F493482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1377 | 395 | 2754 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10025323|Ga0105243_100253233 |
| Length | 137 |
| Sequence | MTQNVETAPAARTLRDMAASAEPARTMLPVHQAGQCSVAATGEIVGSKWTVLIVHDLSEGPRRFTELEHACAGISPRTLAERLRWLEAEGIVVRRSYAESPPRVEYELTDKGDALKPIIDEMRRFGHEWLGCDVHSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 256 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 257 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 258 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 261 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 262 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 263 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 264 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 265 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 266 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 267 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 268 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 269 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 6.03 |
| Rhizosphere | 92.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105243_10025323 | 3300009148 | Bacteria | 4532 |
| 2 | JGI24747J21853_1031309 | 3300001978 | Bacteria | 609 |
| 3 | JGI24743J22301_10006625 | 3300001991 | Bacteria | 1982 |
| 4 | JGI24743J22301_10052076 | 3300001991 | Unclassified | 835 |
| 5 | JGI24743J22301_10072539 | 3300001991 | Bacteria | 719 |
| 6 | JGI24738J21930_10017112 | 3300002075 | Bacteria | 1526 |
| 7 | JGI24033J26618_1017366 | 3300002155 | Unclassified | 900 |
| 8 | JGI24034J26672_10025166 | 3300002239 | Bacteria | 951 |
| 9 | JGI24751J29686_10111242 | 3300002459 | Bacteria | 574 |
| 10 | JGI25406J46586_10013282 | 3300003203 | Bacteria | 3543 |
| 11 | Ga0058862_11948148 | 3300004803 | Bacteria | 549 |
| 12 | Ga0070658_10154985 | 3300005327 | Bacteria | 1920 |
| 13 | Ga0070658_10191527 | 3300005327 | Bacteria | 1723 |
| 14 | Ga0070676_10069255 | 3300005328 | Bacteria | 2114 |
| 15 | Ga0070676_10129842 | 3300005328 | Bacteria | 1592 |
| 16 | Ga0070676_10431802 | 3300005328 | Bacteria | 922 |
| 17 | Ga0070676_10583319 | 3300005328 | Bacteria | 804 |
| 18 | Ga0070683_100001405 | 3300005329 | Bacteria | 18499 |
| 19 | Ga0070683_100019032 | 3300005329 | Bacteria | 6092 |
| 20 | Ga0070683_100030770 | 3300005329 | Bacteria | 4877 |
| 21 | Ga0070683_100158958 | 3300005329 | Bacteria | 2144 |
| 22 | Ga0070683_100197316 | 3300005329 | Bacteria | 1911 |
| 23 | Ga0070683_100237391 | 3300005329 | Bacteria | 1734 |
| 24 | Ga0070683_100387842 | 3300005329 | Bacteria | 1331 |
| 25 | Ga0070683_100534476 | 3300005329 | Bacteria | 1121 |
| 26 | Ga0070683_102427233 | 3300005329 | Unclassified | 502 |
| 27 | Ga0070690_100123873 | 3300005330 | Bacteria | 1738 |
| 28 | Ga0070690_100169633 | 3300005330 | Bacteria | 1501 |
| 29 | Ga0070670_100009289 | 3300005331 | Bacteria | 8398 |
| 30 | Ga0070670_100015080 | 3300005331 | Bacteria | 6632 |
| 31 | Ga0070670_100081538 | 3300005331 | Bacteria | 2779 |
| 32 | Ga0070677_10559961 | 3300005333 | Bacteria | 628 |
| 33 | Ga0068869_100019754 | 3300005334 | Bacteria | 4610 |
| 34 | Ga0068869_100890976 | 3300005334 | Bacteria | 769 |
| 35 | Ga0070680_100009539 | 3300005336 | Bacteria | 7455 |
| 36 | Ga0070680_100021512 | 3300005336 | Bacteria | 5127 |
| 37 | Ga0070680_100050228 | 3300005336 | Bacteria | 3401 |
| 38 | Ga0070680_100244669 | 3300005336 | Bacteria | 1516 |
| 39 | Ga0070682_100012429 | 3300005337 | Bacteria | 4883 |
| 40 | Ga0070682_100023546 | 3300005337 | Bacteria | 3656 |
| 41 | Ga0070682_100121130 | 3300005337 | Bacteria | 1757 |
| 42 | Ga0070682_100232193 | 3300005337 | Bacteria | 1319 |
| 43 | Ga0070682_100905053 | 3300005337 | Bacteria | 725 |
| 44 | Ga0070682_101400430 | 3300005337 | Archaea | 598 |
| 45 | Ga0068868_100065936 | 3300005338 | Bacteria | 2877 |
| 46 | Ga0068868_100113491 | 3300005338 | Bacteria | 2203 |
| 47 | Ga0068868_100187850 | 3300005338 | Bacteria | 1717 |
| 48 | Ga0068868_100349631 | 3300005338 | Bacteria | 1266 |
| 49 | Ga0068868_100621575 | 3300005338 | Bacteria | 959 |
| 50 | Ga0068868_100725116 | 3300005338 | Bacteria | 891 |
| 51 | Ga0070660_100002717 | 3300005339 | Bacteria | 12155 |
| 52 | Ga0070660_100028904 | 3300005339 | Bacteria | 4151 |
| 53 | Ga0070660_100033834 | 3300005339 | Bacteria | 3856 |
| 54 | Ga0070660_100099843 | 3300005339 | Bacteria | 2299 |
| 55 | Ga0070660_100131256 | 3300005339 | Bacteria | 2005 |
| 56 | Ga0070660_100180917 | 3300005339 | Bacteria | 1706 |
| 57 | Ga0070689_100003852 | 3300005340 | Bacteria | 10052 |
| 58 | Ga0070689_100122934 | 3300005340 | Bacteria | 2074 |
| 59 | Ga0070689_100157203 | 3300005340 | Bacteria | 1836 |
| 60 | Ga0070691_10003135 | 3300005341 | Bacteria | 7402 |
| 61 | Ga0070691_10030728 | 3300005341 | Bacteria | 2517 |
| 62 | Ga0070687_100064372 | 3300005343 | Bacteria | 1948 |
| 63 | Ga0070687_100111875 | 3300005343 | Unclassified | 1547 |
| 64 | Ga0070661_100004092 | 3300005344 | Bacteria | 10049 |
| 65 | Ga0070661_100073769 | 3300005344 | Bacteria | 2512 |
| 66 | Ga0070661_100466461 | 3300005344 | Unclassified | 1006 |
| 67 | Ga0070692_10000917 | 3300005345 | Bacteria | 9982 |
| 68 | Ga0070692_10015220 | 3300005345 | Bacteria | 3634 |
| 69 | Ga0070692_10042146 | 3300005345 | Bacteria | 2342 |
| 70 | Ga0070692_10375824 | 3300005345 | Bacteria | 890 |
| 71 | Ga0070668_100093049 | 3300005347 | Bacteria | 2379 |
| 72 | Ga0070668_100099110 | 3300005347 | Bacteria | 2307 |
| 73 | Ga0070668_100391319 | 3300005347 | Unclassified | 1185 |
| 74 | Ga0070675_100013579 | 3300005354 | Bacteria | 6404 |
| 75 | Ga0070675_100064339 | 3300005354 | Bacteria | 3032 |
| 76 | Ga0070675_101173522 | 3300005354 | Unclassified | 707 |
| 77 | Ga0070671_100138274 | 3300005355 | Bacteria | 2054 |
| 78 | Ga0070671_100183393 | 3300005355 | Bacteria | 1772 |
| 79 | Ga0070671_100382069 | 3300005355 | Unclassified | 1204 |
| 80 | Ga0070671_101839761 | 3300005355 | Bacteria | 538 |
| 81 | Ga0070674_100006249 | 3300005356 | Bacteria | 6934 |
| 82 | Ga0070674_100017624 | 3300005356 | Bacteria | 4498 |
| 83 | Ga0070674_100060431 | 3300005356 | Bacteria | 2641 |
| 84 | Ga0070674_100137826 | 3300005356 | Bacteria | 1828 |
| 85 | Ga0070674_100151478 | 3300005356 | Bacteria | 1751 |
| 86 | Ga0070674_100738264 | 3300005356 | Bacteria | 845 |
| 87 | Ga0070674_100879113 | 3300005356 | Bacteria | 779 |
| 88 | Ga0070674_101402457 | 3300005356 | Bacteria | 626 |
| 89 | Ga0070673_100018469 | 3300005364 | Bacteria | 4982 |
| 90 | Ga0070673_100039084 | 3300005364 | Bacteria | 3628 |
| 91 | Ga0070673_100228655 | 3300005364 | Bacteria | 1613 |
| 92 | Ga0070688_100035677 | 3300005365 | Bacteria | 3021 |
| 93 | Ga0070688_100046950 | 3300005365 | Bacteria | 2676 |
| 94 | Ga0070659_100005769 | 3300005366 | Bacteria | 8911 |
| 95 | Ga0070659_100020421 | 3300005366 | Bacteria | 5031 |
| 96 | Ga0070659_100030033 | 3300005366 | Bacteria | 4204 |
| 97 | Ga0070659_100076580 | 3300005366 | Bacteria | 2667 |
| 98 | Ga0070659_100082947 | 3300005366 | Bacteria | 2561 |
| 99 | Ga0070659_100636536 | 3300005366 | Bacteria | 919 |
| 100 | Ga0070667_100181378 | 3300005367 | Bacteria | 1862 |
| 101 | Ga0070709_10095271 | 3300005434 | Bacteria | 1971 |
| 102 | Ga0070714_100032641 | 3300005435 | Bacteria | 4347 |
| 103 | Ga0070713_100129371 | 3300005436 | Bacteria | 2225 |
| 104 | Ga0070701_10038796 | 3300005438 | Bacteria | 2413 |
| 105 | Ga0070701_10039581 | 3300005438 | Bacteria | 2392 |
| 106 | Ga0070701_10746602 | 3300005438 | Bacteria | 662 |
| 107 | Ga0070705_100934122 | 3300005440 | Bacteria | 700 |
| 108 | Ga0070700_100114821 | 3300005441 | Bacteria | 1796 |
| 109 | Ga0070700_100213931 | 3300005441 | Bacteria | 1362 |
| 110 | Ga0070700_100535784 | 3300005441 | Bacteria | 907 |
| 111 | Ga0070694_100144022 | 3300005444 | Bacteria | 1734 |
| 112 | Ga0070694_100215822 | 3300005444 | Bacteria | 1437 |
| 113 | Ga0070694_100267002 | 3300005444 | Bacteria | 1300 |
| 114 | Ga0070694_100288694 | 3300005444 | Bacteria | 1253 |
| 115 | Ga0070708_100113488 | 3300005445 | Bacteria | 2492 |
| 116 | Ga0070708_100701405 | 3300005445 | Bacteria | 953 |
| 117 | Ga0070708_101029493 | 3300005445 | Bacteria | 772 |
| 118 | Ga0070708_101049714 | 3300005445 | Bacteria | 764 |
| 119 | Ga0070663_100091921 | 3300005455 | Bacteria | 2249 |
| 120 | Ga0070663_100378909 | 3300005455 | Bacteria | 1152 |
| 121 | Ga0070663_100503284 | 3300005455 | Unclassified | 1006 |
| 122 | Ga0070678_100020509 | 3300005456 | Bacteria | 4338 |
| 123 | Ga0070678_100036136 | 3300005456 | Bacteria | 3456 |
| 124 | Ga0070678_100046431 | 3300005456 | Bacteria | 3114 |
| 125 | Ga0070678_100503227 | 3300005456 | Unclassified | 1069 |
| 126 | Ga0070678_101656125 | 3300005456 | Bacteria | 601 |
| 127 | Ga0070662_100011454 | 3300005457 | Bacteria | 5852 |
| 128 | Ga0070662_100047899 | 3300005457 | Bacteria | 3077 |
| 129 | Ga0070662_100115846 | 3300005457 | Bacteria | 2047 |
| 130 | Ga0070662_101415533 | 3300005457 | Bacteria | 599 |
| 131 | Ga0070681_10033554 | 3300005458 | Bacteria | 5152 |
| 132 | Ga0070681_10088761 | 3300005458 | Bacteria | 3043 |
| 133 | Ga0070681_10384719 | 3300005458 | Bacteria | 1314 |
| 134 | Ga0068867_100007801 | 3300005459 | Bacteria | 7570 |
| 135 | Ga0068867_100027137 | 3300005459 | Bacteria | 4114 |
| 136 | Ga0068867_100084350 | 3300005459 | Bacteria | 2400 |
| 137 | Ga0068867_100206789 | 3300005459 | Bacteria | 1574 |
| 138 | Ga0068867_100526444 | 3300005459 | Bacteria | 1020 |
| 139 | Ga0068867_100562592 | 3300005459 | Bacteria | 989 |
| 140 | Ga0070685_10004165 | 3300005466 | Bacteria | 7297 |
| 141 | Ga0070685_10016935 | 3300005466 | Bacteria | 3891 |
| 142 | Ga0070685_10031326 | 3300005466 | Bacteria | 2970 |
| 143 | Ga0070706_100047233 | 3300005467 | Bacteria | 3972 |
| 144 | Ga0070707_100027798 | 3300005468 | Bacteria | 5381 |
| 145 | Ga0070707_100258432 | 3300005468 | Unclassified | 1694 |
| 146 | Ga0070707_101081671 | 3300005468 | Bacteria | 768 |
| 147 | Ga0070698_100079986 | 3300005471 | Bacteria | 3264 |
| 148 | Ga0070698_100416419 | 3300005471 | Bacteria | 1278 |
| 149 | Ga0070698_100451343 | 3300005471 | Bacteria | 1221 |
| 150 | Ga0070699_100005200 | 3300005518 | Bacteria | 11442 |
| 151 | Ga0070699_100155093 | 3300005518 | Bacteria | 2026 |
| 152 | Ga0070699_100252609 | 3300005518 | Bacteria | 1575 |
| 153 | Ga0070699_100536889 | 3300005518 | Bacteria | 1064 |
| 154 | Ga0070679_100078953 | 3300005530 | Bacteria | 3280 |
| 155 | Ga0070679_100081458 | 3300005530 | Bacteria | 3226 |
| 156 | Ga0070679_100102120 | 3300005530 | Bacteria | 2854 |
| 157 | Ga0070679_100115819 | 3300005530 | Bacteria | 2665 |
| 158 | Ga0070679_100193876 | 3300005530 | Unclassified | 1999 |
| 159 | Ga0070679_100324007 | 3300005530 | Bacteria | 1490 |
| 160 | Ga0070679_101266688 | 3300005530 | Bacteria | 683 |
| 161 | Ga0070684_100012224 | 3300005535 | Bacteria | 6871 |
| 162 | Ga0070684_100030097 | 3300005535 | Bacteria | 4610 |
| 163 | Ga0070684_100033606 | 3300005535 | Bacteria | 4381 |
| 164 | Ga0070684_100047104 | 3300005535 | Bacteria | 3736 |
| 165 | Ga0070684_100047834 | 3300005535 | Bacteria | 3708 |
| 166 | Ga0070684_100104616 | 3300005535 | Bacteria | 2532 |
| 167 | Ga0070684_100169758 | 3300005535 | Bacteria | 1981 |
| 168 | Ga0070684_100304565 | 3300005535 | Bacteria | 1462 |
| 169 | Ga0070684_100533209 | 3300005535 | Unclassified | 1088 |
| 170 | Ga0070684_100598596 | 3300005535 | Bacteria | 1025 |
| 171 | Ga0070697_100612367 | 3300005536 | Bacteria | 957 |
| 172 | Ga0070697_100664615 | 3300005536 | Unclassified | 918 |
| 173 | Ga0070697_101531841 | 3300005536 | Bacteria | 596 |
| 174 | Ga0068853_100030585 | 3300005539 | Bacteria | 4549 |
| 175 | Ga0068853_100043247 | 3300005539 | Bacteria | 3854 |
| 176 | Ga0068853_100476837 | 3300005539 | Bacteria | 1176 |
| 177 | Ga0068853_100645724 | 3300005539 | Bacteria | 1007 |
| 178 | Ga0070672_100016503 | 3300005543 | Bacteria | 5288 |
| 179 | Ga0070672_100031054 | 3300005543 | Bacteria | 4018 |
| 180 | Ga0070672_100041035 | 3300005543 | Bacteria | 3554 |
| 181 | Ga0070672_100715872 | 3300005543 | Unclassified | 877 |
| 182 | Ga0070672_101408373 | 3300005543 | Unclassified | 624 |
| 183 | Ga0070686_100026827 | 3300005544 | Bacteria | 3480 |
| 184 | Ga0070686_100141771 | 3300005544 | Bacteria | 1674 |
| 185 | Ga0070686_100176280 | 3300005544 | Bacteria | 1516 |
| 186 | Ga0070695_100301139 | 3300005545 | Bacteria | 1185 |
| 187 | Ga0070695_100307007 | 3300005545 | Bacteria | 1175 |
| 188 | Ga0070695_100763506 | 3300005545 | Bacteria | 772 |
| 189 | Ga0070696_100626699 | 3300005546 | Bacteria | 869 |
| 190 | Ga0070693_100015948 | 3300005547 | Bacteria | 3879 |
| 191 | Ga0070693_100054589 | 3300005547 | Bacteria | 2298 |
| 192 | Ga0070693_100106136 | 3300005547 | Bacteria | 1719 |
| 193 | Ga0070693_101149608 | 3300005547 | Bacteria | 594 |
| 194 | Ga0070665_100023124 | 3300005548 | Bacteria | 6262 |
| 195 | Ga0070665_100278994 | 3300005548 | Bacteria | 1673 |
| 196 | Ga0070704_100048900 | 3300005549 | Bacteria | 2962 |
| 197 | Ga0070704_100078313 | 3300005549 | Bacteria | 2425 |
| 198 | Ga0070704_100870360 | 3300005549 | Bacteria | 809 |
| 199 | Ga0068855_100174806 | 3300005563 | Bacteria | 2430 |
| 200 | Ga0068855_100622971 | 3300005563 | Bacteria | 1161 |
| 201 | Ga0068855_101332101 | 3300005563 | Bacteria | 742 |
| 202 | Ga0070664_100016770 | 3300005564 | Bacteria | 6011 |
| 203 | Ga0070664_100019661 | 3300005564 | Bacteria | 5558 |
| 204 | Ga0070664_100613081 | 3300005564 | Bacteria | 1010 |
| 205 | Ga0070664_101232699 | 3300005564 | Bacteria | 706 |
| 206 | Ga0068857_100013490 | 3300005577 | Bacteria | 7118 |
| 207 | Ga0068857_100378601 | 3300005577 | Bacteria | 1314 |
| 208 | Ga0068857_100573238 | 3300005577 | Unclassified | 1065 |
| 209 | Ga0068854_100192654 | 3300005578 | Bacteria | 1598 |
| 210 | Ga0068854_100253860 | 3300005578 | Bacteria | 1405 |
| 211 | Ga0068856_100013469 | 3300005614 | Bacteria | 7914 |
| 212 | Ga0068856_100060165 | 3300005614 | Bacteria | 3752 |
| 213 | Ga0068856_100229082 | 3300005614 | Bacteria | 1874 |
| 214 | Ga0068856_101242312 | 3300005614 | Viruses | 761 |
| 215 | Ga0070702_100008487 | 3300005615 | Bacteria | 4979 |
| 216 | Ga0070702_100012133 | 3300005615 | Bacteria | 4306 |
| 217 | Ga0070702_100092102 | 3300005615 | Bacteria | 1840 |
| 218 | Ga0070702_100863935 | 3300005615 | Bacteria | 705 |
| 219 | Ga0068852_100097305 | 3300005616 | Bacteria | 2647 |
| 220 | Ga0068852_100564459 | 3300005616 | Bacteria | 1140 |
| 221 | Ga0068852_100609234 | 3300005616 | Bacteria | 1097 |
| 222 | Ga0068859_100033061 | 3300005617 | Bacteria | 5195 |
| 223 | Ga0068864_100012769 | 3300005618 | Bacteria | 6943 |
| 224 | Ga0068864_100039006 | 3300005618 | Bacteria | 4058 |
| 225 | Ga0068864_100512999 | 3300005618 | Unclassified | 1155 |
| 226 | Ga0068866_10003279 | 3300005718 | Bacteria | 6652 |
| 227 | Ga0068866_10014812 | 3300005718 | Bacteria | 3452 |
| 228 | Ga0068866_10050978 | 3300005718 | Bacteria | 2104 |
| 229 | Ga0068866_10141841 | 3300005718 | Unclassified | 1380 |
| 230 | Ga0068866_10260137 | 3300005718 | Bacteria | 1066 |
| 231 | Ga0068861_100048189 | 3300005719 | Bacteria | 3220 |
| 232 | Ga0068861_100094098 | 3300005719 | Bacteria | 2371 |
| 233 | Ga0068861_100245563 | 3300005719 | Bacteria | 1525 |
| 234 | Ga0068861_100280246 | 3300005719 | Unclassified | 1435 |
| 235 | Ga0068851_10015652 | 3300005834 | Bacteria | 3617 |
| 236 | Ga0068851_10037325 | 3300005834 | Bacteria | 2435 |
| 237 | Ga0068851_10522985 | 3300005834 | Bacteria | 714 |
| 238 | Ga0068870_10002280 | 3300005840 | Bacteria | 7967 |
| 239 | Ga0068870_10014111 | 3300005840 | Bacteria | 3768 |
| 240 | Ga0068870_10020026 | 3300005840 | Bacteria | 3252 |
| 241 | Ga0068870_10082875 | 3300005840 | Bacteria | 1777 |
| 242 | Ga0068870_10425617 | 3300005840 | Bacteria | 870 |
| 243 | Ga0068870_10893650 | 3300005840 | Bacteria | 627 |
| 244 | Ga0068863_100343255 | 3300005841 | Bacteria | 1453 |
| 245 | Ga0068863_101952968 | 3300005841 | Bacteria | 597 |
| 246 | Ga0068863_102200928 | 3300005841 | Bacteria | 561 |
| 247 | Ga0068858_100031628 | 3300005842 | Bacteria | 4916 |
| 248 | Ga0068858_100108309 | 3300005842 | Bacteria | 2594 |
| 249 | Ga0068858_100809234 | 3300005842 | Unclassified | 914 |
| 250 | Ga0068860_100180416 | 3300005843 | Bacteria | 2040 |
| 251 | Ga0068860_100224189 | 3300005843 | Bacteria | 1826 |
| 252 | Ga0068862_100636004 | 3300005844 | Bacteria | 1028 |
| 253 | Ga0068862_101032690 | 3300005844 | Bacteria | 814 |
| 254 | Ga0068862_101909718 | 3300005844 | Bacteria | 604 |
