F493389
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1368 | 318 | 2736 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100002791|Ga0070680_1000027916 |
| Length | 174 |
| Sequence | MIYRIVKYLNNPILERPAESVTEFGTPELAELVESMFETMYSARGIGLAAPQIDIAKRITVIDITGGEEGHEPEKLVLINPEVIAKEGKITEEEGCLSIPGIREPVTRARKVTIRAQNTEGEWYEMDGEDLLARAFQHEIDHLNGILFVNHLSALKRDLIRRRIRKLQKAGEWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 180 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 181 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 2.19 |
| Rhizosphere | 96.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100002791 | 3300005336 | Bacteria | 12972 |
| 2 | rootH2_10053643 | 3300003320 | Bacteria | 1286 |
| 3 | rootH2_10136940 | 3300003320 | Bacteria | 1432 |
| 4 | rootH2_10159871 | 3300003320 | Bacteria | 1308 |
| 5 | Ga0070658_10019380 | 3300005327 | Bacteria | 5449 |
| 6 | Ga0070658_10053484 | 3300005327 | Bacteria | 3277 |
| 7 | Ga0070676_10034872 | 3300005328 | Bacteria | 2891 |
| 8 | Ga0070683_100001167 | 3300005329 | Bacteria | 19904 |
| 9 | Ga0070683_100002912 | 3300005329 | Bacteria | 13711 |
| 10 | Ga0070683_100008651 | 3300005329 | Bacteria | 8652 |
| 11 | Ga0070683_100083113 | 3300005329 | Bacteria | 2999 |
| 12 | Ga0070683_100289485 | 3300005329 | Unclassified | 1558 |
| 13 | Ga0070683_100524715 | 3300005329 | Bacteria | 1132 |
| 14 | Ga0070690_100057309 | 3300005330 | Bacteria | 2500 |
| 15 | Ga0070690_100502589 | 3300005330 | Unclassified | 907 |
| 16 | Ga0070670_100076836 | 3300005331 | Bacteria | 2869 |
| 17 | Ga0070670_100175601 | 3300005331 | Bacteria | 1859 |
| 18 | Ga0070670_101016912 | 3300005331 | Bacteria | 754 |
| 19 | Ga0070670_101791560 | 3300005331 | Bacteria | 565 |
| 20 | Ga0068869_100000942 | 3300005334 | Bacteria | 16836 |
| 21 | Ga0068869_100079658 | 3300005334 | Bacteria | 2441 |
| 22 | Ga0068869_100368329 | 3300005334 | Bacteria | 1175 |
| 23 | Ga0070666_10002688 | 3300005335 | Bacteria | 10728 |
| 24 | Ga0070666_10009199 | 3300005335 | Bacteria | 6158 |
| 25 | Ga0070666_10030825 | 3300005335 | Unclassified | 3536 |
| 26 | Ga0070666_10577050 | 3300005335 | Bacteria | 819 |
| 27 | Ga0070680_100089413 | 3300005336 | Bacteria | 2548 |
| 28 | Ga0070680_100290466 | 3300005336 | Bacteria | 1386 |
| 29 | Ga0070680_100881916 | 3300005336 | Unclassified | 772 |
| 30 | Ga0070682_100423091 | 3300005337 | Bacteria | 1013 |
| 31 | Ga0070682_100776895 | 3300005337 | Bacteria | 776 |
| 32 | Ga0070682_101022043 | 3300005337 | Unclassified | 687 |
| 33 | Ga0068868_100013761 | 3300005338 | Bacteria | 5944 |
| 34 | Ga0068868_100018247 | 3300005338 | Bacteria | 5242 |
| 35 | Ga0068868_100043783 | 3300005338 | Bacteria | 3497 |
| 36 | Ga0068868_100046800 | 3300005338 | Bacteria | 3386 |
| 37 | Ga0068868_100069082 | 3300005338 | Bacteria | 2815 |
| 38 | Ga0068868_100263578 | 3300005338 | Bacteria | 1454 |
| 39 | Ga0068868_100299193 | 3300005338 | Bacteria | 1366 |
| 40 | Ga0070660_100000964 | 3300005339 | Bacteria | 19258 |
| 41 | Ga0070660_100006653 | 3300005339 | Bacteria | 8018 |
| 42 | Ga0070660_100529265 | 3300005339 | Bacteria | 982 |
| 43 | Ga0070660_100596049 | 3300005339 | Unclassified | 924 |
| 44 | Ga0070689_100633242 | 3300005340 | Bacteria | 929 |
| 45 | Ga0070689_100906050 | 3300005340 | Bacteria | 780 |
| 46 | Ga0070691_10004660 | 3300005341 | Bacteria | 6236 |
| 47 | Ga0070687_100171656 | 3300005343 | Bacteria | 1291 |
| 48 | Ga0070661_100013734 | 3300005344 | Bacteria | 5689 |
| 49 | Ga0070661_100077289 | 3300005344 | Bacteria | 2454 |
| 50 | Ga0070661_100177594 | 3300005344 | Bacteria | 1619 |
| 51 | Ga0070661_100518613 | 3300005344 | Unclassified | 956 |
| 52 | Ga0070661_100531497 | 3300005344 | Unclassified | 944 |
| 53 | Ga0070668_100229617 | 3300005347 | Bacteria | 1534 |
| 54 | Ga0070669_100209189 | 3300005353 | Bacteria | 1538 |
| 55 | Ga0070671_100003769 | 3300005355 | Bacteria | 11903 |
| 56 | Ga0070671_100031352 | 3300005355 | Bacteria | 4391 |
| 57 | Ga0070674_100210053 | 3300005356 | Bacteria | 1508 |
| 58 | Ga0070673_100018718 | 3300005364 | Bacteria | 4956 |
| 59 | Ga0070673_100193511 | 3300005364 | Unclassified | 1748 |
| 60 | Ga0070688_100105636 | 3300005365 | Bacteria | 1864 |
| 61 | Ga0070667_100004496 | 3300005367 | Bacteria | 11766 |
| 62 | Ga0070667_100067516 | 3300005367 | Bacteria | 3040 |
| 63 | Ga0070667_100138801 | 3300005367 | Bacteria | 2127 |
| 64 | Ga0070667_100164146 | 3300005367 | Bacteria | 1958 |
| 65 | Ga0070667_100406939 | 3300005367 | Bacteria | 1239 |
| 66 | Ga0070709_10037194 | 3300005434 | Bacteria | 2971 |
| 67 | Ga0070709_10060853 | 3300005434 | Bacteria | 2402 |
| 68 | Ga0070709_10098663 | 3300005434 | Bacteria | 1942 |
| 69 | Ga0070709_10149426 | 3300005434 | Bacteria | 1613 |
| 70 | Ga0070709_10219933 | 3300005434 | Bacteria | 1354 |
| 71 | Ga0070714_100001316 | 3300005435 | Bacteria | 17938 |
| 72 | Ga0070714_100033191 | 3300005435 | Bacteria | 4315 |
| 73 | Ga0070714_100033743 | 3300005435 | Bacteria | 4281 |
| 74 | Ga0070714_100206698 | 3300005435 | Bacteria | 1798 |
| 75 | Ga0070713_100005133 | 3300005436 | Bacteria | 8914 |
| 76 | Ga0070713_100010293 | 3300005436 | Bacteria | 6751 |
| 77 | Ga0070713_100024734 | 3300005436 | Bacteria | 4685 |
| 78 | Ga0070713_100028339 | 3300005436 | Bacteria | 4422 |
| 79 | Ga0070713_100167635 | 3300005436 | Bacteria | 1965 |
| 80 | Ga0070713_100202402 | 3300005436 | Bacteria | 1794 |
| 81 | Ga0070713_100255553 | 3300005436 | Bacteria | 1600 |
| 82 | Ga0070713_100277842 | 3300005436 | Bacteria | 1535 |
| 83 | Ga0070713_100295859 | 3300005436 | Bacteria | 1489 |
| 84 | Ga0070713_100447142 | 3300005436 | Bacteria | 1213 |
| 85 | Ga0070713_100471936 | 3300005436 | Bacteria | 1181 |
| 86 | Ga0070713_100989574 | 3300005436 | Unclassified | 811 |
| 87 | Ga0070710_10144946 | 3300005437 | Unclassified | 1460 |
| 88 | Ga0070711_100029736 | 3300005439 | Bacteria | 3609 |
| 89 | Ga0070711_100233389 | 3300005439 | Unclassified | 1435 |
| 90 | Ga0070711_100346142 | 3300005439 | Bacteria | 1194 |
| 91 | Ga0070711_100386413 | 3300005439 | Bacteria | 1133 |
| 92 | Ga0070711_100544696 | 3300005439 | Bacteria | 962 |
| 93 | Ga0070705_100003409 | 3300005440 | Bacteria | 7794 |
| 94 | Ga0070705_100371453 | 3300005440 | Unclassified | 1050 |
| 95 | Ga0070705_101247200 | 3300005440 | Bacteria | 614 |
| 96 | Ga0070694_100325204 | 3300005444 | Bacteria | 1184 |
| 97 | Ga0070694_100681716 | 3300005444 | Bacteria | 834 |
| 98 | Ga0070708_100018727 | 3300005445 | Bacteria | 5796 |
| 99 | Ga0070708_100033475 | 3300005445 | Bacteria | 4465 |
| 100 | Ga0070708_100317356 | 3300005445 | Bacteria | 1468 |
| 101 | Ga0070663_100227775 | 3300005455 | Unclassified | 1466 |
| 102 | Ga0070663_101357914 | 3300005455 | Bacteria | 628 |
| 103 | Ga0070678_100017959 | 3300005456 | Bacteria | 4572 |
| 104 | Ga0070678_100066963 | 3300005456 | Bacteria | 2671 |
| 105 | Ga0070678_100148689 | 3300005456 | Bacteria | 1884 |
| 106 | Ga0070662_100075733 | 3300005457 | Bacteria | 2492 |
| 107 | Ga0070681_10002161 | 3300005458 | Bacteria | 17886 |
| 108 | Ga0070681_10019157 | 3300005458 | Bacteria | 6848 |
| 109 | Ga0070681_10021511 | 3300005458 | Bacteria | 6465 |
| 110 | Ga0070681_10038122 | 3300005458 | Bacteria | 4819 |
| 111 | Ga0070681_10079381 | 3300005458 | Bacteria | 3239 |
| 112 | Ga0070681_10598281 | 3300005458 | Bacteria | 1017 |
| 113 | Ga0070681_10905225 | 3300005458 | Bacteria | 801 |
| 114 | Ga0068867_100020449 | 3300005459 | Bacteria | 4718 |
| 115 | Ga0068867_100146161 | 3300005459 | Bacteria | 1853 |
| 116 | Ga0068867_101075786 | 3300005459 | Bacteria | 733 |
| 117 | Ga0070685_10509934 | 3300005466 | Bacteria | 852 |
| 118 | Ga0070706_100024650 | 3300005467 | Bacteria | 5539 |
| 119 | Ga0070706_100043943 | 3300005467 | Bacteria | 4128 |
| 120 | Ga0070707_100019652 | 3300005468 | Bacteria | 6366 |
| 121 | Ga0070707_100245014 | 3300005468 | Bacteria | 1744 |
| 122 | Ga0070707_100258567 | 3300005468 | Bacteria | 1694 |
| 123 | Ga0070707_100624856 | 3300005468 | Bacteria | 1040 |
| 124 | Ga0070707_100659271 | 3300005468 | Unclassified | 1009 |
| 125 | Ga0070707_101559869 | 3300005468 | Unclassified | 627 |
| 126 | Ga0070698_100005081 | 3300005471 | Bacteria | 14407 |
| 127 | Ga0070698_100158095 | 3300005471 | Bacteria | 2212 |
| 128 | Ga0070698_100320787 | 3300005471 | Bacteria | 1480 |
| 129 | Ga0070699_100011938 | 3300005518 | Bacteria | 7498 |
| 130 | Ga0070699_100088836 | 3300005518 | Bacteria | 2700 |
| 131 | Ga0070699_100111350 | 3300005518 | Bacteria | 2404 |
| 132 | Ga0070699_100158831 | 3300005518 | Unclassified | 2000 |
| 133 | Ga0070699_100542531 | 3300005518 | Bacteria | 1058 |
| 134 | Ga0070699_101166507 | 3300005518 | Unclassified | 707 |
| 135 | Ga0070679_100000717 | 3300005530 | Bacteria | 28561 |
| 136 | Ga0070679_100004611 | 3300005530 | Bacteria | 12725 |
| 137 | Ga0070679_100024699 | 3300005530 | Bacteria | 5888 |
| 138 | Ga0070679_100037689 | 3300005530 | Bacteria | 4804 |
| 139 | Ga0070679_100059369 | 3300005530 | Bacteria | 3813 |
| 140 | Ga0070679_100172159 | 3300005530 | Bacteria | 2138 |
| 141 | Ga0070679_100214698 | 3300005530 | Bacteria | 1886 |
| 142 | Ga0070679_100407162 | 3300005530 | Bacteria | 1306 |
| 143 | Ga0070679_100515083 | 3300005530 | Bacteria | 1140 |
| 144 | Ga0070679_100939514 | 3300005530 | Bacteria | 808 |
| 145 | Ga0070684_100005071 | 3300005535 | Bacteria | 10060 |
| 146 | Ga0070684_100007752 | 3300005535 | Bacteria | 8369 |
| 147 | Ga0070684_100028468 | 3300005535 | Bacteria | 4727 |
| 148 | Ga0070684_100030818 | 3300005535 | Bacteria | 4562 |
| 149 | Ga0070684_100034594 | 3300005535 | Bacteria | 4320 |
| 150 | Ga0070684_100064595 | 3300005535 | Bacteria | 3211 |
| 151 | Ga0070684_100167652 | 3300005535 | Bacteria | 1994 |
| 152 | Ga0070684_100241549 | 3300005535 | Bacteria | 1650 |
| 153 | Ga0070684_100331854 | 3300005535 | Bacteria | 1398 |
| 154 | Ga0070684_100442358 | 3300005535 | Bacteria | 1201 |
| 155 | Ga0070684_100456417 | 3300005535 | Bacteria | 1181 |
| 156 | Ga0070697_100000263 | 3300005536 | Bacteria | 42582 |
| 157 | Ga0070697_100002908 | 3300005536 | Bacteria | 13166 |
| 158 | Ga0070697_100962960 | 3300005536 | Unclassified | 758 |
| 159 | Ga0068853_100000944 | 3300005539 | Bacteria | 20386 |
| 160 | Ga0068853_100008112 | 3300005539 | Bacteria | 8429 |
| 161 | Ga0068853_100021062 | 3300005539 | Bacteria | 5428 |
| 162 | Ga0068853_100071549 | 3300005539 | Bacteria | 3020 |
| 163 | Ga0068853_100131788 | 3300005539 | Bacteria | 2238 |
| 164 | Ga0068853_100208734 | 3300005539 | Bacteria | 1780 |
| 165 | Ga0068853_100493543 | 3300005539 | Bacteria | 1155 |
| 166 | Ga0068853_100757857 | 3300005539 | Bacteria | 928 |
| 167 | Ga0070672_100009395 | 3300005543 | Bacteria | 6740 |
| 168 | Ga0070695_100002760 | 3300005545 | Bacteria | 10186 |
| 169 | Ga0070695_100354032 | 3300005545 | Bacteria | 1101 |
| 170 | Ga0070695_100699183 | 3300005545 | Bacteria | 805 |
| 171 | Ga0070696_100002545 | 3300005546 | Bacteria | 12085 |
| 172 | Ga0070696_100147831 | 3300005546 | Bacteria | 1722 |
| 173 | Ga0070693_100000019 | 3300005547 | Bacteria | 60801 |
| 174 | Ga0070693_100017961 | 3300005547 | Bacteria | 3687 |
| 175 | Ga0070693_100504600 | 3300005547 | Bacteria | 859 |
| 176 | Ga0070665_100000462 | 3300005548 | Bacteria | 59040 |
| 177 | Ga0070665_100013679 | 3300005548 | Bacteria | 8165 |
| 178 | Ga0070665_100029122 | 3300005548 | Bacteria | 5557 |
| 179 | Ga0070665_100133650 | 3300005548 | Bacteria | 2483 |
| 180 | Ga0070665_101525718 | 3300005548 | Bacteria | 676 |
| 181 | Ga0070665_101590747 | 3300005548 | Bacteria | 661 |
| 182 | Ga0070704_100016339 | 3300005549 | Bacteria | 4687 |
| 183 | Ga0068855_100000623 | 3300005563 | Bacteria | 43575 |
| 184 | Ga0068855_100000881 | 3300005563 | Bacteria | 37216 |
| 185 | Ga0068855_100003034 | 3300005563 | Bacteria | 20553 |
| 186 | Ga0068855_100003302 | 3300005563 | Bacteria | 19746 |
| 187 | Ga0068855_100012148 | 3300005563 | Bacteria | 10405 |
| 188 | Ga0068855_100014232 | 3300005563 | Bacteria | 9583 |
| 189 | Ga0068855_100016829 | 3300005563 | Bacteria | 8794 |
| 190 | Ga0068855_100018146 | 3300005563 | Bacteria | 8454 |
| 191 | Ga0068855_100039853 | 3300005563 | Bacteria | 5576 |
| 192 | Ga0068855_100051393 | 3300005563 | Bacteria | 4855 |
| 193 | Ga0068855_100309955 | 3300005563 | Bacteria | 1747 |
| 194 | Ga0068855_100313375 | 3300005563 | Bacteria | 1735 |
| 195 | Ga0068855_100548416 | 3300005563 | Bacteria | 1252 |
| 196 | Ga0070664_100100786 | 3300005564 | Bacteria | 2511 |
| 197 | Ga0070664_100145461 | 3300005564 | Bacteria | 2090 |
| 198 | Ga0070664_100168669 | 3300005564 | Bacteria | 1941 |
| 199 | Ga0070664_100335160 | 3300005564 | Bacteria | 1373 |
| 200 | Ga0070664_100364621 | 3300005564 | Bacteria | 1316 |
| 201 | Ga0070664_100813239 | 3300005564 | Bacteria | 874 |
| 202 | Ga0070664_101182300 | 3300005564 | Bacteria | 721 |
| 203 | Ga0068857_100017037 | 3300005577 | Bacteria | 6364 |
| 204 | Ga0068857_100021936 | 3300005577 | Bacteria | 5621 |
| 205 | Ga0068857_100022792 | 3300005577 | Bacteria | 5509 |
| 206 | Ga0068857_100025040 | 3300005577 | Bacteria | 5256 |
| 207 | Ga0068857_100044277 | 3300005577 | Bacteria | 3948 |
| 208 | Ga0068857_100053450 | 3300005577 | Bacteria | 3583 |
| 209 | Ga0068857_100111085 | 3300005577 | Bacteria | 2464 |
| 210 | Ga0068857_100111674 | 3300005577 | Bacteria | 2457 |
| 211 | Ga0068857_100209563 | 3300005577 | Bacteria | 1778 |
| 212 | Ga0068857_101302338 | 3300005577 | Bacteria | 705 |
| 213 | Ga0068854_100038491 | 3300005578 | Bacteria | 3364 |
| 214 | Ga0068854_100064472 | 3300005578 | Bacteria | 2662 |
| 215 | Ga0068854_100069176 | 3300005578 | Bacteria | 2576 |
| 216 | Ga0068854_100690831 | 3300005578 | Bacteria | 880 |
| 217 | Ga0068854_101454843 | 3300005578 | Bacteria | 621 |
