Ga0070684_100304565
1546 Ga0070684_100533209
1547 Ga0070684_100598596
1548 Ga0070697_100612367
1549 Ga0070697_100664615
1550 Ga0070697_101531841
1551 Ga0068853_100030585
1552 Ga0068853_100043247
1553 Ga0068853_100476837
1554 Ga0068853_100645724
1555 Ga0070672_100016503
1556 Ga0070672_100031054
1557 Ga0070672_100041035
1558 Ga0070672_100715872
1559 Ga0070672_101408373
1560 Ga0070686_100026827
1561 Ga0070686_100141771
1562 Ga0070686_100176280
1563 Ga0070695_100301139
1564 Ga0070695_100307007
1565 Ga0070695_100763506
1566 Ga0070696_100626699
1567 Ga0070693_100015948
1568 Ga0070693_100054589
1569 Ga0070693_100106136
1570 Ga0070693_101149608
1571 Ga0070665_100023124
1572 Ga0070665_100278994
1573 Ga0070704_100048900
1574 Ga0070704_100078313
1575 Ga0070704_100870360
1576 Ga0068855_100174806
1577 Ga0068855_100622971
1578 Ga0068855_101332101
1579 Ga0070664_100016770
1580 Ga0070664_100019661
1581 Ga0070664_100613081
1582 Ga0070664_101232699
1583 Ga0068857_100013490
1584 Ga0068857_100378601
1585 Ga0068857_100573238
1586 Ga0068854_100192654
1587 Ga0068854_100253860
1588 Ga0068856_100013469
1589 Ga0068856_100060165
1590 Ga0068856_100229082
1591 Ga0068856_101242312
1592 Ga0070702_100008487
1593 Ga0070702_100012133
1594 Ga0070702_100092102
1595 Ga0070702_100863935
1596 Ga0068852_100097305
1597 Ga0068852_100564459
1598 Ga0068852_100609234
1599 Ga0068859_100033061
1600 Ga0068864_100012769
1601 Ga0068864_100039006
1602 Ga0068864_100512999
1603 Ga0068866_10003279
1604 Ga0068866_10014812
1605 Ga0068866_10050978
1606 Ga0068866_10141841
1607 Ga0068866_10260137
1608 Ga0068861_100048189
1609 Ga0068861_100094098
1610 Ga0068861_100245563
1611 Ga0068861_100280246
1612 Ga0068851_10015652
1613 Ga0068851_10037325
1614 Ga0068851_10522985
1615 Ga0068870_10002280
1616 Ga0068870_10014111
1617 Ga0068870_10020026
1618 Ga0068870_10082875
1619 Ga0068870_10425617
1620 Ga0068870_10893650
1621 Ga0068863_100343255
1622 Ga0068863_101952968
1623 Ga0068863_102200928
1624 Ga0068858_100031628
1625 Ga0068858_100108309
1626 Ga0068858_100809234
1627 Ga0068860_100180416
1628 Ga0068860_100224189
1629 Ga0068862_100636004
1630 Ga0068862_101032690
1631 Ga0068862_101909718
1632 Ga0081455_10002152
1633 Ga0081455_10047017
1634 Ga0081455_10133409
1635 Ga0081455_10179722
1636 Ga0081455_10187366
1637 Ga0081455_10196766
1638 Ga0081455_10405094
1639 Ga0081455_10602559
1640 Ga0081455_10757500
1641 Ga0081540_1002321
1642 Ga0081540_1031707
1643 Ga0081539_10000216
1644 Ga0081539_10000477
1645 Ga0081539_10072272
1646 Ga0075365_10210994
1647 Ga0075365_10288063
1648 Ga0075365_11345489
1649 Ga0075363_100029161
1650 Ga0075364_10170931
1651 Ga0075432_10018044
1652 Ga0075432_10024469
1653 Ga0075432_10047999
1654 Ga0075432_10450664
1655 Ga0070715_10111678
1656 Ga0070712_100013595
1657 Ga0070712_100058885
1658 Ga0075362_10530563
1659 Ga0097621_100011148
1660 Ga0097621_100099488
1661 Ga0097621_100738175
1662 Ga0075370_10222779
1663 Ga0068871_100020551
1664 Ga0068871_100107339
1665 Ga0068871_100454719
1666 Ga0068871_102096404
1667 Ga0075428_100021129
1668 Ga0075428_100093526
1669 Ga0075428_100323134
1670 Ga0075428_100332370
1671 Ga0075428_100881229
1672 Ga0075428_101315789
1673 Ga0075428_102167997
1674 Ga0075430_100018650
1675 Ga0075431_100046111
1676 Ga0075431_100150296
1677 Ga0075431_100201326
1678 Ga0075431_100645521
1679 Ga0075433_10118026
1680 Ga0075433_10270457
1681 Ga0075433_10324135
1682 Ga0075433_10372833
1683 Ga0075433_10377534
1684 Ga0075433_10395328
1685 Ga0075433_10451589
1686 Ga0075434_100070475
1687 Ga0075434_100355004
1688 Ga0075434_100413709
1689 Ga0075434_100866148
1690 Ga0075434_101467019
1691 Ga0075429_100010926
1692 Ga0075429_100030337
1693 Ga0075429_100067941
1694 Ga0075429_100527580
1695 Ga0068865_100003153
1696 Ga0068865_100010036