| 255 | Ga0081455_10002152 | 3300005937 | Bacteria | 23499 |
| 256 | Ga0081455_10047017 | 3300005937 | Bacteria | 3740 |
| 257 | Ga0081455_10133409 | 3300005937 | Bacteria | 1938 |
| 258 | Ga0081455_10179722 | 3300005937 | Unclassified | 1603 |
| 259 | Ga0081455_10187366 | 3300005937 | Bacteria | 1562 |
| 260 | Ga0081455_10196766 | 3300005937 | Bacteria | 1513 |
| 261 | Ga0081455_10405094 | 3300005937 | Bacteria | 945 |
| 262 | Ga0081455_10602559 | 3300005937 | Bacteria | 716 |
| 263 | Ga0081455_10757500 | 3300005937 | Unclassified | 613 |
| 264 | Ga0081540_1002321 | 3300005983 | Bacteria | 15592 |
| 265 | Ga0081540_1031707 | 3300005983 | Bacteria | 2899 |
| 266 | Ga0081539_10000216 | 3300005985 | Bacteria | 134976 |
| 267 | Ga0081539_10000477 | 3300005985 | Bacteria | 84784 |
| 268 | Ga0081539_10072272 | 3300005985 | Bacteria | 1844 |
| 269 | Ga0075365_10210994 | 3300006038 | Bacteria | 1361 |
| 270 | Ga0075365_10288063 | 3300006038 | Bacteria | 1156 |
| 271 | Ga0075365_11345489 | 3300006038 | Bacteria | 502 |
| 272 | Ga0075363_100029161 | 3300006048 | Bacteria | 2846 |
| 273 | Ga0075364_10170931 | 3300006051 | Bacteria | 1469 |
| 274 | Ga0075432_10018044 | 3300006058 | Bacteria | 2407 |
| 275 | Ga0075432_10024469 | 3300006058 | Bacteria | 2069 |
| 276 | Ga0075432_10047999 | 3300006058 | Bacteria | 1501 |
| 277 | Ga0075432_10450664 | 3300006058 | Unclassified | 565 |
| 278 | Ga0070715_10111678 | 3300006163 | Bacteria | 1290 |
| 279 | Ga0070712_100013595 | 3300006175 | Bacteria | 5204 |
| 280 | Ga0070712_100058885 | 3300006175 | Bacteria | 2703 |
| 281 | Ga0075362_10530563 | 3300006177 | Bacteria | 604 |
| 282 | Ga0097621_100011148 | 3300006237 | Bacteria | 6614 |
| 283 | Ga0097621_100099488 | 3300006237 | Bacteria | 2444 |
| 284 | Ga0097621_100738175 | 3300006237 | Bacteria | 909 |
| 285 | Ga0075370_10222779 | 3300006353 | Bacteria | 1115 |
| 286 | Ga0068871_100020551 | 3300006358 | Bacteria | 5060 |
| 287 | Ga0068871_100107339 | 3300006358 | Bacteria | 2345 |
| 288 | Ga0068871_100454719 | 3300006358 | Unclassified | 1148 |
| 289 | Ga0068871_102096404 | 3300006358 | Unclassified | 539 |
| 290 | Ga0075428_100021129 | 3300006844 | Bacteria | 7209 |
| 291 | Ga0075428_100093526 | 3300006844 | Bacteria | 3278 |
| 292 | Ga0075428_100323134 | 3300006844 | Bacteria | 1658 |
| 293 | Ga0075428_100332370 | 3300006844 | Bacteria | 1632 |
| 294 | Ga0075428_100881229 | 3300006844 | Bacteria | 950 |
| 295 | Ga0075428_101315789 | 3300006844 | Bacteria | 760 |
| 296 | Ga0075428_102167997 | 3300006844 | Unclassified | 574 |
| 297 | Ga0075430_100018650 | 3300006846 | Bacteria | 5905 |
| 298 | Ga0075431_100046111 | 3300006847 | Bacteria | 4494 |
| 299 | Ga0075431_100150296 | 3300006847 | Bacteria | 2398 |
| 300 | Ga0075431_100201326 | 3300006847 | Bacteria | 2037 |
| 301 | Ga0075431_100645521 | 3300006847 | Bacteria | 1039 |
| 302 | Ga0075433_10118026 | 3300006852 | Bacteria | 2355 |
| 303 | Ga0075433_10270457 | 3300006852 | Bacteria | 1506 |
| 304 | Ga0075433_10324135 | 3300006852 | Unclassified | 1363 |
| 305 | Ga0075433_10372833 | 3300006852 | Bacteria | 1260 |
| 306 | Ga0075433_10377534 | 3300006852 | Bacteria | 1252 |
| 307 | Ga0075433_10395328 | 3300006852 | Bacteria | 1220 |
| 308 | Ga0075433_10451589 | 3300006852 | Bacteria | 1133 |
| 309 | Ga0075434_100070475 | 3300006871 | Bacteria | 3486 |
| 310 | Ga0075434_100355004 | 3300006871 | Unclassified | 1487 |
| 311 | Ga0075434_100413709 | 3300006871 | Bacteria | 1369 |
| 312 | Ga0075434_100866148 | 3300006871 | Bacteria | 919 |
| 313 | Ga0075434_101467019 | 3300006871 | Unclassified | 692 |
| 314 | Ga0075429_100010926 | 3300006880 | Bacteria | 7855 |
| 315 | Ga0075429_100030337 | 3300006880 | Bacteria | 4696 |
| 316 | Ga0075429_100067941 | 3300006880 | Bacteria | 3102 |
| 317 | Ga0075429_100527580 | 3300006880 | Bacteria | 1035 |
| 318 | Ga0068865_100003153 | 3300006881 | Bacteria | 9868 |
| 319 | Ga0068865_100010036 | 3300006881 | Bacteria | 5890 |
| 320 | Ga0068865_100015979 | 3300006881 | Bacteria | 4794 |
| 321 | Ga0068865_100051631 | 3300006881 | Bacteria | 2847 |
| 322 | Ga0068865_100074599 | 3300006881 | Bacteria | 2416 |
| 323 | Ga0068865_100177956 | 3300006881 | Bacteria | 1636 |
| 324 | Ga0068865_100257253 | 3300006881 | Bacteria | 1381 |
| 325 | Ga0068865_100824311 | 3300006881 | Bacteria | 802 |
| 326 | Ga0075436_100030852 | 3300006914 | Bacteria | 3689 |
| 327 | Ga0075436_100899977 | 3300006914 | Unclassified | 662 |
| 328 | Ga0097620_100033061 | 3300006931 | Bacteria | 5195 |
| 329 | Ga0075435_100023363 | 3300007076 | Bacteria | 4781 |
| 330 | Ga0075435_100184243 | 3300007076 | Bacteria | 1765 |
| 331 | Ga0105244_10195536 | 3300009036 | Bacteria | 955 |
| 332 | Ga0105240_10430523 | 3300009093 | Bacteria | 1480 |
| 333 | Ga0111539_10028825 | 3300009094 | Bacteria | 6770 |
| 334 | Ga0111539_10035537 | 3300009094 | Bacteria | 6032 |
| 335 | Ga0111539_10380814 | 3300009094 | Bacteria | 1643 |
| 336 | Ga0111539_10426431 | 3300009094 | Bacteria | 1545 |
| 337 | Ga0111539_10458036 | 3300009094 | Bacteria | 1485 |
| 338 | Ga0111539_10553146 | 3300009094 | Bacteria | 1340 |
| 339 | Ga0111539_11063406 | 3300009094 | Unclassified | 940 |
| 340 | Ga0111539_11102737 | 3300009094 | Bacteria | 922 |
| 341 | Ga0111539_12968849 | 3300009094 | Bacteria | 548 |
| 342 | Ga0111539_13512423 | 3300009094 | Unclassified | 503 |
| 343 | Ga0105245_10000865 | 3300009098 | Bacteria | 27482 |
| 344 | Ga0105245_10005696 | 3300009098 | Bacteria | 10943 |
| 345 | Ga0105245_10041836 | 3300009098 | Bacteria | 4086 |
| 346 | Ga0105245_10051897 | 3300009098 | Bacteria | 3677 |
| 347 | Ga0105245_10073898 | 3300009098 | Bacteria | 3101 |
| 348 | Ga0105245_10156839 | 3300009098 | Bacteria | 2156 |
| 349 | Ga0105245_10303962 | 3300009098 | Bacteria | 1566 |
| 350 | Ga0105245_10382829 | 3300009098 | Bacteria | 1401 |
| 351 | Ga0105245_10457848 | 3300009098 | Bacteria | 1285 |
| 352 | Ga0105245_10618879 | 3300009098 | Unclassified | 1111 |
| 353 | Ga0105245_10940392 | 3300009098 | Bacteria | 907 |
| 354 | Ga0105245_11762507 | 3300009098 | Bacteria | 672 |
| 355 | Ga0105247_10015667 | 3300009101 | Bacteria | 4538 |
| 356 | Ga0114129_10017864 | 3300009147 | Bacteria | 10099 |
| 357 | Ga0114129_10030517 | 3300009147 | Bacteria | 7627 |
| 358 | Ga0114129_10114533 | 3300009147 | Bacteria | 3718 |
| 359 | Ga0114129_10115187 | 3300009147 | Bacteria | 3706 |
| 360 | Ga0114129_10302540 | 3300009147 | Bacteria | 2131 |
| 361 | Ga0114129_10363336 | 3300009147 | Bacteria | 1915 |
| 362 | Ga0114129_10476383 | 3300009147 | Bacteria | 1634 |
| 363 | Ga0114129_10841008 | 3300009147 | Bacteria | 1168 |
| 364 | Ga0114129_10864412 | 3300009147 | Bacteria | 1149 |
| 365 | Ga0114129_11106428 | 3300009147 | Bacteria | 992 |
| 366 | Ga0114129_11517850 | 3300009147 | Bacteria | 823 |
| 367 | Ga0105243_10010340 | 3300009148 | Bacteria | 7087 |
| 368 | Ga0105243_10019868 | 3300009148 | Bacteria | 5095 |
| 369 | Ga0105243_10020472 | 3300009148 | Bacteria | 5015 |
| 370 | Ga0105243_10040453 | 3300009148 | Bacteria | 3641 |
| 371 | Ga0105243_10239865 | 3300009148 | Unclassified | 1613 |
| 372 | Ga0105243_11534396 | 3300009148 | Bacteria | 691 |
| 373 | Ga0105243_12672455 | 3300009148 | Unclassified | 539 |
| 374 | Ga0105241_10125672 | 3300009174 | Bacteria | 2070 |
| 375 | Ga0105241_10445680 | 3300009174 | Bacteria | 1144 |
| 376 | Ga0105242_10004020 | 3300009176 | Bacteria | 11432 |
| 377 | Ga0105242_10008513 | 3300009176 | Bacteria | 7877 |
| 378 | Ga0105242_10019399 | 3300009176 | Bacteria | 5327 |
| 379 | Ga0105242_10067739 | 3300009176 | Bacteria | 2952 |
| 380 | Ga0105242_10285111 | 3300009176 | Unclassified | 1502 |
| 381 | Ga0105242_10365803 | 3300009176 | Unclassified | 1336 |
| 382 | Ga0105242_10935468 | 3300009176 | Bacteria | 870 |
| 383 | Ga0105242_11071049 | 3300009176 | Bacteria | 818 |
| 384 | Ga0105242_11794508 | 3300009176 | Unclassified | 652 |
| 385 | Ga0105248_10020638 | 3300009177 | Bacteria | 7301 |
| 386 | Ga0105248_10056569 | 3300009177 | Bacteria | 4401 |
| 387 | Ga0105248_10066880 | 3300009177 | Bacteria | 4035 |
| 388 | Ga0105248_10335881 | 3300009177 | Unclassified | 1701 |
| 389 | Ga0105248_11233844 | 3300009177 | Bacteria | 845 |
| 390 | Ga0105237_10185040 | 3300009545 | Bacteria | 2083 |
| 391 | Ga0105238_10533963 | 3300009551 | Unclassified | 1176 |
| 392 | Ga0105238_10618239 | 3300009551 | Bacteria | 1092 |
| 393 | Ga0105238_12068732 | 3300009551 | Bacteria | 603 |
| 394 | Ga0105249_10089242 | 3300009553 | Bacteria | 2880 |
| 395 | Ga0105249_10105026 | 3300009553 | Bacteria | 2663 |
| 396 | Ga0105249_10262139 | 3300009553 | Bacteria | 1718 |
| 397 | Ga0105239_10008794 | 3300010375 | Bacteria | 11428 |
| 398 | Ga0105239_10040473 | 3300010375 | Bacteria | 5106 |
| 399 | Ga0105239_10241430 | 3300010375 | Bacteria | 2028 |
| 400 | Ga0105239_10650258 | 3300010375 | Bacteria | 1204 |
| 401 | Ga0105239_10726171 | 3300010375 | Bacteria | 1136 |
| 402 | Ga0105239_11229853 | 3300010375 | Bacteria | 863 |
| 403 | Ga0105239_11738416 | 3300010375 | Unclassified | 722 |
| 404 | Ga0105239_11860739 | 3300010375 | Bacteria | 698 |
| 405 | Ga0105239_12803543 | 3300010375 | Unclassified | 569 |
| 406 | Ga0105246_10004814 | 3300011119 | Bacteria | 8222 |
| 407 | Ga0105246_10068066 | 3300011119 | Bacteria | 2496 |
| 408 | Ga0105246_10068186 | 3300011119 | Bacteria | 2494 |
| 409 | Ga0105246_10188289 | 3300011119 | Bacteria | 1595 |
| 410 | Ga0105246_10452831 | 3300011119 | Bacteria | 1079 |
| 411 | Ga0105246_12318081 | 3300011119 | Unclassified | 525 |
| 412 | Ga0157325_1014658 | 3300012485 | Bacteria | 632 |
| 413 | Ga0157373_10081338 | 3300013100 | Bacteria | 2283 |
| 414 | Ga0157373_10969842 | 3300013100 | Archaea | 633 |
| 415 | Ga0157371_10033070 | 3300013102 | Bacteria | 3718 |
| 416 | Ga0157371_10133271 | 3300013102 | Bacteria | 1768 |
| 417 | Ga0157371_10292857 | 3300013102 | Bacteria | 1177 |
| 418 | Ga0157369_10015732 | 3300013105 | Bacteria | 8525 |
| 419 | Ga0157369_11351306 | 3300013105 | Unclassified | 726 |
| 420 | Ga0157369_11705710 | 3300013105 | Bacteria | 640 |
| 421 | Ga0157374_10033250 | 3300013296 | Bacteria | 4705 |
| 422 | Ga0157374_11945346 | 3300013296 | Bacteria | 614 |
| 423 | Ga0157378_10169648 | 3300013297 | Bacteria | 2046 |
| 424 | Ga0157378_10716846 | 3300013297 | Unclassified | 1021 |
| 425 | Ga0157378_11175632 | 3300013297 | Bacteria | 806 |
| 426 | Ga0163162_10242880 | 3300013306 | Bacteria | 1932 |
| 427 | Ga0163162_10266149 | 3300013306 | Bacteria | 1846 |
| 428 | Ga0163162_10449533 | 3300013306 | Bacteria | 1420 |
| 429 | Ga0163162_12176262 | 3300013306 | Bacteria | 637 |
| 430 | Ga0157372_10005778 | 3300013307 | Bacteria | 13177 |
| 431 | Ga0157372_10016713 | 3300013307 | Bacteria | 7876 |
| 432 | Ga0157372_10431391 | 3300013307 | Bacteria | 1536 |
| 433 | Ga0157372_10922020 | 3300013307 | Bacteria | 1013 |
| 434 | Ga0157375_10002706 | 3300013308 | Bacteria | 15333 |
| 435 | Ga0157375_10021156 | 3300013308 | Bacteria | 5958 |
| 436 | Ga0157375_10062886 | 3300013308 | Bacteria | 3690 |
| 437 | Ga0157375_10108931 | 3300013308 | Bacteria | 2865 |
| 438 | Ga0157375_10416814 | 3300013308 | Bacteria | 1509 |
| 439 | Ga0157375_10472117 | 3300013308 | Unclassified | 1420 |
| 440 | Ga0157375_10702129 | 3300013308 | Unclassified | 1165 |
| 441 | Ga0157375_12043383 | 3300013308 | Unclassified | 681 |
| 442 | Ga0163163_10167410 | 3300014325 | Bacteria | 2244 |
| 443 | Ga0163163_10242090 | 3300014325 | Bacteria | 1854 |
| 444 | Ga0163163_10272801 | 3300014325 | Bacteria | 1742 |
| 445 | Ga0163163_10336208 | 3300014325 | Bacteria | 1565 |
| 446 | Ga0163163_10486289 | 3300014325 | Bacteria | 1296 |
| 447 | Ga0163163_10609764 | 3300014325 | Unclassified | 1155 |
| 448 | Ga0163163_11389123 | 3300014325 | Unclassified | 764 |
| 449 | Ga0157380_10029906 | 3300014326 | Bacteria | 4167 |
| 450 | Ga0157380_10042173 | 3300014326 | Bacteria | 3565 |
| 451 | Ga0157380_10105103 | 3300014326 | Bacteria | 2360 |
| 452 | Ga0157380_10209134 | 3300014326 | Bacteria | 1737 |
| 453 | Ga0157380_11382979 | 3300014326 | Bacteria | 754 |
| 454 | Ga0157380_11874534 | 3300014326 | Bacteria | 660 |
| 455 | Ga0182008_10001466 | 3300014497 | Bacteria | 15780 |
| 456 | Ga0182008_10122262 | 3300014497 | Bacteria | 1294 |
| 457 | Ga0182008_10220222 | 3300014497 | Bacteria | 971 |
| 458 | Ga0157377_10002959 | 3300014745 | Bacteria | 7598 |
| 459 | Ga0157377_10022631 | 3300014745 | Bacteria | 3321 |
| 460 | Ga0157377_10028581 | 3300014745 | Bacteria | 3002 |
| 461 | Ga0157377_10185563 | 3300014745 | Bacteria | 1311 |
| 462 | Ga0157377_10239673 | 3300014745 | Unclassified | 1170 |
| 463 | Ga0157377_10268121 | 3300014745 | Bacteria | 1114 |
| 464 | Ga0157377_10795888 | 3300014745 | Bacteria | 696 |
| 465 | Ga0157377_10879466 | 3300014745 | Unclassified | 668 |
| 466 | Ga0157379_10074306 | 3300014968 | Bacteria | 3043 |
| 467 | Ga0157379_10102275 | 3300014968 | Bacteria | 2572 |
| 468 | Ga0157376_10082624 | 3300014969 | Bacteria | 2761 |
| 469 | Ga0157376_10112317 | 3300014969 | Bacteria | 2400 |
| 470 | Ga0157376_10135284 | 3300014969 | Bacteria | 2205 |
| 471 | Ga0157376_10521871 | 3300014969 | Unclassified | 1171 |
| 472 | Ga0157376_11400437 | 3300014969 | Bacteria | 731 |
| 473 | Ga0182007_10004451 | 3300015262 | Bacteria | 6349 |
| 474 | Ga0182005_1218142 | 3300015265 | Bacteria | 579 |
| 475 | Ga0163161_10072570 | 3300017792 | Bacteria | 2520 |
| 476 | Ga0163161_10595678 | 3300017792 | Bacteria | 911 |
| 477 | Ga0163161_11781222 | 3300017792 | Bacteria | 547 |
| 478 | Ga0163161_11808438 | 3300017792 | Unclassified | 543 |
| 479 | Ga0197907_11367132 | 3300020069 | Bacteria | 623 |
| 480 | Ga0206356_11323765 | 3300020070 | Bacteria | 817 |
| 481 | Ga0206356_11343203 | 3300020070 | Bacteria | 1406 |
| 482 | Ga0206354_11018335 | 3300020081 | Bacteria | 923 |
| 483 | Ga0206354_11270724 | 3300020081 | Bacteria | 1358 |
| 484 | Ga0206353_10552488 | 3300020082 | Bacteria | 6068 |
| 485 | Ga0206353_11117021 | 3300020082 | Bacteria | 1377 |
| 486 | Ga0206353_11424935 | 3300020082 | Bacteria | 909 |
| 487 | Ga0207656_10125709 | 3300025321 | Bacteria | 1198 |
| 488 | Ga0207656_10226675 | 3300025321 | Bacteria | 910 |
| 489 | Ga0207642_10425410 | 3300025899 | Unclassified | 800 |
| 490 | Ga0207642_10446671 | 3300025899 | Bacteria | 783 |
| 491 | Ga0207710_10082795 | 3300025900 | Bacteria | 1491 |
| 492 | Ga0207688_10000816 | 3300025901 | Bacteria | 15597 |
| 493 | Ga0207688_10009328 | 3300025901 | Bacteria | 5349 |
| 494 | Ga0207688_10264938 | 3300025901 | Bacteria | 1044 |
| 495 | Ga0207688_10322937 | 3300025901 | Bacteria | 947 |
| 496 | Ga0207688_10818561 | 3300025901 | Unclassified | 590 |
| 497 | Ga0207645_10033975 | 3300025907 | Bacteria | 3276 |
| 498 | Ga0207645_10076212 | 3300025907 | Bacteria | 2148 |
| 499 | Ga0207643_10002335 | 3300025908 | Bacteria | 10319 |
| 500 | Ga0207643_10004431 | 3300025908 | Bacteria | 7549 |
| 501 | Ga0207643_10039762 | 3300025908 | Bacteria | 2646 |
| 502 | Ga0207643_10047409 | 3300025908 | Bacteria | 2431 |
| 503 | Ga0207643_10104191 | 3300025908 | Bacteria | 1666 |
| 504 | Ga0207643_10149942 | 3300025908 | Bacteria | 1397 |
| 505 | Ga0207705_10934434 | 3300025909 | Bacteria | 671 |
| 506 | Ga0207684_10336736 | 3300025910 | Bacteria | 1299 |
| 507 | Ga0207654_10219739 | 3300025911 | Bacteria | 1260 |
| 508 | Ga0207654_11122068 | 3300025911 | Bacteria | 573 |
| 509 | Ga0207707_10061566 | 3300025912 | Bacteria | 3265 |
| 510 | Ga0207707_10075947 | 3300025912 | Bacteria | 2932 |
| 511 | Ga0207707_10088880 | 3300025912 | Bacteria | 2699 |
| 512 | Ga0207707_10167632 | 3300025912 | Bacteria | 1919 |
| 513 | Ga0207707_10518234 | 3300025912 | Unclassified | 1015 |
| 514 | Ga0207707_11475315 | 3300025912 | Archaea | 540 |
| 515 | Ga0207695_10709942 | 3300025913 | Bacteria | 886 |
| 516 | Ga0207695_10796479 | 3300025913 | Unclassified | 825 |
| 517 | Ga0207671_10373549 | 3300025914 | Bacteria | 1132 |
| 518 | Ga0207693_10003543 | 3300025915 | Bacteria | 13334 |
| 519 | Ga0207693_10128234 | 3300025915 | Bacteria | 1994 |
| 520 | Ga0207663_10735133 | 3300025916 | Unclassified | 783 |
| 521 | Ga0207660_10038385 | 3300025917 | Bacteria | 3343 |
| 522 | Ga0207660_10173306 | 3300025917 | Bacteria | 1671 |
| 523 | Ga0207660_10233050 | 3300025917 | Bacteria | 1448 |
| 524 | Ga0207660_10564082 | 3300025917 | Bacteria | 926 |
| 525 | Ga0207662_10021188 | 3300025918 | Bacteria | 3712 |
| 526 | Ga0207662_10047572 | 3300025918 | Bacteria | 2541 |
| 527 | Ga0207662_11261206 | 3300025918 | Bacteria | 525 |
| 528 | Ga0207657_10001687 | 3300025919 | Bacteria | 23810 |