| 218 | Ga0068856_100001516 | 3300005614 | Bacteria | 24367 |
| 219 | Ga0068856_100005713 | 3300005614 | Bacteria | 12251 |
| 220 | Ga0068856_100014367 | 3300005614 | Bacteria | 7654 |
| 221 | Ga0068856_100025657 | 3300005614 | Bacteria | 5747 |
| 222 | Ga0068856_100027890 | 3300005614 | Bacteria | 5508 |
| 223 | Ga0068856_100068514 | 3300005614 | Bacteria | 3508 |
| 224 | Ga0068856_100105509 | 3300005614 | Bacteria | 2812 |
| 225 | Ga0068856_100137875 | 3300005614 | Bacteria | 2446 |
| 226 | Ga0068856_100230190 | 3300005614 | Bacteria | 1869 |
| 227 | Ga0068856_100236337 | 3300005614 | Bacteria | 1843 |
| 228 | Ga0068856_100272778 | 3300005614 | Bacteria | 1708 |
| 229 | Ga0068856_100334001 | 3300005614 | Bacteria | 1533 |
| 230 | Ga0068856_100424855 | 3300005614 | Bacteria | 1349 |
| 231 | Ga0068856_100569240 | 3300005614 | Bacteria | 1154 |
| 232 | Ga0068856_100589450 | 3300005614 | Bacteria | 1133 |
| 233 | Ga0068856_101353748 | 3300005614 | Bacteria | 727 |
| 234 | Ga0070702_100494083 | 3300005615 | Bacteria | 897 |
| 235 | Ga0068852_100000049 | 3300005616 | Bacteria | 86882 |
| 236 | Ga0068852_100000095 | 3300005616 | Bacteria | 59631 |
| 237 | Ga0068852_100001588 | 3300005616 | Bacteria | 15454 |
| 238 | Ga0068852_100072304 | 3300005616 | Unclassified | 3031 |
| 239 | Ga0068852_100085203 | 3300005616 | Bacteria | 2814 |
| 240 | Ga0068852_100132326 | 3300005616 | Bacteria | 2298 |
| 241 | Ga0068852_100135084 | 3300005616 | Bacteria | 2277 |
| 242 | Ga0068852_100282096 | 3300005616 | Bacteria | 1602 |
| 243 | Ga0068852_100356742 | 3300005616 | Bacteria | 1429 |
| 244 | Ga0068852_100419687 | 3300005616 | Unclassified | 1319 |
| 245 | Ga0068852_100561054 | 3300005616 | Bacteria | 1143 |
| 246 | Ga0068852_100663889 | 3300005616 | Bacteria | 1051 |
| 247 | Ga0068859_100010731 | 3300005617 | Bacteria | 9219 |
| 248 | Ga0068859_100076870 | 3300005617 | Bacteria | 3379 |
| 249 | Ga0068859_100087987 | 3300005617 | Bacteria | 3155 |
| 250 | Ga0068859_100154705 | 3300005617 | Bacteria | 2370 |
| 251 | Ga0068859_100563875 | 3300005617 | Bacteria | 1233 |
| 252 | Ga0068859_101330067 | 3300005617 | Unclassified | 792 |
| 253 | Ga0068864_100067962 | 3300005618 | Bacteria | 3095 |
| 254 | Ga0068864_100174155 | 3300005618 | Bacteria | 1963 |
| 255 | Ga0068864_100321593 | 3300005618 | Bacteria | 1453 |
| 256 | Ga0068864_100545486 | 3300005618 | Bacteria | 1120 |
| 257 | Ga0068864_100569611 | 3300005618 | Unclassified | 1096 |
| 258 | Ga0068851_10003156 | 3300005834 | Bacteria | 7310 |
| 259 | Ga0068851_10007873 | 3300005834 | Bacteria | 4905 |
| 260 | Ga0068851_10019714 | 3300005834 | Bacteria | 3260 |
| 261 | Ga0068851_10185900 | 3300005834 | Bacteria | 1153 |
| 262 | Ga0068851_10403132 | 3300005834 | Bacteria | 805 |
| 263 | Ga0068863_100001861 | 3300005841 | Bacteria | 20976 |
| 264 | Ga0068863_100002734 | 3300005841 | Bacteria | 17441 |
| 265 | Ga0068863_100013281 | 3300005841 | Bacteria | 7947 |
| 266 | Ga0068863_100038542 | 3300005841 | Unclassified | 4547 |
| 267 | Ga0068863_100074220 | 3300005841 | Bacteria | 3218 |
| 268 | Ga0068863_100109556 | 3300005841 | Bacteria | 2629 |
| 269 | Ga0068863_100321056 | 3300005841 | Bacteria | 1504 |
| 270 | Ga0068863_100342390 | 3300005841 | Bacteria | 1455 |
| 271 | Ga0068858_100000841 | 3300005842 | Bacteria | 31803 |
| 272 | Ga0068858_100020811 | 3300005842 | Bacteria | 6132 |
| 273 | Ga0068858_100043484 | 3300005842 | Bacteria | 4165 |
| 274 | Ga0068858_100405203 | 3300005842 | Bacteria | 1311 |
| 275 | Ga0068858_100659821 | 3300005842 | Bacteria | 1017 |
| 276 | Ga0068860_100001780 | 3300005843 | Bacteria | 22937 |
| 277 | Ga0068860_100030529 | 3300005843 | Bacteria | 5183 |
| 278 | Ga0068860_100045391 | 3300005843 | Bacteria | 4190 |
| 279 | Ga0068860_100227633 | 3300005843 | Bacteria | 1811 |
| 280 | Ga0068860_100429416 | 3300005843 | Bacteria | 1311 |
| 281 | Ga0068860_100915634 | 3300005843 | Bacteria | 893 |
| 282 | Ga0068862_100021633 | 3300005844 | Bacteria | 5377 |
| 283 | Ga0081540_1117804 | 3300005983 | Bacteria | 1109 |
| 284 | Ga0070717_10002283 | 3300006028 | Bacteria | 13442 |
| 285 | Ga0070717_10005514 | 3300006028 | Bacteria | 9235 |
| 286 | Ga0070717_10011465 | 3300006028 | Bacteria | 6734 |
| 287 | Ga0070717_10073027 | 3300006028 | Bacteria | 2866 |
| 288 | Ga0070717_10176352 | 3300006028 | Bacteria | 1861 |
| 289 | Ga0070717_10613410 | 3300006028 | Bacteria | 987 |
| 290 | Ga0070715_10008583 | 3300006163 | Bacteria | 3565 |
| 291 | Ga0070715_10062105 | 3300006163 | Bacteria | 1642 |
| 292 | Ga0070715_10178689 | 3300006163 | Unclassified | 1063 |
| 293 | Ga0070715_10337399 | 3300006163 | Bacteria | 819 |
| 294 | Ga0070715_10635841 | 3300006163 | Bacteria | 630 |
| 295 | Ga0070716_100001038 | 3300006173 | Bacteria | 12171 |
| 296 | Ga0070716_100013740 | 3300006173 | Bacteria | 4134 |
| 297 | Ga0070716_100078419 | 3300006173 | Bacteria | 1964 |
| 298 | Ga0070716_100530411 | 3300006173 | Bacteria | 874 |
| 299 | Ga0070712_100034335 | 3300006175 | Bacteria | 3437 |
| 300 | Ga0070712_100042614 | 3300006175 | Bacteria | 3122 |
| 301 | Ga0070712_100097671 | 3300006175 | Unclassified | 2165 |
| 302 | Ga0070712_100265432 | 3300006175 | Bacteria | 1377 |
| 303 | Ga0097621_100035301 | 3300006237 | Bacteria | 3995 |
| 304 | Ga0097621_100057496 | 3300006237 | Bacteria | 3181 |
| 305 | Ga0097621_100058819 | 3300006237 | Bacteria | 3145 |
| 306 | Ga0097621_100073085 | 3300006237 | Bacteria | 2838 |
| 307 | Ga0097621_100092443 | 3300006237 | Bacteria | 2534 |
| 308 | Ga0097621_100103991 | 3300006237 | Bacteria | 2392 |
| 309 | Ga0097621_100160140 | 3300006237 | Unclassified | 1934 |
| 310 | Ga0097621_100205394 | 3300006237 | Bacteria | 1712 |
| 311 | Ga0097621_100318938 | 3300006237 | Bacteria | 1376 |
| 312 | Ga0097621_100361780 | 3300006237 | Bacteria | 1293 |
| 313 | Ga0097621_100379108 | 3300006237 | Bacteria | 1263 |
| 314 | Ga0097621_100404149 | 3300006237 | Bacteria | 1223 |
| 315 | Ga0097621_100454023 | 3300006237 | Bacteria | 1155 |
| 316 | Ga0097621_100638933 | 3300006237 | Bacteria | 976 |
| 317 | Ga0097621_101068484 | 3300006237 | Unclassified | 757 |
| 318 | Ga0068871_100005207 | 3300006358 | Bacteria | 9092 |
| 319 | Ga0068871_100028148 | 3300006358 | Bacteria | 4403 |
| 320 | Ga0068871_100029558 | 3300006358 | Unclassified | 4305 |
| 321 | Ga0068871_100042290 | 3300006358 | Bacteria | 3657 |
| 322 | Ga0068871_100066082 | 3300006358 | Bacteria | 2964 |
| 323 | Ga0068871_100074706 | 3300006358 | Bacteria | 2797 |
| 324 | Ga0068871_100235591 | 3300006358 | Bacteria | 1590 |
| 325 | Ga0068871_100241901 | 3300006358 | Bacteria | 1569 |
| 326 | Ga0068871_100351006 | 3300006358 | Bacteria | 1305 |
| 327 | Ga0068871_100362797 | 3300006358 | Bacteria | 1283 |
| 328 | Ga0068871_100925860 | 3300006358 | Unclassified | 809 |
| 329 | Ga0075433_10087365 | 3300006852 | Bacteria | 2754 |
| 330 | Ga0075434_100049162 | 3300006871 | Bacteria | 4186 |
| 331 | Ga0075434_100073522 | 3300006871 | Bacteria | 3411 |
| 332 | Ga0068865_100064219 | 3300006881 | Bacteria | 2583 |
| 333 | Ga0075436_100000559 | 3300006914 | Bacteria | 24291 |
| 334 | Ga0075436_100012467 | 3300006914 | Bacteria | 5825 |
| 335 | Ga0075436_100019468 | 3300006914 | Bacteria | 4652 |
| 336 | Ga0075436_100110523 | 3300006914 | Bacteria | 1918 |
| 337 | Ga0097620_100010731 | 3300006931 | Bacteria | 9219 |
| 338 | Ga0097620_100076873 | 3300006931 | Bacteria | 3379 |
| 339 | Ga0097620_100087983 | 3300006931 | Bacteria | 3155 |
| 340 | Ga0097620_100154702 | 3300006931 | Bacteria | 2370 |
| 341 | Ga0097620_100563863 | 3300006931 | Bacteria | 1233 |
| 342 | Ga0097620_101330252 | 3300006931 | Unclassified | 792 |
| 343 | Ga0075435_100139853 | 3300007076 | Bacteria | 2031 |
| 344 | Ga0075435_100544134 | 3300007076 | Bacteria | 1005 |
| 345 | Ga0099794_10008896 | 3300007265 | Bacteria | 4185 |
| 346 | Ga0099794_10018002 | 3300007265 | Bacteria | 3160 |
| 347 | Ga0099794_10047024 | 3300007265 | Bacteria | 2068 |
| 348 | Ga0099794_10052137 | 3300007265 | Bacteria | 1972 |
| 349 | Ga0099794_10101377 | 3300007265 | Bacteria | 1437 |
| 350 | Ga0099794_10188614 | 3300007265 | Unclassified | 1054 |
| 351 | Ga0099794_10199598 | 3300007265 | Unclassified | 1024 |
| 352 | Ga0099794_10255239 | 3300007265 | Unclassified | 904 |
| 353 | Ga0099794_10310098 | 3300007265 | Bacteria | 818 |
| 354 | Ga0099794_10351365 | 3300007265 | Bacteria | 767 |
| 355 | Ga0099794_10452395 | 3300007265 | Bacteria | 673 |
| 356 | Ga0099795_10006652 | 3300007788 | Bacteria | 3169 |
| 357 | Ga0099795_10201743 | 3300007788 | Bacteria | 839 |
| 358 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 359 | Ga0105240_10000839 | 3300009093 | Bacteria | 55340 |
| 360 | Ga0105240_10000904 | 3300009093 | Bacteria | 53010 |
| 361 | Ga0105240_10001150 | 3300009093 | Bacteria | 46310 |
| 362 | Ga0105240_10001167 | 3300009093 | Bacteria | 46058 |
| 363 | Ga0105240_10001456 | 3300009093 | Bacteria | 40471 |
| 364 | Ga0105240_10003229 | 3300009093 | Bacteria | 25527 |
| 365 | Ga0105240_10004689 | 3300009093 | Bacteria | 20669 |
| 366 | Ga0105240_10005098 | 3300009093 | Bacteria | 19683 |
| 367 | Ga0105240_10006651 | 3300009093 | Bacteria | 16964 |
| 368 | Ga0105240_10007154 | 3300009093 | Bacteria | 16258 |
| 369 | Ga0105240_10029233 | 3300009093 | Bacteria | 7185 |
| 370 | Ga0105240_10099435 | 3300009093 | Bacteria | 3540 |
| 371 | Ga0105240_10114317 | 3300009093 | Bacteria | 3261 |
| 372 | Ga0105240_10154906 | 3300009093 | Bacteria | 2726 |
| 373 | Ga0105240_10174958 | 3300009093 | Bacteria | 2538 |
| 374 | Ga0105240_10203660 | 3300009093 | Bacteria | 2317 |
| 375 | Ga0105240_10238967 | 3300009093 | Bacteria | 2107 |
| 376 | Ga0105240_10240351 | 3300009093 | Bacteria | 2100 |
| 377 | Ga0105240_10256960 | 3300009093 | Bacteria | 2017 |
| 378 | Ga0105240_10580644 | 3300009093 | Bacteria | 1236 |
| 379 | Ga0105240_10588221 | 3300009093 | Bacteria | 1227 |
| 380 | Ga0105240_10652870 | 3300009093 | Bacteria | 1153 |
| 381 | Ga0105240_11253303 | 3300009093 | Bacteria | 783 |
| 382 | Ga0105240_11711543 | 3300009093 | Bacteria | 656 |
| 383 | Ga0105245_10002156 | 3300009098 | Bacteria | 17826 |
| 384 | Ga0105245_10009911 | 3300009098 | Bacteria | 8298 |
| 385 | Ga0105245_10012128 | 3300009098 | Bacteria | 7494 |
| 386 | Ga0105245_10019044 | 3300009098 | Bacteria | 6008 |
| 387 | Ga0105245_10028926 | 3300009098 | Bacteria | 4892 |
| 388 | Ga0105245_10036183 | 3300009098 | Bacteria | 4384 |
| 389 | Ga0105245_10072027 | 3300009098 | Bacteria | 3139 |
| 390 | Ga0105245_10127612 | 3300009098 | Bacteria | 2383 |
| 391 | Ga0105245_10205987 | 3300009098 | Bacteria | 1891 |
| 392 | Ga0105245_10378823 | 3300009098 | Bacteria | 1409 |
| 393 | Ga0105245_10907997 | 3300009098 | Bacteria | 922 |
| 394 | Ga0105245_11001472 | 3300009098 | Bacteria | 880 |
| 395 | Ga0105247_10009974 | 3300009101 | Bacteria | 5752 |
| 396 | Ga0105247_10030120 | 3300009101 | Bacteria | 3290 |
| 397 | Ga0105247_10104596 | 3300009101 | Bacteria | 1814 |
| 398 | Ga0105247_10363699 | 3300009101 | Bacteria | 1021 |
| 399 | Ga0105247_10597619 | 3300009101 | Bacteria | 818 |
| 400 | Ga0105247_10695124 | 3300009101 | Bacteria | 765 |
| 401 | Ga0114129_11987220 | 3300009147 | Bacteria | 703 |
| 402 | Ga0105243_10056567 | 3300009148 | Bacteria | 3120 |
| 403 | Ga0105243_10134055 | 3300009148 | Bacteria | 2105 |
| 404 | Ga0105243_10222771 | 3300009148 | Unclassified | 1668 |
| 405 | Ga0105243_10224694 | 3300009148 | Bacteria | 1662 |
| 406 | Ga0105243_10588120 | 3300009148 | Bacteria | 1069 |
| 407 | Ga0105241_10000014 | 3300009174 | Bacteria | 171306 |
| 408 | Ga0105241_10004691 | 3300009174 | Bacteria | 10092 |
| 409 | Ga0105241_10005338 | 3300009174 | Bacteria | 9494 |
| 410 | Ga0105241_10007806 | 3300009174 | Bacteria | 7867 |
| 411 | Ga0105241_10009235 | 3300009174 | Bacteria | 7252 |
| 412 | Ga0105241_10019492 | 3300009174 | Bacteria | 5002 |
| 413 | Ga0105241_10057417 | 3300009174 | Bacteria | 2986 |
| 414 | Ga0105241_10058284 | 3300009174 | Bacteria | 2966 |
| 415 | Ga0105241_10082039 | 3300009174 | Bacteria | 2527 |
| 416 | Ga0105241_10107535 | 3300009174 | Bacteria | 2228 |
| 417 | Ga0105241_10119461 | 3300009174 | Bacteria | 2120 |
| 418 | Ga0105241_10225789 | 3300009174 | Bacteria | 1576 |
| 419 | Ga0105241_10335764 | 3300009174 | Unclassified | 1308 |
| 420 | Ga0105241_10469447 | 3300009174 | Bacteria | 1116 |
| 421 | Ga0105241_10643576 | 3300009174 | Unclassified | 962 |
| 422 | Ga0105241_10740925 | 3300009174 | Bacteria | 900 |
| 423 | Ga0105241_10893930 | 3300009174 | Unclassified | 824 |
| 424 | Ga0105242_10011241 | 3300009176 | Bacteria | 6881 |
| 425 | Ga0105242_10035741 | 3300009176 | Bacteria | 3984 |
| 426 | Ga0105242_10107437 | 3300009176 | Unclassified | 2373 |
| 427 | Ga0105242_10112272 | 3300009176 | Bacteria | 2325 |
| 428 | Ga0105242_10112723 | 3300009176 | Bacteria | 2321 |
| 429 | Ga0105242_10113453 | 3300009176 | Bacteria | 2314 |
| 430 | Ga0105242_10256249 | 3300009176 | Bacteria | 1578 |
| 431 | Ga0105242_10317198 | 3300009176 | Bacteria | 1428 |
| 432 | Ga0105242_10424834 | 3300009176 | Bacteria | 1246 |
| 433 | Ga0105242_10552998 | 3300009176 | Bacteria | 1104 |
| 434 | Ga0105242_10613814 | 3300009176 | Bacteria | 1052 |
| 435 | Ga0105242_10940387 | 3300009176 | Bacteria | 868 |
| 436 | Ga0105242_11368688 | 3300009176 | Unclassified | 734 |
| 437 | Ga0105248_10004322 | 3300009177 | Bacteria | 15718 |
| 438 | Ga0105248_10023504 | 3300009177 | Bacteria | 6846 |
| 439 | Ga0105248_10036438 | 3300009177 | Bacteria | 5501 |
| 440 | Ga0105248_10059800 | 3300009177 | Bacteria | 4280 |
| 441 | Ga0105248_10080095 | 3300009177 | Bacteria | 3670 |
| 442 | Ga0105248_10117786 | 3300009177 | Bacteria | 2996 |
| 443 | Ga0105248_10160799 | 3300009177 | Bacteria | 2533 |
| 444 | Ga0105248_10445357 | 3300009177 | Bacteria | 1459 |