1697 Ga0068865_100015979
1698 Ga0068865_100051631
1699 Ga0068865_100074599
1700 Ga0068865_100177956
1701 Ga0068865_100257253
1702 Ga0068865_100824311
1703 Ga0075436_100030852
1704 Ga0075436_100899977
1705 Ga0097620_100033061
1706 Ga0075435_100023363
1707 Ga0075435_100184243
1708 Ga0105244_10195536
1709 Ga0105240_10430523
1710 Ga0111539_10028825
1711 Ga0111539_10035537
1712 Ga0111539_10380814
1713 Ga0111539_10426431
1714 Ga0111539_10458036
1715 Ga0111539_10553146
1716 Ga0111539_11063406
1717 Ga0111539_11102737
1718 Ga0111539_12968849
1719 Ga0111539_13512423
1720 Ga0105245_10000865
1721 Ga0105245_10005696
1722 Ga0105245_10041836
1723 Ga0105245_10051897
1724 Ga0105245_10073898
1725 Ga0105245_10156839
1726 Ga0105245_10303962
1727 Ga0105245_10382829
1728 Ga0105245_10457848
1729 Ga0105245_10618879
1730 Ga0105245_10940392
1731 Ga0105245_11762507
1732 Ga0105247_10015667
1733 Ga0114129_10017864
1734 Ga0114129_10030517
1735 Ga0114129_10114533
1736 Ga0114129_10115187
1737 Ga0114129_10302540
1738 Ga0114129_10363336
1739 Ga0114129_10476383
1740 Ga0114129_10841008
1741 Ga0114129_10864412
1742 Ga0114129_11106428
1743 Ga0114129_11517850
1744 Ga0105243_10010340
1745 Ga0105243_10019868
1746 Ga0105243_10020472
1747 Ga0105243_10040453
1748 Ga0105243_10239865
1749 Ga0105243_11534396
1750 Ga0105243_12672455
1751 Ga0105241_10125672
1752 Ga0105241_10445680
1753 Ga0105242_10004020
1754 Ga0105242_10008513
1755 Ga0105242_10019399
1756 Ga0105242_10067739
1757 Ga0105242_10285111
1758 Ga0105242_10365803
1759 Ga0105242_10935468
1760 Ga0105242_11071049
1761 Ga0105242_11794508
1762 Ga0105248_10020638
1763 Ga0105248_10056569
1764 Ga0105248_10066880
1765 Ga0105248_10335881
1766 Ga0105248_11233844
1767 Ga0105237_10185040
1768 Ga0105238_10533963
1769 Ga0105238_10618239
1770 Ga0105238_12068732
1771 Ga0105249_10089242
1772 Ga0105249_10105026
1773 Ga0105249_10262139
1774 Ga0105239_10008794
1775 Ga0105239_10040473
1776 Ga0105239_10241430
1777 Ga0105239_10650258
1778 Ga0105239_10726171
1779 Ga0105239_11229853
1780 Ga0105239_11738416
1781 Ga0105239_11860739
1782 Ga0105239_12803543
1783 Ga0105246_10004814
1784 Ga0105246_10068066
1785 Ga0105246_10068186
1786 Ga0105246_10188289
1787 Ga0105246_10452831
1788 Ga0105246_12318081
1789 Ga0157325_1014658
1790 Ga0157373_10081338
1791 Ga0157373_10969842
1792 Ga0157371_10033070
1793 Ga0157371_10133271
1794 Ga0157371_10292857
1795 Ga0157369_10015732
1796 Ga0157369_11351306
1797 Ga0157369_11705710
1798 Ga0157374_10033250
1799 Ga0157374_11945346
1800 Ga0157378_10169648
1801 Ga0157378_10716846
1802 Ga0157378_11175632
1803 Ga0163162_10242880
1804 Ga0163162_10266149
1805 Ga0163162_10449533
1806 Ga0163162_12176262
1807 Ga0157372_10005778
1808 Ga0157372_10016713
1809 Ga0157372_10431391
1810 Ga0157372_10922020
1811 Ga0157375_10002706
1812 Ga0157375_10021156
1813 Ga0157375_10062886
1814 Ga0157375_10108931
1815 Ga0157375_10416814
1816 Ga0157375_10472117
1817 Ga0157375_10702129
1818 Ga0157375_12043383
1819 Ga0163163_10167410
1820 Ga0163163_10242090
1821 Ga0163163_10272801
1822 Ga0163163_10336208
1823 Ga0163163_10486289
1824 Ga0163163_10609764
1825 Ga0163163_11389123
1826 Ga0157380_10029906
1827 Ga0157380_10042173
1828 Ga0157380_10105103
1829 Ga0157380_10209134
1830 Ga0157380_11382979
1831 Ga0157380_11874534
1832 Ga0182008_10001466
1833 Ga0182008_10122262
1834 Ga0182008_10220222
1835 Ga0157377_10002959
1836 Ga0157377_10022631
1837 Ga0157377_10028581
1838 Ga0157377_10185563
1839 Ga0157377_10239673
1840 Ga0157377_10268121
1841 Ga0157377_10795888
1842 Ga0157377_10879466
1843 Ga0157379_10074306
1844 Ga0157379_10102275
1845 Ga0157376_10082624
1846 Ga0157376_10112317
1847 Ga0157376_10135284
1848 Ga0157376_10521871
1849 Ga0157376_11400437
1850 Ga0182007_10004451
1851 Ga0182005_1218142
1852 Ga0163161_10072570