| 529 | Ga0207657_10030201 | 3300025919 | Bacteria | 4922 |
| 530 | Ga0207657_10032572 | 3300025919 | Bacteria | 4707 |
| 531 | Ga0207657_10045985 | 3300025919 | Bacteria | 3826 |
| 532 | Ga0207649_10160018 | 3300025920 | Bacteria | 1559 |
| 533 | Ga0207652_10086827 | 3300025921 | Bacteria | 2743 |
| 534 | Ga0207652_10274328 | 3300025921 | Bacteria | 1521 |
| 535 | Ga0207652_10285055 | 3300025921 | Bacteria | 1490 |
| 536 | Ga0207652_10339736 | 3300025921 | Bacteria | 1355 |
| 537 | Ga0207652_10901234 | 3300025921 | Bacteria | 781 |
| 538 | Ga0207646_10116968 | 3300025922 | Bacteria | 2394 |
| 539 | Ga0207646_10300738 | 3300025922 | Bacteria | 1450 |
| 540 | Ga0207646_11172626 | 3300025922 | Bacteria | 674 |
| 541 | Ga0207681_10369374 | 3300025923 | Bacteria | 1152 |
| 542 | Ga0207681_10890528 | 3300025923 | Bacteria | 745 |
| 543 | Ga0207694_10426091 | 3300025924 | Bacteria | 1106 |
| 544 | Ga0207694_10609311 | 3300025924 | Bacteria | 918 |
| 545 | Ga0207694_10656596 | 3300025924 | Bacteria | 884 |
| 546 | Ga0207650_10014285 | 3300025925 | Bacteria | 5517 |
| 547 | Ga0207650_10038074 | 3300025925 | Bacteria | 3508 |
| 548 | Ga0207650_10053525 | 3300025925 | Bacteria | 2992 |
| 549 | Ga0207659_10026007 | 3300025926 | Bacteria | 3943 |
| 550 | Ga0207659_10115188 | 3300025926 | Bacteria | 2050 |
| 551 | Ga0207659_10467048 | 3300025926 | Bacteria | 1065 |
| 552 | Ga0207659_11183424 | 3300025926 | Bacteria | 657 |
| 553 | Ga0207659_11383087 | 3300025926 | Unclassified | 603 |
| 554 | Ga0207687_10015021 | 3300025927 | Bacteria | 5072 |
| 555 | Ga0207687_10040500 | 3300025927 | Bacteria | 3194 |
| 556 | Ga0207687_10292385 | 3300025927 | Bacteria | 1310 |
| 557 | Ga0207687_10348041 | 3300025927 | Bacteria | 1207 |
| 558 | Ga0207687_10603712 | 3300025927 | Bacteria | 925 |
| 559 | Ga0207687_10770019 | 3300025927 | Unclassified | 820 |
| 560 | Ga0207687_11068832 | 3300025927 | Bacteria | 693 |
| 561 | Ga0207664_10003682 | 3300025929 | Bacteria | 10275 |
| 562 | Ga0207664_10680284 | 3300025929 | Bacteria | 925 |
| 563 | Ga0207664_11390569 | 3300025929 | Unclassified | 622 |
| 564 | Ga0207664_11396284 | 3300025929 | Bacteria | 621 |
| 565 | Ga0207644_10086949 | 3300025931 | Bacteria | 2322 |
| 566 | Ga0207644_10285440 | 3300025931 | Bacteria | 1326 |
| 567 | Ga0207690_10066731 | 3300025932 | Bacteria | 2465 |
| 568 | Ga0207690_10068632 | 3300025932 | Bacteria | 2436 |
| 569 | Ga0207690_10198335 | 3300025932 | Bacteria | 1522 |
| 570 | Ga0207690_10968534 | 3300025932 | Bacteria | 707 |
| 571 | Ga0207706_10030464 | 3300025933 | Bacteria | 4812 |
| 572 | Ga0207706_10041080 | 3300025933 | Bacteria | 4100 |
| 573 | Ga0207706_10055817 | 3300025933 | Bacteria | 3482 |
| 574 | Ga0207706_11425456 | 3300025933 | Unclassified | 568 |
| 575 | Ga0207686_10046937 | 3300025934 | Bacteria | 2668 |
| 576 | Ga0207686_10056842 | 3300025934 | Bacteria | 2461 |
| 577 | Ga0207686_10102534 | 3300025934 | Bacteria | 1913 |
| 578 | Ga0207686_10178773 | 3300025934 | Unclassified | 1503 |
| 579 | Ga0207686_10530088 | 3300025934 | Bacteria | 918 |
| 580 | Ga0207686_10745421 | 3300025934 | Bacteria | 781 |
| 581 | Ga0207709_10013980 | 3300025935 | Bacteria | 4432 |
| 582 | Ga0207709_10037019 | 3300025935 | Bacteria | 2897 |
| 583 | Ga0207709_10199207 | 3300025935 | Bacteria | 1429 |
| 584 | Ga0207709_10303820 | 3300025935 | Unclassified | 1188 |
| 585 | Ga0207709_11314828 | 3300025935 | Unclassified | 598 |
| 586 | Ga0207670_10091776 | 3300025936 | Bacteria | 2148 |
| 587 | Ga0207670_10320098 | 3300025936 | Bacteria | 1220 |
| 588 | Ga0207670_10542229 | 3300025936 | Bacteria | 949 |
| 589 | Ga0207669_10007683 | 3300025937 | Bacteria | 5010 |
| 590 | Ga0207669_10012223 | 3300025937 | Bacteria | 4215 |
| 591 | Ga0207669_10107161 | 3300025937 | Bacteria | 1863 |
| 592 | Ga0207669_10131920 | 3300025937 | Bacteria | 1718 |
| 593 | Ga0207669_10283455 | 3300025937 | Bacteria | 1251 |
| 594 | Ga0207669_10392902 | 3300025937 | Bacteria | 1084 |
| 595 | Ga0207669_10485173 | 3300025937 | Bacteria | 986 |
| 596 | Ga0207669_10607861 | 3300025937 | Bacteria | 889 |
| 597 | Ga0207669_10705079 | 3300025937 | Bacteria | 830 |
| 598 | Ga0207669_10789229 | 3300025937 | Bacteria | 787 |
| 599 | Ga0207669_11770750 | 3300025937 | Unclassified | 528 |
| 600 | Ga0207704_10049937 | 3300025938 | Bacteria | 2521 |
| 601 | Ga0207704_10057714 | 3300025938 | Bacteria | 2386 |
| 602 | Ga0207704_10112644 | 3300025938 | Bacteria | 1843 |
| 603 | Ga0207704_10229714 | 3300025938 | Bacteria | 1379 |
| 604 | Ga0207704_10591565 | 3300025938 | Bacteria | 907 |
| 605 | Ga0207704_11369625 | 3300025938 | Unclassified | 606 |
| 606 | Ga0207691_10009024 | 3300025940 | Bacteria | 9562 |
| 607 | Ga0207691_10009851 | 3300025940 | Bacteria | 9170 |
| 608 | Ga0207691_10025077 | 3300025940 | Bacteria | 5601 |
| 609 | Ga0207691_10074503 | 3300025940 | Bacteria | 3062 |
| 610 | Ga0207711_10081924 | 3300025941 | Bacteria | 2820 |
| 611 | Ga0207711_10302897 | 3300025941 | Unclassified | 1474 |
| 612 | Ga0207711_10350367 | 3300025941 | Bacteria | 1367 |
| 613 | Ga0207711_10479490 | 3300025941 | Bacteria | 1159 |
| 614 | Ga0207711_10595505 | 3300025941 | Bacteria | 1031 |
| 615 | Ga0207689_10283512 | 3300025942 | Bacteria | 1372 |
| 616 | Ga0207689_10601803 | 3300025942 | Bacteria | 925 |
| 617 | Ga0207689_11237435 | 3300025942 | Unclassified | 628 |
| 618 | Ga0207689_11473129 | 3300025942 | Unclassified | 569 |
| 619 | Ga0207661_10064817 | 3300025944 | Bacteria | 2963 |
| 620 | Ga0207661_10147292 | 3300025944 | Bacteria | 2032 |
| 621 | Ga0207661_10153385 | 3300025944 | Bacteria | 1993 |
| 622 | Ga0207661_10202435 | 3300025944 | Bacteria | 1746 |
| 623 | Ga0207661_10458639 | 3300025944 | Bacteria | 1161 |
| 624 | Ga0207679_10013388 | 3300025945 | Bacteria | 5376 |
| 625 | Ga0207679_10181741 | 3300025945 | Bacteria | 1740 |
| 626 | Ga0207679_10195758 | 3300025945 | Bacteria | 1684 |
| 627 | Ga0207679_10376326 | 3300025945 | Bacteria | 1244 |
| 628 | Ga0207679_10452887 | 3300025945 | Bacteria | 1138 |
| 629 | Ga0207679_10869514 | 3300025945 | Bacteria | 824 |
| 630 | Ga0207667_10030665 | 3300025949 | Bacteria | 5812 |
| 631 | Ga0207667_10814154 | 3300025949 | Bacteria | 930 |
| 632 | Ga0207651_10055080 | 3300025960 | Bacteria | 2729 |
| 633 | Ga0207651_10207305 | 3300025960 | Bacteria | 1575 |
| 634 | Ga0207651_10370720 | 3300025960 | Bacteria | 1211 |
| 635 | Ga0207651_10799863 | 3300025960 | Bacteria | 836 |
| 636 | Ga0207712_10646451 | 3300025961 | Bacteria | 919 |
| 637 | Ga0207668_10082390 | 3300025972 | Bacteria | 2337 |
| 638 | Ga0207668_10106093 | 3300025972 | Bacteria | 2098 |
| 639 | Ga0207668_10112312 | 3300025972 | Bacteria | 2047 |
| 640 | Ga0207668_11913950 | 3300025972 | Bacteria | 535 |
| 641 | Ga0207640_10041421 | 3300025981 | Bacteria | 2929 |
| 642 | Ga0207640_10260423 | 3300025981 | Bacteria | 1351 |
| 643 | Ga0207658_10054357 | 3300025986 | Bacteria | 2963 |
| 644 | Ga0207658_11380129 | 3300025986 | Bacteria | 645 |
| 645 | Ga0207677_10020382 | 3300026023 | Bacteria | 4025 |
| 646 | Ga0207677_10375507 | 3300026023 | Bacteria | 1198 |
| 647 | Ga0207677_10858426 | 3300026023 | Bacteria | 816 |
| 648 | Ga0207677_10867028 | 3300026023 | Bacteria | 812 |
| 649 | Ga0207703_10124591 | 3300026035 | Bacteria | 2216 |
| 650 | Ga0207639_10240992 | 3300026041 | Bacteria | 1572 |
| 651 | Ga0207639_10254909 | 3300026041 | Bacteria | 1532 |
| 652 | Ga0207639_10333113 | 3300026041 | Bacteria | 1351 |
| 653 | Ga0207639_10473212 | 3300026041 | Unclassified | 1141 |
| 654 | Ga0207639_12015725 | 3300026041 | Unclassified | 538 |
| 655 | Ga0207678_10138725 | 3300026067 | Bacteria | 2075 |
| 656 | Ga0207678_10241341 | 3300026067 | Bacteria | 1547 |
| 657 | Ga0207678_10504675 | 3300026067 | Bacteria | 1055 |
| 658 | Ga0207678_10601471 | 3300026067 | Bacteria | 964 |
| 659 | Ga0207678_11329534 | 3300026067 | Unclassified | 636 |
| 660 | Ga0207708_10003549 | 3300026075 | Bacteria | 11492 |
| 661 | Ga0207708_10009415 | 3300026075 | Bacteria | 7233 |
| 662 | Ga0207708_10148934 | 3300026075 | Bacteria | 1841 |
| 663 | Ga0207708_10246883 | 3300026075 | Bacteria | 1437 |
| 664 | Ga0207708_10793359 | 3300026075 | Unclassified | 815 |
| 665 | Ga0207708_10830899 | 3300026075 | Bacteria | 797 |
| 666 | Ga0207708_11768314 | 3300026075 | Bacteria | 542 |
| 667 | Ga0207702_10036281 | 3300026078 | Bacteria | 4123 |
| 668 | Ga0207702_10120898 | 3300026078 | Bacteria | 2344 |
| 669 | Ga0207641_10093901 | 3300026088 | Bacteria | 2630 |
| 670 | Ga0207641_10325861 | 3300026088 | Bacteria | 1458 |
| 671 | Ga0207641_10687679 | 3300026088 | Bacteria | 1007 |
| 672 | Ga0207648_10021040 | 3300026089 | Bacteria | 5870 |
| 673 | Ga0207648_10080374 | 3300026089 | Bacteria | 2844 |
| 674 | Ga0207648_10227688 | 3300026089 | Bacteria | 1658 |
| 675 | Ga0207648_10295689 | 3300026089 | Bacteria | 1451 |
| 676 | Ga0207648_10334740 | 3300026089 | Bacteria | 1362 |
| 677 | Ga0207676_10028753 | 3300026095 | Bacteria | 4156 |
| 678 | Ga0207676_10505943 | 3300026095 | Bacteria | 1148 |
| 679 | Ga0207674_10074954 | 3300026116 | Bacteria | 3394 |
| 680 | Ga0207674_10492048 | 3300026116 | Bacteria | 1185 |
| 681 | Ga0207674_10543606 | 3300026116 | Bacteria | 1122 |
| 682 | Ga0207674_10707244 | 3300026116 | Bacteria | 973 |
| 683 | Ga0207674_10737592 | 3300026116 | Bacteria | 951 |
| 684 | Ga0207674_11844099 | 3300026116 | Bacteria | 571 |
| 685 | Ga0207675_100082828 | 3300026118 | Bacteria | 3009 |
| 686 | Ga0207675_100140533 | 3300026118 | Bacteria | 2294 |
| 687 | Ga0207675_100265643 | 3300026118 | Unclassified | 1664 |
| 688 | Ga0207675_101140419 | 3300026118 | Bacteria | 800 |
| 689 | Ga0207683_10008257 | 3300026121 | Bacteria | 8905 |
| 690 | Ga0207683_10037163 | 3300026121 | Bacteria | 4241 |
| 691 | Ga0207683_10039656 | 3300026121 | Bacteria | 4109 |
| 692 | Ga0207683_10158422 | 3300026121 | Bacteria | 2045 |
| 693 | Ga0207683_10164461 | 3300026121 | Bacteria | 2007 |
| 694 | Ga0207683_10375927 | 3300026121 | Bacteria | 1306 |
| 695 | Ga0207683_10417505 | 3300026121 | Bacteria | 1235 |
| 696 | Ga0207683_11603830 | 3300026121 | Unclassified | 600 |
| 697 | Ga0207698_10025840 | 3300026142 | Bacteria | 4144 |
| 698 | Ga0207698_10066186 | 3300026142 | Bacteria | 2843 |
| 699 | Ga0207698_10538372 | 3300026142 | Bacteria | 1142 |
| 700 | Ga0207698_10643691 | 3300026142 | Bacteria | 1049 |
| 701 | Ga0209998_10034288 | 3300027717 | Bacteria | 1134 |
| 702 | Ga0209998_10075560 | 3300027717 | Bacteria | 810 |
| 703 | Ga0207428_10001196 | 3300027907 | Bacteria | 27877 |
| 704 | Ga0207428_10002858 | 3300027907 | Bacteria | 17124 |
| 705 | Ga0207428_10003094 | 3300027907 | Bacteria | 16362 |
| 706 | Ga0207428_10010613 | 3300027907 | Bacteria | 8219 |
| 707 | Ga0207428_10022792 | 3300027907 | Bacteria | 5277 |
| 708 | Ga0207428_10143221 | 3300027907 | Bacteria | 1823 |
| 709 | Ga0207428_10547134 | 3300027907 | Bacteria | 837 |
| 710 | Ga0268266_10079681 | 3300028379 | Bacteria | 2852 |
| 711 | Ga0268266_10123673 | 3300028379 | Bacteria | 2305 |
| 712 | Ga0268265_10019384 | 3300028380 | Bacteria | 4728 |
| 713 | Ga0268265_10977271 | 3300028380 | Bacteria | 835 |
| 714 | Ga0268264_10096769 | 3300028381 | Bacteria | 2557 |
| 715 | Ga0268264_10186364 | 3300028381 | Bacteria | 1888 |
| 716 | Ga0265337_1074129 | 3300028556 | Bacteria | 933 |
| 717 | Ga0265337_1134499 | 3300028556 | Bacteria | 670 |
| 718 | Ga0265319_1018074 | 3300028563 | Bacteria | 2667 |
| 719 | Ga0265319_1023935 | 3300028563 | Bacteria | 2206 |
| 720 | Ga0265334_10013253 | 3300028573 | Bacteria | 3453 |
| 721 | Ga0265318_10010982 | 3300028577 | Bacteria | 3920 |
| 722 | Ga0265318_10059198 | 3300028577 | Bacteria | 1429 |
| 723 | Ga0265318_10267775 | 3300028577 | Unclassified | 623 |
| 724 | Ga0265323_10027737 | 3300028653 | Bacteria | 2126 |
| 725 | Ga0265322_10061912 | 3300028654 | Bacteria | 1061 |
| 726 | Ga0265336_10094075 | 3300028666 | Bacteria | 893 |
| 727 | Ga0265338_10002825 | 3300028800 | Bacteria | 25357 |
| 728 | Ga0265338_10040946 | 3300028800 | Bacteria | 4341 |
| 729 | Ga0265338_10056999 | 3300028800 | Bacteria | 3459 |
| 730 | Ga0265338_10075267 | 3300028800 | Bacteria | 2866 |
| 731 | Ga0265332_10010966 | 3300031238 | Bacteria | 4025 |
| 732 | Ga0265320_10025656 | 3300031240 | Bacteria | 3095 |
| 733 | Ga0265325_10017313 | 3300031241 | Bacteria | 4007 |
| 734 | Ga0265325_10039449 | 3300031241 | Bacteria | 2487 |
| 735 | Ga0265329_10014417 | 3300031242 | Bacteria | 2790 |
| 736 | Ga0265329_10141505 | 3300031242 | Bacteria | 777 |
| 737 | Ga0265340_10008842 | 3300031247 | Bacteria | 5425 |
| 738 | Ga0265339_10108848 | 3300031249 | Bacteria | 1435 |
| 739 | Ga0265331_10013454 | 3300031250 | Bacteria | 4398 |
| 740 | Ga0265327_10015984 | 3300031251 | Bacteria | 4802 |
| 741 | Ga0265327_10029446 | 3300031251 | Bacteria | 3123 |
| 742 | Ga0265316_10032193 | 3300031344 | Bacteria | 4280 |
| 743 | Ga0265316_10980405 | 3300031344 | Archaea | 588 |
| 744 | Ga0265313_10019317 | 3300031595 | Bacteria | 3796 |
| 745 | Ga0265313_10042770 | 3300031595 | Bacteria | 2222 |
| 746 | Ga0265314_10026163 | 3300031711 | Bacteria | 4388 |
| 747 | Ga0265314_10057812 | 3300031711 | Bacteria | 2660 |
| 748 | Ga0265342_10144772 | 3300031712 | Bacteria | 1324 |
| 749 | Ga0373930_0012507 | 3300034816 | Bacteria | 1550 |
| 750 | Ga0373948_0014747 | 3300034817 | Unclassified | 1428 |
| 751 | Ga0373958_0135882 | 3300034819 | Bacteria | 605 |
| 752 | Ga0373959_0018800 | 3300034820 | Bacteria | 1303 |
| 753 | Ga0373934_0007365 | 3300035086 | Bacteria | 4084 |
| 754 | Ga0373949_0011197 | 3300035090 | Bacteria | 1973 |
| 755 | Ga0373951_0106474 | 3300035091 | Bacteria | 750 |
| 756 | Ga0373952_0210375 | 3300035092 | Bacteria | 573 |
| 757 | Ga0373932_0125041 | 3300035112 | Bacteria | 861 |
| 758 | Ga0373941_0005509 | 3300035115 | Bacteria | 2984 |
| 759 | Ga0373953_0476330 | 3300035117 | Unclassified | 553 |
| 760 | Ga0373954_0186210 | 3300035118 | Bacteria | 1019 |
| 761 | Ga0373960_0046379 | 3300035121 | Bacteria | 1275 |
| 762 | Ga0373943_0028124 | 3300035170 | Bacteria | 2648 |
| 763 | Ga0373955_0054516 | 3300035172 | Bacteria | 2187 |
| 764 | Ga0373942_0032748 | 3300035207 | Bacteria | 1382 |
| 765 | Ga0373942_0054887 | 3300035207 | Bacteria | 1127 |
| 766 | Ga0373961_0025852 | 3300035241 | Bacteria | 1600 |
| 767 | Ga0373961_0157372 | 3300035241 | Bacteria | 778 |
| 768 | Ga0373962_0017357 | 3300035242 | Bacteria | 1865 |
| 769 | Ga0373924_0052199 | 3300035410 | Bacteria | 1697 |
| 770 | Ga0373931_0066731 | 3300035691 | Bacteria | 1953 |
| 771 | Ga0373931_0301673 | 3300035691 | Bacteria | 989 |
| 772 | Ga0373931_0321633 | 3300035691 | Bacteria | 961 |
| 773 | Ga0373933_0132028 | 3300035724 | Bacteria | 1571 |
| 774 | Ga0373937_1173568 | 3300036401 | Bacteria | 716 |
| 775 | Ga0395899_0119377 | 3300037312 | Bacteria | 1890 |
| 776 | Ga0395899_0217119 | 3300037312 | Bacteria | 1326 |
| 777 | Ga0395899_0314505 | 3300037312 | Unclassified | 1056 |
| 778 | Ga0395899_0530947 | 3300037312 | Bacteria | 759 |
| 779 | Ga0395900_0052851 | 3300037418 | Bacteria | 4182 |
| 780 | Ga0395900_0244599 | 3300037418 | Bacteria | 1798 |
| 781 | Ga0395900_0375606 | 3300037418 | Unclassified | 1390 |
| 782 | Ga0395900_0525960 | 3300037418 | Bacteria | 1130 |
| 783 | Ga0395900_0602637 | 3300037418 | Bacteria | 1039 |
| 784 | Ga0395900_1051256 | 3300037418 | Bacteria | 733 |
| 785 | Ga0395900_1191339 | 3300037418 | Bacteria | 677 |
| 786 | Ga0395900_1224734 | 3300037418 | Bacteria | 666 |
| 787 | Ga0395900_1631245 | 3300037418 | Unclassified | 556 |
| 788 | Ga0395898_0004143 | 3300037466 | Bacteria | 15899 |
| 789 | Ga0395898_0057869 | 3300037466 | Bacteria | 3775 |
| 790 | Ga0395898_0116582 | 3300037466 | Bacteria | 2559 |
| 791 | Ga0395898_0473016 | 3300037466 | Bacteria | 1192 |
| 792 | Ga0395898_0594721 | 3300037466 | Bacteria | 1049 |
| 793 | Ga0395898_1060610 | 3300037466 | Bacteria | 745 |
| 794 | Ga0395898_1749150 | 3300037466 | Unclassified | 544 |
| 795 | Ga0395898_1772148 | 3300037466 | Unclassified | 539 |
| 796 | Ga0395905_0003900 | 3300037471 | Bacteria | 15734 |
| 797 | Ga0395905_0032900 | 3300037471 | Bacteria | 4875 |
| 798 | Ga0395905_0167044 | 3300037471 | Bacteria | 2068 |
| 799 | Ga0395905_1327733 | 3300037471 | Unclassified | 623 |
| 800 | Ga0395905_1467979 | 3300037471 | Bacteria | 586 |
| 801 | Ga0395901_0001175 | 3300038443 | Bacteria | 27810 |
| 802 | Ga0395901_0001894 | 3300038443 | Bacteria | 21606 |
| 803 | Ga0395901_0099969 | 3300038443 | Bacteria | 3042 |
| 804 | Ga0395901_0114319 | 3300038443 | Bacteria | 2835 |
| 805 | Ga0395901_0487897 | 3300038443 | Bacteria | 1256 |