| 445 | Ga0105248_10589521 | 3300009177 | Unclassified | 1254 |
| 446 | Ga0105248_10633792 | 3300009177 | Bacteria | 1206 |
| 447 | Ga0105248_10764333 | 3300009177 | Bacteria | 1090 |
| 448 | Ga0105248_11075935 | 3300009177 | Bacteria | 909 |
| 449 | Ga0105237_10003893 | 3300009545 | Bacteria | 17520 |
| 450 | Ga0105237_10007736 | 3300009545 | Bacteria | 11734 |
| 451 | Ga0105237_10010226 | 3300009545 | Bacteria | 9998 |
| 452 | Ga0105237_10023341 | 3300009545 | Bacteria | 6339 |
| 453 | Ga0105237_10029243 | 3300009545 | Bacteria | 5605 |
| 454 | Ga0105237_10092676 | 3300009545 | Bacteria | 3011 |
| 455 | Ga0105237_10122584 | 3300009545 | Bacteria | 2593 |
| 456 | Ga0105237_10265275 | 3300009545 | Bacteria | 1720 |
| 457 | Ga0105237_10628732 | 3300009545 | Bacteria | 1080 |
| 458 | Ga0105237_10742186 | 3300009545 | Bacteria | 988 |
| 459 | Ga0105237_11692647 | 3300009545 | Bacteria | 640 |
| 460 | Ga0105238_10000658 | 3300009551 | Bacteria | 36203 |
| 461 | Ga0105238_10001077 | 3300009551 | Bacteria | 27578 |
| 462 | Ga0105238_10003880 | 3300009551 | Bacteria | 14842 |
| 463 | Ga0105238_10009399 | 3300009551 | Bacteria | 9787 |
| 464 | Ga0105238_10009529 | 3300009551 | Bacteria | 9720 |
| 465 | Ga0105238_10024560 | 3300009551 | Bacteria | 6143 |
| 466 | Ga0105238_10025711 | 3300009551 | Bacteria | 6003 |
| 467 | Ga0105238_10032757 | 3300009551 | Bacteria | 5290 |
| 468 | Ga0105238_10038804 | 3300009551 | Bacteria | 4836 |
| 469 | Ga0105238_10071939 | 3300009551 | Bacteria | 3455 |
| 470 | Ga0105238_10258961 | 3300009551 | Bacteria | 1719 |
| 471 | Ga0105238_11202481 | 3300009551 | Bacteria | 782 |
| 472 | Ga0105238_11647251 | 3300009551 | Bacteria | 672 |
| 473 | Ga0105249_10009429 | 3300009553 | Bacteria | 8544 |
| 474 | Ga0105249_10051778 | 3300009553 | Bacteria | 3747 |
| 475 | Ga0105249_10076853 | 3300009553 | Bacteria | 3095 |
| 476 | Ga0105249_10704935 | 3300009553 | Bacteria | 1070 |
| 477 | Ga0099796_10004116 | 3300010159 | Bacteria | 3477 |
| 478 | Ga0105239_10002219 | 3300010375 | Bacteria | 24922 |
| 479 | Ga0105239_10006418 | 3300010375 | Bacteria | 13650 |
| 480 | Ga0105239_10007915 | 3300010375 | Bacteria | 12152 |
| 481 | Ga0105239_10010547 | 3300010375 | Bacteria | 10332 |
| 482 | Ga0105239_10013129 | 3300010375 | Bacteria | 9204 |
| 483 | Ga0105239_10017993 | 3300010375 | Bacteria | 7814 |
| 484 | Ga0105239_10076896 | 3300010375 | Bacteria | 3672 |
| 485 | Ga0105239_10123673 | 3300010375 | Bacteria | 2874 |
| 486 | Ga0105239_10154445 | 3300010375 | Unclassified | 2562 |
| 487 | Ga0105239_10205403 | 3300010375 | Bacteria | 2208 |
| 488 | Ga0105239_10210253 | 3300010375 | Bacteria | 2181 |
| 489 | Ga0105246_10001710 | 3300011119 | Bacteria | 13105 |
| 490 | Ga0105246_10004304 | 3300011119 | Bacteria | 8660 |
| 491 | Ga0105246_10146269 | 3300011119 | Bacteria | 1783 |
| 492 | Ga0105246_10662824 | 3300011119 | Unclassified | 910 |
| 493 | Ga0157373_10064781 | 3300013100 | Bacteria | 2587 |
| 494 | Ga0157373_10846679 | 3300013100 | Bacteria | 676 |
| 495 | Ga0157373_10896115 | 3300013100 | Bacteria | 658 |
| 496 | Ga0157371_10314099 | 3300013102 | Bacteria | 1136 |
| 497 | Ga0157371_10373274 | 3300013102 | Bacteria | 1041 |
| 498 | Ga0157371_10451024 | 3300013102 | Bacteria | 946 |
| 499 | Ga0157370_10000005 | 3300013104 | Bacteria | 288514 |
| 500 | Ga0157370_10002893 | 3300013104 | Bacteria | 20474 |
| 501 | Ga0157370_10003670 | 3300013104 | Bacteria | 17924 |
| 502 | Ga0157370_10004975 | 3300013104 | Bacteria | 15044 |
| 503 | Ga0157370_10035401 | 3300013104 | Bacteria | 4853 |
| 504 | Ga0157370_10074183 | 3300013104 | Bacteria | 3209 |
| 505 | Ga0157370_10121051 | 3300013104 | Bacteria | 2443 |
| 506 | Ga0157370_10551093 | 3300013104 | Unclassified | 1057 |
| 507 | Ga0157370_10768674 | 3300013104 | Bacteria | 877 |
| 508 | Ga0157370_11128978 | 3300013104 | Bacteria | 708 |
| 509 | Ga0157369_10000266 | 3300013105 | Bacteria | 70735 |
| 510 | Ga0157369_10003469 | 3300013105 | Bacteria | 18709 |
| 511 | Ga0157369_10003568 | 3300013105 | Bacteria | 18484 |
| 512 | Ga0157369_10018391 | 3300013105 | Bacteria | 7835 |
| 513 | Ga0157369_10027298 | 3300013105 | Bacteria | 6330 |
| 514 | Ga0157369_10028160 | 3300013105 | Bacteria | 6219 |
| 515 | Ga0157369_10030376 | 3300013105 | Bacteria | 5959 |
| 516 | Ga0157369_10034284 | 3300013105 | Bacteria | 5572 |
| 517 | Ga0157369_10039645 | 3300013105 | Bacteria | 5147 |
| 518 | Ga0157369_10079146 | 3300013105 | Bacteria | 3521 |
| 519 | Ga0157369_10101391 | 3300013105 | Bacteria | 3067 |
| 520 | Ga0157369_10139154 | 3300013105 | Bacteria | 2569 |
| 521 | Ga0157369_10201143 | 3300013105 | Bacteria | 2091 |
| 522 | Ga0157369_10220341 | 3300013105 | Bacteria | 1986 |
| 523 | Ga0157369_10242034 | 3300013105 | Unclassified | 1884 |
| 524 | Ga0157369_10285702 | 3300013105 | Bacteria | 1718 |
| 525 | Ga0157369_10288127 | 3300013105 | Bacteria | 1710 |
| 526 | Ga0157369_10498646 | 3300013105 | Bacteria | 1260 |
| 527 | Ga0157374_10002719 | 3300013296 | Bacteria | 14857 |
| 528 | Ga0157374_10002942 | 3300013296 | Bacteria | 14272 |
| 529 | Ga0157374_10003429 | 3300013296 | Bacteria | 13323 |
| 530 | Ga0157374_10072850 | 3300013296 | Unclassified | 3242 |
| 531 | Ga0157374_10109021 | 3300013296 | Bacteria | 2662 |
| 532 | Ga0157374_10131929 | 3300013296 | Bacteria | 2418 |
| 533 | Ga0157374_10139231 | 3300013296 | Bacteria | 2355 |
| 534 | Ga0157374_10208387 | 3300013296 | Bacteria | 1916 |
| 535 | Ga0157374_10311589 | 3300013296 | Unclassified | 1558 |
| 536 | Ga0157374_10497724 | 3300013296 | Bacteria | 1223 |
| 537 | Ga0157374_10676973 | 3300013296 | Bacteria | 1044 |
| 538 | Ga0157374_10857486 | 3300013296 | Unclassified | 925 |
| 539 | Ga0157374_10942614 | 3300013296 | Bacteria | 882 |
| 540 | Ga0157374_11474199 | 3300013296 | Bacteria | 704 |
| 541 | Ga0157374_11860916 | 3300013296 | Bacteria | 627 |
| 542 | Ga0157378_10000316 | 3300013297 | Bacteria | 47349 |
| 543 | Ga0157378_10009939 | 3300013297 | Bacteria | 8296 |
| 544 | Ga0157378_10017618 | 3300013297 | Bacteria | 6271 |
| 545 | Ga0157378_10045935 | 3300013297 | Bacteria | 3882 |
| 546 | Ga0157378_10124410 | 3300013297 | Bacteria | 2381 |
| 547 | Ga0157378_10210903 | 3300013297 | Bacteria | 1842 |
| 548 | Ga0157378_10510080 | 3300013297 | Bacteria | 1203 |
| 549 | Ga0157378_10561282 | 3300013297 | Unclassified | 1148 |
| 550 | Ga0157378_10590058 | 3300013297 | Bacteria | 1121 |
| 551 | Ga0157378_10596771 | 3300013297 | Bacteria | 1115 |
| 552 | Ga0157378_10792232 | 3300013297 | Unclassified | 973 |
| 553 | Ga0157378_10803673 | 3300013297 | Bacteria | 966 |
| 554 | Ga0157378_10809115 | 3300013297 | Bacteria | 963 |
| 555 | Ga0157378_10854551 | 3300013297 | Bacteria | 938 |
| 556 | Ga0163162_10004608 | 3300013306 | Bacteria | 13286 |
| 557 | Ga0163162_10017631 | 3300013306 | Bacteria | 6985 |
| 558 | Ga0163162_10020819 | 3300013306 | Bacteria | 6448 |
| 559 | Ga0163162_10042380 | 3300013306 | Bacteria | 4556 |
| 560 | Ga0163162_10427055 | 3300013306 | Unclassified | 1457 |
| 561 | Ga0163162_10437004 | 3300013306 | Bacteria | 1441 |
| 562 | Ga0163162_10480415 | 3300013306 | Bacteria | 1374 |
| 563 | Ga0163162_10689098 | 3300013306 | Bacteria | 1144 |
| 564 | Ga0163162_11706160 | 3300013306 | Bacteria | 719 |
| 565 | Ga0163162_12110012 | 3300013306 | Bacteria | 646 |
| 566 | Ga0157372_10000755 | 3300013307 | Bacteria | 35052 |
| 567 | Ga0157372_10002651 | 3300013307 | Bacteria | 19391 |
| 568 | Ga0157372_10005248 | 3300013307 | Bacteria | 13762 |
| 569 | Ga0157372_10009747 | 3300013307 | Bacteria | 10216 |
| 570 | Ga0157372_10013164 | 3300013307 | Bacteria | 8826 |
| 571 | Ga0157372_10016918 | 3300013307 | Bacteria | 7829 |
| 572 | Ga0157372_10025746 | 3300013307 | Bacteria | 6400 |
| 573 | Ga0157372_10041998 | 3300013307 | Bacteria | 5056 |
| 574 | Ga0157372_10055961 | 3300013307 | Bacteria | 4407 |
| 575 | Ga0157372_10056203 | 3300013307 | Bacteria | 4397 |
| 576 | Ga0157372_10118521 | 3300013307 | Bacteria | 3038 |
| 577 | Ga0157372_10136260 | 3300013307 | Bacteria | 2827 |
| 578 | Ga0157372_10474625 | 3300013307 | Bacteria | 1458 |
| 579 | Ga0157372_10606817 | 3300013307 | Unclassified | 1276 |
| 580 | Ga0157372_10669648 | 3300013307 | Bacteria | 1208 |
| 581 | Ga0157372_10832683 | 3300013307 | Bacteria | 1071 |
| 582 | Ga0157372_11059881 | 3300013307 | Bacteria | 938 |
| 583 | Ga0157372_11097825 | 3300013307 | Bacteria | 920 |
| 584 | Ga0157372_11355445 | 3300013307 | Bacteria | 820 |
| 585 | Ga0157372_11685072 | 3300013307 | Bacteria | 729 |
| 586 | Ga0157372_12225339 | 3300013307 | Bacteria | 630 |
| 587 | Ga0157375_10009399 | 3300013308 | Bacteria | 8583 |
| 588 | Ga0157375_10019853 | 3300013308 | Bacteria | 6126 |
| 589 | Ga0157375_10072366 | 3300013308 | Bacteria | 3464 |
| 590 | Ga0157375_10198083 | 3300013308 | Bacteria | 2164 |
| 591 | Ga0157375_10346612 | 3300013308 | Bacteria | 1651 |
| 592 | Ga0157375_10355611 | 3300013308 | Bacteria | 1631 |
| 593 | Ga0157375_10388376 | 3300013308 | Bacteria | 1563 |
| 594 | Ga0157375_11132328 | 3300013308 | Unclassified | 917 |
| 595 | Ga0163163_10001566 | 3300014325 | Bacteria | 19297 |
| 596 | Ga0163163_10003008 | 3300014325 | Bacteria | 14268 |
| 597 | Ga0163163_10049024 | 3300014325 | Bacteria | 4155 |
| 598 | Ga0163163_10083023 | 3300014325 | Bacteria | 3209 |
| 599 | Ga0163163_10178213 | 3300014325 | Bacteria | 2172 |
| 600 | Ga0163163_10216082 | 3300014325 | Bacteria | 1966 |
| 601 | Ga0163163_10248958 | 3300014325 | Unclassified | 1827 |
| 602 | Ga0163163_10297226 | 3300014325 | Unclassified | 1667 |
| 603 | Ga0163163_10304263 | 3300014325 | Bacteria | 1647 |
| 604 | Ga0163163_10396601 | 3300014325 | Bacteria | 1438 |
| 605 | Ga0163163_10436062 | 3300014325 | Bacteria | 1369 |
| 606 | Ga0163163_10497457 | 3300014325 | Bacteria | 1281 |
| 607 | Ga0163163_10716468 | 3300014325 | Bacteria | 1064 |
| 608 | Ga0157377_10084310 | 3300014745 | Bacteria | 1864 |
| 609 | Ga0157379_10039454 | 3300014968 | Bacteria | 4213 |
| 610 | Ga0157379_10083192 | 3300014968 | Bacteria | 2869 |
| 611 | Ga0157379_10084780 | 3300014968 | Unclassified | 2839 |
| 612 | Ga0157379_10091751 | 3300014968 | Bacteria | 2725 |
| 613 | Ga0157379_10117979 | 3300014968 | Bacteria | 2387 |
| 614 | Ga0157379_10223685 | 3300014968 | Bacteria | 1705 |
| 615 | Ga0157379_10306748 | 3300014968 | Bacteria | 1447 |
| 616 | Ga0157379_10409085 | 3300014968 | Bacteria | 1248 |
| 617 | Ga0157379_10631359 | 3300014968 | Bacteria | 1002 |
| 618 | Ga0157379_10769929 | 3300014968 | Unclassified | 907 |
| 619 | Ga0157376_10000040 | 3300014969 | Bacteria | 121140 |
| 620 | Ga0157376_10010806 | 3300014969 | Bacteria | 6701 |
| 621 | Ga0157376_10059744 | 3300014969 | Bacteria | 3197 |
| 622 | Ga0157376_10075430 | 3300014969 | Unclassified | 2878 |
| 623 | Ga0157376_10232919 | 3300014969 | Unclassified | 1712 |
| 624 | Ga0157376_10243819 | 3300014969 | Bacteria | 1675 |
| 625 | Ga0157376_10680440 | 3300014969 | Bacteria | 1032 |
| 626 | Ga0157376_10685054 | 3300014969 | Bacteria | 1029 |
| 627 | Ga0157376_10749769 | 3300014969 | Bacteria | 985 |
| 628 | Ga0157376_10754546 | 3300014969 | Bacteria | 982 |
| 629 | Ga0157376_11163105 | 3300014969 | Unclassified | 799 |
| 630 | Ga0157376_11552305 | 3300014969 | Bacteria | 696 |
| 631 | Ga0163161_10044673 | 3300017792 | Bacteria | 3192 |
| 632 | Ga0206351_10035105 | 3300020077 | Bacteria | 733 |
| 633 | Ga0213874_10190105 | 3300021377 | Unclassified | 734 |
| 634 | Ga0213876_10017317 | 3300021384 | Bacteria | 3804 |
| 635 | Ga0213876_10458249 | 3300021384 | Bacteria | 678 |
| 636 | Ga0213876_10486054 | 3300021384 | Unclassified | 657 |
| 637 | Ga0224572_1025417 | 3300024225 | Unclassified | 1137 |
| 638 | Ga0228598_1012620 | 3300024227 | Bacteria | 1678 |
| 639 | Ga0228598_1063680 | 3300024227 | Bacteria | 735 |
| 640 | Ga0209437_115078 | 3300025233 | Bacteria | 1063 |
| 641 | Ga0209233_1005124 | 3300025261 | Bacteria | 4383 |
| 642 | Ga0207697_10096556 | 3300025315 | Bacteria | 1257 |
| 643 | Ga0207697_10188643 | 3300025315 | Unclassified | 905 |
| 644 | Ga0207656_10002473 | 3300025321 | Bacteria | 6236 |
| 645 | Ga0207656_10012793 | 3300025321 | Unclassified | 3194 |
| 646 | Ga0207656_10122151 | 3300025321 | Bacteria | 1213 |
| 647 | Ga0207656_10129802 | 3300025321 | Bacteria | 1180 |
| 648 | Ga0207656_10132156 | 3300025321 | Bacteria | 1170 |
| 649 | Ga0207653_10003592 | 3300025885 | Bacteria | 4883 |
| 650 | Ga0207692_10084276 | 3300025898 | Bacteria | 1707 |
| 651 | Ga0207692_10324155 | 3300025898 | Bacteria | 943 |
| 652 | Ga0207710_10001958 | 3300025900 | Bacteria | 9844 |
| 653 | Ga0207710_10066889 | 3300025900 | Bacteria | 1640 |
| 654 | Ga0207710_10094597 | 3300025900 | Unclassified | 1403 |
| 655 | Ga0207680_10001465 | 3300025903 | Bacteria | 11179 |
| 656 | Ga0207680_10030433 | 3300025903 | Bacteria | 3045 |
| 657 | Ga0207680_10119514 | 3300025903 | Bacteria | 1721 |
| 658 | Ga0207685_10177109 | 3300025905 | Bacteria | 986 |
| 659 | Ga0207685_10189675 | 3300025905 | Unclassified | 959 |
| 660 | Ga0207699_10011702 | 3300025906 | Bacteria | 4441 |
| 661 | Ga0207699_10012146 | 3300025906 | Unclassified | 4374 |
| 662 | Ga0207699_10056306 | 3300025906 | Bacteria | 2343 |
| 663 | Ga0207699_10130620 | 3300025906 | Bacteria | 1638 |
| 664 | Ga0207645_10068410 | 3300025907 | Bacteria | 2271 |
| 665 | Ga0207705_10005460 | 3300025909 | Bacteria | 9505 |
| 666 | Ga0207705_10099448 | 3300025909 | Bacteria | 2138 |
| 667 | Ga0207705_10730318 | 3300025909 | Bacteria | 769 |
| 668 | Ga0207684_10008000 | 3300025910 | Bacteria | 9445 |
| 669 | Ga0207684_10358390 | 3300025910 | Bacteria | 1255 |
| 670 | Ga0207684_10434044 | 3300025910 | Bacteria | 1128 |
| 671 | Ga0207654_10000018 | 3300025911 | Bacteria | 173245 |
| 672 | Ga0207654_10000559 | 3300025911 | Bacteria | 21075 |