1853 Ga0163161_10595678
1854 Ga0163161_11781222
1855 Ga0163161_11808438
1856 Ga0197907_11367132
1857 Ga0206356_11323765
1858 Ga0206356_11343203
1859 Ga0206354_11018335
1860 Ga0206354_11270724
1861 Ga0206353_10552488
1862 Ga0206353_11117021
1863 Ga0206353_11424935
1864 Ga0207656_10125709
1865 Ga0207656_10226675
1866 Ga0207642_10425410
1867 Ga0207642_10446671
1868 Ga0207710_10082795
1869 Ga0207688_10000816
1870 Ga0207688_10009328
1871 Ga0207688_10264938
1872 Ga0207688_10322937
1873 Ga0207688_10818561
1874 Ga0207645_10033975
1875 Ga0207645_10076212
1876 Ga0207643_10002335
1877 Ga0207643_10004431
1878 Ga0207643_10039762
1879 Ga0207643_10047409
1880 Ga0207643_10104191
1881 Ga0207643_10149942
1882 Ga0207705_10934434
1883 Ga0207684_10336736
1884 Ga0207654_10219739
1885 Ga0207654_11122068
1886 Ga0207707_10061566
1887 Ga0207707_10075947
1888 Ga0207707_10088880
1889 Ga0207707_10167632
1890 Ga0207707_10518234
1891 Ga0207707_11475315
1892 Ga0207695_10709942
1893 Ga0207695_10796479
1894 Ga0207671_10373549
1895 Ga0207693_10003543
1896 Ga0207693_10128234
1897 Ga0207663_10735133
1898 Ga0207660_10038385
1899 Ga0207660_10173306
1900 Ga0207660_10233050
1901 Ga0207660_10564082
1902 Ga0207662_10021188
1903 Ga0207662_10047572
1904 Ga0207662_11261206
1905 Ga0207657_10001687
1906 Ga0207657_10030201
1907 Ga0207657_10032572
1908 Ga0207657_10045985
1909 Ga0207649_10160018
1910 Ga0207652_10086827
1911 Ga0207652_10274328
1912 Ga0207652_10285055
1913 Ga0207652_10339736
1914 Ga0207652_10901234
1915 Ga0207646_10116968
1916 Ga0207646_10300738
1917 Ga0207646_11172626
1918 Ga0207681_10369374
1919 Ga0207681_10890528
1920 Ga0207694_10426091
1921 Ga0207694_10609311
1922 Ga0207694_10656596
1923 Ga0207650_10014285
1924 Ga0207650_10038074
1925 Ga0207650_10053525
1926 Ga0207659_10026007
1927 Ga0207659_10115188
1928 Ga0207659_10467048
1929 Ga0207659_11183424
1930 Ga0207659_11383087
1931 Ga0207687_10015021
1932 Ga0207687_10040500
1933 Ga0207687_10292385
1934 Ga0207687_10348041
1935 Ga0207687_10603712
1936 Ga0207687_10770019
1937 Ga0207687_11068832
1938 Ga0207664_10003682
1939 Ga0207664_10680284
1940 Ga0207664_11390569
1941 Ga0207664_11396284
1942 Ga0207644_10086949
1943 Ga0207644_10285440
1944 Ga0207690_10066731
1945 Ga0207690_10068632
1946 Ga0207690_10198335
1947 Ga0207690_10968534
1948 Ga0207706_10030464
1949 Ga0207706_10041080
1950 Ga0207706_10055817
1951 Ga0207706_11425456
1952 Ga0207686_10046937
1953 Ga0207686_10056842
1954 Ga0207686_10102534
1955 Ga0207686_10178773
1956 Ga0207686_10530088
1957 Ga0207686_10745421
1958 Ga0207709_10013980
1959 Ga0207709_10037019
1960 Ga0207709_10199207
1961 Ga0207709_10303820
1962 Ga0207709_11314828
1963 Ga0207670_10091776
1964 Ga0207670_10320098
1965 Ga0207670_10542229
1966 Ga0207669_10007683
1967 Ga0207669_10012223
1968 Ga0207669_10107161
1969 Ga0207669_10131920
1970 Ga0207669_10283455
1971 Ga0207669_10392902
1972 Ga0207669_10485173
1973 Ga0207669_10607861
1974 Ga0207669_10705079
1975 Ga0207669_10789229
1976 Ga0207669_11770750
1977 Ga0207704_10049937
1978 Ga0207704_10057714
1979 Ga0207704_10112644
1980 Ga0207704_10229714
1981 Ga0207704_10591565
1982 Ga0207704_11369625
1983 Ga0207691_10009024
1984 Ga0207691_10009851
1985 Ga0207691_10025077
1986 Ga0207691_10074503
1987 Ga0207711_10081924
1988 Ga0207711_10302897
1989 Ga0207711_10350367
1990 Ga0207711_10479490
1991 Ga0207711_10595505
1992 Ga0207689_10283512
1993 Ga0207689_10601803
1994 Ga0207689_11237435
1995 Ga0207689_11473129
1996 Ga0207661_10064817
1997 Ga0207661_10147292
1998 Ga0207661_10153385
1999 Ga0207661_10202435
2000 Ga0207661_10458639
2001 Ga0207679_10013388
2002 Ga0207679_10181741
2003 Ga0207679_10195758
2004 Ga0207679_10376326
2005 Ga0207679_10452887
2006 Ga0207679_10869514
2007 Ga0207667_10030665
2008 Ga0207667_10814154