| 806 | Ga0395901_0615013 | 3300038443 | Bacteria | 1094 |
| 807 | Ga0395901_0990451 | 3300038443 | Bacteria | 817 |
| 808 | Ga0395901_1978857 | 3300038443 | Unclassified | 529 |
| 809 | Ga0439453_0065349 | 3300041408 | Unclassified | 761 |
| 810 | Ga0451793_0140964 | 3300041452 | Bacteria | 904 |
| 811 | Ga0451793_1117621 | 3300041452 | Unclassified | 809 |
| 812 | Ga0451795_0186197 | 3300041456 | Unclassified | 840 |
| 813 | Ga0451798_0170046 | 3300041458 | Bacteria | 754 |
| 814 | Ga0451802_2063843 | 3300041460 | Unclassified | 588 |
| 815 | Ga0451807_0366467 | 3300041486 | Bacteria | 1246 |
| 816 | Ga0451835_1071592 | 3300041492 | Bacteria | 1630 |
| 817 | Ga0451837_1771718 | 3300041494 | Unclassified | 550 |
| 818 | Ga0451845_0377167 | 3300041501 | Bacteria | 612 |
| 819 | Ga0451847_0626268 | 3300041503 | Bacteria | 579 |
| 820 | Ga0451853_0503966 | 3300041512 | Unclassified | 661 |
| 821 | Ga0451853_1439937 | 3300041512 | Bacteria | 915 |
| 822 | Ga0439448_0063343 | 3300042005 | Bacteria | 1224 |
| 823 | Ga0450920_111143 | 3300042122 | Unclassified | 572 |
| 824 | Ga0450923_194098 | 3300042125 | Unclassified | 503 |
| 825 | Ga0450902_065821 | 3300042137 | Unclassified | 629 |
| 826 | Ga0450906_002797 | 3300042145 | Bacteria | 3804 |
| 827 | Ga0450907_002290 | 3300042146 | Bacteria | 3708 |
| 828 | Ga0439458_0110535 | 3300042157 | Bacteria | 718 |
| 829 | Ga0439435_0142734 | 3300042436 | Bacteria | 764 |
| 830 | Ga0439435_0223276 | 3300042436 | Bacteria | 627 |
| 831 | Ga0439435_0293667 | 3300042436 | Bacteria | 555 |
| 832 | Ga0439464_0065129 | 3300042439 | Bacteria | 1072 |
| 833 | Ga0439464_0177517 | 3300042439 | Bacteria | 673 |
| 834 | Ga0439440_0224842 | 3300042993 | Bacteria | 564 |
| 835 | Ga0453683_1040393 | 3300044673 | Unclassified | 544 |
| 836 | Ga0466966_0207824 | 3300044684 | Bacteria | 1184 |
| 837 | Ga0466961_0666967 | 3300044693 | Bacteria | 624 |
| 838 | Ga0466963_0245251 | 3300044694 | Bacteria | 1257 |
| 839 | Ga0466963_0287439 | 3300044694 | Bacteria | 1156 |
| 840 | Ga0466963_0321310 | 3300044694 | Bacteria | 1089 |
| 841 | Ga0466963_0652258 | 3300044694 | Unclassified | 743 |
| 842 | Ga0466964_0034636 | 3300044706 | Bacteria | 2015 |
| 843 | Ga0466964_0518221 | 3300044706 | Bacteria | 643 |
| 844 | Ga0466971_0095768 | 3300044719 | Bacteria | 1361 |
| 845 | Ga0466971_0304871 | 3300044719 | Bacteria | 765 |
| 846 | Ga0466968_0101672 | 3300044735 | Bacteria | 1284 |
| 847 | Ga0466968_0149931 | 3300044735 | Bacteria | 1071 |
| 848 | Ga0466970_0560701 | 3300044765 | Bacteria | 661 |
| 849 | Ga0466957_0417883 | 3300044842 | Bacteria | 919 |
| 850 | Ga0466957_0712018 | 3300044842 | Bacteria | 709 |
| 851 | Ga0466959_0289215 | 3300045049 | Bacteria | 1124 |
| 852 | Ga0451576_1016160 | 3300045051 | Bacteria | 869 |
| 853 | Ga0466958_0170690 | 3300045836 | Bacteria | 1377 |
| 854 | Ga0466958_0185582 | 3300045836 | Bacteria | 1321 |
| 855 | Ga0466958_0598288 | 3300045836 | Unclassified | 717 |
| 856 | Ga0466967_0000047 | 3300045976 | Bacteria | 43648 |
| 857 | Ga0466967_0083772 | 3300045976 | Bacteria | 2884 |
| 858 | Ga0466967_0161369 | 3300045976 | Bacteria | 2104 |
| 859 | Ga0466967_0215087 | 3300045976 | Bacteria | 1824 |
| 860 | Ga0466967_0272680 | 3300045976 | Unclassified | 1621 |
| 861 | Ga0466967_0405542 | 3300045976 | Bacteria | 1327 |
| 862 | Ga0466967_0489428 | 3300045976 | Bacteria | 1206 |
| 863 | Ga0466967_0535907 | 3300045976 | Bacteria | 1151 |
| 864 | Ga0466967_0582082 | 3300045976 | Bacteria | 1103 |
| 865 | Ga0495592_0553975 | 3300046454 | Bacteria | 707 |
| 866 | Ga0495603_0035829 | 3300046455 | Bacteria | 2980 |
| 867 | Ga0495603_0073846 | 3300046455 | Bacteria | 2003 |
| 868 | Ga0495603_0279380 | 3300046455 | Bacteria | 960 |
| 869 | Ga0495603_0475192 | 3300046455 | Unclassified | 716 |
| 870 | Ga0495603_0614567 | 3300046455 | Unclassified | 622 |
| 871 | Ga0495603_0808555 | 3300046455 | Unclassified | 534 |
| 872 | Ga0495641_0188497 | 3300046461 | Bacteria | 924 |
| 873 | Ga0495641_0288069 | 3300046461 | Bacteria | 740 |
| 874 | Ga0495651_0028264 | 3300046462 | Bacteria | 4371 |
| 875 | Ga0495653_0029348 | 3300046463 | Bacteria | 4392 |
| 876 | Ga0495582_0781134 | 3300046473 | Unclassified | 553 |
| 877 | Ga0495584_0158577 | 3300046491 | Bacteria | 1150 |
| 878 | Ga0495596_0270604 | 3300046500 | Unclassified | 660 |
| 879 | Ga0495608_0003415 | 3300046511 | Bacteria | 11374 |
| 880 | Ga0495628_0430286 | 3300046516 | Bacteria | 961 |
| 881 | Ga0495630_0372191 | 3300046517 | Bacteria | 1094 |
| 882 | Ga0495630_0412315 | 3300046517 | Bacteria | 1035 |
| 883 | Ga0495637_0217763 | 3300046520 | Bacteria | 696 |
| 884 | Ga0495643_0515435 | 3300046522 | Unclassified | 513 |
| 885 | Ga0495644_0150018 | 3300046523 | Bacteria | 892 |
| 886 | Ga0495640_0096177 | 3300046533 | Bacteria | 1949 |
| 887 | Ga0495640_0257189 | 3300046533 | Bacteria | 1092 |
| 888 | Ga0495587_0245230 | 3300046536 | Bacteria | 1008 |
| 889 | Ga0495622_0257262 | 3300046557 | Bacteria | 767 |
| 890 | Ga0495633_0447927 | 3300046558 | Bacteria | 583 |
| 891 | Ga0495633_0498449 | 3300046558 | Bacteria | 549 |
| 892 | Ga0495667_0099258 | 3300046559 | Unclassified | 1885 |
| 893 | Ga0495667_0186580 | 3300046559 | Bacteria | 1330 |
| 894 | Ga0495656_0825891 | 3300046615 | Bacteria | 501 |
| 895 | Ga0495634_0202108 | 3300046642 | Bacteria | 1234 |
| 896 | Ga0495634_0387686 | 3300046642 | Bacteria | 832 |
| 897 | Ga0495635_0284772 | 3300046663 | Bacteria | 1110 |
| 898 | Ga0495659_0429567 | 3300046664 | Bacteria | 573 |
| 899 | Ga0495588_0305543 | 3300046674 | Bacteria | 837 |
| 900 | Ga0495657_0175976 | 3300046675 | Bacteria | 1315 |
| 901 | Ga0495646_0595845 | 3300046680 | Bacteria | 562 |
| 902 | Ga0495658_0084809 | 3300046683 | Bacteria | 1866 |
| 903 | Ga0495669_0155967 | 3300046684 | Bacteria | 1082 |
| 904 | Ga0495669_0468321 | 3300046684 | Unclassified | 612 |
| 905 | Ga0495613_0345113 | 3300046689 | Bacteria | 1023 |
| 906 | Ga0495613_0751315 | 3300046689 | Bacteria | 639 |
| 907 | Ga0495670_0205910 | 3300046691 | Unclassified | 1043 |
| 908 | Ga0495671_0389084 | 3300046692 | Bacteria | 668 |
| 909 | Ga0495589_0133893 | 3300046794 | Bacteria | 1189 |
| 910 | Ga0495660_0372994 | 3300046810 | Bacteria | 630 |
| 911 | Ga0495581_0327730 | 3300047315 | Bacteria | 894 |
| 912 | Ga0495674_0034616 | 3300047319 | Bacteria | 4566 |
| 913 | Ga0495674_0587126 | 3300047319 | Bacteria | 884 |
| 914 | Ga0495676_0128272 | 3300047321 | Bacteria | 1835 |
| 915 | Ga0495676_0410071 | 3300047321 | Bacteria | 898 |
| 916 | Ga0495680_0030143 | 3300047322 | Bacteria | 4433 |
| 917 | Ga0495680_0447692 | 3300047322 | Bacteria | 884 |
| 918 | Ga0495675_0519850 | 3300047444 | Bacteria | 682 |
| 919 | Ga0495677_0024931 | 3300047445 | Bacteria | 2170 |
| 920 | Ga0495677_0410004 | 3300047445 | Bacteria | 536 |
| 921 | Ga0495684_0829812 | 3300047471 | Unclassified | 601 |
| 922 | Ga0495602_0255950 | 3300048088 | Bacteria | 1302 |
| 923 | Ga0495602_1150795 | 3300048088 | Unclassified | 507 |
| 924 | Ga0495626_0221376 | 3300048091 | Unclassified | 769 |
| 925 | Ga0496100_0016868 | 3300048903 | Bacteria | 4297 |
| 926 | Ga0496100_0076658 | 3300048903 | Bacteria | 2245 |
| 927 | Ga0496100_0393818 | 3300048903 | Unclassified | 1054 |
| 928 | Ga0496100_0452147 | 3300048903 | Bacteria | 985 |
| 929 | Ga0496100_1139677 | 3300048903 | Bacteria | 615 |
| 930 | Ga0496101_0040100 | 3300048904 | Bacteria | 3335 |
| 931 | Ga0496101_0069709 | 3300048904 | Bacteria | 2573 |
| 932 | Ga0496101_0221245 | 3300048904 | Unclassified | 1469 |
| 933 | Ga0496101_0267798 | 3300048904 | Bacteria | 1333 |
| 934 | Ga0496101_0377968 | 3300048904 | Unclassified | 1114 |
| 935 | Ga0496101_0524279 | 3300048904 | Bacteria | 936 |
| 936 | Ga0496101_1166398 | 3300048904 | Bacteria | 604 |
| 937 | Ga0496102_0094521 | 3300048905 | Bacteria | 2770 |
| 938 | Ga0496102_0162475 | 3300048905 | Bacteria | 2101 |
| 939 | Ga0496102_0504034 | 3300048905 | Unclassified | 1133 |
| 940 | Ga0496102_1373151 | 3300048905 | Bacteria | 626 |
| 941 | Ga0496102_1668037 | 3300048905 | Unclassified | 555 |
| 942 | Ga0496103_0041231 | 3300048906 | Bacteria | 2838 |
| 943 | Ga0496103_0410328 | 3300048906 | Bacteria | 870 |
| 944 | Ga0496104_0043681 | 3300048907 | Bacteria | 4209 |
| 945 | Ga0496104_0069316 | 3300048907 | Bacteria | 3352 |
| 946 | Ga0496104_0813958 | 3300048907 | Bacteria | 840 |
| 947 | Ga0496104_1799970 | 3300048907 | Unclassified | 515 |
| 948 | Ga0496105_0057142 | 3300048908 | Bacteria | 3222 |
| 949 | Ga0496105_0281869 | 3300048908 | Bacteria | 1340 |
| 950 | Ga0496105_0695404 | 3300048908 | Unclassified | 781 |
| 951 | Ga0496105_0878244 | 3300048908 | Unclassified | 677 |
| 952 | Ga0496105_1039787 | 3300048908 | Viruses | 611 |
| 953 | Ga0496106_0050988 | 3300048909 | Bacteria | 3120 |
| 954 | Ga0496106_0061387 | 3300048909 | Bacteria | 2851 |
| 955 | Ga0496106_0527575 | 3300048909 | Bacteria | 948 |
| 956 | Ga0496106_0674510 | 3300048909 | Bacteria | 825 |
| 957 | Ga0496106_0703878 | 3300048909 | Bacteria | 805 |
| 958 | Ga0496106_1153680 | 3300048909 | Bacteria | 606 |
| 959 | Ga0496106_1176749 | 3300048909 | Bacteria | 599 |
| 960 | Ga0496107_0020386 | 3300048910 | Bacteria | 4682 |
| 961 | Ga0496107_0286648 | 3300048910 | Unclassified | 1226 |
| 962 | Ga0496107_0675976 | 3300048910 | Bacteria | 760 |
| 963 | Ga0496107_0928531 | 3300048910 | Bacteria | 634 |
| 964 | Ga0496108_0008153 | 3300048911 | Bacteria | 8496 |
| 965 | Ga0496108_0059292 | 3300048911 | Bacteria | 3218 |
| 966 | Ga0496108_0123995 | 3300048911 | Bacteria | 2217 |
| 967 | Ga0496108_0574805 | 3300048911 | Bacteria | 982 |
| 968 | Ga0496108_0678092 | 3300048911 | Bacteria | 895 |
| 969 | Ga0496109_0026615 | 3300048912 | Bacteria | 5159 |
| 970 | Ga0496109_0072401 | 3300048912 | Bacteria | 3166 |
| 971 | Ga0496109_0084777 | 3300048912 | Bacteria | 2924 |
| 972 | Ga0496109_0112802 | 3300048912 | Bacteria | 2528 |
| 973 | Ga0496109_0404795 | 3300048912 | Bacteria | 1289 |
| 974 | Ga0496109_0431052 | 3300048912 | Bacteria | 1245 |
| 975 | Ga0496109_0477626 | 3300048912 | Bacteria | 1177 |
| 976 | Ga0496110_0024462 | 3300048913 | Bacteria | 5146 |
| 977 | Ga0496110_0034274 | 3300048913 | Bacteria | 4397 |
| 978 | Ga0496110_0038123 | 3300048913 | Bacteria | 4180 |
| 979 | Ga0496110_0064213 | 3300048913 | Bacteria | 3244 |
| 980 | Ga0496110_0521186 | 3300048913 | Bacteria | 1081 |
| 981 | Ga0496110_0577812 | 3300048913 | Bacteria | 1020 |
| 982 | Ga0496110_0639966 | 3300048913 | Unclassified | 963 |
| 983 | Ga0496110_1048870 | 3300048913 | Bacteria | 723 |
| 984 | Ga0496111_0008218 | 3300048914 | Bacteria | 6898 |
| 985 | Ga0496111_0016469 | 3300048914 | Bacteria | 5093 |
| 986 | Ga0496111_0055552 | 3300048914 | Bacteria | 2864 |
| 987 | Ga0496111_0142828 | 3300048914 | Bacteria | 1774 |
| 988 | Ga0496111_0658641 | 3300048914 | Bacteria | 764 |
| 989 | Ga0496111_1040429 | 3300048914 | Bacteria | 585 |
| 990 | Ga0496112_0083822 | 3300048915 | Bacteria | 3153 |
| 991 | Ga0496112_0284341 | 3300048915 | Bacteria | 1600 |
| 992 | Ga0496112_0336448 | 3300048915 | Bacteria | 1453 |
| 993 | Ga0496112_0692825 | 3300048915 | Bacteria | 947 |
| 994 | Ga0496113_0088351 | 3300048916 | Bacteria | 2384 |
| 995 | Ga0496113_0357962 | 3300048916 | Bacteria | 1171 |
| 996 | Ga0496113_1422783 | 3300048916 | Bacteria | 537 |
| 997 | Ga0496114_0004408 | 3300048917 | Bacteria | 10918 |
| 998 | Ga0496114_0061930 | 3300048917 | Bacteria | 3131 |
| 999 | Ga0496114_0411326 | 3300048917 | Bacteria | 1198 |
| 1000 | Ga0496114_0427260 | 3300048917 | Bacteria | 1174 |
| 1001 | Ga0496115_0135596 | 3300048918 | Bacteria | 2030 |
| 1002 | Ga0501031_0012038 | 3300049568 | Bacteria | 5641 |
| 1003 | Ga0501031_0046419 | 3300049568 | Bacteria | 2832 |
| 1004 | Ga0501031_0102930 | 3300049568 | Bacteria | 1863 |
| 1005 | Ga0501031_0133062 | 3300049568 | Bacteria | 1625 |
| 1006 | Ga0501031_0268790 | 3300049568 | Bacteria | 1107 |
| 1007 | Ga0501031_0618238 | 3300049568 | Bacteria | 697 |
| 1008 | Ga0501031_0772134 | 3300049568 | Bacteria | 616 |
| 1009 | Ga0501032_0009312 | 3300049569 | Bacteria | 7112 |
| 1010 | Ga0501032_0040718 | 3300049569 | Bacteria | 3157 |
| 1011 | Ga0501032_0258716 | 3300049569 | Archaea | 1129 |
| 1012 | Ga0501033_0021846 | 3300049570 | Bacteria | 4829 |
| 1013 | Ga0501033_0036869 | 3300049570 | Bacteria | 3662 |
| 1014 | Ga0501033_0325338 | 3300049570 | Bacteria | 1080 |
| 1015 | Ga0501033_0738189 | 3300049570 | Bacteria | 668 |
| 1016 | Ga0501034_0006648 | 3300049571 | Bacteria | 12406 |
| 1017 | Ga0501034_0241853 | 3300049571 | Bacteria | 1751 |
| 1018 | Ga0501036_0028893 | 3300049572 | Bacteria | 4686 |
| 1019 | Ga0501036_0067807 | 3300049572 | Bacteria | 3019 |
| 1020 | Ga0501036_0950110 | 3300049572 | Bacteria | 704 |
| 1021 | Ga0501036_1054021 | 3300049572 | Bacteria | 665 |
| 1022 | Ga0501036_1255580 | 3300049572 | Bacteria | 603 |
| 1023 | Ga0501036_1264560 | 3300049572 | Bacteria | 600 |
| 1024 | Ga0501036_1572774 | 3300049572 | Bacteria | 531 |
| 1025 | Ga0501037_0025445 | 3300049573 | Bacteria | 4373 |
| 1026 | Ga0501037_0093995 | 3300049573 | Bacteria | 2168 |
| 1027 | Ga0501037_0336475 | 3300049573 | Unclassified | 1043 |
| 1028 | Ga0501037_0642386 | 3300049573 | Bacteria | 710 |
| 1029 | Ga0501037_0877976 | 3300049573 | Bacteria | 589 |
| 1030 | Ga0501038_0014026 | 3300049574 | Bacteria | 7303 |
| 1031 | Ga0501038_0022951 | 3300049574 | Bacteria | 5585 |
| 1032 | Ga0501038_0099483 | 3300049574 | Bacteria | 2424 |
| 1033 | Ga0501038_0104310 | 3300049574 | Bacteria | 2356 |
| 1034 | Ga0501038_0107049 | 3300049574 | Bacteria | 2320 |
| 1035 | Ga0501039_0017827 | 3300049575 | Bacteria | 5447 |
| 1036 | Ga0501039_0020329 | 3300049575 | Bacteria | 5089 |
| 1037 | Ga0501039_0044490 | 3300049575 | Bacteria | 3429 |
| 1038 | Ga0501039_0069024 | 3300049575 | Bacteria | 2744 |
| 1039 | Ga0501039_0187473 | 3300049575 | Bacteria | 1627 |
| 1040 | Ga0501039_0310053 | 3300049575 | Bacteria | 1240 |
| 1041 | Ga0501039_0332769 | 3300049575 | Bacteria | 1193 |
| 1042 | Ga0501039_0342544 | 3300049575 | Bacteria | 1175 |
| 1043 | Ga0501040_0025559 | 3300049576 | Bacteria | 3971 |
| 1044 | Ga0501040_0034647 | 3300049576 | Bacteria | 3420 |
| 1045 | Ga0501040_0060242 | 3300049576 | Bacteria | 2608 |
| 1046 | Ga0501040_0104962 | 3300049576 | Bacteria | 1974 |
| 1047 | Ga0501040_0154227 | 3300049576 | Bacteria | 1621 |
| 1048 | Ga0501040_0237634 | 3300049576 | Unclassified | 1298 |
| 1049 | Ga0501040_0241137 | 3300049576 | Bacteria | 1289 |
| 1050 | Ga0501040_0272580 | 3300049576 | Unclassified | 1208 |
| 1051 | Ga0501040_0597726 | 3300049576 | Unclassified | 797 |
| 1052 | Ga0501041_0008903 | 3300049577 | Bacteria | 5906 |
| 1053 | Ga0501041_0014526 | 3300049577 | Bacteria | 4676 |
| 1054 | Ga0501041_0015210 | 3300049577 | Bacteria | 4569 |
| 1055 | Ga0501041_0019270 | 3300049577 | Bacteria | 4073 |
| 1056 | Ga0501041_0040061 | 3300049577 | Bacteria | 2843 |
| 1057 | Ga0501041_0072764 | 3300049577 | Bacteria | 2112 |
| 1058 | Ga0501041_0135766 | 3300049577 | Bacteria | 1533 |
| 1059 | Ga0501041_0211426 | 3300049577 | Bacteria | 1217 |
| 1060 | Ga0501042_0003538 | 3300049578 | Bacteria | 9829 |
| 1061 | Ga0501042_0017606 | 3300049578 | Bacteria | 4931 |
| 1062 | Ga0501042_0026539 | 3300049578 | Bacteria | 4069 |
| 1063 | Ga0501042_0027078 | 3300049578 | Bacteria | 4030 |
| 1064 | Ga0501042_0030894 | 3300049578 | Bacteria | 3788 |
| 1065 | Ga0501042_0106781 | 3300049578 | Bacteria | 2015 |
| 1066 | Ga0501042_0133533 | 3300049578 | Bacteria | 1789 |
| 1067 | Ga0501042_0144127 | 3300049578 | Bacteria | 1718 |
| 1068 | Ga0501042_0270108 | 3300049578 | Bacteria | 1228 |
| 1069 | Ga0501042_0675095 | 3300049578 | Bacteria | 751 |
| 1070 | Ga0501043_0034936 | 3300049579 | Bacteria | 3954 |
| 1071 | Ga0501043_0042331 | 3300049579 | Bacteria | 3579 |
| 1072 | Ga0501043_0118712 | 3300049579 | Bacteria | 2074 |
| 1073 | Ga0501043_0276892 | 3300049579 | Bacteria | 1287 |
| 1074 | Ga0501043_0672144 | 3300049579 | Bacteria | 759 |
| 1075 | Ga0501046_0007807 | 3300049580 | Bacteria | 9387 |
| 1076 | Ga0501046_0008573 | 3300049580 | Bacteria | 8897 |
| 1077 | Ga0501046_0087294 | 3300049580 | Bacteria | 2404 |
| 1078 | Ga0501046_0167359 | 3300049580 | Unclassified | 1651 |
| 1079 | Ga0501046_0336084 | 3300049580 | Bacteria | 1098 |
| 1080 | Ga0501046_0383796 | 3300049580 | Bacteria | 1016 |
| 1081 | Ga0501046_0579556 | 3300049580 | Bacteria | 798 |
| 1082 | Ga0501046_0788196 | 3300049580 | Bacteria | 666 |
| 1083 | Ga0501046_0801238 | 3300049580 | Bacteria | 660 |
| 1084 | Ga0501047_0126429 | 3300049581 | Bacteria | 2437 |