| 673 | Ga0207654_10002749 | 3300025911 | Bacteria | 8928 |
| 674 | Ga0207654_10003369 | 3300025911 | Bacteria | 8095 |
| 675 | Ga0207654_10015104 | 3300025911 | Unclassified | 3999 |
| 676 | Ga0207654_10029747 | 3300025911 | Bacteria | 2993 |
| 677 | Ga0207654_10078749 | 3300025911 | Bacteria | 1978 |
| 678 | Ga0207654_10112676 | 3300025911 | Bacteria | 1695 |
| 679 | Ga0207654_10255465 | 3300025911 | Bacteria | 1176 |
| 680 | Ga0207654_10288296 | 3300025911 | Bacteria | 1112 |
| 681 | Ga0207707_10002540 | 3300025912 | Bacteria | 16376 |
| 682 | Ga0207707_10013981 | 3300025912 | Bacteria | 6999 |
| 683 | Ga0207707_10024120 | 3300025912 | Bacteria | 5320 |
| 684 | Ga0207707_10026986 | 3300025912 | Bacteria | 5019 |
| 685 | Ga0207707_10087217 | 3300025912 | Bacteria | 2727 |
| 686 | Ga0207707_10290186 | 3300025912 | Unclassified | 1415 |
| 687 | Ga0207707_10489208 | 3300025912 | Unclassified | 1050 |
| 688 | Ga0207695_10000167 | 3300025913 | Bacteria | 194371 |
| 689 | Ga0207695_10000297 | 3300025913 | Bacteria | 123067 |
| 690 | Ga0207695_10000384 | 3300025913 | Bacteria | 100121 |
| 691 | Ga0207695_10000539 | 3300025913 | Bacteria | 78884 |
| 692 | Ga0207695_10000770 | 3300025913 | Bacteria | 60994 |
| 693 | Ga0207695_10000825 | 3300025913 | Bacteria | 57395 |
| 694 | Ga0207695_10000942 | 3300025913 | Bacteria | 51840 |
| 695 | Ga0207695_10003871 | 3300025913 | Bacteria | 20713 |
| 696 | Ga0207695_10006112 | 3300025913 | Bacteria | 15710 |
| 697 | Ga0207695_10015143 | 3300025913 | Bacteria | 9095 |
| 698 | Ga0207695_10039408 | 3300025913 | Bacteria | 5079 |
| 699 | Ga0207695_10078908 | 3300025913 | Bacteria | 3339 |
| 700 | Ga0207695_10120599 | 3300025913 | Bacteria | 2591 |
| 701 | Ga0207695_10260635 | 3300025913 | Bacteria | 1631 |
| 702 | Ga0207695_10314767 | 3300025913 | Bacteria | 1455 |
| 703 | Ga0207695_10323390 | 3300025913 | Bacteria | 1432 |
| 704 | Ga0207695_10323537 | 3300025913 | Bacteria | 1431 |
| 705 | Ga0207695_10376491 | 3300025913 | Bacteria | 1305 |
| 706 | Ga0207695_10395491 | 3300025913 | Bacteria | 1267 |
| 707 | Ga0207695_10420130 | 3300025913 | Bacteria | 1221 |
| 708 | Ga0207695_10545255 | 3300025913 | Bacteria | 1041 |
| 709 | Ga0207695_10642066 | 3300025913 | Unclassified | 942 |
| 710 | Ga0207695_10952207 | 3300025913 | Unclassified | 738 |
| 711 | Ga0207671_10000207 | 3300025914 | Bacteria | 88886 |
| 712 | Ga0207671_10000211 | 3300025914 | Bacteria | 88074 |
| 713 | Ga0207671_10005189 | 3300025914 | Bacteria | 12108 |
| 714 | Ga0207671_10015635 | 3300025914 | Bacteria | 5933 |
| 715 | Ga0207671_10041861 | 3300025914 | Unclassified | 3391 |
| 716 | Ga0207671_10135677 | 3300025914 | Bacteria | 1892 |
| 717 | Ga0207671_10196651 | 3300025914 | Bacteria | 1573 |
| 718 | Ga0207671_10299234 | 3300025914 | Bacteria | 1271 |
| 719 | Ga0207671_10335874 | 3300025914 | Bacteria | 1197 |
| 720 | Ga0207671_10723480 | 3300025914 | Bacteria | 791 |
| 721 | Ga0207671_10851874 | 3300025914 | Unclassified | 722 |
| 722 | Ga0207671_10890423 | 3300025914 | Unclassified | 704 |
| 723 | Ga0207693_10098395 | 3300025915 | Bacteria | 2294 |
| 724 | Ga0207693_10111920 | 3300025915 | Bacteria | 2141 |
| 725 | Ga0207693_10176508 | 3300025915 | Bacteria | 1681 |
| 726 | Ga0207693_10183606 | 3300025915 | Bacteria | 1646 |
| 727 | Ga0207693_10320981 | 3300025915 | Bacteria | 1212 |
| 728 | Ga0207663_10102556 | 3300025916 | Bacteria | 1925 |
| 729 | Ga0207663_10449234 | 3300025916 | Bacteria | 994 |
| 730 | Ga0207663_10530111 | 3300025916 | Bacteria | 918 |
| 731 | Ga0207663_10576954 | 3300025916 | Bacteria | 882 |
| 732 | Ga0207663_11084614 | 3300025916 | Bacteria | 643 |
| 733 | Ga0207660_10003140 | 3300025917 | Bacteria | 10806 |
| 734 | Ga0207660_10024648 | 3300025917 | Bacteria | 4075 |
| 735 | Ga0207660_10231891 | 3300025917 | Bacteria | 1452 |
| 736 | Ga0207660_10311890 | 3300025917 | Bacteria | 1254 |
| 737 | Ga0207660_10551360 | 3300025917 | Unclassified | 937 |
| 738 | Ga0207657_10002306 | 3300025919 | Bacteria | 20684 |
| 739 | Ga0207657_10082827 | 3300025919 | Bacteria | 2692 |
| 740 | Ga0207657_10116390 | 3300025919 | Bacteria | 2203 |
| 741 | Ga0207649_10007995 | 3300025920 | Bacteria | 5754 |
| 742 | Ga0207649_10100879 | 3300025920 | Bacteria | 1910 |
| 743 | Ga0207649_10108322 | 3300025920 | Bacteria | 1852 |
| 744 | Ga0207649_10303202 | 3300025920 | Bacteria | 1168 |
| 745 | Ga0207649_10313814 | 3300025920 | Bacteria | 1150 |
| 746 | Ga0207649_10476582 | 3300025920 | Bacteria | 946 |
| 747 | Ga0207649_10562911 | 3300025920 | Bacteria | 873 |
| 748 | Ga0207652_10004686 | 3300025921 | Bacteria | 11088 |
| 749 | Ga0207652_10006572 | 3300025921 | Bacteria | 9372 |
| 750 | Ga0207652_10009897 | 3300025921 | Bacteria | 7671 |
| 751 | Ga0207652_10138131 | 3300025921 | Bacteria | 2178 |
| 752 | Ga0207652_10147122 | 3300025921 | Unclassified | 2109 |
| 753 | Ga0207652_10285803 | 3300025921 | Bacteria | 1488 |
| 754 | Ga0207652_10784655 | 3300025921 | Bacteria | 847 |
| 755 | Ga0207646_10045435 | 3300025922 | Bacteria | 3943 |
| 756 | Ga0207646_10123715 | 3300025922 | Unclassified | 2325 |
| 757 | Ga0207646_10155479 | 3300025922 | Bacteria | 2062 |
| 758 | Ga0207646_10160426 | 3300025922 | Bacteria | 2029 |
| 759 | Ga0207646_10185887 | 3300025922 | Bacteria | 1877 |
| 760 | Ga0207646_10358215 | 3300025922 | Bacteria | 1318 |
| 761 | Ga0207646_10539089 | 3300025922 | Bacteria | 1050 |
| 762 | Ga0207646_11156013 | 3300025922 | Bacteria | 680 |
| 763 | Ga0207681_10191336 | 3300025923 | Bacteria | 1566 |
| 764 | Ga0207681_10359015 | 3300025923 | Bacteria | 1168 |
| 765 | Ga0207694_10000118 | 3300025924 | Bacteria | 83927 |
| 766 | Ga0207694_10000484 | 3300025924 | Bacteria | 36222 |
| 767 | Ga0207694_10000823 | 3300025924 | Bacteria | 27668 |
| 768 | Ga0207694_10001030 | 3300025924 | Bacteria | 24309 |
| 769 | Ga0207694_10005449 | 3300025924 | Bacteria | 9789 |
| 770 | Ga0207694_10024333 | 3300025924 | Bacteria | 4598 |
| 771 | Ga0207694_10029031 | 3300025924 | Bacteria | 4218 |
| 772 | Ga0207694_10031174 | 3300025924 | Bacteria | 4072 |
| 773 | Ga0207694_10035630 | 3300025924 | Bacteria | 3819 |
| 774 | Ga0207694_10046448 | 3300025924 | Bacteria | 3356 |
| 775 | Ga0207694_10095502 | 3300025924 | Bacteria | 2350 |
| 776 | Ga0207694_10125980 | 3300025924 | Bacteria | 2049 |
| 777 | Ga0207694_10328220 | 3300025924 | Bacteria | 1264 |
| 778 | Ga0207650_10155100 | 3300025925 | Bacteria | 1810 |
| 779 | Ga0207650_11540121 | 3300025925 | Bacteria | 565 |
| 780 | Ga0207659_10109918 | 3300025926 | Bacteria | 2094 |
| 781 | Ga0207687_10003603 | 3300025927 | Bacteria | 10427 |
| 782 | Ga0207687_10022716 | 3300025927 | Bacteria | 4177 |
| 783 | Ga0207687_10062250 | 3300025927 | Bacteria | 2638 |
| 784 | Ga0207687_10081065 | 3300025927 | Bacteria | 2344 |
| 785 | Ga0207687_10138547 | 3300025927 | Bacteria | 1843 |
| 786 | Ga0207687_10161699 | 3300025927 | Bacteria | 1719 |
| 787 | Ga0207687_10314447 | 3300025927 | Bacteria | 1266 |
| 788 | Ga0207687_10386954 | 3300025927 | Bacteria | 1147 |
| 789 | Ga0207687_10639357 | 3300025927 | Bacteria | 899 |
| 790 | Ga0207687_11607907 | 3300025927 | Unclassified | 558 |
| 791 | Ga0207700_10002914 | 3300025928 | Bacteria | 9859 |
| 792 | Ga0207700_10028252 | 3300025928 | Bacteria | 3941 |
| 793 | Ga0207700_10044198 | 3300025928 | Bacteria | 3278 |
| 794 | Ga0207700_10084438 | 3300025928 | Bacteria | 2489 |
| 795 | Ga0207700_10299647 | 3300025928 | Bacteria | 1388 |
| 796 | Ga0207664_10012235 | 3300025929 | Bacteria | 6132 |
| 797 | Ga0207664_10037869 | 3300025929 | Bacteria | 3735 |
| 798 | Ga0207664_10110490 | 3300025929 | Bacteria | 2286 |
| 799 | Ga0207664_10461067 | 3300025929 | Bacteria | 1135 |
| 800 | Ga0207664_10513134 | 3300025929 | Bacteria | 1074 |
| 801 | Ga0207664_10917148 | 3300025929 | Bacteria | 786 |
| 802 | Ga0207644_10005916 | 3300025931 | Bacteria | 7975 |
| 803 | Ga0207644_10034067 | 3300025931 | Bacteria | 3563 |
| 804 | Ga0207644_10040055 | 3300025931 | Bacteria | 3310 |
| 805 | Ga0207644_10098279 | 3300025931 | Bacteria | 2194 |
| 806 | Ga0207644_10215420 | 3300025931 | Bacteria | 1520 |
| 807 | Ga0207690_10011567 | 3300025932 | Bacteria | 5271 |
| 808 | Ga0207706_10003066 | 3300025933 | Bacteria | 16084 |
| 809 | Ga0207686_10017121 | 3300025934 | Bacteria | 4078 |
| 810 | Ga0207686_10024345 | 3300025934 | Bacteria | 3507 |
| 811 | Ga0207686_10032314 | 3300025934 | Bacteria | 3114 |
| 812 | Ga0207686_10052481 | 3300025934 | Bacteria | 2545 |
| 813 | Ga0207686_10055003 | 3300025934 | Bacteria | 2495 |
| 814 | Ga0207686_10062170 | 3300025934 | Bacteria | 2370 |
| 815 | Ga0207686_10080178 | 3300025934 | Unclassified | 2127 |
| 816 | Ga0207686_10090364 | 3300025934 | Bacteria | 2020 |
| 817 | Ga0207686_10505978 | 3300025934 | Bacteria | 938 |
| 818 | Ga0207686_10995416 | 3300025934 | Bacteria | 680 |
| 819 | Ga0207709_10084879 | 3300025935 | Bacteria | 2051 |
| 820 | Ga0207709_10128424 | 3300025935 | Unclassified | 1723 |
| 821 | Ga0207709_10208062 | 3300025935 | Bacteria | 1402 |
| 822 | Ga0207709_10519165 | 3300025935 | Bacteria | 932 |
| 823 | Ga0207670_10371559 | 3300025936 | Unclassified | 1137 |
| 824 | Ga0207669_10240422 | 3300025937 | Bacteria | 1342 |
| 825 | Ga0207704_10132754 | 3300025938 | Bacteria | 1728 |
| 826 | Ga0207704_10173336 | 3300025938 | Bacteria | 1550 |
| 827 | Ga0207665_10000011 | 3300025939 | Bacteria | 145201 |
| 828 | Ga0207665_10001886 | 3300025939 | Bacteria | 14134 |
| 829 | Ga0207665_10039627 | 3300025939 | Bacteria | 3141 |
| 830 | Ga0207665_10052707 | 3300025939 | Bacteria | 2741 |
| 831 | Ga0207665_10053545 | 3300025939 | Bacteria | 2720 |
| 832 | Ga0207665_10282994 | 3300025939 | Bacteria | 1234 |
| 833 | Ga0207665_10436406 | 3300025939 | Bacteria | 1003 |
| 834 | Ga0207691_10014464 | 3300025940 | Bacteria | 7523 |
| 835 | Ga0207691_10653931 | 3300025940 | Bacteria | 888 |
| 836 | Ga0207711_10000701 | 3300025941 | Bacteria | 33020 |
| 837 | Ga0207711_10002368 | 3300025941 | Bacteria | 16873 |
| 838 | Ga0207711_10004561 | 3300025941 | Bacteria | 11782 |
| 839 | Ga0207711_10035393 | 3300025941 | Bacteria | 4232 |
| 840 | Ga0207711_10082332 | 3300025941 | Bacteria | 2813 |
| 841 | Ga0207711_10092261 | 3300025941 | Bacteria | 2665 |
| 842 | Ga0207711_10095353 | 3300025941 | Bacteria | 2624 |
| 843 | Ga0207711_10104413 | 3300025941 | Unclassified | 2511 |
| 844 | Ga0207711_10137510 | 3300025941 | Bacteria | 2195 |
| 845 | Ga0207711_10186154 | 3300025941 | Bacteria | 1890 |
| 846 | Ga0207711_10427783 | 3300025941 | Bacteria | 1232 |
| 847 | Ga0207689_10000639 | 3300025942 | Bacteria | 33456 |
| 848 | Ga0207689_10031696 | 3300025942 | Bacteria | 4398 |
| 849 | Ga0207689_10115440 | 3300025942 | Bacteria | 2207 |
| 850 | Ga0207689_10286448 | 3300025942 | Bacteria | 1364 |
| 851 | Ga0207689_10302332 | 3300025942 | Unclassified | 1326 |
| 852 | Ga0207689_10308211 | 3300025942 | Bacteria | 1313 |
| 853 | Ga0207661_10002207 | 3300025944 | Bacteria | 13431 |
| 854 | Ga0207661_10008706 | 3300025944 | Bacteria | 7255 |
| 855 | Ga0207661_10015272 | 3300025944 | Bacteria | 5647 |
| 856 | Ga0207661_10017408 | 3300025944 | Bacteria | 5318 |
| 857 | Ga0207661_10020722 | 3300025944 | Bacteria | 4919 |
| 858 | Ga0207661_10078725 | 3300025944 | Bacteria | 2715 |
| 859 | Ga0207661_10081609 | 3300025944 | Bacteria | 2671 |
| 860 | Ga0207661_10140583 | 3300025944 | Bacteria | 2077 |
| 861 | Ga0207661_10210067 | 3300025944 | Unclassified | 1715 |
| 862 | Ga0207661_10397972 | 3300025944 | Bacteria | 1249 |
| 863 | Ga0207679_10269403 | 3300025945 | Bacteria | 1456 |
| 864 | Ga0207679_10290095 | 3300025945 | Unclassified | 1406 |
| 865 | Ga0207679_11231617 | 3300025945 | Bacteria | 687 |
| 866 | Ga0207679_11262962 | 3300025945 | Bacteria | 678 |
| 867 | Ga0207679_11521645 | 3300025945 | Unclassified | 613 |
| 868 | Ga0207667_10000704 | 3300025949 | Bacteria | 43381 |
| 869 | Ga0207667_10001298 | 3300025949 | Bacteria | 31322 |
| 870 | Ga0207667_10001669 | 3300025949 | Bacteria | 27969 |
| 871 | Ga0207667_10003842 | 3300025949 | Bacteria | 18465 |
| 872 | Ga0207667_10005331 | 3300025949 | Bacteria | 15672 |
| 873 | Ga0207667_10021374 | 3300025949 | Bacteria | 7171 |
| 874 | Ga0207667_10022036 | 3300025949 | Bacteria | 7049 |
| 875 | Ga0207667_10024356 | 3300025949 | Bacteria | 6646 |
| 876 | Ga0207667_10043726 | 3300025949 | Bacteria | 4752 |
| 877 | Ga0207667_10045348 | 3300025949 | Bacteria | 4657 |
| 878 | Ga0207667_10053693 | 3300025949 | Bacteria | 4239 |
| 879 | Ga0207667_10057480 | 3300025949 | Bacteria | 4083 |
| 880 | Ga0207667_10175601 | 3300025949 | Bacteria | 2201 |
| 881 | Ga0207667_10631988 | 3300025949 | Bacteria | 1077 |
| 882 | Ga0207667_10832265 | 3300025949 | Bacteria | 918 |
| 883 | Ga0207667_10871885 | 3300025949 | Bacteria | 893 |
| 884 | Ga0207651_10012262 | 3300025960 | Bacteria | 4842 |
| 885 | Ga0207651_10160017 | 3300025960 | Bacteria | 1764 |
| 886 | Ga0207712_10020844 | 3300025961 | Bacteria | 4299 |
| 887 | Ga0207712_10530544 | 3300025961 | Bacteria | 1010 |
| 888 | Ga0207640_10015561 | 3300025981 | Bacteria | 4407 |
| 889 | Ga0207640_10028252 | 3300025981 | Bacteria | 3428 |
| 890 | Ga0207640_10771451 | 3300025981 | Bacteria | 831 |
| 891 | Ga0207640_10843378 | 3300025981 | Bacteria | 797 |
| 892 | Ga0207640_11305646 | 3300025981 | Bacteria | 648 |
| 893 | Ga0207640_11568133 | 3300025981 | Bacteria | 593 |
| 894 | Ga0207658_10008830 | 3300025986 | Bacteria | 6838 |
| 895 | Ga0207658_10341552 | 3300025986 | Bacteria | 1301 |
| 896 | Ga0207677_10003199 | 3300026023 | Bacteria | 8638 |
| 897 | Ga0207677_10015604 | 3300026023 | Bacteria | 4474 |
| 898 | Ga0207677_10019576 | 3300026023 | Bacteria | 4091 |
| 899 | Ga0207677_10040980 | 3300026023 | Bacteria | 3059 |
| 900 | Ga0207703_10014435 | 3300026035 | Bacteria | 6159 |
| 901 | Ga0207703_10018747 | 3300026035 | Bacteria | 5405 |