2009 Ga0207651_10055080
2010 Ga0207651_10207305
2011 Ga0207651_10370720
2012 Ga0207651_10799863
2013 Ga0207712_10646451
2014 Ga0207668_10082390
2015 Ga0207668_10106093
2016 Ga0207668_10112312
2017 Ga0207668_11913950
2018 Ga0207640_10041421
2019 Ga0207640_10260423
2020 Ga0207658_10054357
2021 Ga0207658_11380129
2022 Ga0207677_10020382
2023 Ga0207677_10375507
2024 Ga0207677_10858426
2025 Ga0207677_10867028
2026 Ga0207703_10124591
2027 Ga0207639_10240992
2028 Ga0207639_10254909
2029 Ga0207639_10333113
2030 Ga0207639_10473212
2031 Ga0207639_12015725
2032 Ga0207678_10138725
2033 Ga0207678_10241341
2034 Ga0207678_10504675
2035 Ga0207678_10601471
2036 Ga0207678_11329534
2037 Ga0207708_10003549
2038 Ga0207708_10009415
2039 Ga0207708_10148934
2040 Ga0207708_10246883
2041 Ga0207708_10793359
2042 Ga0207708_10830899
2043 Ga0207708_11768314
2044 Ga0207702_10036281
2045 Ga0207702_10120898
2046 Ga0207641_10093901
2047 Ga0207641_10325861
2048 Ga0207641_10687679
2049 Ga0207648_10021040
2050 Ga0207648_10080374
2051 Ga0207648_10227688
2052 Ga0207648_10295689
2053 Ga0207648_10334740
2054 Ga0207676_10028753
2055 Ga0207676_10505943
2056 Ga0207674_10074954
2057 Ga0207674_10492048
2058 Ga0207674_10543606
2059 Ga0207674_10707244
2060 Ga0207674_10737592
2061 Ga0207674_11844099
2062 Ga0207675_100082828
2063 Ga0207675_100140533
2064 Ga0207675_100265643
2065 Ga0207675_101140419
2066 Ga0207683_10008257
2067 Ga0207683_10037163
2068 Ga0207683_10039656
2069 Ga0207683_10158422
2070 Ga0207683_10164461
2071 Ga0207683_10375927
2072 Ga0207683_10417505
2073 Ga0207683_11603830
2074 Ga0207698_10025840
2075 Ga0207698_10066186
2076 Ga0207698_10538372
2077 Ga0207698_10643691
2078 Ga0209998_10034288
2079 Ga0209998_10075560
2080 Ga0207428_10001196
2081 Ga0207428_10002858
2082 Ga0207428_10003094
2083 Ga0207428_10010613
2084 Ga0207428_10022792
2085 Ga0207428_10143221
2086 Ga0207428_10547134
2087 Ga0268266_10079681
2088 Ga0268266_10123673
2089 Ga0268265_10019384
2090 Ga0268265_10977271
2091 Ga0268264_10096769
2092 Ga0268264_10186364
2093 Ga0265337_1074129
2094 Ga0265337_1134499
2095 Ga0265319_1018074
2096 Ga0265319_1023935
2097 Ga0265334_10013253
2098 Ga0265318_10010982
2099 Ga0265318_10059198
2100 Ga0265318_10267775
2101 Ga0265323_10027737
2102 Ga0265322_10061912
2103 Ga0265336_10094075
2104 Ga0265338_10002825
2105 Ga0265338_10040946
2106 Ga0265338_10056999
2107 Ga0265338_10075267
2108 Ga0265332_10010966
2109 Ga0265320_10025656
2110 Ga0265325_10017313
2111 Ga0265325_10039449
2112 Ga0265329_10014417
2113 Ga0265329_10141505
2114 Ga0265340_10008842
2115 Ga0265339_10108848
2116 Ga0265331_10013454
2117 Ga0265327_10015984
2118 Ga0265327_10029446
2119 Ga0265316_10032193
2120 Ga0265316_10980405
2121 Ga0265313_10019317
2122 Ga0265313_10042770
2123 Ga0265314_10026163
2124 Ga0265314_10057812
2125 Ga0265342_10144772
2126 Ga0373930_0012507
2127 Ga0373948_0014747
2128 Ga0373958_0135882
2129 Ga0373959_0018800
2130 Ga0373934_0007365
2131 Ga0373949_0011197
2132 Ga0373951_0106474
2133 Ga0373952_0210375
2134 Ga0373932_0125041
2135 Ga0373941_0005509
2136 Ga0373953_0476330
2137 Ga0373954_0186210
2138 Ga0373960_0046379
2139 Ga0373943_0028124
2140 Ga0373955_0054516
2141 Ga0373942_0032748
2142 Ga0373942_0054887
2143 Ga0373961_0025852
2144 Ga0373961_0157372
2145 Ga0373962_0017357
2146 Ga0373924_0052199
2147 Ga0373931_0066731
2148 Ga0373931_0301673
2149 Ga0373931_0321633
2150 Ga0373933_0132028
2151 Ga0373937_1173568
2152 Ga0395899_0119377
2153 Ga0395899_0217119
2154 Ga0395899_0314505
2155 Ga0395899_0530947
2156 Ga0395900_0052851
2157 Ga0395900_0244599
2158 Ga0395900_0375606
2159 Ga0395900_0525960
2160 Ga0395900_0602637
2161 Ga0395900_1051256
2162 Ga0395900_1191339
2163 Ga0395900_1224734
2164 Ga0395900_1631245
2165 Ga0395898_0004143
2166 Ga0395898_0057869