| 1085 | Ga0501047_0196516 | 3300049581 | Bacteria | 1879 |
| 1086 | Ga0501048_0017545 | 3300049582 | Bacteria | 5271 |
| 1087 | Ga0501048_0034908 | 3300049582 | Bacteria | 3624 |
| 1088 | Ga0501048_0039370 | 3300049582 | Bacteria | 3391 |
| 1089 | Ga0501048_0044252 | 3300049582 | Bacteria | 3184 |
| 1090 | Ga0501048_0055531 | 3300049582 | Bacteria | 2811 |
| 1091 | Ga0501048_0153411 | 3300049582 | Bacteria | 1629 |
| 1092 | Ga0501048_0345539 | 3300049582 | Bacteria | 1061 |
| 1093 | Ga0501048_0401076 | 3300049582 | Bacteria | 980 |
| 1094 | Ga0501048_1211490 | 3300049582 | Unclassified | 543 |
| 1095 | Ga0501048_1273361 | 3300049582 | Bacteria | 529 |
| 1096 | Ga0501067_0024919 | 3300049583 | Bacteria | 3317 |
| 1097 | Ga0501067_0032625 | 3300049583 | Bacteria | 2891 |
| 1098 | Ga0501067_0042129 | 3300049583 | Bacteria | 2535 |
| 1099 | Ga0501067_0043714 | 3300049583 | Bacteria | 2489 |
| 1100 | Ga0501067_0091319 | 3300049583 | Bacteria | 1690 |
| 1101 | Ga0501067_0131387 | 3300049583 | Bacteria | 1393 |
| 1102 | Ga0501067_0133302 | 3300049583 | Bacteria | 1383 |
| 1103 | Ga0501067_0217198 | 3300049583 | Bacteria | 1065 |
| 1104 | Ga0501067_0493225 | 3300049583 | Archaea | 685 |
| 1105 | Ga0501067_0559982 | 3300049583 | Bacteria | 640 |
| 1106 | Ga0501067_0671300 | 3300049583 | Unclassified | 582 |
| 1107 | Ga0501067_0762400 | 3300049583 | Unclassified | 545 |
| 1108 | Ga0501067_0798129 | 3300049583 | Unclassified | 532 |
| 1109 | Ga0501068_0005150 | 3300049584 | Bacteria | 7128 |
| 1110 | Ga0501068_0013672 | 3300049584 | Bacteria | 4622 |
| 1111 | Ga0501068_0026897 | 3300049584 | Bacteria | 3394 |
| 1112 | Ga0501068_0041966 | 3300049584 | Bacteria | 2750 |
| 1113 | Ga0501068_0132097 | 3300049584 | Bacteria | 1562 |
| 1114 | Ga0501068_0199924 | 3300049584 | Bacteria | 1267 |
| 1115 | Ga0501068_0378843 | 3300049584 | Bacteria | 911 |
| 1116 | Ga0501068_0407945 | 3300049584 | Bacteria | 876 |
| 1117 | Ga0501068_0521056 | 3300049584 | Bacteria | 772 |
| 1118 | Ga0501069_0008060 | 3300049585 | Bacteria | 5534 |
| 1119 | Ga0501069_0012222 | 3300049585 | Bacteria | 4561 |
| 1120 | Ga0501069_0029632 | 3300049585 | Unclassified | 3003 |
| 1121 | Ga0501069_0041140 | 3300049585 | Bacteria | 2554 |
| 1122 | Ga0501069_0074900 | 3300049585 | Bacteria | 1900 |
| 1123 | Ga0501069_0121590 | 3300049585 | Bacteria | 1491 |
| 1124 | Ga0501069_0240185 | 3300049585 | Bacteria | 1055 |
| 1125 | Ga0501069_0458473 | 3300049585 | Bacteria | 758 |
| 1126 | Ga0501069_0650322 | 3300049585 | Archaea | 634 |
| 1127 | Ga0501069_0819646 | 3300049585 | Bacteria | 564 |
| 1128 | Ga0501070_0005450 | 3300049586 | Bacteria | 10862 |
| 1129 | Ga0501070_0024219 | 3300049586 | Bacteria | 5090 |
| 1130 | Ga0501070_0042991 | 3300049586 | Bacteria | 3761 |
| 1131 | Ga0501070_0121643 | 3300049586 | Bacteria | 2157 |
| 1132 | Ga0501070_0767947 | 3300049586 | Bacteria | 759 |
| 1133 | Ga0501070_0916381 | 3300049586 | Bacteria | 683 |
| 1134 | Ga0501071_0004239 | 3300049587 | Bacteria | 9083 |
| 1135 | Ga0501071_0016601 | 3300049587 | Bacteria | 5065 |
| 1136 | Ga0501071_0024934 | 3300049587 | Bacteria | 4185 |
| 1137 | Ga0501071_0044149 | 3300049587 | Bacteria | 3196 |
| 1138 | Ga0501071_0111975 | 3300049587 | Unclassified | 2018 |
| 1139 | Ga0501071_0116910 | 3300049587 | Bacteria | 1974 |
| 1140 | Ga0501071_0179963 | 3300049587 | Bacteria | 1584 |
| 1141 | Ga0501071_0211552 | 3300049587 | Bacteria | 1458 |
| 1142 | Ga0501071_0293214 | 3300049587 | Unclassified | 1232 |
| 1143 | Ga0501071_0486838 | 3300049587 | Bacteria | 946 |
| 1144 | Ga0501071_0624281 | 3300049587 | Bacteria | 829 |
| 1145 | Ga0501071_0787089 | 3300049587 | Bacteria | 733 |
| 1146 | Ga0501071_0822950 | 3300049587 | Bacteria | 716 |
| 1147 | Ga0501071_1507907 | 3300049587 | Bacteria | 519 |
| 1148 | Ga0501072_0001651 | 3300049588 | Bacteria | 16651 |
| 1149 | Ga0501072_0005423 | 3300049588 | Bacteria | 9707 |
| 1150 | Ga0501072_0020822 | 3300049588 | Bacteria | 5083 |
| 1151 | Ga0501072_0036004 | 3300049588 | Bacteria | 3879 |
| 1152 | Ga0501072_0045724 | 3300049588 | Bacteria | 3443 |
| 1153 | Ga0501072_0055072 | 3300049588 | Bacteria | 3135 |
| 1154 | Ga0501072_0058860 | 3300049588 | Bacteria | 3028 |
| 1155 | Ga0501072_0124428 | 3300049588 | Bacteria | 2054 |
| 1156 | Ga0501072_0141336 | 3300049588 | Bacteria | 1919 |
| 1157 | Ga0501072_0278708 | 3300049588 | Bacteria | 1330 |
| 1158 | Ga0501072_0334331 | 3300049588 | Unclassified | 1203 |
| 1159 | Ga0501072_0348745 | 3300049588 | Unclassified | 1175 |
| 1160 | Ga0501072_0441587 | 3300049588 | Bacteria | 1031 |
| 1161 | Ga0501072_0549802 | 3300049588 | Bacteria | 912 |
| 1162 | Ga0501072_0745548 | 3300049588 | Unclassified | 768 |
| 1163 | Ga0501072_0887041 | 3300049588 | Bacteria | 697 |
| 1164 | Ga0501073_0009378 | 3300049589 | Bacteria | 7225 |
| 1165 | Ga0501073_0012213 | 3300049589 | Bacteria | 6270 |
| 1166 | Ga0501073_0013372 | 3300049589 | Bacteria | 5973 |
| 1167 | Ga0501073_0045049 | 3300049589 | Bacteria | 3108 |
| 1168 | Ga0501073_0217281 | 3300049589 | Bacteria | 1321 |
| 1169 | Ga0501073_0362632 | 3300049589 | Bacteria | 1001 |
| 1170 | Ga0501073_0670145 | 3300049589 | Bacteria | 716 |
| 1171 | Ga0501074_0002358 | 3300049590 | Bacteria | 13147 |
| 1172 | Ga0501074_0004166 | 3300049590 | Bacteria | 10326 |
| 1173 | Ga0501074_0023088 | 3300049590 | Bacteria | 4523 |
| 1174 | Ga0501074_0051706 | 3300049590 | Bacteria | 2965 |
| 1175 | Ga0501074_0090902 | 3300049590 | Bacteria | 2186 |
| 1176 | Ga0501074_0185834 | 3300049590 | Bacteria | 1482 |
| 1177 | Ga0501074_0222392 | 3300049590 | Bacteria | 1344 |
| 1178 | Ga0501074_0287260 | 3300049590 | Bacteria | 1169 |
| 1179 | Ga0501075_0020051 | 3300049591 | Bacteria | 4856 |
| 1180 | Ga0501075_0058875 | 3300049591 | Bacteria | 2893 |
| 1181 | Ga0501075_0071665 | 3300049591 | Bacteria | 2619 |
| 1182 | Ga0501075_0106452 | 3300049591 | Bacteria | 2131 |
| 1183 | Ga0501075_0113984 | 3300049591 | Bacteria | 2055 |
| 1184 | Ga0501075_0258925 | 3300049591 | Bacteria | 1326 |
| 1185 | Ga0501075_0278682 | 3300049591 | Unclassified | 1274 |
| 1186 | Ga0501075_0287171 | 3300049591 | Bacteria | 1253 |
| 1187 | Ga0501075_0293146 | 3300049591 | Bacteria | 1239 |
| 1188 | Ga0501075_0325920 | 3300049591 | Unclassified | 1170 |
| 1189 | Ga0501075_0548482 | 3300049591 | Bacteria | 882 |
| 1190 | Ga0501075_0700446 | 3300049591 | Bacteria | 772 |
| 1191 | Ga0501076_0003936 | 3300049592 | Bacteria | 10478 |
| 1192 | Ga0501076_0012716 | 3300049592 | Bacteria | 6300 |
| 1193 | Ga0501076_0058483 | 3300049592 | Bacteria | 3064 |
| 1194 | Ga0501076_0112320 | 3300049592 | Bacteria | 2203 |
| 1195 | Ga0501076_0139566 | 3300049592 | Bacteria | 1968 |
| 1196 | Ga0501076_0226924 | 3300049592 | Bacteria | 1527 |
| 1197 | Ga0501076_0267670 | 3300049592 | Bacteria | 1399 |
| 1198 | Ga0501076_0383920 | 3300049592 | Bacteria | 1154 |
| 1199 | Ga0501076_0394058 | 3300049592 | Bacteria | 1138 |
| 1200 | Ga0501076_0423574 | 3300049592 | Unclassified | 1095 |
| 1201 | Ga0501076_0650545 | 3300049592 | Bacteria | 870 |
| 1202 | Ga0501076_1372199 | 3300049592 | Unclassified | 581 |
| 1203 | Ga0501076_1695491 | 3300049592 | Unclassified | 518 |
| 1204 | Ga0501076_1708753 | 3300049592 | Bacteria | 516 |
| 1205 | Ga0501077_0001226 | 3300049593 | Bacteria | 15492 |
| 1206 | Ga0501077_0003639 | 3300049593 | Bacteria | 9273 |
| 1207 | Ga0501077_0015474 | 3300049593 | Bacteria | 4803 |
| 1208 | Ga0501077_0026652 | 3300049593 | Bacteria | 3668 |
| 1209 | Ga0501077_0042129 | 3300049593 | Bacteria | 2905 |
| 1210 | Ga0501077_0191286 | 3300049593 | Unclassified | 1300 |
| 1211 | Ga0501077_0241160 | 3300049593 | Unclassified | 1149 |
| 1212 | Ga0501077_0473322 | 3300049593 | Bacteria | 803 |
| 1213 | Ga0501077_0480978 | 3300049593 | Unclassified | 796 |
| 1214 | Ga0501077_0543895 | 3300049593 | Unclassified | 745 |
| 1215 | Ga0501077_0590153 | 3300049593 | Bacteria | 713 |
| 1216 | Ga0501077_0610053 | 3300049593 | Archaea | 701 |
| 1217 | Ga0501077_1078606 | 3300049593 | Bacteria | 517 |
| 1218 | Ga0501079_0003747 | 3300049741 | Bacteria | 11218 |
| 1219 | Ga0501079_0051905 | 3300049741 | Bacteria | 3166 |
| 1220 | Ga0501079_0066665 | 3300049741 | Bacteria | 2778 |
| 1221 | Ga0501079_0082527 | 3300049741 | Bacteria | 2486 |
| 1222 | Ga0501079_0086547 | 3300049741 | Bacteria | 2425 |
| 1223 | Ga0501079_0092115 | 3300049741 | Bacteria | 2348 |
| 1224 | Ga0501079_0128587 | 3300049741 | Bacteria | 1971 |
| 1225 | Ga0501079_0195242 | 3300049741 | Bacteria | 1580 |
| 1226 | Ga0501079_0756240 | 3300049741 | Bacteria | 765 |
| 1227 | Ga0501079_1319198 | 3300049741 | Unclassified | 568 |
| 1228 | Ga0501079_1353700 | 3300049741 | Bacteria | 560 |
| 1229 | Ga0501080_0013674 | 3300049742 | Bacteria | 7473 |
| 1230 | Ga0501080_0014355 | 3300049742 | Bacteria | 7293 |
| 1231 | Ga0501080_0050842 | 3300049742 | Bacteria | 3856 |
| 1232 | Ga0501080_0108758 | 3300049742 | Bacteria | 2569 |
| 1233 | Ga0501080_0172991 | 3300049742 | Bacteria | 1991 |
| 1234 | Ga0501080_0216392 | 3300049742 | Bacteria | 1754 |
| 1235 | Ga0501080_0553682 | 3300049742 | Unclassified | 1024 |
| 1236 | Ga0501081_0008544 | 3300049743 | Bacteria | 6654 |
| 1237 | Ga0501081_0016971 | 3300049743 | Bacteria | 4811 |
| 1238 | Ga0501081_0038237 | 3300049743 | Bacteria | 3277 |
| 1239 | Ga0501081_0053405 | 3300049743 | Bacteria | 2790 |
| 1240 | Ga0501081_0076239 | 3300049743 | Bacteria | 2341 |
| 1241 | Ga0501081_0094034 | 3300049743 | Bacteria | 2111 |
| 1242 | Ga0501081_0097443 | 3300049743 | Bacteria | 2075 |
| 1243 | Ga0501081_0198350 | 3300049743 | Bacteria | 1455 |
| 1244 | Ga0501081_0285514 | 3300049743 | Bacteria | 1209 |
| 1245 | Ga0501081_1190889 | 3300049743 | Unclassified | 577 |
| 1246 | Ga0501081_1392638 | 3300049743 | Bacteria | 532 |
| 1247 | Ga0501083_0022414 | 3300049744 | Bacteria | 4384 |
| 1248 | Ga0501083_0027169 | 3300049744 | Bacteria | 3950 |
| 1249 | Ga0501083_0036063 | 3300049744 | Bacteria | 3375 |
| 1250 | Ga0501083_0262384 | 3300049744 | Unclassified | 1124 |
| 1251 | Ga0501083_0455414 | 3300049744 | Bacteria | 833 |
| 1252 | Ga0501083_0891601 | 3300049744 | Bacteria | 579 |
| 1253 | Ga0501035_0016223 | 3300049822 | Bacteria | 6874 |
| 1254 | Ga0501035_0047583 | 3300049822 | Bacteria | 3849 |
| 1255 | Ga0501035_0059885 | 3300049822 | Bacteria | 3391 |
| 1256 | Ga0501035_0197842 | 3300049822 | Bacteria | 1725 |
| 1257 | Ga0501035_0542707 | 3300049822 | Bacteria | 953 |
| 1258 | Ga0501035_1397203 | 3300049822 | Unclassified | 537 |
| 1259 | Ga0501044_0084672 | 3300049823 | Bacteria | 3204 |
| 1260 | Ga0501044_0492730 | 3300049823 | Bacteria | 1127 |
| 1261 | Ga0501044_1102259 | 3300049823 | Bacteria | 663 |
| 1262 | Ga0501045_0000909 | 3300049824 | Bacteria | 19287 |
| 1263 | Ga0501045_0009467 | 3300049824 | Bacteria | 6817 |
| 1264 | Ga0501045_0039307 | 3300049824 | Bacteria | 3442 |
| 1265 | Ga0501045_0042790 | 3300049824 | Bacteria | 3297 |
| 1266 | Ga0501045_0053808 | 3300049824 | Bacteria | 2941 |
| 1267 | Ga0501045_0098691 | 3300049824 | Bacteria | 2161 |
| 1268 | Ga0501045_0413681 | 3300049824 | Unclassified | 1003 |
| 1269 | Ga0501045_0630942 | 3300049824 | Bacteria | 792 |
| 1270 | Ga0501045_0683172 | 3300049824 | Bacteria | 758 |
| 1271 | Ga0501045_1237283 | 3300049824 | Bacteria | 544 |
| 1272 | nmdc:mga03683_551052_c1 | 3300050489 | Bacteria | 561 |
| 1273 | nmdc:mga03n38_17683_c1 | 3300050490 | Bacteria | 2797 |
| 1274 | nmdc:mga00v17_110322_c1 | 3300050491 | Bacteria | 1745 |
| 1275 | nmdc:mga00v17_960189_c1 | 3300050491 | Unclassified | 539 |
| 1276 | nmdc:mga0yw44_403448_c1 | 3300050492 | Bacteria | 924 |
| 1277 | nmdc:mga06z11_933129_c1 | 3300050494 | Bacteria | 529 |
| 1278 | nmdc:mga05p37_100200_c1 | 3300050507 | Bacteria | 3568 |
| 1279 | nmdc:mga05p37_104041_c1 | 3300050507 | Bacteria | 3493 |
| 1280 | nmdc:mga05p37_12780_c1 | 3300050507 | Bacteria | 10034 |
| 1281 | nmdc:mga05p37_1412827_c1 | 3300050507 | Bacteria | 700 |
| 1282 | nmdc:mga05p37_172752_c1 | 3300050507 | Bacteria | 2635 |
| 1283 | nmdc:mga05p37_2044102_c1 | 3300050507 | Unclassified | 540 |
| 1284 | nmdc:mga05p37_266595_c1 | 3300050507 | Bacteria | 2048 |
| 1285 | nmdc:mga05p37_43366_c1 | 3300050507 | Bacteria | 5534 |
| 1286 | nmdc:mga05p37_480493_c1 | 3300050507 | Bacteria | 1431 |
| 1287 | nmdc:mga05p37_493695_c1 | 3300050507 | Bacteria | 1407 |
| 1288 | nmdc:mga05p37_62982_c1 | 3300050507 | Bacteria | 4565 |
| 1289 | nmdc:mga09592_51272_c1 | 3300050508 | Bacteria | 3481 |
| 1290 | nmdc:mga09592_543478_c1 | 3300050508 | Bacteria | 998 |
| 1291 | nmdc:mga09592_558188_c1 | 3300050508 | Bacteria | 983 |
| 1292 | nmdc:mga09592_574177_c1 | 3300050508 | Unclassified | 968 |
| 1293 | nmdc:mga09592_667699_c1 | 3300050508 | Bacteria | 886 |
| 1294 | nmdc:mga0qj67_4619_c1 | 3300050509 | Bacteria | 9990 |
| 1295 | nmdc:mga0qj67_615726_c1 | 3300050509 | Bacteria | 868 |
| 1296 | nmdc:mga06r32_142882_c1 | 3300050510 | Bacteria | 2370 |
| 1297 | nmdc:mga06r32_149692_c1 | 3300050510 | Bacteria | 2312 |
| 1298 | nmdc:mga06r32_32885_c1 | 3300050510 | Bacteria | 4883 |
| 1299 | nmdc:mga06r32_594284_c1 | 3300050510 | Bacteria | 1078 |
| 1300 | nmdc:mga06r32_67730_c1 | 3300050510 | Bacteria | 3447 |
| 1301 | nmdc:mga08y16_104774_c1 | 3300050511 | Bacteria | 2944 |
| 1302 | nmdc:mga08y16_1396842_c1 | 3300050511 | Unclassified | 663 |
| 1303 | nmdc:mga08y16_154884_c1 | 3300050511 | Bacteria | 2382 |
| 1304 | nmdc:mga08y16_23777_c1 | 3300050511 | Bacteria | 6470 |
| 1305 | nmdc:mga08y16_553118_c1 | 3300050511 | Bacteria | 1164 |
| 1306 | nmdc:mga08y16_86500_c1 | 3300050511 | Bacteria | 3267 |
| 1307 | nmdc:mga08y16_89841_c1 | 3300050511 | Bacteria | 3201 |
| 1308 | nmdc:mga08y16_978204_c1 | 3300050511 | Bacteria | 828 |
| 1309 | nmdc:mga0n895_1308197_c1 | 3300050512 | Bacteria | 696 |
| 1310 | nmdc:mga0n895_171743_c1 | 3300050512 | Unclassified | 2200 |
| 1311 | nmdc:mga0n895_246130_c1 | 3300050512 | Bacteria | 1815 |
| 1312 | nmdc:mga0n895_467662_c1 | 3300050512 | Unclassified | 1272 |
| 1313 | nmdc:mga0n895_543103_c1 | 3300050512 | Bacteria | 1168 |
| 1314 | nmdc:mga0n895_860670_c1 | 3300050512 | Bacteria | 894 |
| 1315 | nmdc:mga0rr50_1044594_c1 | 3300050513 | Unclassified | 696 |
| 1316 | nmdc:mga0rr50_109106_c1 | 3300050513 | Bacteria | 2188 |
| 1317 | nmdc:mga0rr50_802966_c1 | 3300050513 | Unclassified | 803 |
| 1318 | nmdc:mga0rr50_96285_c1 | 3300050513 | Bacteria | 2316 |
| 1319 | nmdc:mga08x19_1025854_c1 | 3300050514 | Unclassified | 586 |
| 1320 | nmdc:mga08x19_20397_c1 | 3300050514 | Bacteria | 4081 |
| 1321 | nmdc:mga0a205_360825_c1 | 3300050515 | Unclassified | 1017 |
| 1322 | nmdc:mga0a205_410423_c1 | 3300050515 | Bacteria | 1217 |
| 1323 | nmdc:mga0a205_434145_c1 | 3300050515 | Bacteria | 1174 |
| 1324 | nmdc:mga0a205_648689_c1 | 3300050515 | Unclassified | 907 |
| 1325 | nmdc:mga0a205_814202_c1 | 3300050515 | Bacteria | 782 |
| 1326 | nmdc:mga0a205_916989_c1 | 3300050515 | Bacteria | 723 |
| 1327 | Ga0495612_0162607 | 3300053078 | Bacteria | 975 |
| 1328 | Ga0495612_0182139 | 3300053078 | Bacteria | 923 |
| 1329 | Ga0495595_0007348 | 3300053084 | Bacteria | 4510 |
| 1330 | Ga0495595_0057451 | 3300053084 | Bacteria | 1815 |
| 1331 | Ga0495619_0005609 | 3300053085 | Bacteria | 7962 |
| 1332 | Ga0495619_0052504 | 3300053085 | Bacteria | 2695 |
| 1333 | Ga0495619_0092743 | 3300053085 | Bacteria | 2046 |
| 1334 | Ga0501084_0001727 | 3300054114 | Bacteria | 17332 |
| 1335 | Ga0501084_0001938 | 3300054114 | Bacteria | 16527 |
| 1336 | Ga0501084_0010553 | 3300054114 | Bacteria | 7640 |
| 1337 | Ga0501084_0037373 | 3300054114 | Bacteria | 4057 |
| 1338 | Ga0501084_0064394 | 3300054114 | Bacteria | 3068 |
| 1339 | Ga0501084_0090175 | 3300054114 | Bacteria | 2573 |
| 1340 | Ga0501084_0092310 | 3300054114 | Bacteria | 2542 |
| 1341 | Ga0501084_0123387 | 3300054114 | Bacteria | 2179 |
| 1342 | Ga0501084_0342470 | 3300054114 | Bacteria | 1263 |
| 1343 | Ga0501084_0560275 | 3300054114 | Bacteria | 966 |
| 1344 | Ga0501084_0573247 | 3300054114 | Unclassified | 954 |
| 1345 | Ga0501084_0958367 | 3300054114 | Unclassified | 719 |
| 1346 | Ga0501084_1186010 | 3300054114 | Unclassified | 641 |
| 1347 | Ga0501084_1432745 | 3300054114 | Bacteria | 578 |
| 1348 | Ga0587083_0222991 | 3300059505 | Bacteria | 549 |
| 1349 | Ga0501082_0007325 | 3300060353 | Bacteria | 9523 |
| 1350 | Ga0501082_0022432 | 3300060353 | Bacteria | 5437 |
| 1351 | Ga0501082_0039044 | 3300060353 | Bacteria | 4095 |
| 1352 | Ga0501082_0117020 | 3300060353 | Bacteria | 2309 |
| 1353 | Ga0501082_0268810 | 3300060353 | Unclassified | 1484 |