| 902 | Ga0207703_10033447 | 3300026035 | Bacteria | 4076 |
| 903 | Ga0207703_10093727 | 3300026035 | Bacteria | 2529 |
| 904 | Ga0207703_10348419 | 3300026035 | Bacteria | 1363 |
| 905 | Ga0207703_10484078 | 3300026035 | Bacteria | 1160 |
| 906 | Ga0207703_11114920 | 3300026035 | Bacteria | 758 |
| 907 | Ga0207639_10000063 | 3300026041 | Bacteria | 100309 |
| 908 | Ga0207639_10001850 | 3300026041 | Bacteria | 14229 |
| 909 | Ga0207639_10027801 | 3300026041 | Bacteria | 4124 |
| 910 | Ga0207639_10070705 | 3300026041 | Bacteria | 2727 |
| 911 | Ga0207639_10127893 | 3300026041 | Bacteria | 2098 |
| 912 | Ga0207639_10128467 | 3300026041 | Bacteria | 2094 |
| 913 | Ga0207639_10132262 | 3300026041 | Bacteria | 2067 |
| 914 | Ga0207639_10133353 | 3300026041 | Bacteria | 2059 |
| 915 | Ga0207639_10220462 | 3300026041 | Bacteria | 1638 |
| 916 | Ga0207639_11272420 | 3300026041 | Bacteria | 690 |
| 917 | Ga0207639_11381542 | 3300026041 | Bacteria | 661 |
| 918 | Ga0207678_10547836 | 3300026067 | Bacteria | 1011 |
| 919 | Ga0207678_11001226 | 3300026067 | Bacteria | 740 |
| 920 | Ga0207708_10725289 | 3300026075 | Unclassified | 851 |
| 921 | Ga0207702_10001530 | 3300026078 | Bacteria | 22891 |
| 922 | Ga0207702_10003431 | 3300026078 | Bacteria | 14477 |
| 923 | Ga0207702_10004553 | 3300026078 | Bacteria | 12288 |
| 924 | Ga0207702_10026789 | 3300026078 | Bacteria | 4787 |
| 925 | Ga0207702_10033402 | 3300026078 | Bacteria | 4297 |
| 926 | Ga0207702_10059910 | 3300026078 | Bacteria | 3244 |
| 927 | Ga0207702_10118771 | 3300026078 | Bacteria | 2363 |
| 928 | Ga0207702_10175867 | 3300026078 | Bacteria | 1967 |
| 929 | Ga0207702_10186544 | 3300026078 | Unclassified | 1913 |
| 930 | Ga0207702_10189269 | 3300026078 | Bacteria | 1900 |
| 931 | Ga0207702_10238822 | 3300026078 | Bacteria | 1702 |
| 932 | Ga0207702_10300631 | 3300026078 | Bacteria | 1523 |
| 933 | Ga0207702_10518200 | 3300026078 | Bacteria | 1164 |
| 934 | Ga0207702_10806703 | 3300026078 | Bacteria | 928 |
| 935 | Ga0207702_11105141 | 3300026078 | Bacteria | 787 |
| 936 | Ga0207641_10003572 | 3300026088 | Bacteria | 13744 |
| 937 | Ga0207641_10013528 | 3300026088 | Bacteria | 6694 |
| 938 | Ga0207641_10017715 | 3300026088 | Bacteria | 5835 |
| 939 | Ga0207641_10027289 | 3300026088 | Unclassified | 4716 |
| 940 | Ga0207641_10028508 | 3300026088 | Bacteria | 4614 |
| 941 | Ga0207641_10058025 | 3300026088 | Bacteria | 3293 |
| 942 | Ga0207641_10358549 | 3300026088 | Bacteria | 1391 |
| 943 | Ga0207648_10020471 | 3300026089 | Bacteria | 5957 |
| 944 | Ga0207648_10154584 | 3300026089 | Bacteria | 2025 |
| 945 | Ga0207648_10214990 | 3300026089 | Bacteria | 1707 |
| 946 | Ga0207676_10010814 | 3300026095 | Bacteria | 6508 |
| 947 | Ga0207676_10066221 | 3300026095 | Bacteria | 2880 |
| 948 | Ga0207676_10094899 | 3300026095 | Bacteria | 2459 |
| 949 | Ga0207676_10333225 | 3300026095 | Bacteria | 1397 |
| 950 | Ga0207676_10416416 | 3300026095 | Bacteria | 1259 |
| 951 | Ga0207674_10004642 | 3300026116 | Bacteria | 16498 |
| 952 | Ga0207674_10006628 | 3300026116 | Bacteria | 13604 |
| 953 | Ga0207674_10007498 | 3300026116 | Bacteria | 12718 |
| 954 | Ga0207674_10010952 | 3300026116 | Bacteria | 10207 |
| 955 | Ga0207674_10018657 | 3300026116 | Bacteria | 7535 |
| 956 | Ga0207674_10112333 | 3300026116 | Bacteria | 2698 |
| 957 | Ga0207674_10139870 | 3300026116 | Bacteria | 2381 |
| 958 | Ga0207674_10366269 | 3300026116 | Bacteria | 1393 |
| 959 | Ga0207674_11605502 | 3300026116 | Bacteria | 619 |
| 960 | Ga0207675_100916811 | 3300026118 | Bacteria | 893 |
| 961 | Ga0207683_10001872 | 3300026121 | Bacteria | 18606 |
| 962 | Ga0207683_10494253 | 3300026121 | Bacteria | 1130 |
| 963 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 964 | Ga0207698_10000093 | 3300026142 | Bacteria | 57865 |
| 965 | Ga0207698_10002110 | 3300026142 | Bacteria | 11725 |
| 966 | Ga0207698_10006244 | 3300026142 | Bacteria | 7419 |
| 967 | Ga0207698_10028874 | 3300026142 | Bacteria | 3963 |
| 968 | Ga0207698_10081346 | 3300026142 | Unclassified | 2614 |
| 969 | Ga0207698_10112650 | 3300026142 | Bacteria | 2284 |
| 970 | Ga0207698_10166165 | 3300026142 | Bacteria | 1937 |
| 971 | Ga0207698_10248121 | 3300026142 | Bacteria | 1627 |
| 972 | Ga0207698_10479779 | 3300026142 | Bacteria | 1206 |
| 973 | Ga0207698_10735715 | 3300026142 | Bacteria | 984 |
| 974 | Ga0207698_10925705 | 3300026142 | Bacteria | 880 |
| 975 | Ga0209179_1020399 | 3300027512 | Bacteria | 1285 |
| 976 | Ga0209588_1001606 | 3300027671 | Bacteria | 5954 |
| 977 | Ga0209588_1007654 | 3300027671 | Bacteria | 3185 |
| 978 | Ga0209588_1010308 | 3300027671 | Bacteria | 2808 |
| 979 | Ga0209588_1153886 | 3300027671 | Unclassified | 728 |
| 980 | Ga0265354_1000512 | 3300028016 | Bacteria | 6673 |
| 981 | Ga0265356_1004788 | 3300028017 | Bacteria | 1641 |
| 982 | Ga0265357_1000491 | 3300028023 | Unclassified | 2325 |
| 983 | Ga0268266_10001991 | 3300028379 | Bacteria | 22890 |
| 984 | Ga0268266_10008821 | 3300028379 | Bacteria | 8928 |
| 985 | Ga0268266_10028158 | 3300028379 | Bacteria | 4777 |
| 986 | Ga0268266_10064079 | 3300028379 | Bacteria | 3174 |
| 987 | Ga0268266_10071655 | 3300028379 | Bacteria | 3004 |
| 988 | Ga0268266_10114572 | 3300028379 | Unclassified | 2392 |
| 989 | Ga0268266_10176606 | 3300028379 | Bacteria | 1942 |
| 990 | Ga0268265_10014315 | 3300028380 | Bacteria | 5402 |
| 991 | Ga0268264_10014414 | 3300028381 | Bacteria | 6496 |
| 992 | Ga0268264_10018806 | 3300028381 | Bacteria | 5649 |
| 993 | Ga0268264_10059391 | 3300028381 | Bacteria | 3204 |
| 994 | Ga0268264_10144101 | 3300028381 | Bacteria | 2128 |
| 995 | Ga0268264_10179435 | 3300028381 | Bacteria | 1922 |
| 996 | Ga0268264_10291504 | 3300028381 | Bacteria | 1533 |
| 997 | Ga0268264_10678520 | 3300028381 | Bacteria | 1022 |
| 998 | Ga0265319_1002192 | 3300028563 | Bacteria | 10881 |
| 999 | Ga0265318_10000076 | 3300028577 | Bacteria | 94026 |
| 1000 | Ga0265336_10091630 | 3300028666 | Bacteria | 906 |
| 1001 | Ga0265338_10032424 | 3300028800 | Bacteria | 5096 |
| 1002 | Ga0265338_10069513 | 3300028800 | Unclassified | 3025 |
| 1003 | Ga0265338_10327361 | 3300028800 | Bacteria | 1107 |
| 1004 | Ga0265338_10501979 | 3300028800 | Bacteria | 854 |
| 1005 | Ga0265338_10591459 | 3300028800 | Bacteria | 773 |
| 1006 | Ga0265338_10772056 | 3300028800 | Bacteria | 660 |
| 1007 | Ga0265770_1004703 | 3300030878 | Unclassified | 1867 |
| 1008 | Ga0265765_1000870 | 3300030879 | Bacteria | 2627 |
| 1009 | Ga0265760_10000022 | 3300031090 | Bacteria | 68294 |
| 1010 | Ga0265760_10001426 | 3300031090 | Bacteria | 7037 |
| 1011 | Ga0265760_10009836 | 3300031090 | Bacteria | 2728 |
| 1012 | Ga0265760_10010281 | 3300031090 | Unclassified | 2671 |
| 1013 | Ga0265760_10065013 | 3300031090 | Bacteria | 1113 |
| 1014 | Ga0265330_10155665 | 3300031235 | Bacteria | 971 |
| 1015 | Ga0265330_10322605 | 3300031235 | Bacteria | 652 |
| 1016 | Ga0265332_10057676 | 3300031238 | Bacteria | 1663 |
| 1017 | Ga0265328_10001785 | 3300031239 | Bacteria | 9809 |
| 1018 | Ga0265328_10075243 | 3300031239 | Bacteria | 1242 |
| 1019 | Ga0265320_10000031 | 3300031240 | Bacteria | 147045 |
| 1020 | Ga0265320_10146702 | 3300031240 | Bacteria | 1067 |
| 1021 | Ga0265325_10004183 | 3300031241 | Bacteria | 9174 |
| 1022 | Ga0265325_10004533 | 3300031241 | Bacteria | 8752 |
| 1023 | Ga0265325_10011266 | 3300031241 | Bacteria | 5140 |
| 1024 | Ga0265325_10140662 | 3300031241 | Bacteria | 1148 |
| 1025 | Ga0265329_10000860 | 3300031242 | Bacteria | 15331 |
| 1026 | Ga0265340_10002347 | 3300031247 | Bacteria | 10797 |
| 1027 | Ga0265340_10239107 | 3300031247 | Bacteria | 811 |
| 1028 | Ga0265339_10000031 | 3300031249 | Bacteria | 133838 |
| 1029 | Ga0265339_10003292 | 3300031249 | Bacteria | 11308 |
| 1030 | Ga0265339_10023552 | 3300031249 | Bacteria | 3557 |
| 1031 | Ga0265331_10000039 | 3300031250 | Bacteria | 194439 |
| 1032 | Ga0265331_10010269 | 3300031250 | Bacteria | 5190 |
| 1033 | Ga0265316_10000662 | 3300031344 | Bacteria | 38352 |
| 1034 | Ga0265316_10002301 | 3300031344 | Bacteria | 19963 |
| 1035 | Ga0265316_10003285 | 3300031344 | Bacteria | 16411 |
| 1036 | Ga0265316_10011125 | 3300031344 | Bacteria | 8144 |
| 1037 | Ga0265316_10015019 | 3300031344 | Bacteria | 6789 |
| 1038 | Ga0265316_10022182 | 3300031344 | Bacteria | 5361 |
| 1039 | Ga0265316_10057908 | 3300031344 | Bacteria | 3020 |
| 1040 | Ga0265316_10159995 | 3300031344 | Unclassified | 1684 |
| 1041 | Ga0307509_10175889 | 3300031507 | Bacteria | 2013 |
| 1042 | Ga0265313_10005224 | 3300031595 | Bacteria | 9620 |
| 1043 | Ga0265313_10016048 | 3300031595 | Bacteria | 4328 |
| 1044 | Ga0265314_10000067 | 3300031711 | Bacteria | 156225 |
| 1045 | Ga0265314_10001577 | 3300031711 | Bacteria | 25037 |
| 1046 | Ga0265314_10012255 | 3300031711 | Bacteria | 7014 |
| 1047 | Ga0265314_10019058 | 3300031711 | Bacteria | 5323 |
| 1048 | Ga0265314_10029215 | 3300031711 | Bacteria | 4101 |
| 1049 | Ga0265314_10197417 | 3300031711 | Bacteria | 1192 |
| 1050 | Ga0265342_10000920 | 3300031712 | Bacteria | 29215 |
| 1051 | Ga0265342_10003163 | 3300031712 | Bacteria | 13714 |
| 1052 | Ga0265342_10046882 | 3300031712 | Bacteria | 2596 |
| 1053 | Ga0307409_100243827 | 3300031995 | Bacteria | 1638 |
| 1054 | Ga0316212_1002189 | 3300033547 | Unclassified | 2762 |
| 1055 | Ga0373926_0005499 | 3300035083 | Unclassified | 4180 |
| 1056 | Ga0373934_0014871 | 3300035086 | Bacteria | 2948 |
| 1057 | Ga0373934_0081629 | 3300035086 | Bacteria | 1299 |
| 1058 | Ga0373923_0055647 | 3300035111 | Bacteria | 1668 |
| 1059 | Ga0373923_0125536 | 3300035111 | Bacteria | 1150 |
| 1060 | Ga0373936_0289558 | 3300035113 | Bacteria | 737 |
| 1061 | Ga0373953_0014045 | 3300035117 | Bacteria | 2873 |
| 1062 | Ga0373953_0260444 | 3300035117 | Bacteria | 754 |
| 1063 | Ga0373954_0000984 | 3300035118 | Bacteria | 11222 |
| 1064 | Ga0373954_0056017 | 3300035118 | Unclassified | 1855 |
| 1065 | Ga0373956_0012605 | 3300035119 | Unclassified | 3507 |
| 1066 | Ga0373956_0081120 | 3300035119 | Unclassified | 1489 |
| 1067 | Ga0373956_0280286 | 3300035119 | Bacteria | 793 |
| 1068 | Ga0373957_0109451 | 3300035120 | Bacteria | 1112 |
| 1069 | Ga0373943_0040866 | 3300035170 | Bacteria | 2240 |
| 1070 | Ga0373946_0002371 | 3300035171 | Bacteria | 6661 |
| 1071 | Ga0373946_0092099 | 3300035171 | Bacteria | 1345 |
| 1072 | Ga0373946_0237453 | 3300035171 | Bacteria | 885 |
| 1073 | Ga0373955_0055891 | 3300035172 | Bacteria | 2163 |
| 1074 | Ga0373955_0354363 | 3300035172 | Unclassified | 889 |
| 1075 | Ga0373931_0032724 | 3300035691 | Bacteria | 2692 |
| 1076 | Ga0373935_0026595 | 3300035692 | Bacteria | 3573 |
| 1077 | Ga0373927_0000212 | 3300035695 | Bacteria | 46178 |
| 1078 | Ga0373927_0000614 | 3300035695 | Bacteria | 27048 |
| 1079 | Ga0373927_0007240 | 3300035695 | Bacteria | 7526 |
| 1080 | Ga0373927_0046800 | 3300035695 | Bacteria | 2798 |
| 1081 | Ga0373927_0120406 | 3300035695 | Bacteria | 1713 |
| 1082 | Ga0373927_0126976 | 3300035695 | Bacteria | 1665 |
| 1083 | Ga0373933_0000367 | 3300035724 | Bacteria | 28838 |
| 1084 | Ga0373933_0015424 | 3300035724 | Bacteria | 4258 |
| 1085 | Ga0373933_0101328 | 3300035724 | Bacteria | 1787 |
| 1086 | Ga0373933_0356160 | 3300035724 | Unclassified | 951 |
| 1087 | Ga0373933_0957281 | 3300035724 | Bacteria | 564 |
| 1088 | Ga0373947_0026681 | 3300035725 | Bacteria | 3378 |
| 1089 | Ga0373947_0071247 | 3300035725 | Bacteria | 2131 |
| 1090 | Ga0373937_0002124 | 3300036401 | Bacteria | 16565 |
| 1091 | Ga0373937_0004512 | 3300036401 | Bacteria | 11824 |
| 1092 | Ga0373937_0006149 | 3300036401 | Bacteria | 10338 |
| 1093 | Ga0373937_0006208 | 3300036401 | Bacteria | 10296 |
| 1094 | Ga0373937_0048327 | 3300036401 | Bacteria | 3895 |
| 1095 | Ga0373937_0059532 | 3300036401 | Bacteria | 3510 |
| 1096 | Ga0373937_0439175 | 3300036401 | Bacteria | 1239 |
| 1097 | Ga0373937_0441669 | 3300036401 | Bacteria | 1235 |
| 1098 | Ga0373937_0786259 | 3300036401 | Bacteria | 899 |
| 1099 | Ga0373937_1174169 | 3300036401 | Bacteria | 716 |
| 1100 | Ga0373925_0000487 | 3300037068 | Bacteria | 39835 |
| 1101 | Ga0373925_0009147 | 3300037068 | Bacteria | 7209 |
| 1102 | Ga0373925_0063308 | 3300037068 | Bacteria | 2783 |
| 1103 | Ga0373925_0173252 | 3300037068 | Bacteria | 1704 |
| 1104 | Ga0373925_0303700 | 3300037068 | Bacteria | 1289 |
| 1105 | Ga0373925_0487661 | 3300037068 | Unclassified | 1011 |
| 1106 | Ga0395899_0300915 | 3300037312 | Bacteria | 1085 |
| 1107 | Ga0395899_0319120 | 3300037312 | Bacteria | 1047 |
| 1108 | Ga0395900_0028406 | 3300037418 | Bacteria | 5729 |
| 1109 | Ga0395900_0058272 | 3300037418 | Bacteria | 3976 |
| 1110 | Ga0395900_0357847 | 3300037418 | Bacteria | 1432 |
| 1111 | Ga0395898_0101022 | 3300037466 | Bacteria | 2770 |
| 1112 | Ga0395898_0178528 | 3300037466 | Unclassified | 2029 |
| 1113 | Ga0395898_0474578 | 3300037466 | Bacteria | 1190 |
| 1114 | Ga0395905_0667277 | 3300037471 | Bacteria | 942 |
| 1115 | Ga0436364_0708475 | 3300037853 | Bacteria | 732 |
| 1116 | Ga0395901_0545268 | 3300038443 | Bacteria | 1176 |
| 1117 | Ga0436365_0320037 | 3300039437 | Bacteria | 4465 |
| 1118 | Ga0436365_0352286 | 3300039437 | Unclassified | 779 |
| 1119 | Ga0436365_1092844 | 3300039437 | Unclassified | 633 |
| 1120 | Ga0436365_1396730 | 3300039437 | Bacteria | 683 |
| 1121 | Ga0436360_0025204 | 3300039438 | Bacteria | 662 |
| 1122 | Ga0436363_0413293 | 3300039450 | Unclassified | 998 |
| 1123 | Ga0436363_1122484 | 3300039450 | Bacteria | 1855 |
| 1124 | Ga0436362_0678365 | 3300039453 | Bacteria | 1083 |
| 1125 | Ga0436362_0796667 | 3300039453 | Bacteria | 1371 |
| 1126 | Ga0451791_0662513 | 3300041451 | Bacteria | 917 |
| 1127 | Ga0451797_0373435 | 3300041453 | Unclassified | 976 |
| 1128 | Ga0451837_1137245 | 3300041494 | Bacteria | 1626 |