2167 Ga0395898_0116582
2168 Ga0395898_0473016
2169 Ga0395898_0594721
2170 Ga0395898_1060610
2171 Ga0395898_1749150
2172 Ga0395898_1772148
2173 Ga0395905_0003900
2174 Ga0395905_0032900
2175 Ga0395905_0167044
2176 Ga0395905_1327733
2177 Ga0395905_1467979
2178 Ga0395901_0001175
2179 Ga0395901_0001894
2180 Ga0395901_0099969
2181 Ga0395901_0114319
2182 Ga0395901_0487897
2183 Ga0395901_0615013
2184 Ga0395901_0990451
2185 Ga0395901_1978857
2186 Ga0439453_0065349
2187 Ga0451793_0140964
2188 Ga0451793_1117621
2189 Ga0451795_0186197
2190 Ga0451798_0170046
2191 Ga0451802_2063843
2192 Ga0451807_0366467
2193 Ga0451835_1071592
2194 Ga0451837_1771718
2195 Ga0451845_0377167
2196 Ga0451847_0626268
2197 Ga0451853_0503966
2198 Ga0451853_1439937
2199 Ga0439448_0063343
2200 Ga0450920_111143
2201 Ga0450923_194098
2202 Ga0450902_065821
2203 Ga0450906_002797
2204 Ga0450907_002290
2205 Ga0439458_0110535
2206 Ga0439435_0142734
2207 Ga0439435_0223276
2208 Ga0439435_0293667
2209 Ga0439464_0065129
2210 Ga0439464_0177517
2211 Ga0439440_0224842
2212 Ga0453683_1040393
2213 Ga0466966_0207824
2214 Ga0466961_0666967
2215 Ga0466963_0245251
2216 Ga0466963_0287439
2217 Ga0466963_0321310
2218 Ga0466963_0652258
2219 Ga0466964_0034636
2220 Ga0466964_0518221
2221 Ga0466971_0095768
2222 Ga0466971_0304871
2223 Ga0466968_0101672
2224 Ga0466968_0149931
2225 Ga0466970_0560701
2226 Ga0466957_0417883
2227 Ga0466957_0712018
2228 Ga0466959_0289215
2229 Ga0451576_1016160
2230 Ga0466958_0170690
2231 Ga0466958_0185582
2232 Ga0466958_0598288
2233 Ga0466967_0000047
2234 Ga0466967_0083772
2235 Ga0466967_0161369
2236 Ga0466967_0215087
2237 Ga0466967_0272680
2238 Ga0466967_0405542
2239 Ga0466967_0489428
2240 Ga0466967_0535907
2241 Ga0466967_0582082
2242 Ga0495592_0553975
2243 Ga0495603_0035829
2244 Ga0495603_0073846
2245 Ga0495603_0279380
2246 Ga0495603_0475192
2247 Ga0495603_0614567
2248 Ga0495603_0808555
2249 Ga0495641_0188497
2250 Ga0495641_0288069
2251 Ga0495651_0028264
2252 Ga0495653_0029348
2253 Ga0495582_0781134
2254 Ga0495584_0158577
2255 Ga0495596_0270604
2256 Ga0495608_0003415
2257 Ga0495628_0430286
2258 Ga0495630_0372191
2259 Ga0495630_0412315
2260 Ga0495637_0217763
2261 Ga0495643_0515435
2262 Ga0495644_0150018
2263 Ga0495640_0096177
2264 Ga0495640_0257189
2265 Ga0495587_0245230
2266 Ga0495622_0257262
2267 Ga0495633_0447927
2268 Ga0495633_0498449
2269 Ga0495667_0099258
2270 Ga0495667_0186580
2271 Ga0495656_0825891
2272 Ga0495634_0202108
2273 Ga0495634_0387686
2274 Ga0495635_0284772
2275 Ga0495659_0429567
2276 Ga0495588_0305543
2277 Ga0495657_0175976
2278 Ga0495646_0595845
2279 Ga0495658_0084809
2280 Ga0495669_0155967
2281 Ga0495669_0468321
2282 Ga0495613_0345113
2283 Ga0495613_0751315
2284 Ga0495670_0205910
2285 Ga0495671_0389084
2286 Ga0495589_0133893
2287 Ga0495660_0372994
2288 Ga0495581_0327730
2289 Ga0495674_0034616
2290 Ga0495674_0587126
2291 Ga0495676_0128272
2292 Ga0495676_0410071
2293 Ga0495680_0030143
2294 Ga0495680_0447692
2295 Ga0495675_0519850
2296 Ga0495677_0024931
2297 Ga0495677_0410004
2298 Ga0495684_0829812
2299 Ga0495602_0255950
2300 Ga0495602_1150795
2301 Ga0495626_0221376
2302 Ga0496100_0016868
2303 Ga0496100_0076658
2304 Ga0496100_0393818
2305 Ga0496100_0452147
2306 Ga0496100_1139677
2307 Ga0496101_0040100
2308 Ga0496101_0069709
2309 Ga0496101_0221245
2310 Ga0496101_0267798
2311 Ga0496101_0377968
2312 Ga0496101_0524279
2313 Ga0496101_1166398
2314 Ga0496102_0094521
2315 Ga0496102_0162475
2316 Ga0496102_0504034
2317 Ga0496102_1373151
2318 Ga0496102_1668037
2319 Ga0496103_0041231
2320 Ga0496103_0410328
2321 Ga0496104_0043681
2322 Ga0496104_0069316
2323 Ga0496104_0813958
2324 Ga0496104_1799970
2325 Ga0496105_0057142
2326 Ga0496105_0281869
2327 Ga0496105_0695404
2328 Ga0496105_0878244
2329 Ga0496105_1039787