| 1354 | Ga0501082_0283158 | 3300060353 | Bacteria | 1443 |
| 1355 | Ga0501082_0335404 | 3300060353 | Unclassified | 1317 |
| 1356 | Ga0501082_0382357 | 3300060353 | Bacteria | 1228 |
| 1357 | Ga0501082_0590593 | 3300060353 | Bacteria | 972 |
| 1358 | Ga0501082_1051620 | 3300060353 | Unclassified | 712 |
| 1359 | Ga0501082_1229887 | 3300060353 | Bacteria | 654 |
| 1360 | Ga0501082_1329837 | 3300060353 | Bacteria | 628 |
| 1361 | Ga0466962_0158490 | 3300061719 | Bacteria | 1100 |
| 1362 | Ga0466962_0623646 | 3300061719 | Unclassified | 550 |
| 1363 | Ga0530510_0009521 | 3300061734 | Bacteria | 6813 |
| 1364 | Ga0530510_0032193 | 3300061734 | Bacteria | 3770 |
| 1365 | Ga0530510_0045754 | 3300061734 | Bacteria | 3161 |
| 1366 | Ga0530510_0049002 | 3300061734 | Bacteria | 3053 |
| 1367 | Ga0530510_0050575 | 3300061734 | Bacteria | 3002 |
| 1368 | Ga0530510_0099733 | 3300061734 | Bacteria | 2123 |
| 1369 | Ga0530510_0385680 | 3300061734 | Bacteria | 1055 |
| 1370 | Ga0530510_0392763 | 3300061734 | Bacteria | 1045 |
| 1371 | Ga0530510_0396617 | 3300061734 | Bacteria | 1040 |
| 1372 | Ga0530510_0517425 | 3300061734 | Bacteria | 905 |
| 1373 | Ga0530510_0534651 | 3300061734 | Bacteria | 890 |
| 1374 | Ga0530510_0548529 | 3300061734 | Unclassified | 878 |
| 1375 | Ga0530510_0652251 | 3300061734 | Unclassified | 801 |
| 1376 | Ga0530510_0866940 | 3300061734 | Unclassified | 690 |
| 1377 | Ga0530510_1311350 | 3300061734 | Unclassified | 555 |
| 1378 | Ga0105243_10025323 | |||
| 1379 | JGI24747J21853_1031309 | |||
| 1380 | JGI24743J22301_10006625 | |||
| 1381 | JGI24743J22301_10052076 | |||
| 1382 | JGI24743J22301_10072539 | |||
| 1383 | JGI24738J21930_10017112 | |||
| 1384 | JGI24033J26618_1017366 | |||
| 1385 | JGI24034J26672_10025166 | |||
| 1386 | JGI24751J29686_10111242 | |||
| 1387 | JGI25406J46586_10013282 | |||
| 1388 | Ga0058862_11948148 | |||
| 1389 | Ga0070658_10154985 | |||
| 1390 | Ga0070658_10191527 | |||
| 1391 | Ga0070676_10069255 | |||
| 1392 | Ga0070676_10129842 | |||
| 1393 | Ga0070676_10431802 | |||
| 1394 | Ga0070676_10583319 | |||
| 1395 | Ga0070683_100001405 | |||
| 1396 | Ga0070683_100019032 | |||
| 1397 | Ga0070683_100030770 | |||
| 1398 | Ga0070683_100158958 | |||
| 1399 | Ga0070683_100197316 | |||
| 1400 | Ga0070683_100237391 | |||
| 1401 | Ga0070683_100387842 | |||
| 1402 | Ga0070683_100534476 | |||
| 1403 | Ga0070683_102427233 | |||
| 1404 | Ga0070690_100123873 | |||
| 1405 | Ga0070690_100169633 | |||
| 1406 | Ga0070670_100009289 | |||
| 1407 | Ga0070670_100015080 | |||
| 1408 | Ga0070670_100081538 | |||
| 1409 | Ga0070677_10559961 | |||
| 1410 | Ga0068869_100019754 | |||
| 1411 | Ga0068869_100890976 | |||
| 1412 | Ga0070680_100009539 | |||
| 1413 | Ga0070680_100021512 | |||
| 1414 | Ga0070680_100050228 | |||
| 1415 | Ga0070680_100244669 | |||
| 1416 | Ga0070682_100012429 | |||
| 1417 | Ga0070682_100023546 | |||
| 1418 | Ga0070682_100121130 | |||
| 1419 | Ga0070682_100232193 | |||
| 1420 | Ga0070682_100905053 | |||
| 1421 | Ga0070682_101400430 | |||
| 1422 | Ga0068868_100065936 | |||
| 1423 | Ga0068868_100113491 | |||
| 1424 | Ga0068868_100187850 | |||
| 1425 | Ga0068868_100349631 | |||
| 1426 | Ga0068868_100621575 | |||
| 1427 | Ga0068868_100725116 | |||
| 1428 | Ga0070660_100002717 | |||
| 1429 | Ga0070660_100028904 | |||
| 1430 | Ga0070660_100033834 | |||
| 1431 | Ga0070660_100099843 | |||
| 1432 | Ga0070660_100131256 | |||
| 1433 | Ga0070660_100180917 | |||
| 1434 | Ga0070689_100003852 | |||
| 1435 | Ga0070689_100122934 | |||
| 1436 | Ga0070689_100157203 | |||
| 1437 | Ga0070691_10003135 | |||
| 1438 | Ga0070691_10030728 | |||
| 1439 | Ga0070687_100064372 | |||
| 1440 | Ga0070687_100111875 | |||
| 1441 | Ga0070661_100004092 | |||
| 1442 | Ga0070661_100073769 | |||
| 1443 | Ga0070661_100466461 | |||
| 1444 | Ga0070692_10000917 | |||
| 1445 | Ga0070692_10015220 | |||
| 1446 | Ga0070692_10042146 | |||
| 1447 | Ga0070692_10375824 | |||
| 1448 | Ga0070668_100093049 | |||
| 1449 | Ga0070668_100099110 | |||
| 1450 | Ga0070668_100391319 | |||
| 1451 | Ga0070675_100013579 | |||
| 1452 | Ga0070675_100064339 | |||
| 1453 | Ga0070675_101173522 | |||
| 1454 | Ga0070671_100138274 | |||
| 1455 | Ga0070671_100183393 | |||
| 1456 | Ga0070671_100382069 | |||
| 1457 | Ga0070671_101839761 | |||
| 1458 | Ga0070674_100006249 | |||
| 1459 | Ga0070674_100017624 | |||
| 1460 | Ga0070674_100060431 | |||
| 1461 | Ga0070674_100137826 | |||
| 1462 | Ga0070674_100151478 | |||
| 1463 | Ga0070674_100738264 | |||
| 1464 | Ga0070674_100879113 | |||
| 1465 | Ga0070674_101402457 | |||
| 1466 | Ga0070673_100018469 | |||
| 1467 | Ga0070673_100039084 | |||
| 1468 | Ga0070673_100228655 | |||
| 1469 | Ga0070688_100035677 | |||
| 1470 | Ga0070688_100046950 | |||
| 1471 | Ga0070659_100005769 | |||
| 1472 | Ga0070659_100020421 | |||
| 1473 | Ga0070659_100030033 | |||
| 1474 | Ga0070659_100076580 | |||
| 1475 | Ga0070659_100082947 | |||
| 1476 | Ga0070659_100636536 | |||
| 1477 | Ga0070667_100181378 | |||
| 1478 | Ga0070709_10095271 | |||
| 1479 | Ga0070714_100032641 | |||
| 1480 | Ga0070713_100129371 | |||
| 1481 | Ga0070701_10038796 | |||
| 1482 | Ga0070701_10039581 | |||
| 1483 | Ga0070701_10746602 | |||
| 1484 | Ga0070705_100934122 | |||
| 1485 | Ga0070700_100114821 | |||
| 1486 | Ga0070700_100213931 | |||
| 1487 | Ga0070700_100535784 | |||
| 1488 | Ga0070694_100144022 | |||
| 1489 | Ga0070694_100215822 | |||
| 1490 | Ga0070694_100267002 | |||
| 1491 | Ga0070694_100288694 | |||
| 1492 | Ga0070708_100113488 | |||
| 1493 | Ga0070708_100701405 | |||
| 1494 | Ga0070708_101029493 | |||
| 1495 | Ga0070708_101049714 | |||
| 1496 | Ga0070663_100091921 | |||
| 1497 | Ga0070663_100378909 | |||
| 1498 | Ga0070663_100503284 | |||
| 1499 | Ga0070678_100020509 | |||
| 1500 | Ga0070678_100036136 | |||
| 1501 | Ga0070678_100046431 | |||
| 1502 | Ga0070678_100503227 | |||
| 1503 | Ga0070678_101656125 | |||
| 1504 | Ga0070662_100011454 | |||
| 1505 | Ga0070662_100047899 | |||
| 1506 | Ga0070662_100115846 | |||
| 1507 | Ga0070662_101415533 | |||
| 1508 | Ga0070681_10033554 | |||
| 1509 | Ga0070681_10088761 | |||
| 1510 | Ga0070681_10384719 | |||
| 1511 | Ga0068867_100007801 | |||
| 1512 | Ga0068867_100027137 | |||
| 1513 | Ga0068867_100084350 | |||
| 1514 | Ga0068867_100206789 | |||
| 1515 | Ga0068867_100526444 | |||
| 1516 | Ga0068867_100562592 | |||
| 1517 | Ga0070685_10004165 | |||
| 1518 | Ga0070685_10016935 | |||
| 1519 | Ga0070685_10031326 | |||
| 1520 | Ga0070706_100047233 | |||
| 1521 | Ga0070707_100027798 | |||
| 1522 | Ga0070707_100258432 | |||
| 1523 | Ga0070707_101081671 | |||
| 1524 | Ga0070698_100079986 | |||
| 1525 | Ga0070698_100416419 | |||
| 1526 | Ga0070698_100451343 | |||
| 1527 | Ga0070699_100005200 | |||
| 1528 | Ga0070699_100155093 | |||
| 1529 | Ga0070699_100252609 | |||
| 1530 | Ga0070699_100536889 | |||
| 1531 | Ga0070679_100078953 | |||
| 1532 | Ga0070679_100081458 | |||
| 1533 | Ga0070679_100102120 | |||
| 1534 | Ga0070679_100115819 | |||
| 1535 | Ga0070679_100193876 | |||
| 1536 | Ga0070679_100324007 | |||
| 1537 | Ga0070679_101266688 | |||
| 1538 | Ga0070684_100012224 | |||
| 1539 | Ga0070684_100030097 | |||
| 1540 | Ga0070684_100033606 | |||
| 1541 | Ga0070684_100047104 | |||
| 1542 | Ga0070684_100047834 | |||
| 1543 | Ga0070684_100104616 | |||
| 1544 | Ga0070684_100169758 | |||
| 1545 | Ga0070684_100304565 | |||
| 1546 | Ga0070684_100533209 | |||
| 1547 | Ga0070684_100598596 | |||
| 1548 | Ga0070697_100612367 | |||
| 1549 | Ga0070697_100664615 | |||
| 1550 | Ga0070697_101531841 | |||
| 1551 | Ga0068853_100030585 | |||
| 1552 | Ga0068853_100043247 | |||
| 1553 | Ga0068853_100476837 | |||
| 1554 | Ga0068853_100645724 | |||
| 1555 | Ga0070672_100016503 | |||
| 1556 | Ga0070672_100031054 | |||
| 1557 | Ga0070672_100041035 | |||
| 1558 | Ga0070672_100715872 | |||
| 1559 | Ga0070672_101408373 | |||
| 1560 | Ga0070686_100026827 | |||
| 1561 | Ga0070686_100141771 | |||
| 1562 | Ga0070686_100176280 | |||
| 1563 | Ga0070695_100301139 | |||
| 1564 | Ga0070695_100307007 | |||
| 1565 | Ga0070695_100763506 | |||
| 1566 | Ga0070696_100626699 | |||
| 1567 | Ga0070693_100015948 | |||
| 1568 | Ga0070693_100054589 | |||
| 1569 | Ga0070693_100106136 | |||
| 1570 | Ga0070693_101149608 | |||
| 1571 | Ga0070665_100023124 | |||
| 1572 | Ga0070665_100278994 | |||
| 1573 | Ga0070704_100048900 | |||
| 1574 | Ga0070704_100078313 | |||
| 1575 | Ga0070704_100870360 | |||
| 1576 | Ga0068855_100174806 | |||
| 1577 | Ga0068855_100622971 | |||
| 1578 | Ga0068855_101332101 | |||
| 1579 | Ga0070664_100016770 | |||
| 1580 | Ga0070664_100019661 | |||
| 1581 | Ga0070664_100613081 | |||
| 1582 | Ga0070664_101232699 | |||
| 1583 | Ga0068857_100013490 | |||
| 1584 | Ga0068857_100378601 | |||
| 1585 | Ga0068857_100573238 | |||
| 1586 | Ga0068854_100192654 | |||
| 1587 | Ga0068854_100253860 | |||
| 1588 | Ga0068856_100013469 | |||
| 1589 | Ga0068856_100060165 | |||
| 1590 | Ga0068856_100229082 | |||
| 1591 | Ga0068856_101242312 | |||
| 1592 | Ga0070702_100008487 | |||
| 1593 | Ga0070702_100012133 | |||
| 1594 | Ga0070702_100092102 | |||
| 1595 | Ga0070702_100863935 | |||
| 1596 | Ga0068852_100097305 | |||
| 1597 | Ga0068852_100564459 | |||
| 1598 | Ga0068852_100609234 | |||
| 1599 | Ga0068859_100033061 | |||
| 1600 | Ga0068864_100012769 | |||
| 1601 | Ga0068864_100039006 | |||
| 1602 | Ga0068864_100512999 | |||
| 1603 | Ga0068866_10003279 | |||
| 1604 | Ga0068866_10014812 | |||
| 1605 | Ga0068866_10050978 | |||
| 1606 | Ga0068866_10141841 | |||
| 1607 | Ga0068866_10260137 | |||
| 1608 | Ga0068861_100048189 | |||
| 1609 | Ga0068861_100094098 | |||
| 1610 | Ga0068861_100245563 | |||
| 1611 | Ga0068861_100280246 | |||
| 1612 | Ga0068851_10015652 | |||
| 1613 | Ga0068851_10037325 | |||
| 1614 | Ga0068851_10522985 | |||
| 1615 | Ga0068870_10002280 | |||
| 1616 | Ga0068870_10014111 | |||
| 1617 | Ga0068870_10020026 | |||
| 1618 | Ga0068870_10082875 | |||
| 1619 | Ga0068870_10425617 | |||
| 1620 | Ga0068870_10893650 | |||
| 1621 | Ga0068863_100343255 | |||
| 1622 | Ga0068863_101952968 | |||
| 1623 | Ga0068863_102200928 | |||
| 1624 | Ga0068858_100031628 | |||
| 1625 | Ga0068858_100108309 | |||
| 1626 | Ga0068858_100809234 | |||
| 1627 | Ga0068860_100180416 | |||
| 1628 | Ga0068860_100224189 | |||
| 1629 | Ga0068862_100636004 | |||
| 1630 | Ga0068862_101032690 | |||
| 1631 | Ga0068862_101909718 | |||
| 1632 | Ga0081455_10002152 | |||
| 1633 | Ga0081455_10047017 | |||
| 1634 | Ga0081455_10133409 | |||
| 1635 | Ga0081455_10179722 | |||
| 1636 | Ga0081455_10187366 | |||
| 1637 | Ga0081455_10196766 | |||
| 1638 | Ga0081455_10405094 | |||
| 1639 | Ga0081455_10602559 | |||
| 1640 | Ga0081455_10757500 | |||
| 1641 | Ga0081540_1002321 | |||
| 1642 | Ga0081540_1031707 | |||
| 1643 | Ga0081539_10000216 | |||
| 1644 | Ga0081539_10000477 | |||
| 1645 | Ga0081539_10072272 | |||
| 1646 | Ga0075365_10210994 | |||
| 1647 | Ga0075365_10288063 | |||
| 1648 | Ga0075365_11345489 | |||
| 1649 | Ga0075363_100029161 | |||
| 1650 | Ga0075364_10170931 | |||
| 1651 | Ga0075432_10018044 | |||
| 1652 | Ga0075432_10024469 | |||
| 1653 | Ga0075432_10047999 | |||
| 1654 | Ga0075432_10450664 | |||
| 1655 | Ga0070715_10111678 | |||
| 1656 | Ga0070712_100013595 | |||
| 1657 | Ga0070712_100058885 | |||
| 1658 | Ga0075362_10530563 | |||
| 1659 | Ga0097621_100011148 | |||
| 1660 | Ga0097621_100099488 | |||
| 1661 | Ga0097621_100738175 | |||
| 1662 | Ga0075370_10222779 | |||
| 1663 | Ga0068871_100020551 | |||
| 1664 | Ga0068871_100107339 | |||
| 1665 | Ga0068871_100454719 | |||
| 1666 | Ga0068871_102096404 | |||
| 1667 | Ga0075428_100021129 | |||
| 1668 | Ga0075428_100093526 | |||
| 1669 | Ga0075428_100323134 | |||
| 1670 | Ga0075428_100332370 | |||
| 1671 | Ga0075428_100881229 | |||
| 1672 | Ga0075428_101315789 | |||
| 1673 | Ga0075428_102167997 | |||
| 1674 | Ga0075430_100018650 | |||
| 1675 | Ga0075431_100046111 | |||
| 1676 | Ga0075431_100150296 | |||
| 1677 | Ga0075431_100201326 | |||
| 1678 | Ga0075431_100645521 | |||
| 1679 | Ga0075433_10118026 | |||
| 1680 | Ga0075433_10270457 | |||
| 1681 | Ga0075433_10324135 | |||
| 1682 | Ga0075433_10372833 | |||
| 1683 | Ga0075433_10377534 | |||
| 1684 | Ga0075433_10395328 | |||
| 1685 | Ga0075433_10451589 | |||
| 1686 | Ga0075434_100070475 | |||
| 1687 | Ga0075434_100355004 | |||
| 1688 | Ga0075434_100413709 | |||
| 1689 | Ga0075434_100866148 | |||
| 1690 | Ga0075434_101467019 | |||
| 1691 | Ga0075429_100010926 | |||
| 1692 | Ga0075429_100030337 | |||
| 1693 | Ga0075429_100067941 | |||
| 1694 | Ga0075429_100527580 | |||
| 1695 | Ga0068865_100003153 | |||
| 1696 | Ga0068865_100010036 | |||
| 1697 | Ga0068865_100015979 | |||
| 1698 | Ga0068865_100051631 | |||
| 1699 | Ga0068865_100074599 | |||
| 1700 | Ga0068865_100177956 | |||
| 1701 | Ga0068865_100257253 | |||
| 1702 | Ga0068865_100824311 | |||
| 1703 | Ga0075436_100030852 | |||
| 1704 | Ga0075436_100899977 | |||
| 1705 | Ga0097620_100033061 | |||
| 1706 | Ga0075435_100023363 | |||
| 1707 | Ga0075435_100184243 | |||
| 1708 | Ga0105244_10195536 | |||
| 1709 | Ga0105240_10430523 | |||
| 1710 | Ga0111539_10028825 | |||
| 1711 | Ga0111539_10035537 | |||
| 1712 | Ga0111539_10380814 | |||
| 1713 | Ga0111539_10426431 | |||
| 1714 | Ga0111539_10458036 | |||
| 1715 | Ga0111539_10553146 | |||
| 1716 | Ga0111539_11063406 | |||
| 1717 | Ga0111539_11102737 | |||
| 1718 | Ga0111539_12968849 | |||
| 1719 | Ga0111539_13512423 | |||
| 1720 | Ga0105245_10000865 | |||
| 1721 | Ga0105245_10005696 | |||
| 1722 | Ga0105245_10041836 | |||
| 1723 | Ga0105245_10051897 | |||
| 1724 | Ga0105245_10073898 | |||
| 1725 | Ga0105245_10156839 | |||
| 1726 | Ga0105245_10303962 | |||
| 1727 | Ga0105245_10382829 | |||
| 1728 | Ga0105245_10457848 | |||
| 1729 | Ga0105245_10618879 | |||
| 1730 | Ga0105245_10940392 | |||
| 1731 | Ga0105245_11762507 | |||
| 1732 | Ga0105247_10015667 | |||
| 1733 | Ga0114129_10017864 | |||
| 1734 | Ga0114129_10030517 | |||
| 1735 | Ga0114129_10114533 | |||
| 1736 | Ga0114129_10115187 | |||
| 1737 | Ga0114129_10302540 | |||
| 1738 | Ga0114129_10363336 | |||
| 1739 | Ga0114129_10476383 | |||
| 1740 | Ga0114129_10841008 | |||
| 1741 | Ga0114129_10864412 | |||
| 1742 | Ga0114129_11106428 | |||
| 1743 | Ga0114129_11517850 | |||
| 1744 | Ga0105243_10010340 | |||
| 1745 | Ga0105243_10019868 | |||
| 1746 | Ga0105243_10020472 | |||
| 1747 | Ga0105243_10040453 | |||
| 1748 | Ga0105243_10239865 | |||
| 1749 | Ga0105243_11534396 | |||
| 1750 | Ga0105243_12672455 | |||
| 1751 | Ga0105241_10125672 | |||
| 1752 | Ga0105241_10445680 | |||
| 1753 | Ga0105242_10004020 | |||
| 1754 | Ga0105242_10008513 | |||
| 1755 | Ga0105242_10019399 | |||
| 1756 | Ga0105242_10067739 | |||
| 1757 | Ga0105242_10285111 | |||
| 1758 | Ga0105242_10365803 | |||
| 1759 | Ga0105242_10935468 | |||
| 1760 | Ga0105242_11071049 | |||
| 1761 | Ga0105242_11794508 | |||
| 1762 | Ga0105248_10020638 | |||
| 1763 | Ga0105248_10056569 | |||
| 1764 | Ga0105248_10066880 | |||
| 1765 | Ga0105248_10335881 | |||
| 1766 | Ga0105248_11233844 | |||
| 1767 | Ga0105237_10185040 | |||
| 1768 | Ga0105238_10533963 | |||
| 1769 | Ga0105238_10618239 | |||
| 1770 | Ga0105238_12068732 | |||
| 1771 | Ga0105249_10089242 | |||
| 1772 | Ga0105249_10105026 | |||
| 1773 | Ga0105249_10262139 | |||
| 1774 | Ga0105239_10008794 | |||
| 1775 | Ga0105239_10040473 | |||
| 1776 | Ga0105239_10241430 | |||
| 1777 | Ga0105239_10650258 | |||
| 1778 | Ga0105239_10726171 | |||
| 1779 | Ga0105239_11229853 | |||
| 1780 | Ga0105239_11738416 | |||
| 1781 | Ga0105239_11860739 | |||
| 1782 | Ga0105239_12803543 | |||
| 1783 | Ga0105246_10004814 | |||
| 1784 | Ga0105246_10068066 | |||
| 1785 | Ga0105246_10068186 | |||
| 1786 | Ga0105246_10188289 | |||
| 1787 | Ga0105246_10452831 | |||
| 1788 | Ga0105246_12318081 | |||
| 1789 | Ga0157325_1014658 | |||
| 1790 | Ga0157373_10081338 | |||
| 1791 | Ga0157373_10969842 | |||
| 1792 | Ga0157371_10033070 | |||
| 1793 | Ga0157371_10133271 | |||
| 1794 | Ga0157371_10292857 | |||
| 1795 | Ga0157369_10015732 | |||
| 1796 | Ga0157369_11351306 | |||
| 1797 | Ga0157369_11705710 | |||
| 1798 | Ga0157374_10033250 | |||
| 1799 | Ga0157374_11945346 | |||
| 1800 | Ga0157378_10169648 | |||
| 1801 | Ga0157378_10716846 | |||
| 1802 | Ga0157378_11175632 | |||
| 1803 | Ga0163162_10242880 | |||
| 1804 | Ga0163162_10266149 | |||
| 1805 | Ga0163162_10449533 | |||
| 1806 | Ga0163162_12176262 | |||
| 1807 | Ga0157372_10005778 | |||
| 1808 | Ga0157372_10016713 | |||
| 1809 | Ga0157372_10431391 | |||
| 1810 | Ga0157372_10922020 | |||
| 1811 | Ga0157375_10002706 | |||
| 1812 | Ga0157375_10021156 | |||
| 1813 | Ga0157375_10062886 | |||
| 1814 | Ga0157375_10108931 | |||