| 1129 | Ga0451577_0000054 | 3300042876 | Bacteria | 278798 |
| 1130 | Ga0451577_0563173 | 3300042876 | Bacteria | 1034 |
| 1131 | Ga0453683_0012500 | 3300044673 | Bacteria | 5564 |
| 1132 | Ga0453683_0660509 | 3300044673 | Bacteria | 684 |
| 1133 | Ga0466966_0191978 | 3300044684 | Bacteria | 1237 |
| 1134 | Ga0466963_0003591 | 3300044694 | Bacteria | 8916 |
| 1135 | Ga0466963_0236383 | 3300044694 | Bacteria | 1281 |
| 1136 | Ga0453684_0000366 | 3300044712 | Bacteria | 186117 |
| 1137 | Ga0453684_0860484 | 3300044712 | Bacteria | 974 |
| 1138 | Ga0466971_0382292 | 3300044719 | Bacteria | 684 |
| 1139 | Ga0466957_0160777 | 3300044842 | Bacteria | 1459 |
| 1140 | Ga0466959_0003780 | 3300045049 | Bacteria | 10032 |
| 1141 | Ga0451576_0002744 | 3300045051 | Bacteria | 25540 |
| 1142 | Ga0451576_0081985 | 3300045051 | Bacteria | 3354 |
| 1143 | Ga0451576_1298025 | 3300045051 | Bacteria | 759 |
| 1144 | Ga0466967_0010770 | 3300045976 | Bacteria | 6876 |
| 1145 | Ga0495592_0020926 | 3300046454 | Bacteria | 4976 |
| 1146 | Ga0495592_0145802 | 3300046454 | Unclassified | 1642 |
| 1147 | Ga0495592_0516637 | 3300046454 | Bacteria | 739 |
| 1148 | Ga0495603_0033957 | 3300046455 | Unclassified | 3069 |
| 1149 | Ga0495603_0255773 | 3300046455 | Bacteria | 1008 |
| 1150 | Ga0495629_0009423 | 3300046459 | Bacteria | 7141 |
| 1151 | Ga0495629_0021039 | 3300046459 | Bacteria | 4655 |
| 1152 | Ga0495629_0194719 | 3300046459 | Unclassified | 1402 |
| 1153 | Ga0495629_0553159 | 3300046459 | Bacteria | 772 |
| 1154 | Ga0495651_0005310 | 3300046462 | Bacteria | 9823 |
| 1155 | Ga0495651_0023595 | 3300046462 | Bacteria | 4783 |
| 1156 | Ga0495651_0029074 | 3300046462 | Bacteria | 4311 |
| 1157 | Ga0495651_0055560 | 3300046462 | Bacteria | 3042 |
| 1158 | Ga0495651_0067662 | 3300046462 | Bacteria | 2724 |
| 1159 | Ga0495651_0194208 | 3300046462 | Bacteria | 1426 |
| 1160 | Ga0495651_0477887 | 3300046462 | Bacteria | 801 |
| 1161 | Ga0495651_0572032 | 3300046462 | Bacteria | 716 |
| 1162 | Ga0495653_0004837 | 3300046463 | Bacteria | 10921 |
| 1163 | Ga0495653_0096955 | 3300046463 | Bacteria | 2143 |
| 1164 | Ga0495653_0127636 | 3300046463 | Bacteria | 1804 |
| 1165 | Ga0495580_0001970 | 3300046472 | Bacteria | 18028 |
| 1166 | Ga0495580_0008565 | 3300046472 | Bacteria | 8117 |
| 1167 | Ga0495580_0034985 | 3300046472 | Unclassified | 3614 |
| 1168 | Ga0495580_0075316 | 3300046472 | Bacteria | 2355 |
| 1169 | Ga0495580_0095136 | 3300046472 | Bacteria | 2072 |
| 1170 | Ga0495580_0203451 | 3300046472 | Bacteria | 1364 |
| 1171 | Ga0495580_0290830 | 3300046472 | Bacteria | 1114 |
| 1172 | Ga0495580_0349593 | 3300046472 | Bacteria | 1002 |
| 1173 | Ga0495582_0000255 | 3300046473 | Bacteria | 29705 |
| 1174 | Ga0495582_0023087 | 3300046473 | Bacteria | 3403 |
| 1175 | Ga0495582_0052653 | 3300046473 | Unclassified | 2244 |
| 1176 | Ga0495582_0069851 | 3300046473 | Bacteria | 1942 |
| 1177 | Ga0495582_0302795 | 3300046473 | Unclassified | 919 |
| 1178 | Ga0495639_0031000 | 3300046475 | Bacteria | 2378 |
| 1179 | Ga0495662_0042048 | 3300046476 | Unclassified | 2206 |
| 1180 | Ga0495662_0316233 | 3300046476 | Bacteria | 768 |
| 1181 | Ga0495664_0094229 | 3300046477 | Bacteria | 1802 |
| 1182 | Ga0495664_0145950 | 3300046477 | Bacteria | 1435 |
| 1183 | Ga0495664_0168741 | 3300046477 | Bacteria | 1328 |
| 1184 | Ga0495664_0198865 | 3300046477 | Bacteria | 1215 |
| 1185 | Ga0495664_0245294 | 3300046477 | Bacteria | 1083 |
| 1186 | Ga0495664_0398055 | 3300046477 | Bacteria | 827 |
| 1187 | Ga0495594_0049642 | 3300046499 | Bacteria | 2307 |
| 1188 | Ga0495594_0158855 | 3300046499 | Bacteria | 1285 |
| 1189 | Ga0495583_0011240 | 3300046506 | Bacteria | 5153 |
| 1190 | Ga0495606_0242505 | 3300046507 | Bacteria | 1004 |
| 1191 | Ga0495608_0016320 | 3300046511 | Bacteria | 5137 |
| 1192 | Ga0495608_0060218 | 3300046511 | Bacteria | 2499 |
| 1193 | Ga0495628_0018232 | 3300046516 | Bacteria | 5819 |
| 1194 | Ga0495628_0040792 | 3300046516 | Bacteria | 3708 |
| 1195 | Ga0495628_0068289 | 3300046516 | Unclassified | 2774 |
| 1196 | Ga0495628_0098366 | 3300046516 | Bacteria | 2260 |
| 1197 | Ga0495628_0192910 | 3300046516 | Bacteria | 1538 |
| 1198 | Ga0495628_0670598 | 3300046516 | Bacteria | 735 |
| 1199 | Ga0495630_0012890 | 3300046517 | Bacteria | 6073 |
| 1200 | Ga0495630_0668974 | 3300046517 | Bacteria | 795 |
| 1201 | Ga0495630_1137874 | 3300046517 | Bacteria | 591 |
| 1202 | Ga0495632_0106888 | 3300046519 | Bacteria | 1316 |
| 1203 | Ga0495666_0017540 | 3300046526 | Unclassified | 3565 |
| 1204 | Ga0495666_0068896 | 3300046526 | Bacteria | 1684 |
| 1205 | Ga0495652_0006027 | 3300046529 | Bacteria | 11340 |
| 1206 | Ga0495652_0014296 | 3300046529 | Bacteria | 7128 |
| 1207 | Ga0495652_0109741 | 3300046529 | Bacteria | 2221 |
| 1208 | Ga0495652_0119825 | 3300046529 | Bacteria | 2101 |
| 1209 | Ga0495652_0125081 | 3300046529 | Bacteria | 2044 |
| 1210 | Ga0495652_0271395 | 3300046529 | Bacteria | 1246 |
| 1211 | Ga0495652_0532657 | 3300046529 | Bacteria | 810 |
| 1212 | Ga0495665_0002414 | 3300046531 | Bacteria | 10097 |
| 1213 | Ga0495665_0043319 | 3300046531 | Unclassified | 2394 |
| 1214 | Ga0495665_0055060 | 3300046531 | Bacteria | 2101 |
| 1215 | Ga0495665_0081644 | 3300046531 | Bacteria | 1700 |
| 1216 | Ga0495665_0120067 | 3300046531 | Bacteria | 1377 |
| 1217 | Ga0495665_0240075 | 3300046531 | Bacteria | 934 |
| 1218 | Ga0495665_0301994 | 3300046531 | Unclassified | 820 |
| 1219 | Ga0495640_0007376 | 3300046533 | Bacteria | 8656 |
| 1220 | Ga0495586_0004250 | 3300046535 | Bacteria | 7660 |
| 1221 | Ga0495586_0025331 | 3300046535 | Unclassified | 3174 |
| 1222 | Ga0495586_0033544 | 3300046535 | Bacteria | 2755 |
| 1223 | Ga0495586_0038456 | 3300046535 | Unclassified | 2570 |
| 1224 | Ga0495586_0192584 | 3300046535 | Bacteria | 1155 |
| 1225 | Ga0495586_0247178 | 3300046535 | Bacteria | 1017 |
| 1226 | Ga0495587_0010437 | 3300046536 | Bacteria | 5912 |
| 1227 | Ga0495587_0024075 | 3300046536 | Bacteria | 3736 |
| 1228 | Ga0495587_0062628 | 3300046536 | Bacteria | 2177 |
| 1229 | Ga0495587_0070383 | 3300046536 | Bacteria | 2036 |
| 1230 | Ga0495587_0280994 | 3300046536 | Bacteria | 933 |
| 1231 | Ga0495587_0364515 | 3300046536 | Unclassified | 804 |
| 1232 | Ga0495587_0380575 | 3300046536 | Bacteria | 785 |
| 1233 | Ga0495645_0002621 | 3300046543 | Bacteria | 12232 |
| 1234 | Ga0495645_0006398 | 3300046543 | Bacteria | 8174 |
| 1235 | Ga0495645_0143585 | 3300046543 | Bacteria | 1663 |
| 1236 | Ga0495645_0238778 | 3300046543 | Unclassified | 1213 |
| 1237 | Ga0495645_0265425 | 3300046543 | Unclassified | 1135 |
| 1238 | Ga0495645_0281918 | 3300046543 | Bacteria | 1092 |
| 1239 | Ga0495622_0076440 | 3300046557 | Bacteria | 1543 |
| 1240 | Ga0495667_0019551 | 3300046559 | Bacteria | 4569 |
| 1241 | Ga0495667_0102175 | 3300046559 | Bacteria | 1854 |
| 1242 | Ga0495667_0340618 | 3300046559 | Bacteria | 948 |
| 1243 | Ga0495634_0087026 | 3300046642 | Bacteria | 2034 |
| 1244 | Ga0495625_0017254 | 3300046660 | Bacteria | 5653 |
| 1245 | Ga0495625_0097932 | 3300046660 | Bacteria | 2018 |
| 1246 | Ga0495635_0019092 | 3300046663 | Bacteria | 4786 |
| 1247 | Ga0495635_0072239 | 3300046663 | Bacteria | 2365 |
| 1248 | Ga0495635_0385825 | 3300046663 | Unclassified | 932 |
| 1249 | Ga0495657_0153492 | 3300046675 | Bacteria | 1429 |
| 1250 | Ga0495657_0169218 | 3300046675 | Bacteria | 1347 |
| 1251 | Ga0495657_0374905 | 3300046675 | Bacteria | 840 |
| 1252 | Ga0495657_0392233 | 3300046675 | Unclassified | 818 |
| 1253 | Ga0495599_0071000 | 3300046678 | Bacteria | 2174 |
| 1254 | Ga0495599_0206931 | 3300046678 | Bacteria | 1204 |
| 1255 | Ga0495599_0277381 | 3300046678 | Bacteria | 1016 |
| 1256 | Ga0495623_0002771 | 3300046679 | Bacteria | 11582 |
| 1257 | Ga0495623_0033445 | 3300046679 | Bacteria | 3299 |
| 1258 | Ga0495623_0037763 | 3300046679 | Bacteria | 3089 |
| 1259 | Ga0495646_0056392 | 3300046680 | Bacteria | 2355 |
| 1260 | Ga0495646_0074022 | 3300046680 | Unclassified | 2000 |
| 1261 | Ga0495646_0266390 | 3300046680 | Bacteria | 914 |
| 1262 | Ga0495658_0028290 | 3300046683 | Unclassified | 3024 |
| 1263 | Ga0495658_0043246 | 3300046683 | Bacteria | 2519 |
| 1264 | Ga0495658_0048485 | 3300046683 | Bacteria | 2395 |
| 1265 | Ga0495658_0513598 | 3300046683 | Unclassified | 767 |
| 1266 | Ga0495613_0063132 | 3300046689 | Bacteria | 2710 |
| 1267 | Ga0495613_0064422 | 3300046689 | Unclassified | 2680 |
| 1268 | Ga0495613_0104281 | 3300046689 | Bacteria | 2047 |
| 1269 | Ga0495613_0295192 | 3300046689 | Unclassified | 1123 |
| 1270 | Ga0495613_0296976 | 3300046689 | Bacteria | 1119 |
| 1271 | Ga0495624_0016828 | 3300046690 | Bacteria | 4919 |
| 1272 | Ga0495624_0036034 | 3300046690 | Bacteria | 3192 |
| 1273 | Ga0495670_0242982 | 3300046691 | Bacteria | 959 |
| 1274 | Ga0495600_0043393 | 3300046809 | Bacteria | 2933 |
| 1275 | Ga0495600_0052437 | 3300046809 | Bacteria | 2664 |
| 1276 | Ga0495600_0057638 | 3300046809 | Bacteria | 2537 |
| 1277 | Ga0495600_0098945 | 3300046809 | Bacteria | 1901 |
| 1278 | Ga0495600_0159044 | 3300046809 | Bacteria | 1461 |
| 1279 | Ga0495581_0045922 | 3300047315 | Unclassified | 2524 |
| 1280 | Ga0495581_0223333 | 3300047315 | Unclassified | 1101 |
| 1281 | Ga0495604_0007664 | 3300047317 | Bacteria | 8548 |
| 1282 | Ga0495604_0101146 | 3300047317 | Bacteria | 2118 |
| 1283 | Ga0495604_0176312 | 3300047317 | Bacteria | 1498 |
| 1284 | Ga0495604_0340131 | 3300047317 | Bacteria | 999 |
| 1285 | Ga0495604_0596347 | 3300047317 | Unclassified | 709 |
| 1286 | Ga0495674_0030006 | 3300047319 | Unclassified | 4947 |
| 1287 | Ga0495674_0088420 | 3300047319 | Bacteria | 2650 |
| 1288 | Ga0495674_0098283 | 3300047319 | Bacteria | 2493 |
| 1289 | Ga0495674_0107724 | 3300047319 | Unclassified | 2365 |
| 1290 | Ga0495674_0129386 | 3300047319 | Unclassified | 2128 |
| 1291 | Ga0495674_0207527 | 3300047319 | Bacteria | 1624 |
| 1292 | Ga0495674_0230055 | 3300047319 | Bacteria | 1530 |
| 1293 | Ga0495674_0693323 | 3300047319 | Bacteria | 800 |
| 1294 | Ga0495676_0042036 | 3300047321 | Unclassified | 3756 |
| 1295 | Ga0495676_0332809 | 3300047321 | Bacteria | 1018 |
| 1296 | Ga0495676_0439261 | 3300047321 | Bacteria | 862 |
| 1297 | Ga0495680_0000244 | 3300047322 | Bacteria | 60043 |
| 1298 | Ga0495680_0034311 | 3300047322 | Unclassified | 4099 |
| 1299 | Ga0495680_0062978 | 3300047322 | Bacteria | 2849 |
| 1300 | Ga0495683_0161671 | 3300047323 | Bacteria | 1035 |
| 1301 | Ga0495675_0009163 | 3300047444 | Bacteria | 6155 |
| 1302 | Ga0495675_0017775 | 3300047444 | Bacteria | 4509 |
| 1303 | Ga0495675_0259432 | 3300047444 | Bacteria | 1041 |
| 1304 | Ga0495684_0001166 | 3300047471 | Bacteria | 21130 |
| 1305 | Ga0495684_0010165 | 3300047471 | Bacteria | 7280 |
| 1306 | Ga0495684_0031692 | 3300047471 | Bacteria | 4060 |
| 1307 | Ga0495684_0047861 | 3300047471 | Bacteria | 3269 |
| 1308 | Ga0495684_0059328 | 3300047471 | Bacteria | 2914 |
| 1309 | Ga0495684_0267878 | 3300047471 | Bacteria | 1237 |
| 1310 | Ga0495684_0268226 | 3300047471 | Bacteria | 1236 |
| 1311 | Ga0495593_0040537 | 3300047673 | Bacteria | 2507 |
| 1312 | Ga0495602_0001165 | 3300048088 | Bacteria | 25733 |
| 1313 | Ga0495602_0078715 | 3300048088 | Bacteria | 2783 |
| 1314 | Ga0495602_0091649 | 3300048088 | Bacteria | 2520 |
| 1315 | Ga0495602_0131209 | 3300048088 | Bacteria | 1998 |
| 1316 | Ga0495602_0337080 | 3300048088 | Unclassified | 1092 |
| 1317 | Ga0495602_0435835 | 3300048088 | Bacteria | 928 |
| 1318 | Ga0495602_0786959 | 3300048088 | Bacteria | 640 |
| 1319 | Ga0495614_0050465 | 3300048089 | Bacteria | 1782 |
| 1320 | Ga0495614_0101854 | 3300048089 | Bacteria | 1256 |
| 1321 | Ga0496100_0792357 | 3300048903 | Bacteria | 742 |
| 1322 | Ga0496101_0199652 | 3300048904 | Bacteria | 1546 |
| 1323 | Ga0496102_0221000 | 3300048905 | Bacteria | 1786 |
| 1324 | Ga0496102_0564365 | 3300048905 | Bacteria | 1061 |
| 1325 | Ga0496104_0007093 | 3300048907 | Bacteria | 9878 |
| 1326 | Ga0496104_0239219 | 3300048907 | Bacteria | 1728 |
| 1327 | Ga0496104_0251254 | 3300048907 | Unclassified | 1681 |
| 1328 | Ga0496105_0007132 | 3300048908 | Bacteria | 8621 |
| 1329 | Ga0496105_0265831 | 3300048908 | Bacteria | 1386 |
| 1330 | Ga0496105_0773714 | 3300048908 | Unclassified | 732 |
| 1331 | Ga0496107_0824620 | 3300048910 | Bacteria | 678 |
| 1332 | Ga0496108_1177876 | 3300048911 | Bacteria | 649 |
| 1333 | Ga0496112_0005998 | 3300048915 | Bacteria | 10604 |
| 1334 | Ga0496112_0029023 | 3300048915 | Bacteria | 5347 |
| 1335 | Ga0496112_0061991 | 3300048915 | Bacteria | 3688 |
| 1336 | Ga0496112_0285842 | 3300048915 | Bacteria | 1596 |
| 1337 | Ga0496112_0376130 | 3300048915 | Bacteria | 1362 |
| 1338 | Ga0496112_0970945 | 3300048915 | Unclassified | 770 |
| 1339 | Ga0496114_0008506 | 3300048917 | Bacteria | 8136 |
| 1340 | Ga0496114_0013414 | 3300048917 | Bacteria | 6571 |
| 1341 | Ga0496114_0267583 | 3300048917 | Bacteria | 1506 |
| 1342 | Ga0496115_0004389 | 3300048918 | Bacteria | 10213 |
| 1343 | Ga0496115_0110730 | 3300048918 | Bacteria | 2255 |
| 1344 | Ga0496115_0125732 | 3300048918 | Bacteria | 2112 |
| 1345 | Ga0496115_0150820 | 3300048918 | Bacteria | 1919 |
| 1346 | Ga0496115_0159335 | 3300048918 | Bacteria | 1865 |
| 1347 | Ga0496115_0487826 | 3300048918 | Bacteria | 991 |
| 1348 | Ga0496115_0629992 | 3300048918 | Bacteria | 850 |
| 1349 | Ga0496126_0000063 | 3300048929 | Bacteria | 256841 |
| 1350 | Ga0495682_0037587 | 3300049460 | Bacteria | 1781 |
| 1351 | nmdc:mga0n895_55727_c1 | 3300050512 | Bacteria | 3891 |
| 1352 | nmdc:mga0n895_60052_c1 | 3300050512 | Bacteria | 3751 |
| 1353 | nmdc:mga0n895_62602_c1 | 3300050512 | Bacteria | 3678 |
| 1354 | nmdc:mga0rr50_12928_c1 | 3300050513 | Bacteria | 5414 |
| 1355 | nmdc:mga0rr50_384601_c1 | 3300050513 | Bacteria | 1184 |
| 1356 | nmdc:mga08x19_113_c1 | 3300050514 | Bacteria | 71736 |