2330 Ga0496106_0050988
2331 Ga0496106_0061387
2332 Ga0496106_0527575
2333 Ga0496106_0674510
2334 Ga0496106_0703878
2335 Ga0496106_1153680
2336 Ga0496106_1176749
2337 Ga0496107_0020386
2338 Ga0496107_0286648
2339 Ga0496107_0675976
2340 Ga0496107_0928531
2341 Ga0496108_0008153
2342 Ga0496108_0059292
2343 Ga0496108_0123995
2344 Ga0496108_0574805
2345 Ga0496108_0678092
2346 Ga0496109_0026615
2347 Ga0496109_0072401
2348 Ga0496109_0084777
2349 Ga0496109_0112802
2350 Ga0496109_0404795
2351 Ga0496109_0431052
2352 Ga0496109_0477626
2353 Ga0496110_0024462
2354 Ga0496110_0034274
2355 Ga0496110_0038123
2356 Ga0496110_0064213
2357 Ga0496110_0521186
2358 Ga0496110_0577812
2359 Ga0496110_0639966
2360 Ga0496110_1048870
2361 Ga0496111_0008218
2362 Ga0496111_0016469
2363 Ga0496111_0055552
2364 Ga0496111_0142828
2365 Ga0496111_0658641
2366 Ga0496111_1040429
2367 Ga0496112_0083822
2368 Ga0496112_0284341
2369 Ga0496112_0336448
2370 Ga0496112_0692825
2371 Ga0496113_0088351
2372 Ga0496113_0357962
2373 Ga0496113_1422783
2374 Ga0496114_0004408
2375 Ga0496114_0061930
2376 Ga0496114_0411326
2377 Ga0496114_0427260
2378 Ga0496115_0135596
2379 Ga0501031_0012038
2380 Ga0501031_0046419
2381 Ga0501031_0102930
2382 Ga0501031_0133062
2383 Ga0501031_0268790
2384 Ga0501031_0618238
2385 Ga0501031_0772134
2386 Ga0501032_0009312
2387 Ga0501032_0040718
2388 Ga0501032_0258716
2389 Ga0501033_0021846
2390 Ga0501033_0036869
2391 Ga0501033_0325338
2392 Ga0501033_0738189
2393 Ga0501034_0006648
2394 Ga0501034_0241853
2395 Ga0501036_0028893
2396 Ga0501036_0067807
2397 Ga0501036_0950110
2398 Ga0501036_1054021
2399 Ga0501036_1255580
2400 Ga0501036_1264560
2401 Ga0501036_1572774
2402 Ga0501037_0025445
2403 Ga0501037_0093995
2404 Ga0501037_0336475
2405 Ga0501037_0642386
2406 Ga0501037_0877976
2407 Ga0501038_0014026
2408 Ga0501038_0022951
2409 Ga0501038_0099483
2410 Ga0501038_0104310
2411 Ga0501038_0107049
2412 Ga0501039_0017827
2413 Ga0501039_0020329
2414 Ga0501039_0044490
2415 Ga0501039_0069024
2416 Ga0501039_0187473
2417 Ga0501039_0310053
2418 Ga0501039_0332769
2419 Ga0501039_0342544
2420 Ga0501040_0025559
2421 Ga0501040_0034647
2422 Ga0501040_0060242
2423 Ga0501040_0104962
2424 Ga0501040_0154227
2425 Ga0501040_0237634
2426 Ga0501040_0241137
2427 Ga0501040_0272580
2428 Ga0501040_0597726
2429 Ga0501041_0008903
2430 Ga0501041_0014526
2431 Ga0501041_0015210
2432 Ga0501041_0019270
2433 Ga0501041_0040061
2434 Ga0501041_0072764
2435 Ga0501041_0135766
2436 Ga0501041_0211426
2437 Ga0501042_0003538
2438 Ga0501042_0017606
2439 Ga0501042_0026539
2440 Ga0501042_0027078
2441 Ga0501042_0030894
2442 Ga0501042_0106781
2443 Ga0501042_0133533
2444 Ga0501042_0144127
2445 Ga0501042_0270108
2446 Ga0501042_0675095
2447 Ga0501043_0034936
2448 Ga0501043_0042331
2449 Ga0501043_0118712
2450 Ga0501043_0276892
2451 Ga0501043_0672144
2452 Ga0501046_0007807
2453 Ga0501046_0008573
2454 Ga0501046_0087294
2455 Ga0501046_0167359
2456 Ga0501046_0336084
2457 Ga0501046_0383796
2458 Ga0501046_0579556
2459 Ga0501046_0788196
2460 Ga0501046_0801238
2461 Ga0501047_0126429
2462 Ga0501047_0196516
2463 Ga0501048_0017545
2464 Ga0501048_0034908
2465 Ga0501048_0039370
2466 Ga0501048_0044252
2467 Ga0501048_0055531
2468 Ga0501048_0153411
2469 Ga0501048_0345539
2470 Ga0501048_0401076
2471 Ga0501048_1211490
2472 Ga0501048_1273361
2473 Ga0501067_0024919
2474 Ga0501067_0032625
2475 Ga0501067_0042129
2476 Ga0501067_0043714
2477 Ga0501067_0091319
2478 Ga0501067_0131387
2479 Ga0501067_0133302
2480 Ga0501067_0217198
2481 Ga0501067_0493225
2482 Ga0501067_0559982
2483 Ga0501067_0671300
2484 Ga0501067_0762400
2485 Ga0501067_0798129
2486 Ga0501068_0005150
2487 Ga0501068_0013672
2488 Ga0501068_0026897
2489 Ga0501068_0041966
2490 Ga0501068_0132097
2491 Ga0501068_0199924
2492 Ga0501068_0378843
2493 Ga0501068_0407945