| 1815 | Ga0157375_10416814 | |||
| 1816 | Ga0157375_10472117 | |||
| 1817 | Ga0157375_10702129 | |||
| 1818 | Ga0157375_12043383 | |||
| 1819 | Ga0163163_10167410 | |||
| 1820 | Ga0163163_10242090 | |||
| 1821 | Ga0163163_10272801 | |||
| 1822 | Ga0163163_10336208 | |||
| 1823 | Ga0163163_10486289 | |||
| 1824 | Ga0163163_10609764 | |||
| 1825 | Ga0163163_11389123 | |||
| 1826 | Ga0157380_10029906 | |||
| 1827 | Ga0157380_10042173 | |||
| 1828 | Ga0157380_10105103 | |||
| 1829 | Ga0157380_10209134 | |||
| 1830 | Ga0157380_11382979 | |||
| 1831 | Ga0157380_11874534 | |||
| 1832 | Ga0182008_10001466 | |||
| 1833 | Ga0182008_10122262 | |||
| 1834 | Ga0182008_10220222 | |||
| 1835 | Ga0157377_10002959 | |||
| 1836 | Ga0157377_10022631 | |||
| 1837 | Ga0157377_10028581 | |||
| 1838 | Ga0157377_10185563 | |||
| 1839 | Ga0157377_10239673 | |||
| 1840 | Ga0157377_10268121 | |||
| 1841 | Ga0157377_10795888 | |||
| 1842 | Ga0157377_10879466 | |||
| 1843 | Ga0157379_10074306 | |||
| 1844 | Ga0157379_10102275 | |||
| 1845 | Ga0157376_10082624 | |||
| 1846 | Ga0157376_10112317 | |||
| 1847 | Ga0157376_10135284 | |||
| 1848 | Ga0157376_10521871 | |||
| 1849 | Ga0157376_11400437 | |||
| 1850 | Ga0182007_10004451 | |||
| 1851 | Ga0182005_1218142 | |||
| 1852 | Ga0163161_10072570 | |||
| 1853 | Ga0163161_10595678 | |||
| 1854 | Ga0163161_11781222 | |||
| 1855 | Ga0163161_11808438 | |||
| 1856 | Ga0197907_11367132 | |||
| 1857 | Ga0206356_11323765 | |||
| 1858 | Ga0206356_11343203 | |||
| 1859 | Ga0206354_11018335 | |||
| 1860 | Ga0206354_11270724 | |||
| 1861 | Ga0206353_10552488 | |||
| 1862 | Ga0206353_11117021 | |||
| 1863 | Ga0206353_11424935 | |||
| 1864 | Ga0207656_10125709 | |||
| 1865 | Ga0207656_10226675 | |||
| 1866 | Ga0207642_10425410 | |||
| 1867 | Ga0207642_10446671 | |||
| 1868 | Ga0207710_10082795 | |||
| 1869 | Ga0207688_10000816 | |||
| 1870 | Ga0207688_10009328 | |||
| 1871 | Ga0207688_10264938 | |||
| 1872 | Ga0207688_10322937 | |||
| 1873 | Ga0207688_10818561 | |||
| 1874 | Ga0207645_10033975 | |||
| 1875 | Ga0207645_10076212 | |||
| 1876 | Ga0207643_10002335 | |||
| 1877 | Ga0207643_10004431 | |||
| 1878 | Ga0207643_10039762 | |||
| 1879 | Ga0207643_10047409 | |||
| 1880 | Ga0207643_10104191 | |||
| 1881 | Ga0207643_10149942 | |||
| 1882 | Ga0207705_10934434 | |||
| 1883 | Ga0207684_10336736 | |||
| 1884 | Ga0207654_10219739 | |||
| 1885 | Ga0207654_11122068 | |||
| 1886 | Ga0207707_10061566 | |||
| 1887 | Ga0207707_10075947 | |||
| 1888 | Ga0207707_10088880 | |||
| 1889 | Ga0207707_10167632 | |||
| 1890 | Ga0207707_10518234 | |||
| 1891 | Ga0207707_11475315 | |||
| 1892 | Ga0207695_10709942 | |||
| 1893 | Ga0207695_10796479 | |||
| 1894 | Ga0207671_10373549 | |||
| 1895 | Ga0207693_10003543 | |||
| 1896 | Ga0207693_10128234 | |||
| 1897 | Ga0207663_10735133 | |||
| 1898 | Ga0207660_10038385 | |||
| 1899 | Ga0207660_10173306 | |||
| 1900 | Ga0207660_10233050 | |||
| 1901 | Ga0207660_10564082 | |||
| 1902 | Ga0207662_10021188 | |||
| 1903 | Ga0207662_10047572 | |||
| 1904 | Ga0207662_11261206 | |||
| 1905 | Ga0207657_10001687 | |||
| 1906 | Ga0207657_10030201 | |||
| 1907 | Ga0207657_10032572 | |||
| 1908 | Ga0207657_10045985 | |||
| 1909 | Ga0207649_10160018 | |||
| 1910 | Ga0207652_10086827 | |||
| 1911 | Ga0207652_10274328 | |||
| 1912 | Ga0207652_10285055 | |||
| 1913 | Ga0207652_10339736 | |||
| 1914 | Ga0207652_10901234 | |||
| 1915 | Ga0207646_10116968 | |||
| 1916 | Ga0207646_10300738 | |||
| 1917 | Ga0207646_11172626 | |||
| 1918 | Ga0207681_10369374 | |||
| 1919 | Ga0207681_10890528 | |||
| 1920 | Ga0207694_10426091 | |||
| 1921 | Ga0207694_10609311 | |||
| 1922 | Ga0207694_10656596 | |||
| 1923 | Ga0207650_10014285 | |||
| 1924 | Ga0207650_10038074 | |||
| 1925 | Ga0207650_10053525 | |||
| 1926 | Ga0207659_10026007 | |||
| 1927 | Ga0207659_10115188 | |||
| 1928 | Ga0207659_10467048 | |||
| 1929 | Ga0207659_11183424 | |||
| 1930 | Ga0207659_11383087 | |||
| 1931 | Ga0207687_10015021 | |||
| 1932 | Ga0207687_10040500 | |||
| 1933 | Ga0207687_10292385 | |||
| 1934 | Ga0207687_10348041 | |||
| 1935 | Ga0207687_10603712 | |||
| 1936 | Ga0207687_10770019 | |||
| 1937 | Ga0207687_11068832 | |||
| 1938 | Ga0207664_10003682 | |||
| 1939 | Ga0207664_10680284 | |||
| 1940 | Ga0207664_11390569 | |||
| 1941 | Ga0207664_11396284 | |||
| 1942 | Ga0207644_10086949 | |||
| 1943 | Ga0207644_10285440 | |||
| 1944 | Ga0207690_10066731 | |||
| 1945 | Ga0207690_10068632 | |||
| 1946 | Ga0207690_10198335 | |||
| 1947 | Ga0207690_10968534 | |||
| 1948 | Ga0207706_10030464 | |||
| 1949 | Ga0207706_10041080 | |||
| 1950 | Ga0207706_10055817 | |||
| 1951 | Ga0207706_11425456 | |||
| 1952 | Ga0207686_10046937 | |||
| 1953 | Ga0207686_10056842 | |||
| 1954 | Ga0207686_10102534 | |||
| 1955 | Ga0207686_10178773 | |||
| 1956 | Ga0207686_10530088 | |||
| 1957 | Ga0207686_10745421 | |||
| 1958 | Ga0207709_10013980 | |||
| 1959 | Ga0207709_10037019 | |||
| 1960 | Ga0207709_10199207 | |||
| 1961 | Ga0207709_10303820 | |||
| 1962 | Ga0207709_11314828 | |||
| 1963 | Ga0207670_10091776 | |||
| 1964 | Ga0207670_10320098 | |||
| 1965 | Ga0207670_10542229 | |||
| 1966 | Ga0207669_10007683 | |||
| 1967 | Ga0207669_10012223 | |||
| 1968 | Ga0207669_10107161 | |||
| 1969 | Ga0207669_10131920 | |||
| 1970 | Ga0207669_10283455 | |||
| 1971 | Ga0207669_10392902 | |||
| 1972 | Ga0207669_10485173 | |||
| 1973 | Ga0207669_10607861 | |||
| 1974 | Ga0207669_10705079 | |||
| 1975 | Ga0207669_10789229 | |||
| 1976 | Ga0207669_11770750 | |||
| 1977 | Ga0207704_10049937 | |||
| 1978 | Ga0207704_10057714 | |||
| 1979 | Ga0207704_10112644 | |||
| 1980 | Ga0207704_10229714 | |||
| 1981 | Ga0207704_10591565 | |||
| 1982 | Ga0207704_11369625 | |||
| 1983 | Ga0207691_10009024 | |||
| 1984 | Ga0207691_10009851 | |||
| 1985 | Ga0207691_10025077 | |||
| 1986 | Ga0207691_10074503 | |||
| 1987 | Ga0207711_10081924 | |||
| 1988 | Ga0207711_10302897 | |||
| 1989 | Ga0207711_10350367 | |||
| 1990 | Ga0207711_10479490 | |||
| 1991 | Ga0207711_10595505 | |||
| 1992 | Ga0207689_10283512 | |||
| 1993 | Ga0207689_10601803 | |||
| 1994 | Ga0207689_11237435 | |||
| 1995 | Ga0207689_11473129 | |||
| 1996 | Ga0207661_10064817 | |||
| 1997 | Ga0207661_10147292 | |||
| 1998 | Ga0207661_10153385 | |||
| 1999 | Ga0207661_10202435 | |||
| 2000 | Ga0207661_10458639 | |||
| 2001 | Ga0207679_10013388 | |||
| 2002 | Ga0207679_10181741 | |||
| 2003 | Ga0207679_10195758 | |||
| 2004 | Ga0207679_10376326 | |||
| 2005 | Ga0207679_10452887 | |||
| 2006 | Ga0207679_10869514 | |||
| 2007 | Ga0207667_10030665 | |||
| 2008 | Ga0207667_10814154 | |||
| 2009 | Ga0207651_10055080 | |||
| 2010 | Ga0207651_10207305 | |||
| 2011 | Ga0207651_10370720 | |||
| 2012 | Ga0207651_10799863 | |||
| 2013 | Ga0207712_10646451 | |||
| 2014 | Ga0207668_10082390 | |||
| 2015 | Ga0207668_10106093 | |||
| 2016 | Ga0207668_10112312 | |||
| 2017 | Ga0207668_11913950 | |||
| 2018 | Ga0207640_10041421 | |||
| 2019 | Ga0207640_10260423 | |||
| 2020 | Ga0207658_10054357 | |||
| 2021 | Ga0207658_11380129 | |||
| 2022 | Ga0207677_10020382 | |||
| 2023 | Ga0207677_10375507 | |||
| 2024 | Ga0207677_10858426 | |||
| 2025 | Ga0207677_10867028 | |||
| 2026 | Ga0207703_10124591 | |||
| 2027 | Ga0207639_10240992 | |||
| 2028 | Ga0207639_10254909 | |||
| 2029 | Ga0207639_10333113 | |||
| 2030 | Ga0207639_10473212 | |||
| 2031 | Ga0207639_12015725 | |||
| 2032 | Ga0207678_10138725 | |||
| 2033 | Ga0207678_10241341 | |||
| 2034 | Ga0207678_10504675 | |||
| 2035 | Ga0207678_10601471 | |||
| 2036 | Ga0207678_11329534 | |||
| 2037 | Ga0207708_10003549 | |||
| 2038 | Ga0207708_10009415 | |||
| 2039 | Ga0207708_10148934 | |||
| 2040 | Ga0207708_10246883 | |||
| 2041 | Ga0207708_10793359 | |||
| 2042 | Ga0207708_10830899 | |||
| 2043 | Ga0207708_11768314 | |||
| 2044 | Ga0207702_10036281 | |||
| 2045 | Ga0207702_10120898 | |||
| 2046 | Ga0207641_10093901 | |||
| 2047 | Ga0207641_10325861 | |||
| 2048 | Ga0207641_10687679 | |||
| 2049 | Ga0207648_10021040 | |||
| 2050 | Ga0207648_10080374 | |||
| 2051 | Ga0207648_10227688 | |||
| 2052 | Ga0207648_10295689 | |||
| 2053 | Ga0207648_10334740 | |||
| 2054 | Ga0207676_10028753 | |||
| 2055 | Ga0207676_10505943 | |||
| 2056 | Ga0207674_10074954 | |||
| 2057 | Ga0207674_10492048 | |||
| 2058 | Ga0207674_10543606 | |||
| 2059 | Ga0207674_10707244 | |||
| 2060 | Ga0207674_10737592 | |||
| 2061 | Ga0207674_11844099 | |||
| 2062 | Ga0207675_100082828 | |||
| 2063 | Ga0207675_100140533 | |||
| 2064 | Ga0207675_100265643 | |||
| 2065 | Ga0207675_101140419 | |||
| 2066 | Ga0207683_10008257 | |||
| 2067 | Ga0207683_10037163 | |||
| 2068 | Ga0207683_10039656 | |||
| 2069 | Ga0207683_10158422 | |||
| 2070 | Ga0207683_10164461 | |||
| 2071 | Ga0207683_10375927 | |||
| 2072 | Ga0207683_10417505 | |||
| 2073 | Ga0207683_11603830 | |||
| 2074 | Ga0207698_10025840 | |||
| 2075 | Ga0207698_10066186 | |||
| 2076 | Ga0207698_10538372 | |||
| 2077 | Ga0207698_10643691 | |||
| 2078 | Ga0209998_10034288 | |||
| 2079 | Ga0209998_10075560 | |||
| 2080 | Ga0207428_10001196 | |||
| 2081 | Ga0207428_10002858 | |||
| 2082 | Ga0207428_10003094 | |||
| 2083 | Ga0207428_10010613 | |||
| 2084 | Ga0207428_10022792 | |||
| 2085 | Ga0207428_10143221 | |||
| 2086 | Ga0207428_10547134 | |||
| 2087 | Ga0268266_10079681 | |||
| 2088 | Ga0268266_10123673 | |||
| 2089 | Ga0268265_10019384 | |||
| 2090 | Ga0268265_10977271 | |||
| 2091 | Ga0268264_10096769 | |||
| 2092 | Ga0268264_10186364 | |||
| 2093 | Ga0265337_1074129 | |||
| 2094 | Ga0265337_1134499 | |||
| 2095 | Ga0265319_1018074 | |||
| 2096 | Ga0265319_1023935 | |||
| 2097 | Ga0265334_10013253 | |||
| 2098 | Ga0265318_10010982 | |||
| 2099 | Ga0265318_10059198 | |||
| 2100 | Ga0265318_10267775 | |||
| 2101 | Ga0265323_10027737 | |||
| 2102 | Ga0265322_10061912 | |||
| 2103 | Ga0265336_10094075 | |||
| 2104 | Ga0265338_10002825 | |||
| 2105 | Ga0265338_10040946 | |||
| 2106 | Ga0265338_10056999 | |||
| 2107 | Ga0265338_10075267 | |||
| 2108 | Ga0265332_10010966 | |||
| 2109 | Ga0265320_10025656 | |||
| 2110 | Ga0265325_10017313 | |||
| 2111 | Ga0265325_10039449 | |||
| 2112 | Ga0265329_10014417 | |||
| 2113 | Ga0265329_10141505 | |||
| 2114 | Ga0265340_10008842 | |||
| 2115 | Ga0265339_10108848 | |||
| 2116 | Ga0265331_10013454 | |||
| 2117 | Ga0265327_10015984 | |||
| 2118 | Ga0265327_10029446 | |||
| 2119 | Ga0265316_10032193 | |||
| 2120 | Ga0265316_10980405 | |||
| 2121 | Ga0265313_10019317 | |||
| 2122 | Ga0265313_10042770 | |||
| 2123 | Ga0265314_10026163 | |||
| 2124 | Ga0265314_10057812 | |||
| 2125 | Ga0265342_10144772 | |||
| 2126 | Ga0373930_0012507 | |||
| 2127 | Ga0373948_0014747 | |||
| 2128 | Ga0373958_0135882 | |||
| 2129 | Ga0373959_0018800 | |||
| 2130 | Ga0373934_0007365 | |||
| 2131 | Ga0373949_0011197 | |||
| 2132 | Ga0373951_0106474 | |||
| 2133 | Ga0373952_0210375 | |||
| 2134 | Ga0373932_0125041 | |||
| 2135 | Ga0373941_0005509 | |||
| 2136 | Ga0373953_0476330 | |||
| 2137 | Ga0373954_0186210 | |||
| 2138 | Ga0373960_0046379 | |||
| 2139 | Ga0373943_0028124 | |||
| 2140 | Ga0373955_0054516 | |||
| 2141 | Ga0373942_0032748 | |||
| 2142 | Ga0373942_0054887 | |||
| 2143 | Ga0373961_0025852 | |||
| 2144 | Ga0373961_0157372 | |||
| 2145 | Ga0373962_0017357 | |||
| 2146 | Ga0373924_0052199 | |||
| 2147 | Ga0373931_0066731 | |||
| 2148 | Ga0373931_0301673 | |||
| 2149 | Ga0373931_0321633 | |||
| 2150 | Ga0373933_0132028 | |||
| 2151 | Ga0373937_1173568 | |||
| 2152 | Ga0395899_0119377 | |||
| 2153 | Ga0395899_0217119 | |||
| 2154 | Ga0395899_0314505 | |||
| 2155 | Ga0395899_0530947 | |||
| 2156 | Ga0395900_0052851 | |||
| 2157 | Ga0395900_0244599 | |||
| 2158 | Ga0395900_0375606 | |||
| 2159 | Ga0395900_0525960 | |||
| 2160 | Ga0395900_0602637 | |||
| 2161 | Ga0395900_1051256 | |||
| 2162 | Ga0395900_1191339 | |||
| 2163 | Ga0395900_1224734 | |||
| 2164 | Ga0395900_1631245 | |||
| 2165 | Ga0395898_0004143 | |||
| 2166 | Ga0395898_0057869 | |||
| 2167 | Ga0395898_0116582 | |||
| 2168 | Ga0395898_0473016 | |||
| 2169 | Ga0395898_0594721 | |||
| 2170 | Ga0395898_1060610 | |||
| 2171 | Ga0395898_1749150 | |||
| 2172 | Ga0395898_1772148 | |||
| 2173 | Ga0395905_0003900 | |||
| 2174 | Ga0395905_0032900 | |||
| 2175 | Ga0395905_0167044 | |||
| 2176 | Ga0395905_1327733 | |||
| 2177 | Ga0395905_1467979 | |||
| 2178 | Ga0395901_0001175 | |||
| 2179 | Ga0395901_0001894 | |||
| 2180 | Ga0395901_0099969 | |||
| 2181 | Ga0395901_0114319 | |||
| 2182 | Ga0395901_0487897 | |||
| 2183 | Ga0395901_0615013 | |||
| 2184 | Ga0395901_0990451 | |||
| 2185 | Ga0395901_1978857 | |||
| 2186 | Ga0439453_0065349 | |||
| 2187 | Ga0451793_0140964 | |||
| 2188 | Ga0451793_1117621 | |||
| 2189 | Ga0451795_0186197 | |||
| 2190 | Ga0451798_0170046 | |||
| 2191 | Ga0451802_2063843 | |||
| 2192 | Ga0451807_0366467 | |||
| 2193 | Ga0451835_1071592 | |||
| 2194 | Ga0451837_1771718 | |||
| 2195 | Ga0451845_0377167 | |||
| 2196 | Ga0451847_0626268 | |||
| 2197 | Ga0451853_0503966 | |||
| 2198 | Ga0451853_1439937 | |||
| 2199 | Ga0439448_0063343 | |||
| 2200 | Ga0450920_111143 | |||
| 2201 | Ga0450923_194098 | |||
| 2202 | Ga0450902_065821 | |||
| 2203 | Ga0450906_002797 | |||
| 2204 | Ga0450907_002290 | |||
| 2205 | Ga0439458_0110535 | |||
| 2206 | Ga0439435_0142734 | |||
| 2207 | Ga0439435_0223276 | |||
| 2208 | Ga0439435_0293667 | |||
| 2209 | Ga0439464_0065129 | |||
| 2210 | Ga0439464_0177517 | |||
| 2211 | Ga0439440_0224842 | |||
| 2212 | Ga0453683_1040393 | |||
| 2213 | Ga0466966_0207824 | |||
| 2214 | Ga0466961_0666967 | |||
| 2215 | Ga0466963_0245251 | |||
| 2216 | Ga0466963_0287439 | |||
| 2217 | Ga0466963_0321310 | |||
| 2218 | Ga0466963_0652258 | |||
| 2219 | Ga0466964_0034636 | |||
| 2220 | Ga0466964_0518221 | |||
| 2221 | Ga0466971_0095768 | |||
| 2222 | Ga0466971_0304871 | |||
| 2223 | Ga0466968_0101672 | |||
| 2224 | Ga0466968_0149931 | |||
| 2225 | Ga0466970_0560701 | |||
| 2226 | Ga0466957_0417883 | |||
| 2227 | Ga0466957_0712018 | |||
| 2228 | Ga0466959_0289215 | |||
| 2229 | Ga0451576_1016160 | |||
| 2230 | Ga0466958_0170690 | |||
| 2231 | Ga0466958_0185582 | |||
| 2232 | Ga0466958_0598288 | |||
| 2233 | Ga0466967_0000047 | |||
| 2234 | Ga0466967_0083772 | |||
| 2235 | Ga0466967_0161369 | |||
| 2236 | Ga0466967_0215087 | |||
| 2237 | Ga0466967_0272680 | |||
| 2238 | Ga0466967_0405542 | |||
| 2239 | Ga0466967_0489428 | |||
| 2240 | Ga0466967_0535907 | |||
| 2241 | Ga0466967_0582082 | |||
| 2242 | Ga0495592_0553975 | |||
| 2243 | Ga0495603_0035829 | |||
| 2244 | Ga0495603_0073846 | |||
| 2245 | Ga0495603_0279380 | |||
| 2246 | Ga0495603_0475192 | |||
| 2247 | Ga0495603_0614567 | |||
| 2248 | Ga0495603_0808555 | |||
| 2249 | Ga0495641_0188497 | |||
| 2250 | Ga0495641_0288069 | |||
| 2251 | Ga0495651_0028264 | |||
| 2252 | Ga0495653_0029348 | |||
| 2253 | Ga0495582_0781134 | |||
| 2254 | Ga0495584_0158577 | |||
| 2255 | Ga0495596_0270604 | |||
| 2256 | Ga0495608_0003415 | |||
| 2257 | Ga0495628_0430286 | |||
| 2258 | Ga0495630_0372191 | |||
| 2259 | Ga0495630_0412315 | |||
| 2260 | Ga0495637_0217763 | |||
| 2261 | Ga0495643_0515435 | |||
| 2262 | Ga0495644_0150018 | |||
| 2263 | Ga0495640_0096177 | |||
| 2264 | Ga0495640_0257189 | |||
| 2265 | Ga0495587_0245230 | |||
| 2266 | Ga0495622_0257262 | |||
| 2267 | Ga0495633_0447927 | |||
| 2268 | Ga0495633_0498449 | |||
| 2269 | Ga0495667_0099258 | |||
| 2270 | Ga0495667_0186580 | |||
| 2271 | Ga0495656_0825891 | |||
| 2272 | Ga0495634_0202108 | |||
| 2273 | Ga0495634_0387686 | |||
| 2274 | Ga0495635_0284772 | |||
| 2275 | Ga0495659_0429567 | |||
| 2276 | Ga0495588_0305543 | |||
| 2277 | Ga0495657_0175976 | |||
| 2278 | Ga0495646_0595845 | |||
| 2279 | Ga0495658_0084809 | |||
| 2280 | Ga0495669_0155967 | |||
| 2281 | Ga0495669_0468321 | |||
| 2282 | Ga0495613_0345113 | |||
| 2283 | Ga0495613_0751315 | |||
| 2284 | Ga0495670_0205910 | |||
| 2285 | Ga0495671_0389084 | |||
| 2286 | Ga0495589_0133893 | |||
| 2287 | Ga0495660_0372994 | |||
| 2288 | Ga0495581_0327730 | |||
| 2289 | Ga0495674_0034616 | |||
| 2290 | Ga0495674_0587126 | |||
| 2291 | Ga0495676_0128272 | |||
| 2292 | Ga0495676_0410071 | |||
| 2293 | Ga0495680_0030143 | |||
| 2294 | Ga0495680_0447692 | |||
| 2295 | Ga0495675_0519850 | |||
| 2296 | Ga0495677_0024931 | |||
| 2297 | Ga0495677_0410004 | |||
| 2298 | Ga0495684_0829812 | |||
| 2299 | Ga0495602_0255950 | |||
| 2300 | Ga0495602_1150795 | |||
| 2301 | Ga0495626_0221376 | |||
| 2302 | Ga0496100_0016868 | |||
| 2303 | Ga0496100_0076658 | |||
| 2304 | Ga0496100_0393818 | |||
| 2305 | Ga0496100_0452147 | |||
| 2306 | Ga0496100_1139677 | |||
| 2307 | Ga0496101_0040100 | |||