| 1357 | nmdc:mga08x19_33799_c1 | 3300050514 | Bacteria | 3229 |
| 1358 | nmdc:mga08x19_6177_c1 | 3300050514 | Bacteria | 7084 |
| 1359 | nmdc:mga0a205_104383_c1 | 3300050515 | Bacteria | 2733 |
| 1360 | Ga0495601_0040152 | 3300053077 | Bacteria | 2931 |
| 1361 | Ga0495601_0067755 | 3300053077 | Bacteria | 2274 |
| 1362 | Ga0495601_0089897 | 3300053077 | Bacteria | 1975 |
| 1363 | Ga0495601_0190439 | 3300053077 | Bacteria | 1341 |
| 1364 | Ga0495612_0000322 | 3300053078 | Bacteria | 19413 |
| 1365 | Ga0495619_0095903 | 3300053085 | Bacteria | 2013 |
| 1366 | Ga0495619_0151232 | 3300053085 | Bacteria | 1601 |
| 1367 | Ga0500568_0001844 | 3300053139 | Bacteria | 13063 |
| 1368 | Ga0466962_0194109 | 3300061719 | Unclassified | 991 |
| 1369 | Ga0070680_100002791 | |||
| 1370 | rootH2_10053643 | |||
| 1371 | rootH2_10136940 | |||
| 1372 | rootH2_10159871 | |||
| 1373 | Ga0070658_10019380 | |||
| 1374 | Ga0070658_10053484 | |||
| 1375 | Ga0070676_10034872 | |||
| 1376 | Ga0070683_100001167 | |||
| 1377 | Ga0070683_100002912 | |||
| 1378 | Ga0070683_100008651 | |||
| 1379 | Ga0070683_100083113 | |||
| 1380 | Ga0070683_100289485 | |||
| 1381 | Ga0070683_100524715 | |||
| 1382 | Ga0070690_100057309 | |||
| 1383 | Ga0070690_100502589 | |||
| 1384 | Ga0070670_100076836 | |||
| 1385 | Ga0070670_100175601 | |||
| 1386 | Ga0070670_101016912 | |||
| 1387 | Ga0070670_101791560 | |||
| 1388 | Ga0068869_100000942 | |||
| 1389 | Ga0068869_100079658 | |||
| 1390 | Ga0068869_100368329 | |||
| 1391 | Ga0070666_10002688 | |||
| 1392 | Ga0070666_10009199 | |||
| 1393 | Ga0070666_10030825 | |||
| 1394 | Ga0070666_10577050 | |||
| 1395 | Ga0070680_100089413 | |||
| 1396 | Ga0070680_100290466 | |||
| 1397 | Ga0070680_100881916 | |||
| 1398 | Ga0070682_100423091 | |||
| 1399 | Ga0070682_100776895 | |||
| 1400 | Ga0070682_101022043 | |||
| 1401 | Ga0068868_100013761 | |||
| 1402 | Ga0068868_100018247 | |||
| 1403 | Ga0068868_100043783 | |||
| 1404 | Ga0068868_100046800 | |||
| 1405 | Ga0068868_100069082 | |||
| 1406 | Ga0068868_100263578 | |||
| 1407 | Ga0068868_100299193 | |||
| 1408 | Ga0070660_100000964 | |||
| 1409 | Ga0070660_100006653 | |||
| 1410 | Ga0070660_100529265 | |||
| 1411 | Ga0070660_100596049 | |||
| 1412 | Ga0070689_100633242 | |||
| 1413 | Ga0070689_100906050 | |||
| 1414 | Ga0070691_10004660 | |||
| 1415 | Ga0070687_100171656 | |||
| 1416 | Ga0070661_100013734 | |||
| 1417 | Ga0070661_100077289 | |||
| 1418 | Ga0070661_100177594 | |||
| 1419 | Ga0070661_100518613 | |||
| 1420 | Ga0070661_100531497 | |||
| 1421 | Ga0070668_100229617 | |||
| 1422 | Ga0070669_100209189 | |||
| 1423 | Ga0070671_100003769 | |||
| 1424 | Ga0070671_100031352 | |||
| 1425 | Ga0070674_100210053 | |||
| 1426 | Ga0070673_100018718 | |||
| 1427 | Ga0070673_100193511 | |||
| 1428 | Ga0070688_100105636 | |||
| 1429 | Ga0070667_100004496 | |||
| 1430 | Ga0070667_100067516 | |||
| 1431 | Ga0070667_100138801 | |||
| 1432 | Ga0070667_100164146 | |||
| 1433 | Ga0070667_100406939 | |||
| 1434 | Ga0070709_10037194 | |||
| 1435 | Ga0070709_10060853 | |||
| 1436 | Ga0070709_10098663 | |||
| 1437 | Ga0070709_10149426 | |||
| 1438 | Ga0070709_10219933 | |||
| 1439 | Ga0070714_100001316 | |||
| 1440 | Ga0070714_100033191 | |||
| 1441 | Ga0070714_100033743 | |||
| 1442 | Ga0070714_100206698 | |||
| 1443 | Ga0070713_100005133 | |||
| 1444 | Ga0070713_100010293 | |||
| 1445 | Ga0070713_100024734 | |||
| 1446 | Ga0070713_100028339 | |||
| 1447 | Ga0070713_100167635 | |||
| 1448 | Ga0070713_100202402 | |||
| 1449 | Ga0070713_100255553 | |||
| 1450 | Ga0070713_100277842 | |||
| 1451 | Ga0070713_100295859 | |||
| 1452 | Ga0070713_100447142 | |||
| 1453 | Ga0070713_100471936 | |||
| 1454 | Ga0070713_100989574 | |||
| 1455 | Ga0070710_10144946 | |||
| 1456 | Ga0070711_100029736 | |||
| 1457 | Ga0070711_100233389 | |||
| 1458 | Ga0070711_100346142 | |||
| 1459 | Ga0070711_100386413 | |||
| 1460 | Ga0070711_100544696 | |||
| 1461 | Ga0070705_100003409 | |||
| 1462 | Ga0070705_100371453 | |||
| 1463 | Ga0070705_101247200 | |||
| 1464 | Ga0070694_100325204 | |||
| 1465 | Ga0070694_100681716 | |||
| 1466 | Ga0070708_100018727 | |||
| 1467 | Ga0070708_100033475 | |||
| 1468 | Ga0070708_100317356 | |||
| 1469 | Ga0070663_100227775 | |||
| 1470 | Ga0070663_101357914 | |||
| 1471 | Ga0070678_100017959 | |||
| 1472 | Ga0070678_100066963 | |||
| 1473 | Ga0070678_100148689 | |||
| 1474 | Ga0070662_100075733 | |||
| 1475 | Ga0070681_10002161 | |||
| 1476 | Ga0070681_10019157 | |||
| 1477 | Ga0070681_10021511 | |||
| 1478 | Ga0070681_10038122 | |||
| 1479 | Ga0070681_10079381 | |||
| 1480 | Ga0070681_10598281 | |||
| 1481 | Ga0070681_10905225 | |||
| 1482 | Ga0068867_100020449 | |||
| 1483 | Ga0068867_100146161 | |||
| 1484 | Ga0068867_101075786 | |||
| 1485 | Ga0070685_10509934 | |||
| 1486 | Ga0070706_100024650 | |||
| 1487 | Ga0070706_100043943 | |||
| 1488 | Ga0070707_100019652 | |||
| 1489 | Ga0070707_100245014 | |||
| 1490 | Ga0070707_100258567 | |||
| 1491 | Ga0070707_100624856 | |||
| 1492 | Ga0070707_100659271 | |||
| 1493 | Ga0070707_101559869 | |||
| 1494 | Ga0070698_100005081 | |||
| 1495 | Ga0070698_100158095 | |||
| 1496 | Ga0070698_100320787 | |||
| 1497 | Ga0070699_100011938 | |||
| 1498 | Ga0070699_100088836 | |||
| 1499 | Ga0070699_100111350 | |||
| 1500 | Ga0070699_100158831 | |||
| 1501 | Ga0070699_100542531 | |||
| 1502 | Ga0070699_101166507 | |||
| 1503 | Ga0070679_100000717 | |||
| 1504 | Ga0070679_100004611 | |||
| 1505 | Ga0070679_100024699 | |||
| 1506 | Ga0070679_100037689 | |||
| 1507 | Ga0070679_100059369 | |||
| 1508 | Ga0070679_100172159 | |||
| 1509 | Ga0070679_100214698 | |||
| 1510 | Ga0070679_100407162 | |||
| 1511 | Ga0070679_100515083 | |||
| 1512 | Ga0070679_100939514 | |||
| 1513 | Ga0070684_100005071 | |||
| 1514 | Ga0070684_100007752 | |||
| 1515 | Ga0070684_100028468 | |||
| 1516 | Ga0070684_100030818 | |||
| 1517 | Ga0070684_100034594 | |||
| 1518 | Ga0070684_100064595 | |||
| 1519 | Ga0070684_100167652 | |||
| 1520 | Ga0070684_100241549 | |||
| 1521 | Ga0070684_100331854 | |||
| 1522 | Ga0070684_100442358 | |||
| 1523 | Ga0070684_100456417 | |||
| 1524 | Ga0070697_100000263 | |||
| 1525 | Ga0070697_100002908 | |||
| 1526 | Ga0070697_100962960 | |||
| 1527 | Ga0068853_100000944 | |||
| 1528 | Ga0068853_100008112 | |||
| 1529 | Ga0068853_100021062 | |||
| 1530 | Ga0068853_100071549 | |||
| 1531 | Ga0068853_100131788 | |||
| 1532 | Ga0068853_100208734 | |||
| 1533 | Ga0068853_100493543 | |||
| 1534 | Ga0068853_100757857 | |||
| 1535 | Ga0070672_100009395 | |||
| 1536 | Ga0070695_100002760 | |||
| 1537 | Ga0070695_100354032 | |||
| 1538 | Ga0070695_100699183 | |||
| 1539 | Ga0070696_100002545 | |||
| 1540 | Ga0070696_100147831 | |||
| 1541 | Ga0070693_100000019 | |||
| 1542 | Ga0070693_100017961 | |||
| 1543 | Ga0070693_100504600 | |||
| 1544 | Ga0070665_100000462 | |||
| 1545 | Ga0070665_100013679 | |||
| 1546 | Ga0070665_100029122 | |||
| 1547 | Ga0070665_100133650 | |||
| 1548 | Ga0070665_101525718 | |||
| 1549 | Ga0070665_101590747 | |||
| 1550 | Ga0070704_100016339 | |||
| 1551 | Ga0068855_100000623 | |||
| 1552 | Ga0068855_100000881 | |||
| 1553 | Ga0068855_100003034 | |||
| 1554 | Ga0068855_100003302 | |||
| 1555 | Ga0068855_100012148 | |||
| 1556 | Ga0068855_100014232 | |||
| 1557 | Ga0068855_100016829 | |||
| 1558 | Ga0068855_100018146 | |||
| 1559 | Ga0068855_100039853 | |||
| 1560 | Ga0068855_100051393 | |||
| 1561 | Ga0068855_100309955 | |||
| 1562 | Ga0068855_100313375 | |||
| 1563 | Ga0068855_100548416 | |||
| 1564 | Ga0070664_100100786 | |||
| 1565 | Ga0070664_100145461 | |||
| 1566 | Ga0070664_100168669 | |||
| 1567 | Ga0070664_100335160 | |||
| 1568 | Ga0070664_100364621 | |||
| 1569 | Ga0070664_100813239 | |||
| 1570 | Ga0070664_101182300 | |||
| 1571 | Ga0068857_100017037 | |||
| 1572 | Ga0068857_100021936 | |||
| 1573 | Ga0068857_100022792 | |||
| 1574 | Ga0068857_100025040 | |||
| 1575 | Ga0068857_100044277 | |||
| 1576 | Ga0068857_100053450 | |||
| 1577 | Ga0068857_100111085 | |||
| 1578 | Ga0068857_100111674 | |||
| 1579 | Ga0068857_100209563 | |||
| 1580 | Ga0068857_101302338 | |||
| 1581 | Ga0068854_100038491 | |||
| 1582 | Ga0068854_100064472 | |||
| 1583 | Ga0068854_100069176 | |||
| 1584 | Ga0068854_100690831 | |||
| 1585 | Ga0068854_101454843 | |||
| 1586 | Ga0068856_100001516 | |||
| 1587 | Ga0068856_100005713 | |||
| 1588 | Ga0068856_100014367 | |||
| 1589 | Ga0068856_100025657 | |||
| 1590 | Ga0068856_100027890 | |||
| 1591 | Ga0068856_100068514 | |||
| 1592 | Ga0068856_100105509 | |||
| 1593 | Ga0068856_100137875 | |||
| 1594 | Ga0068856_100230190 | |||
| 1595 | Ga0068856_100236337 | |||
| 1596 | Ga0068856_100272778 | |||
| 1597 | Ga0068856_100334001 | |||
| 1598 | Ga0068856_100424855 | |||
| 1599 | Ga0068856_100569240 | |||
| 1600 | Ga0068856_100589450 | |||
| 1601 | Ga0068856_101353748 | |||
| 1602 | Ga0070702_100494083 | |||
| 1603 | Ga0068852_100000049 | |||
| 1604 | Ga0068852_100000095 | |||
| 1605 | Ga0068852_100001588 | |||
| 1606 | Ga0068852_100072304 | |||
| 1607 | Ga0068852_100085203 | |||
| 1608 | Ga0068852_100132326 | |||
| 1609 | Ga0068852_100135084 | |||
| 1610 | Ga0068852_100282096 | |||
| 1611 | Ga0068852_100356742 | |||
| 1612 | Ga0068852_100419687 | |||
| 1613 | Ga0068852_100561054 | |||
| 1614 | Ga0068852_100663889 | |||
| 1615 | Ga0068859_100010731 | |||
| 1616 | Ga0068859_100076870 | |||
| 1617 | Ga0068859_100087987 | |||
| 1618 | Ga0068859_100154705 | |||
| 1619 | Ga0068859_100563875 | |||
| 1620 | Ga0068859_101330067 | |||
| 1621 | Ga0068864_100067962 | |||
| 1622 | Ga0068864_100174155 | |||
| 1623 | Ga0068864_100321593 | |||
| 1624 | Ga0068864_100545486 | |||
| 1625 | Ga0068864_100569611 | |||
| 1626 | Ga0068851_10003156 | |||
| 1627 | Ga0068851_10007873 | |||
| 1628 | Ga0068851_10019714 | |||
| 1629 | Ga0068851_10185900 | |||
| 1630 | Ga0068851_10403132 | |||
| 1631 | Ga0068863_100001861 | |||
| 1632 | Ga0068863_100002734 | |||
| 1633 | Ga0068863_100013281 | |||
| 1634 | Ga0068863_100038542 | |||
| 1635 | Ga0068863_100074220 | |||
| 1636 | Ga0068863_100109556 | |||
| 1637 | Ga0068863_100321056 | |||
| 1638 | Ga0068863_100342390 | |||
| 1639 | Ga0068858_100000841 | |||
| 1640 | Ga0068858_100020811 | |||
| 1641 | Ga0068858_100043484 | |||
| 1642 | Ga0068858_100405203 | |||
| 1643 | Ga0068858_100659821 | |||
| 1644 | Ga0068860_100001780 | |||
| 1645 | Ga0068860_100030529 | |||
| 1646 | Ga0068860_100045391 | |||
| 1647 | Ga0068860_100227633 | |||
| 1648 | Ga0068860_100429416 | |||
| 1649 | Ga0068860_100915634 | |||
| 1650 | Ga0068862_100021633 | |||
| 1651 | Ga0081540_1117804 | |||
| 1652 | Ga0070717_10002283 | |||
| 1653 | Ga0070717_10005514 | |||
| 1654 | Ga0070717_10011465 | |||
| 1655 | Ga0070717_10073027 | |||
| 1656 | Ga0070717_10176352 | |||
| 1657 | Ga0070717_10613410 | |||
| 1658 | Ga0070715_10008583 | |||
| 1659 | Ga0070715_10062105 | |||
| 1660 | Ga0070715_10178689 | |||
| 1661 | Ga0070715_10337399 | |||
| 1662 | Ga0070715_10635841 | |||
| 1663 | Ga0070716_100001038 | |||
| 1664 | Ga0070716_100013740 | |||
| 1665 | Ga0070716_100078419 | |||
| 1666 | Ga0070716_100530411 | |||
| 1667 | Ga0070712_100034335 | |||
| 1668 | Ga0070712_100042614 | |||
| 1669 | Ga0070712_100097671 | |||
| 1670 | Ga0070712_100265432 | |||
| 1671 | Ga0097621_100035301 | |||
| 1672 | Ga0097621_100057496 | |||
| 1673 | Ga0097621_100058819 | |||
| 1674 | Ga0097621_100073085 | |||
| 1675 | Ga0097621_100092443 | |||
| 1676 | Ga0097621_100103991 | |||
| 1677 | Ga0097621_100160140 | |||
| 1678 | Ga0097621_100205394 | |||
| 1679 | Ga0097621_100318938 | |||
| 1680 | Ga0097621_100361780 | |||
| 1681 | Ga0097621_100379108 | |||
| 1682 | Ga0097621_100404149 | |||
| 1683 | Ga0097621_100454023 | |||
| 1684 | Ga0097621_100638933 | |||
| 1685 | Ga0097621_101068484 | |||
| 1686 | Ga0068871_100005207 | |||
| 1687 | Ga0068871_100028148 | |||
| 1688 | Ga0068871_100029558 | |||
| 1689 | Ga0068871_100042290 | |||
| 1690 | Ga0068871_100066082 | |||
| 1691 | Ga0068871_100074706 | |||
| 1692 | Ga0068871_100235591 | |||
| 1693 | Ga0068871_100241901 | |||
| 1694 | Ga0068871_100351006 | |||
| 1695 | Ga0068871_100362797 | |||
| 1696 | Ga0068871_100925860 | |||
| 1697 | Ga0075433_10087365 | |||
| 1698 | Ga0075434_100049162 | |||
| 1699 | Ga0075434_100073522 | |||
| 1700 | Ga0068865_100064219 | |||
| 1701 | Ga0075436_100000559 | |||
| 1702 | Ga0075436_100012467 | |||
| 1703 | Ga0075436_100019468 | |||
| 1704 | Ga0075436_100110523 | |||
| 1705 | Ga0097620_100010731 | |||
| 1706 | Ga0097620_100076873 | |||
| 1707 | Ga0097620_100087983 | |||
| 1708 | Ga0097620_100154702 | |||
| 1709 | Ga0097620_100563863 | |||
| 1710 | Ga0097620_101330252 | |||
| 1711 | Ga0075435_100139853 | |||
| 1712 | Ga0075435_100544134 | |||
| 1713 | Ga0099794_10008896 | |||
| 1714 | Ga0099794_10018002 | |||
| 1715 | Ga0099794_10047024 | |||
| 1716 | Ga0099794_10052137 | |||
| 1717 | Ga0099794_10101377 | |||
| 1718 | Ga0099794_10188614 | |||
| 1719 | Ga0099794_10199598 | |||
| 1720 | Ga0099794_10255239 | |||
| 1721 | Ga0099794_10310098 | |||
| 1722 | Ga0099794_10351365 | |||
| 1723 | Ga0099794_10452395 | |||
| 1724 | Ga0099795_10006652 | |||
| 1725 | Ga0099795_10201743 | |||
| 1726 | Ga0105240_10000002 | |||
| 1727 | Ga0105240_10000839 | |||
| 1728 | Ga0105240_10000904 | |||
| 1729 | Ga0105240_10001150 | |||
| 1730 | Ga0105240_10001167 | |||
| 1731 | Ga0105240_10001456 | |||
| 1732 | Ga0105240_10003229 | |||
| 1733 | Ga0105240_10004689 | |||
| 1734 | Ga0105240_10005098 | |||
| 1735 | Ga0105240_10006651 | |||
| 1736 | Ga0105240_10007154 | |||
| 1737 | Ga0105240_10029233 | |||
| 1738 | Ga0105240_10099435 | |||
| 1739 | Ga0105240_10114317 | |||
| 1740 | Ga0105240_10154906 | |||
| 1741 | Ga0105240_10174958 | |||
| 1742 | Ga0105240_10203660 | |||