2494 Ga0501068_0521056
2495 Ga0501069_0008060
2496 Ga0501069_0012222
2497 Ga0501069_0029632
2498 Ga0501069_0041140
2499 Ga0501069_0074900
2500 Ga0501069_0121590
2501 Ga0501069_0240185
2502 Ga0501069_0458473
2503 Ga0501069_0650322
2504 Ga0501069_0819646
2505 Ga0501070_0005450
2506 Ga0501070_0024219
2507 Ga0501070_0042991
2508 Ga0501070_0121643
2509 Ga0501070_0767947
2510 Ga0501070_0916381
2511 Ga0501071_0004239
2512 Ga0501071_0016601
2513 Ga0501071_0024934
2514 Ga0501071_0044149
2515 Ga0501071_0111975
2516 Ga0501071_0116910
2517 Ga0501071_0179963
2518 Ga0501071_0211552
2519 Ga0501071_0293214
2520 Ga0501071_0486838
2521 Ga0501071_0624281
2522 Ga0501071_0787089
2523 Ga0501071_0822950
2524 Ga0501071_1507907
2525 Ga0501072_0001651
2526 Ga0501072_0005423
2527 Ga0501072_0020822
2528 Ga0501072_0036004
2529 Ga0501072_0045724
2530 Ga0501072_0055072
2531 Ga0501072_0058860
2532 Ga0501072_0124428
2533 Ga0501072_0141336
2534 Ga0501072_0278708
2535 Ga0501072_0334331
2536 Ga0501072_0348745
2537 Ga0501072_0441587
2538 Ga0501072_0549802
2539 Ga0501072_0745548
2540 Ga0501072_0887041
2541 Ga0501073_0009378
2542 Ga0501073_0012213
2543 Ga0501073_0013372
2544 Ga0501073_0045049
2545 Ga0501073_0217281
2546 Ga0501073_0362632
2547 Ga0501073_0670145
2548 Ga0501074_0002358
2549 Ga0501074_0004166
2550 Ga0501074_0023088
2551 Ga0501074_0051706
2552 Ga0501074_0090902
2553 Ga0501074_0185834
2554 Ga0501074_0222392
2555 Ga0501074_0287260
2556 Ga0501075_0020051
2557 Ga0501075_0058875
2558 Ga0501075_0071665
2559 Ga0501075_0106452
2560 Ga0501075_0113984
2561 Ga0501075_0258925
2562 Ga0501075_0278682
2563 Ga0501075_0287171
2564 Ga0501075_0293146
2565 Ga0501075_0325920
2566 Ga0501075_0548482
2567 Ga0501075_0700446
2568 Ga0501076_0003936
2569 Ga0501076_0012716
2570 Ga0501076_0058483
2571 Ga0501076_0112320
2572 Ga0501076_0139566
2573 Ga0501076_0226924
2574 Ga0501076_0267670
2575 Ga0501076_0383920
2576 Ga0501076_0394058
2577 Ga0501076_0423574
2578 Ga0501076_0650545
2579 Ga0501076_1372199
2580 Ga0501076_1695491
2581 Ga0501076_1708753
2582 Ga0501077_0001226
2583 Ga0501077_0003639
2584 Ga0501077_0015474
2585 Ga0501077_0026652
2586 Ga0501077_0042129
2587 Ga0501077_0191286
2588 Ga0501077_0241160
2589 Ga0501077_0473322
2590 Ga0501077_0480978
2591 Ga0501077_0543895
2592 Ga0501077_0590153
2593 Ga0501077_0610053
2594 Ga0501077_1078606
2595 Ga0501079_0003747
2596 Ga0501079_0051905
2597 Ga0501079_0066665
2598 Ga0501079_0082527
2599 Ga0501079_0086547
2600 Ga0501079_0092115
2601 Ga0501079_0128587
2602 Ga0501079_0195242
2603 Ga0501079_0756240
2604 Ga0501079_1319198
2605 Ga0501079_1353700
2606 Ga0501080_0013674
2607 Ga0501080_0014355
2608 Ga0501080_0050842
2609 Ga0501080_0108758
2610 Ga0501080_0172991
2611 Ga0501080_0216392
2612 Ga0501080_0553682
2613 Ga0501081_0008544
2614 Ga0501081_0016971
2615 Ga0501081_0038237
2616 Ga0501081_0053405
2617 Ga0501081_0076239
2618 Ga0501081_0094034
2619 Ga0501081_0097443
2620 Ga0501081_0198350
2621 Ga0501081_0285514
2622 Ga0501081_1190889
2623 Ga0501081_1392638
2624 Ga0501083_0022414
2625 Ga0501083_0027169
2626 Ga0501083_0036063
2627 Ga0501083_0262384
2628 Ga0501083_0455414
2629 Ga0501083_0891601
2630 Ga0501035_0016223
2631 Ga0501035_0047583
2632 Ga0501035_0059885
2633 Ga0501035_0197842
2634 Ga0501035_0542707
2635 Ga0501035_1397203
2636 Ga0501044_0084672
2637 Ga0501044_0492730
2638 Ga0501044_1102259
2639 Ga0501045_0000909
2640 Ga0501045_0009467
2641 Ga0501045_0039307
2642 Ga0501045_0042790
2643 Ga0501045_0053808
2644 Ga0501045_0098691
2645 Ga0501045_0413681
2646 Ga0501045_0630942
2647 Ga0501045_0683172
2648 Ga0501045_1237283
2649 nmdc:mga03683_551052_c1
2650 nmdc:mga03n38_17683_c1
2651 nmdc:mga00v17_110322_c1
2652 nmdc:mga00v17_960189_c1
2653 nmdc:mga0yw44_403448_c1
2654 nmdc:mga06z11_933129_c1