| 2308 | Ga0496101_0069709 | |||
| 2309 | Ga0496101_0221245 | |||
| 2310 | Ga0496101_0267798 | |||
| 2311 | Ga0496101_0377968 | |||
| 2312 | Ga0496101_0524279 | |||
| 2313 | Ga0496101_1166398 | |||
| 2314 | Ga0496102_0094521 | |||
| 2315 | Ga0496102_0162475 | |||
| 2316 | Ga0496102_0504034 | |||
| 2317 | Ga0496102_1373151 | |||
| 2318 | Ga0496102_1668037 | |||
| 2319 | Ga0496103_0041231 | |||
| 2320 | Ga0496103_0410328 | |||
| 2321 | Ga0496104_0043681 | |||
| 2322 | Ga0496104_0069316 | |||
| 2323 | Ga0496104_0813958 | |||
| 2324 | Ga0496104_1799970 | |||
| 2325 | Ga0496105_0057142 | |||
| 2326 | Ga0496105_0281869 | |||
| 2327 | Ga0496105_0695404 | |||
| 2328 | Ga0496105_0878244 | |||
| 2329 | Ga0496105_1039787 | |||
| 2330 | Ga0496106_0050988 | |||
| 2331 | Ga0496106_0061387 | |||
| 2332 | Ga0496106_0527575 | |||
| 2333 | Ga0496106_0674510 | |||
| 2334 | Ga0496106_0703878 | |||
| 2335 | Ga0496106_1153680 | |||
| 2336 | Ga0496106_1176749 | |||
| 2337 | Ga0496107_0020386 | |||
| 2338 | Ga0496107_0286648 | |||
| 2339 | Ga0496107_0675976 | |||
| 2340 | Ga0496107_0928531 | |||
| 2341 | Ga0496108_0008153 | |||
| 2342 | Ga0496108_0059292 | |||
| 2343 | Ga0496108_0123995 | |||
| 2344 | Ga0496108_0574805 | |||
| 2345 | Ga0496108_0678092 | |||
| 2346 | Ga0496109_0026615 | |||
| 2347 | Ga0496109_0072401 | |||
| 2348 | Ga0496109_0084777 | |||
| 2349 | Ga0496109_0112802 | |||
| 2350 | Ga0496109_0404795 | |||
| 2351 | Ga0496109_0431052 | |||
| 2352 | Ga0496109_0477626 | |||
| 2353 | Ga0496110_0024462 | |||
| 2354 | Ga0496110_0034274 | |||
| 2355 | Ga0496110_0038123 | |||
| 2356 | Ga0496110_0064213 | |||
| 2357 | Ga0496110_0521186 | |||
| 2358 | Ga0496110_0577812 | |||
| 2359 | Ga0496110_0639966 | |||
| 2360 | Ga0496110_1048870 | |||
| 2361 | Ga0496111_0008218 | |||
| 2362 | Ga0496111_0016469 | |||
| 2363 | Ga0496111_0055552 | |||
| 2364 | Ga0496111_0142828 | |||
| 2365 | Ga0496111_0658641 | |||
| 2366 | Ga0496111_1040429 | |||
| 2367 | Ga0496112_0083822 | |||
| 2368 | Ga0496112_0284341 | |||
| 2369 | Ga0496112_0336448 | |||
| 2370 | Ga0496112_0692825 | |||
| 2371 | Ga0496113_0088351 | |||
| 2372 | Ga0496113_0357962 | |||
| 2373 | Ga0496113_1422783 | |||
| 2374 | Ga0496114_0004408 | |||
| 2375 | Ga0496114_0061930 | |||
| 2376 | Ga0496114_0411326 | |||
| 2377 | Ga0496114_0427260 | |||
| 2378 | Ga0496115_0135596 | |||
| 2379 | Ga0501031_0012038 | |||
| 2380 | Ga0501031_0046419 | |||
| 2381 | Ga0501031_0102930 | |||
| 2382 | Ga0501031_0133062 | |||
| 2383 | Ga0501031_0268790 | |||
| 2384 | Ga0501031_0618238 | |||
| 2385 | Ga0501031_0772134 | |||
| 2386 | Ga0501032_0009312 | |||
| 2387 | Ga0501032_0040718 | |||
| 2388 | Ga0501032_0258716 | |||
| 2389 | Ga0501033_0021846 | |||
| 2390 | Ga0501033_0036869 | |||
| 2391 | Ga0501033_0325338 | |||
| 2392 | Ga0501033_0738189 | |||
| 2393 | Ga0501034_0006648 | |||
| 2394 | Ga0501034_0241853 | |||
| 2395 | Ga0501036_0028893 | |||
| 2396 | Ga0501036_0067807 | |||
| 2397 | Ga0501036_0950110 | |||
| 2398 | Ga0501036_1054021 | |||
| 2399 | Ga0501036_1255580 | |||
| 2400 | Ga0501036_1264560 | |||
| 2401 | Ga0501036_1572774 | |||
| 2402 | Ga0501037_0025445 | |||
| 2403 | Ga0501037_0093995 | |||
| 2404 | Ga0501037_0336475 | |||
| 2405 | Ga0501037_0642386 | |||
| 2406 | Ga0501037_0877976 | |||
| 2407 | Ga0501038_0014026 | |||
| 2408 | Ga0501038_0022951 | |||
| 2409 | Ga0501038_0099483 | |||
| 2410 | Ga0501038_0104310 | |||
| 2411 | Ga0501038_0107049 | |||
| 2412 | Ga0501039_0017827 | |||
| 2413 | Ga0501039_0020329 | |||
| 2414 | Ga0501039_0044490 | |||
| 2415 | Ga0501039_0069024 | |||
| 2416 | Ga0501039_0187473 | |||
| 2417 | Ga0501039_0310053 | |||
| 2418 | Ga0501039_0332769 | |||
| 2419 | Ga0501039_0342544 | |||
| 2420 | Ga0501040_0025559 | |||
| 2421 | Ga0501040_0034647 | |||
| 2422 | Ga0501040_0060242 | |||
| 2423 | Ga0501040_0104962 | |||
| 2424 | Ga0501040_0154227 | |||
| 2425 | Ga0501040_0237634 | |||
| 2426 | Ga0501040_0241137 | |||
| 2427 | Ga0501040_0272580 | |||
| 2428 | Ga0501040_0597726 | |||
| 2429 | Ga0501041_0008903 | |||
| 2430 | Ga0501041_0014526 | |||
| 2431 | Ga0501041_0015210 | |||
| 2432 | Ga0501041_0019270 | |||
| 2433 | Ga0501041_0040061 | |||
| 2434 | Ga0501041_0072764 | |||
| 2435 | Ga0501041_0135766 | |||
| 2436 | Ga0501041_0211426 | |||
| 2437 | Ga0501042_0003538 | |||
| 2438 | Ga0501042_0017606 | |||
| 2439 | Ga0501042_0026539 | |||
| 2440 | Ga0501042_0027078 | |||
| 2441 | Ga0501042_0030894 | |||
| 2442 | Ga0501042_0106781 | |||
| 2443 | Ga0501042_0133533 | |||
| 2444 | Ga0501042_0144127 | |||
| 2445 | Ga0501042_0270108 | |||
| 2446 | Ga0501042_0675095 | |||
| 2447 | Ga0501043_0034936 | |||
| 2448 | Ga0501043_0042331 | |||
| 2449 | Ga0501043_0118712 | |||
| 2450 | Ga0501043_0276892 | |||
| 2451 | Ga0501043_0672144 | |||
| 2452 | Ga0501046_0007807 | |||
| 2453 | Ga0501046_0008573 | |||
| 2454 | Ga0501046_0087294 | |||
| 2455 | Ga0501046_0167359 | |||
| 2456 | Ga0501046_0336084 | |||
| 2457 | Ga0501046_0383796 | |||
| 2458 | Ga0501046_0579556 | |||
| 2459 | Ga0501046_0788196 | |||
| 2460 | Ga0501046_0801238 | |||
| 2461 | Ga0501047_0126429 | |||
| 2462 | Ga0501047_0196516 | |||
| 2463 | Ga0501048_0017545 | |||
| 2464 | Ga0501048_0034908 | |||
| 2465 | Ga0501048_0039370 | |||
| 2466 | Ga0501048_0044252 | |||
| 2467 | Ga0501048_0055531 | |||
| 2468 | Ga0501048_0153411 | |||
| 2469 | Ga0501048_0345539 | |||
| 2470 | Ga0501048_0401076 | |||
| 2471 | Ga0501048_1211490 | |||
| 2472 | Ga0501048_1273361 | |||
| 2473 | Ga0501067_0024919 | |||
| 2474 | Ga0501067_0032625 | |||
| 2475 | Ga0501067_0042129 | |||
| 2476 | Ga0501067_0043714 | |||
| 2477 | Ga0501067_0091319 | |||
| 2478 | Ga0501067_0131387 | |||
| 2479 | Ga0501067_0133302 | |||
| 2480 | Ga0501067_0217198 | |||
| 2481 | Ga0501067_0493225 | |||
| 2482 | Ga0501067_0559982 | |||
| 2483 | Ga0501067_0671300 | |||
| 2484 | Ga0501067_0762400 | |||
| 2485 | Ga0501067_0798129 | |||
| 2486 | Ga0501068_0005150 | |||
| 2487 | Ga0501068_0013672 | |||
| 2488 | Ga0501068_0026897 | |||
| 2489 | Ga0501068_0041966 | |||
| 2490 | Ga0501068_0132097 | |||
| 2491 | Ga0501068_0199924 | |||
| 2492 | Ga0501068_0378843 | |||
| 2493 | Ga0501068_0407945 | |||
| 2494 | Ga0501068_0521056 | |||
| 2495 | Ga0501069_0008060 | |||
| 2496 | Ga0501069_0012222 | |||
| 2497 | Ga0501069_0029632 | |||
| 2498 | Ga0501069_0041140 | |||
| 2499 | Ga0501069_0074900 | |||
| 2500 | Ga0501069_0121590 | |||
| 2501 | Ga0501069_0240185 | |||
| 2502 | Ga0501069_0458473 | |||
| 2503 | Ga0501069_0650322 | |||
| 2504 | Ga0501069_0819646 | |||
| 2505 | Ga0501070_0005450 | |||
| 2506 | Ga0501070_0024219 | |||
| 2507 | Ga0501070_0042991 | |||
| 2508 | Ga0501070_0121643 | |||
| 2509 | Ga0501070_0767947 | |||
| 2510 | Ga0501070_0916381 | |||
| 2511 | Ga0501071_0004239 | |||
| 2512 | Ga0501071_0016601 | |||
| 2513 | Ga0501071_0024934 | |||
| 2514 | Ga0501071_0044149 | |||
| 2515 | Ga0501071_0111975 | |||
| 2516 | Ga0501071_0116910 | |||
| 2517 | Ga0501071_0179963 | |||
| 2518 | Ga0501071_0211552 | |||
| 2519 | Ga0501071_0293214 | |||
| 2520 | Ga0501071_0486838 | |||
| 2521 | Ga0501071_0624281 | |||
| 2522 | Ga0501071_0787089 | |||
| 2523 | Ga0501071_0822950 | |||
| 2524 | Ga0501071_1507907 | |||
| 2525 | Ga0501072_0001651 | |||
| 2526 | Ga0501072_0005423 | |||
| 2527 | Ga0501072_0020822 | |||
| 2528 | Ga0501072_0036004 | |||
| 2529 | Ga0501072_0045724 | |||
| 2530 | Ga0501072_0055072 | |||
| 2531 | Ga0501072_0058860 | |||
| 2532 | Ga0501072_0124428 | |||
| 2533 | Ga0501072_0141336 | |||
| 2534 | Ga0501072_0278708 | |||
| 2535 | Ga0501072_0334331 | |||
| 2536 | Ga0501072_0348745 | |||
| 2537 | Ga0501072_0441587 | |||
| 2538 | Ga0501072_0549802 | |||
| 2539 | Ga0501072_0745548 | |||
| 2540 | Ga0501072_0887041 | |||
| 2541 | Ga0501073_0009378 | |||
| 2542 | Ga0501073_0012213 | |||
| 2543 | Ga0501073_0013372 | |||
| 2544 | Ga0501073_0045049 | |||
| 2545 | Ga0501073_0217281 | |||
| 2546 | Ga0501073_0362632 | |||
| 2547 | Ga0501073_0670145 | |||
| 2548 | Ga0501074_0002358 | |||
| 2549 | Ga0501074_0004166 | |||
| 2550 | Ga0501074_0023088 | |||
| 2551 | Ga0501074_0051706 | |||
| 2552 | Ga0501074_0090902 | |||
| 2553 | Ga0501074_0185834 | |||
| 2554 | Ga0501074_0222392 | |||
| 2555 | Ga0501074_0287260 | |||
| 2556 | Ga0501075_0020051 | |||
| 2557 | Ga0501075_0058875 | |||
| 2558 | Ga0501075_0071665 | |||
| 2559 | Ga0501075_0106452 | |||
| 2560 | Ga0501075_0113984 | |||
| 2561 | Ga0501075_0258925 | |||
| 2562 | Ga0501075_0278682 | |||
| 2563 | Ga0501075_0287171 | |||
| 2564 | Ga0501075_0293146 | |||
| 2565 | Ga0501075_0325920 | |||
| 2566 | Ga0501075_0548482 | |||
| 2567 | Ga0501075_0700446 | |||
| 2568 | Ga0501076_0003936 | |||
| 2569 | Ga0501076_0012716 | |||
| 2570 | Ga0501076_0058483 | |||
| 2571 | Ga0501076_0112320 | |||
| 2572 | Ga0501076_0139566 | |||
| 2573 | Ga0501076_0226924 | |||
| 2574 | Ga0501076_0267670 | |||
| 2575 | Ga0501076_0383920 | |||
| 2576 | Ga0501076_0394058 | |||
| 2577 | Ga0501076_0423574 | |||
| 2578 | Ga0501076_0650545 | |||
| 2579 | Ga0501076_1372199 | |||
| 2580 | Ga0501076_1695491 | |||
| 2581 | Ga0501076_1708753 | |||
| 2582 | Ga0501077_0001226 | |||
| 2583 | Ga0501077_0003639 | |||
| 2584 | Ga0501077_0015474 | |||
| 2585 | Ga0501077_0026652 | |||
| 2586 | Ga0501077_0042129 | |||
| 2587 | Ga0501077_0191286 | |||
| 2588 | Ga0501077_0241160 | |||
| 2589 | Ga0501077_0473322 | |||
| 2590 | Ga0501077_0480978 | |||
| 2591 | Ga0501077_0543895 | |||
| 2592 | Ga0501077_0590153 | |||
| 2593 | Ga0501077_0610053 | |||
| 2594 | Ga0501077_1078606 | |||
| 2595 | Ga0501079_0003747 | |||
| 2596 | Ga0501079_0051905 | |||
| 2597 | Ga0501079_0066665 | |||
| 2598 | Ga0501079_0082527 | |||
| 2599 | Ga0501079_0086547 | |||
| 2600 | Ga0501079_0092115 | |||
| 2601 | Ga0501079_0128587 | |||
| 2602 | Ga0501079_0195242 | |||
| 2603 | Ga0501079_0756240 | |||
| 2604 | Ga0501079_1319198 | |||
| 2605 | Ga0501079_1353700 | |||
| 2606 | Ga0501080_0013674 | |||
| 2607 | Ga0501080_0014355 | |||
| 2608 | Ga0501080_0050842 | |||
| 2609 | Ga0501080_0108758 | |||
| 2610 | Ga0501080_0172991 | |||
| 2611 | Ga0501080_0216392 | |||
| 2612 | Ga0501080_0553682 | |||
| 2613 | Ga0501081_0008544 | |||
| 2614 | Ga0501081_0016971 | |||
| 2615 | Ga0501081_0038237 | |||
| 2616 | Ga0501081_0053405 | |||
| 2617 | Ga0501081_0076239 | |||
| 2618 | Ga0501081_0094034 | |||
| 2619 | Ga0501081_0097443 | |||
| 2620 | Ga0501081_0198350 | |||
| 2621 | Ga0501081_0285514 | |||
| 2622 | Ga0501081_1190889 | |||
| 2623 | Ga0501081_1392638 | |||
| 2624 | Ga0501083_0022414 | |||
| 2625 | Ga0501083_0027169 | |||
| 2626 | Ga0501083_0036063 | |||
| 2627 | Ga0501083_0262384 | |||
| 2628 | Ga0501083_0455414 | |||
| 2629 | Ga0501083_0891601 | |||
| 2630 | Ga0501035_0016223 | |||
| 2631 | Ga0501035_0047583 | |||
| 2632 | Ga0501035_0059885 | |||
| 2633 | Ga0501035_0197842 | |||
| 2634 | Ga0501035_0542707 | |||
| 2635 | Ga0501035_1397203 | |||
| 2636 | Ga0501044_0084672 | |||
| 2637 | Ga0501044_0492730 | |||
| 2638 | Ga0501044_1102259 | |||
| 2639 | Ga0501045_0000909 | |||
| 2640 | Ga0501045_0009467 | |||
| 2641 | Ga0501045_0039307 | |||
| 2642 | Ga0501045_0042790 | |||
| 2643 | Ga0501045_0053808 | |||
| 2644 | Ga0501045_0098691 | |||
| 2645 | Ga0501045_0413681 | |||
| 2646 | Ga0501045_0630942 | |||
| 2647 | Ga0501045_0683172 | |||
| 2648 | Ga0501045_1237283 | |||
| 2649 | nmdc:mga03683_551052_c1 | |||
| 2650 | nmdc:mga03n38_17683_c1 | |||
| 2651 | nmdc:mga00v17_110322_c1 | |||
| 2652 | nmdc:mga00v17_960189_c1 | |||
| 2653 | nmdc:mga0yw44_403448_c1 | |||
| 2654 | nmdc:mga06z11_933129_c1 | |||
| 2655 | nmdc:mga05p37_100200_c1 | |||
| 2656 | nmdc:mga05p37_104041_c1 | |||
| 2657 | nmdc:mga05p37_12780_c1 | |||
| 2658 | nmdc:mga05p37_1412827_c1 | |||
| 2659 | nmdc:mga05p37_172752_c1 | |||
| 2660 | nmdc:mga05p37_2044102_c1 | |||
| 2661 | nmdc:mga05p37_266595_c1 | |||
| 2662 | nmdc:mga05p37_43366_c1 | |||
| 2663 | nmdc:mga05p37_480493_c1 | |||
| 2664 | nmdc:mga05p37_493695_c1 | |||
| 2665 | nmdc:mga05p37_62982_c1 | |||
| 2666 | nmdc:mga09592_51272_c1 | |||
| 2667 | nmdc:mga09592_543478_c1 | |||
| 2668 | nmdc:mga09592_558188_c1 | |||
| 2669 | nmdc:mga09592_574177_c1 | |||
| 2670 | nmdc:mga09592_667699_c1 | |||
| 2671 | nmdc:mga0qj67_4619_c1 | |||
| 2672 | nmdc:mga0qj67_615726_c1 | |||
| 2673 | nmdc:mga06r32_142882_c1 | |||
| 2674 | nmdc:mga06r32_149692_c1 | |||
| 2675 | nmdc:mga06r32_32885_c1 | |||
| 2676 | nmdc:mga06r32_594284_c1 | |||
| 2677 | nmdc:mga06r32_67730_c1 | |||
| 2678 | nmdc:mga08y16_104774_c1 | |||
| 2679 | nmdc:mga08y16_1396842_c1 | |||
| 2680 | nmdc:mga08y16_154884_c1 | |||
| 2681 | nmdc:mga08y16_23777_c1 | |||
| 2682 | nmdc:mga08y16_553118_c1 | |||
| 2683 | nmdc:mga08y16_86500_c1 | |||
| 2684 | nmdc:mga08y16_89841_c1 | |||
| 2685 | nmdc:mga08y16_978204_c1 | |||
| 2686 | nmdc:mga0n895_1308197_c1 | |||
| 2687 | nmdc:mga0n895_171743_c1 | |||
| 2688 | nmdc:mga0n895_246130_c1 | |||
| 2689 | nmdc:mga0n895_467662_c1 | |||
| 2690 | nmdc:mga0n895_543103_c1 | |||
| 2691 | nmdc:mga0n895_860670_c1 | |||
| 2692 | nmdc:mga0rr50_1044594_c1 | |||
| 2693 | nmdc:mga0rr50_109106_c1 | |||
| 2694 | nmdc:mga0rr50_802966_c1 | |||
| 2695 | nmdc:mga0rr50_96285_c1 | |||
| 2696 | nmdc:mga08x19_1025854_c1 | |||
| 2697 | nmdc:mga08x19_20397_c1 | |||
| 2698 | nmdc:mga0a205_360825_c1 | |||
| 2699 | nmdc:mga0a205_410423_c1 | |||
| 2700 | nmdc:mga0a205_434145_c1 | |||
| 2701 | nmdc:mga0a205_648689_c1 | |||
| 2702 | nmdc:mga0a205_814202_c1 | |||
| 2703 | nmdc:mga0a205_916989_c1 | |||
| 2704 | Ga0495612_0162607 | |||
| 2705 | Ga0495612_0182139 | |||
| 2706 | Ga0495595_0007348 | |||
| 2707 | Ga0495595_0057451 | |||
| 2708 | Ga0495619_0005609 | |||
| 2709 | Ga0495619_0052504 | |||
| 2710 | Ga0495619_0092743 | |||
| 2711 | Ga0501084_0001727 | |||
| 2712 | Ga0501084_0001938 | |||
| 2713 | Ga0501084_0010553 | |||
| 2714 | Ga0501084_0037373 | |||
| 2715 | Ga0501084_0064394 | |||
| 2716 | Ga0501084_0090175 | |||
| 2717 | Ga0501084_0092310 | |||
| 2718 | Ga0501084_0123387 | |||
| 2719 | Ga0501084_0342470 | |||
| 2720 | Ga0501084_0560275 | |||
| 2721 | Ga0501084_0573247 | |||
| 2722 | Ga0501084_0958367 | |||
| 2723 | Ga0501084_1186010 | |||
| 2724 | Ga0501084_1432745 | |||
| 2725 | Ga0587083_0222991 | |||
| 2726 | Ga0501082_0007325 | |||
| 2727 | Ga0501082_0022432 | |||
| 2728 | Ga0501082_0039044 | |||
| 2729 | Ga0501082_0117020 | |||
| 2730 | Ga0501082_0268810 | |||
| 2731 | Ga0501082_0283158 | |||
| 2732 | Ga0501082_0335404 | |||
| 2733 | Ga0501082_0382357 | |||
| 2734 | Ga0501082_0590593 | |||
| 2735 | Ga0501082_1051620 | |||
| 2736 | Ga0501082_1229887 | |||
| 2737 | Ga0501082_1329837 | |||
| 2738 | Ga0466962_0158490 | |||
| 2739 | Ga0466962_0623646 | |||
| 2740 | Ga0530510_0009521 | |||
| 2741 | Ga0530510_0032193 | |||
| 2742 | Ga0530510_0045754 | |||
| 2743 | Ga0530510_0049002 | |||
| 2744 | Ga0530510_0050575 | |||
| 2745 | Ga0530510_0099733 | |||
| 2746 | Ga0530510_0385680 | |||
| 2747 | Ga0530510_0392763 | |||
| 2748 | Ga0530510_0396617 | |||
| 2749 | Ga0530510_0517425 | |||
| 2750 | Ga0530510_0534651 | |||
| 2751 | Ga0530510_0548529 | |||
| 2752 | Ga0530510_0652251 | |||
| 2753 | Ga0530510_0866940 | |||
| 2754 | Ga0530510_1311350 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a5m-assembly1.cif.gz_B | redox regulator hypr in its oxidized form | 0.9608 | 10 | 102 |
| 4a5n-assembly2.cif.gz_D | redoxregulator hypr in its reduced form | 0.9545 | 12 | 102 |
| 2fsw-assembly1.cif.gz_A | crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 | 0.9516 | 8 | 102 |
| 7kd3-assembly1.cif.gz_A | structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 | 0.9461 | 9 | 105 |
| 7bze-assembly1.cif.gz_A-2 | structure of bacillus subtilis hxlr, k13a mutant | 0.9385 | 9 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fswA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9457 | 8 | 101 | 1.10.10.10 |
| af_P9WMG3_11_158_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.939 | 11 | 104 | 1.10.10.10 |
| 5hs9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9053 | 12 | 102 | 1.10.10.10 |
| 5hs9B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8976 | 8 | 102 | 1.10.10.10 |
| af_Q9VD25_77_142_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8941 | 21 | 82 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9KFM3-F1-model_v4 | deleted | 0.9911 | 11 | 102 |
|
| AF-A0A7Y5WYV9-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9893 | 4 | 103 |
GO:0003677
|
| AF-A0A538JJH9-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9854 | 11 | 104 |
GO:0003677
|
| AF-A0A6N7QHP6-F1-model_v4 | deleted | 0.9848 | 10 | 105 |
|
| AF-A0A841UAS2-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9847 | 10 | 102 |
GO:0003677
|