2655 nmdc:mga05p37_100200_c1
2656 nmdc:mga05p37_104041_c1
2657 nmdc:mga05p37_12780_c1
2658 nmdc:mga05p37_1412827_c1
2659 nmdc:mga05p37_172752_c1
2660 nmdc:mga05p37_2044102_c1
2661 nmdc:mga05p37_266595_c1
2662 nmdc:mga05p37_43366_c1
2663 nmdc:mga05p37_480493_c1
2664 nmdc:mga05p37_493695_c1
2665 nmdc:mga05p37_62982_c1
2666 nmdc:mga09592_51272_c1
2667 nmdc:mga09592_543478_c1
2668 nmdc:mga09592_558188_c1
2669 nmdc:mga09592_574177_c1
2670 nmdc:mga09592_667699_c1
2671 nmdc:mga0qj67_4619_c1
2672 nmdc:mga0qj67_615726_c1
2673 nmdc:mga06r32_142882_c1
2674 nmdc:mga06r32_149692_c1
2675 nmdc:mga06r32_32885_c1
2676 nmdc:mga06r32_594284_c1
2677 nmdc:mga06r32_67730_c1
2678 nmdc:mga08y16_104774_c1
2679 nmdc:mga08y16_1396842_c1
2680 nmdc:mga08y16_154884_c1
2681 nmdc:mga08y16_23777_c1
2682 nmdc:mga08y16_553118_c1
2683 nmdc:mga08y16_86500_c1
2684 nmdc:mga08y16_89841_c1
2685 nmdc:mga08y16_978204_c1
2686 nmdc:mga0n895_1308197_c1
2687 nmdc:mga0n895_171743_c1
2688 nmdc:mga0n895_246130_c1
2689 nmdc:mga0n895_467662_c1
2690 nmdc:mga0n895_543103_c1
2691 nmdc:mga0n895_860670_c1
2692 nmdc:mga0rr50_1044594_c1
2693 nmdc:mga0rr50_109106_c1
2694 nmdc:mga0rr50_802966_c1
2695 nmdc:mga0rr50_96285_c1
2696 nmdc:mga08x19_1025854_c1
2697 nmdc:mga08x19_20397_c1
2698 nmdc:mga0a205_360825_c1
2699 nmdc:mga0a205_410423_c1
2700 nmdc:mga0a205_434145_c1
2701 nmdc:mga0a205_648689_c1
2702 nmdc:mga0a205_814202_c1
2703 nmdc:mga0a205_916989_c1
2704 Ga0495612_0162607
2705 Ga0495612_0182139
2706 Ga0495595_0007348
2707 Ga0495595_0057451
2708 Ga0495619_0005609
2709 Ga0495619_0052504
2710 Ga0495619_0092743
2711 Ga0501084_0001727
2712 Ga0501084_0001938
2713 Ga0501084_0010553
2714 Ga0501084_0037373
2715 Ga0501084_0064394
2716 Ga0501084_0090175
2717 Ga0501084_0092310
2718 Ga0501084_0123387
2719 Ga0501084_0342470
2720 Ga0501084_0560275
2721 Ga0501084_0573247
2722 Ga0501084_0958367
2723 Ga0501084_1186010
2724 Ga0501084_1432745
2725 Ga0587083_0222991
2726 Ga0501082_0007325
2727 Ga0501082_0022432
2728 Ga0501082_0039044
2729 Ga0501082_0117020
2730 Ga0501082_0268810
2731 Ga0501082_0283158
2732 Ga0501082_0335404
2733 Ga0501082_0382357
2734 Ga0501082_0590593
2735 Ga0501082_1051620
2736 Ga0501082_1229887
2737 Ga0501082_1329837
2738 Ga0466962_0158490
2739 Ga0466962_0623646
2740 Ga0530510_0009521
2741 Ga0530510_0032193
2742 Ga0530510_0045754
2743 Ga0530510_0049002
2744 Ga0530510_0050575
2745 Ga0530510_0099733
2746 Ga0530510_0385680
2747 Ga0530510_0392763
2748 Ga0530510_0396617
2749 Ga0530510_0517425
2750 Ga0530510_0534651
2751 Ga0530510_0548529
2752 Ga0530510_0652251
2753 Ga0530510_0866940
2754 Ga0530510_1311350

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

44

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9608 10 102
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.9545 12 102
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.9516 8 102
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9461 9 105
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9385 9 105
ID Description Score Start End Superfamily
2fswA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9457 8 101 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.939 11 104 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9053 12 102 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8976 8 102 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8941 21 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7T9KFM3-F1-model_v4 deleted 0.9911 11 102
AF-A0A7Y5WYV9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9893 4 103 GO:0003677
AF-A0A538JJH9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9854 11 104 GO:0003677
AF-A0A6N7QHP6-F1-model_v4 deleted 0.9848 10 105
AF-A0A841UAS2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9847 10 102 GO:0003677

Map