| 1743 | Ga0105240_10238967 | |||
| 1744 | Ga0105240_10240351 | |||
| 1745 | Ga0105240_10256960 | |||
| 1746 | Ga0105240_10580644 | |||
| 1747 | Ga0105240_10588221 | |||
| 1748 | Ga0105240_10652870 | |||
| 1749 | Ga0105240_11253303 | |||
| 1750 | Ga0105240_11711543 | |||
| 1751 | Ga0105245_10002156 | |||
| 1752 | Ga0105245_10009911 | |||
| 1753 | Ga0105245_10012128 | |||
| 1754 | Ga0105245_10019044 | |||
| 1755 | Ga0105245_10028926 | |||
| 1756 | Ga0105245_10036183 | |||
| 1757 | Ga0105245_10072027 | |||
| 1758 | Ga0105245_10127612 | |||
| 1759 | Ga0105245_10205987 | |||
| 1760 | Ga0105245_10378823 | |||
| 1761 | Ga0105245_10907997 | |||
| 1762 | Ga0105245_11001472 | |||
| 1763 | Ga0105247_10009974 | |||
| 1764 | Ga0105247_10030120 | |||
| 1765 | Ga0105247_10104596 | |||
| 1766 | Ga0105247_10363699 | |||
| 1767 | Ga0105247_10597619 | |||
| 1768 | Ga0105247_10695124 | |||
| 1769 | Ga0114129_11987220 | |||
| 1770 | Ga0105243_10056567 | |||
| 1771 | Ga0105243_10134055 | |||
| 1772 | Ga0105243_10222771 | |||
| 1773 | Ga0105243_10224694 | |||
| 1774 | Ga0105243_10588120 | |||
| 1775 | Ga0105241_10000014 | |||
| 1776 | Ga0105241_10004691 | |||
| 1777 | Ga0105241_10005338 | |||
| 1778 | Ga0105241_10007806 | |||
| 1779 | Ga0105241_10009235 | |||
| 1780 | Ga0105241_10019492 | |||
| 1781 | Ga0105241_10057417 | |||
| 1782 | Ga0105241_10058284 | |||
| 1783 | Ga0105241_10082039 | |||
| 1784 | Ga0105241_10107535 | |||
| 1785 | Ga0105241_10119461 | |||
| 1786 | Ga0105241_10225789 | |||
| 1787 | Ga0105241_10335764 | |||
| 1788 | Ga0105241_10469447 | |||
| 1789 | Ga0105241_10643576 | |||
| 1790 | Ga0105241_10740925 | |||
| 1791 | Ga0105241_10893930 | |||
| 1792 | Ga0105242_10011241 | |||
| 1793 | Ga0105242_10035741 | |||
| 1794 | Ga0105242_10107437 | |||
| 1795 | Ga0105242_10112272 | |||
| 1796 | Ga0105242_10112723 | |||
| 1797 | Ga0105242_10113453 | |||
| 1798 | Ga0105242_10256249 | |||
| 1799 | Ga0105242_10317198 | |||
| 1800 | Ga0105242_10424834 | |||
| 1801 | Ga0105242_10552998 | |||
| 1802 | Ga0105242_10613814 | |||
| 1803 | Ga0105242_10940387 | |||
| 1804 | Ga0105242_11368688 | |||
| 1805 | Ga0105248_10004322 | |||
| 1806 | Ga0105248_10023504 | |||
| 1807 | Ga0105248_10036438 | |||
| 1808 | Ga0105248_10059800 | |||
| 1809 | Ga0105248_10080095 | |||
| 1810 | Ga0105248_10117786 | |||
| 1811 | Ga0105248_10160799 | |||
| 1812 | Ga0105248_10445357 | |||
| 1813 | Ga0105248_10589521 | |||
| 1814 | Ga0105248_10633792 | |||
| 1815 | Ga0105248_10764333 | |||
| 1816 | Ga0105248_11075935 | |||
| 1817 | Ga0105237_10003893 | |||
| 1818 | Ga0105237_10007736 | |||
| 1819 | Ga0105237_10010226 | |||
| 1820 | Ga0105237_10023341 | |||
| 1821 | Ga0105237_10029243 | |||
| 1822 | Ga0105237_10092676 | |||
| 1823 | Ga0105237_10122584 | |||
| 1824 | Ga0105237_10265275 | |||
| 1825 | Ga0105237_10628732 | |||
| 1826 | Ga0105237_10742186 | |||
| 1827 | Ga0105237_11692647 | |||
| 1828 | Ga0105238_10000658 | |||
| 1829 | Ga0105238_10001077 | |||
| 1830 | Ga0105238_10003880 | |||
| 1831 | Ga0105238_10009399 | |||
| 1832 | Ga0105238_10009529 | |||
| 1833 | Ga0105238_10024560 | |||
| 1834 | Ga0105238_10025711 | |||
| 1835 | Ga0105238_10032757 | |||
| 1836 | Ga0105238_10038804 | |||
| 1837 | Ga0105238_10071939 | |||
| 1838 | Ga0105238_10258961 | |||
| 1839 | Ga0105238_11202481 | |||
| 1840 | Ga0105238_11647251 | |||
| 1841 | Ga0105249_10009429 | |||
| 1842 | Ga0105249_10051778 | |||
| 1843 | Ga0105249_10076853 | |||
| 1844 | Ga0105249_10704935 | |||
| 1845 | Ga0099796_10004116 | |||
| 1846 | Ga0105239_10002219 | |||
| 1847 | Ga0105239_10006418 | |||
| 1848 | Ga0105239_10007915 | |||
| 1849 | Ga0105239_10010547 | |||
| 1850 | Ga0105239_10013129 | |||
| 1851 | Ga0105239_10017993 | |||
| 1852 | Ga0105239_10076896 | |||
| 1853 | Ga0105239_10123673 | |||
| 1854 | Ga0105239_10154445 | |||
| 1855 | Ga0105239_10205403 | |||
| 1856 | Ga0105239_10210253 | |||
| 1857 | Ga0105246_10001710 | |||
| 1858 | Ga0105246_10004304 | |||
| 1859 | Ga0105246_10146269 | |||
| 1860 | Ga0105246_10662824 | |||
| 1861 | Ga0157373_10064781 | |||
| 1862 | Ga0157373_10846679 | |||
| 1863 | Ga0157373_10896115 | |||
| 1864 | Ga0157371_10314099 | |||
| 1865 | Ga0157371_10373274 | |||
| 1866 | Ga0157371_10451024 | |||
| 1867 | Ga0157370_10000005 | |||
| 1868 | Ga0157370_10002893 | |||
| 1869 | Ga0157370_10003670 | |||
| 1870 | Ga0157370_10004975 | |||
| 1871 | Ga0157370_10035401 | |||
| 1872 | Ga0157370_10074183 | |||
| 1873 | Ga0157370_10121051 | |||
| 1874 | Ga0157370_10551093 | |||
| 1875 | Ga0157370_10768674 | |||
| 1876 | Ga0157370_11128978 | |||
| 1877 | Ga0157369_10000266 | |||
| 1878 | Ga0157369_10003469 | |||
| 1879 | Ga0157369_10003568 | |||
| 1880 | Ga0157369_10018391 | |||
| 1881 | Ga0157369_10027298 | |||
| 1882 | Ga0157369_10028160 | |||
| 1883 | Ga0157369_10030376 | |||
| 1884 | Ga0157369_10034284 | |||
| 1885 | Ga0157369_10039645 | |||
| 1886 | Ga0157369_10079146 | |||
| 1887 | Ga0157369_10101391 | |||
| 1888 | Ga0157369_10139154 | |||
| 1889 | Ga0157369_10201143 | |||
| 1890 | Ga0157369_10220341 | |||
| 1891 | Ga0157369_10242034 | |||
| 1892 | Ga0157369_10285702 | |||
| 1893 | Ga0157369_10288127 | |||
| 1894 | Ga0157369_10498646 | |||
| 1895 | Ga0157374_10002719 | |||
| 1896 | Ga0157374_10002942 | |||
| 1897 | Ga0157374_10003429 | |||
| 1898 | Ga0157374_10072850 | |||
| 1899 | Ga0157374_10109021 | |||
| 1900 | Ga0157374_10131929 | |||
| 1901 | Ga0157374_10139231 | |||
| 1902 | Ga0157374_10208387 | |||
| 1903 | Ga0157374_10311589 | |||
| 1904 | Ga0157374_10497724 | |||
| 1905 | Ga0157374_10676973 | |||
| 1906 | Ga0157374_10857486 | |||
| 1907 | Ga0157374_10942614 | |||
| 1908 | Ga0157374_11474199 | |||
| 1909 | Ga0157374_11860916 | |||
| 1910 | Ga0157378_10000316 | |||
| 1911 | Ga0157378_10009939 | |||
| 1912 | Ga0157378_10017618 | |||
| 1913 | Ga0157378_10045935 | |||
| 1914 | Ga0157378_10124410 | |||
| 1915 | Ga0157378_10210903 | |||
| 1916 | Ga0157378_10510080 | |||
| 1917 | Ga0157378_10561282 | |||
| 1918 | Ga0157378_10590058 | |||
| 1919 | Ga0157378_10596771 | |||
| 1920 | Ga0157378_10792232 | |||
| 1921 | Ga0157378_10803673 | |||
| 1922 | Ga0157378_10809115 | |||
| 1923 | Ga0157378_10854551 | |||
| 1924 | Ga0163162_10004608 | |||
| 1925 | Ga0163162_10017631 | |||
| 1926 | Ga0163162_10020819 | |||
| 1927 | Ga0163162_10042380 | |||
| 1928 | Ga0163162_10427055 | |||
| 1929 | Ga0163162_10437004 | |||
| 1930 | Ga0163162_10480415 | |||
| 1931 | Ga0163162_10689098 | |||
| 1932 | Ga0163162_11706160 | |||
| 1933 | Ga0163162_12110012 | |||
| 1934 | Ga0157372_10000755 | |||
| 1935 | Ga0157372_10002651 | |||
| 1936 | Ga0157372_10005248 | |||
| 1937 | Ga0157372_10009747 | |||
| 1938 | Ga0157372_10013164 | |||
| 1939 | Ga0157372_10016918 | |||
| 1940 | Ga0157372_10025746 | |||
| 1941 | Ga0157372_10041998 | |||
| 1942 | Ga0157372_10055961 | |||
| 1943 | Ga0157372_10056203 | |||
| 1944 | Ga0157372_10118521 | |||
| 1945 | Ga0157372_10136260 | |||
| 1946 | Ga0157372_10474625 | |||
| 1947 | Ga0157372_10606817 | |||
| 1948 | Ga0157372_10669648 | |||
| 1949 | Ga0157372_10832683 | |||
| 1950 | Ga0157372_11059881 | |||
| 1951 | Ga0157372_11097825 | |||
| 1952 | Ga0157372_11355445 | |||
| 1953 | Ga0157372_11685072 | |||
| 1954 | Ga0157372_12225339 | |||
| 1955 | Ga0157375_10009399 | |||
| 1956 | Ga0157375_10019853 | |||
| 1957 | Ga0157375_10072366 | |||
| 1958 | Ga0157375_10198083 | |||
| 1959 | Ga0157375_10346612 | |||
| 1960 | Ga0157375_10355611 | |||
| 1961 | Ga0157375_10388376 | |||
| 1962 | Ga0157375_11132328 | |||
| 1963 | Ga0163163_10001566 | |||
| 1964 | Ga0163163_10003008 | |||
| 1965 | Ga0163163_10049024 | |||
| 1966 | Ga0163163_10083023 | |||
| 1967 | Ga0163163_10178213 | |||
| 1968 | Ga0163163_10216082 | |||
| 1969 | Ga0163163_10248958 | |||
| 1970 | Ga0163163_10297226 | |||
| 1971 | Ga0163163_10304263 | |||
| 1972 | Ga0163163_10396601 | |||
| 1973 | Ga0163163_10436062 | |||
| 1974 | Ga0163163_10497457 | |||
| 1975 | Ga0163163_10716468 | |||
| 1976 | Ga0157377_10084310 | |||
| 1977 | Ga0157379_10039454 | |||
| 1978 | Ga0157379_10083192 | |||
| 1979 | Ga0157379_10084780 | |||
| 1980 | Ga0157379_10091751 | |||
| 1981 | Ga0157379_10117979 | |||
| 1982 | Ga0157379_10223685 | |||
| 1983 | Ga0157379_10306748 | |||
| 1984 | Ga0157379_10409085 | |||
| 1985 | Ga0157379_10631359 | |||
| 1986 | Ga0157379_10769929 | |||
| 1987 | Ga0157376_10000040 | |||
| 1988 | Ga0157376_10010806 | |||
| 1989 | Ga0157376_10059744 | |||
| 1990 | Ga0157376_10075430 | |||
| 1991 | Ga0157376_10232919 | |||
| 1992 | Ga0157376_10243819 | |||
| 1993 | Ga0157376_10680440 | |||
| 1994 | Ga0157376_10685054 | |||
| 1995 | Ga0157376_10749769 | |||
| 1996 | Ga0157376_10754546 | |||
| 1997 | Ga0157376_11163105 | |||
| 1998 | Ga0157376_11552305 | |||
| 1999 | Ga0163161_10044673 | |||
| 2000 | Ga0206351_10035105 | |||
| 2001 | Ga0213874_10190105 | |||
| 2002 | Ga0213876_10017317 | |||
| 2003 | Ga0213876_10458249 | |||
| 2004 | Ga0213876_10486054 | |||
| 2005 | Ga0224572_1025417 | |||
| 2006 | Ga0228598_1012620 | |||
| 2007 | Ga0228598_1063680 | |||
| 2008 | Ga0209437_115078 | |||
| 2009 | Ga0209233_1005124 | |||
| 2010 | Ga0207697_10096556 | |||
| 2011 | Ga0207697_10188643 | |||
| 2012 | Ga0207656_10002473 | |||
| 2013 | Ga0207656_10012793 | |||
| 2014 | Ga0207656_10122151 | |||
| 2015 | Ga0207656_10129802 | |||
| 2016 | Ga0207656_10132156 | |||
| 2017 | Ga0207653_10003592 | |||
| 2018 | Ga0207692_10084276 | |||
| 2019 | Ga0207692_10324155 | |||
| 2020 | Ga0207710_10001958 | |||
| 2021 | Ga0207710_10066889 | |||
| 2022 | Ga0207710_10094597 | |||
| 2023 | Ga0207680_10001465 | |||
| 2024 | Ga0207680_10030433 | |||
| 2025 | Ga0207680_10119514 | |||
| 2026 | Ga0207685_10177109 | |||
| 2027 | Ga0207685_10189675 | |||
| 2028 | Ga0207699_10011702 | |||
| 2029 | Ga0207699_10012146 | |||
| 2030 | Ga0207699_10056306 | |||
| 2031 | Ga0207699_10130620 | |||
| 2032 | Ga0207645_10068410 | |||
| 2033 | Ga0207705_10005460 | |||
| 2034 | Ga0207705_10099448 | |||
| 2035 | Ga0207705_10730318 | |||
| 2036 | Ga0207684_10008000 | |||
| 2037 | Ga0207684_10358390 | |||
| 2038 | Ga0207684_10434044 | |||
| 2039 | Ga0207654_10000018 | |||
| 2040 | Ga0207654_10000559 | |||
| 2041 | Ga0207654_10002749 | |||
| 2042 | Ga0207654_10003369 | |||
| 2043 | Ga0207654_10015104 | |||
| 2044 | Ga0207654_10029747 | |||
| 2045 | Ga0207654_10078749 | |||
| 2046 | Ga0207654_10112676 | |||
| 2047 | Ga0207654_10255465 | |||
| 2048 | Ga0207654_10288296 | |||
| 2049 | Ga0207707_10002540 | |||
| 2050 | Ga0207707_10013981 | |||
| 2051 | Ga0207707_10024120 | |||
| 2052 | Ga0207707_10026986 | |||
| 2053 | Ga0207707_10087217 | |||
| 2054 | Ga0207707_10290186 | |||
| 2055 | Ga0207707_10489208 | |||
| 2056 | Ga0207695_10000167 | |||
| 2057 | Ga0207695_10000297 | |||
| 2058 | Ga0207695_10000384 | |||
| 2059 | Ga0207695_10000539 | |||
| 2060 | Ga0207695_10000770 | |||
| 2061 | Ga0207695_10000825 | |||
| 2062 | Ga0207695_10000942 | |||
| 2063 | Ga0207695_10003871 | |||
| 2064 | Ga0207695_10006112 | |||
| 2065 | Ga0207695_10015143 | |||
| 2066 | Ga0207695_10039408 | |||
| 2067 | Ga0207695_10078908 | |||
| 2068 | Ga0207695_10120599 | |||
| 2069 | Ga0207695_10260635 | |||
| 2070 | Ga0207695_10314767 | |||
| 2071 | Ga0207695_10323390 | |||
| 2072 | Ga0207695_10323537 | |||
| 2073 | Ga0207695_10376491 | |||
| 2074 | Ga0207695_10395491 | |||
| 2075 | Ga0207695_10420130 | |||
| 2076 | Ga0207695_10545255 | |||
| 2077 | Ga0207695_10642066 | |||
| 2078 | Ga0207695_10952207 | |||
| 2079 | Ga0207671_10000207 | |||
| 2080 | Ga0207671_10000211 | |||
| 2081 | Ga0207671_10005189 | |||
| 2082 | Ga0207671_10015635 | |||
| 2083 | Ga0207671_10041861 | |||
| 2084 | Ga0207671_10135677 | |||
| 2085 | Ga0207671_10196651 | |||
| 2086 | Ga0207671_10299234 | |||
| 2087 | Ga0207671_10335874 | |||
| 2088 | Ga0207671_10723480 | |||
| 2089 | Ga0207671_10851874 | |||
| 2090 | Ga0207671_10890423 | |||
| 2091 | Ga0207693_10098395 | |||
| 2092 | Ga0207693_10111920 | |||
| 2093 | Ga0207693_10176508 | |||
| 2094 | Ga0207693_10183606 | |||
| 2095 | Ga0207693_10320981 | |||
| 2096 | Ga0207663_10102556 | |||
| 2097 | Ga0207663_10449234 | |||
| 2098 | Ga0207663_10530111 | |||
| 2099 | Ga0207663_10576954 | |||
| 2100 | Ga0207663_11084614 | |||
| 2101 | Ga0207660_10003140 | |||
| 2102 | Ga0207660_10024648 | |||
| 2103 | Ga0207660_10231891 | |||
| 2104 | Ga0207660_10311890 | |||
| 2105 | Ga0207660_10551360 | |||
| 2106 | Ga0207657_10002306 | |||
| 2107 | Ga0207657_10082827 | |||
| 2108 | Ga0207657_10116390 | |||
| 2109 | Ga0207649_10007995 | |||
| 2110 | Ga0207649_10100879 | |||
| 2111 | Ga0207649_10108322 | |||
| 2112 | Ga0207649_10303202 | |||
| 2113 | Ga0207649_10313814 | |||
| 2114 | Ga0207649_10476582 | |||
| 2115 | Ga0207649_10562911 | |||
| 2116 | Ga0207652_10004686 | |||
| 2117 | Ga0207652_10006572 | |||
| 2118 | Ga0207652_10009897 | |||
| 2119 | Ga0207652_10138131 | |||
| 2120 | Ga0207652_10147122 | |||
| 2121 | Ga0207652_10285803 | |||
| 2122 | Ga0207652_10784655 | |||
| 2123 | Ga0207646_10045435 | |||
| 2124 | Ga0207646_10123715 | |||
| 2125 | Ga0207646_10155479 | |||
| 2126 | Ga0207646_10160426 | |||
| 2127 | Ga0207646_10185887 | |||
| 2128 | Ga0207646_10358215 | |||
| 2129 | Ga0207646_10539089 | |||
| 2130 | Ga0207646_11156013 | |||
| 2131 | Ga0207681_10191336 | |||
| 2132 | Ga0207681_10359015 | |||
| 2133 | Ga0207694_10000118 | |||
| 2134 | Ga0207694_10000484 | |||
| 2135 | Ga0207694_10000823 | |||
| 2136 | Ga0207694_10001030 | |||
| 2137 | Ga0207694_10005449 | |||
| 2138 | Ga0207694_10024333 | |||
| 2139 | Ga0207694_10029031 | |||
| 2140 | Ga0207694_10031174 | |||
| 2141 | Ga0207694_10035630 | |||
| 2142 | Ga0207694_10046448 | |||
| 2143 | Ga0207694_10095502 | |||
| 2144 | Ga0207694_10125980 | |||
| 2145 | Ga0207694_10328220 | |||
| 2146 | Ga0207650_10155100 | |||
| 2147 | Ga0207650_11540121 | |||
| 2148 | Ga0207659_10109918 | |||
| 2149 | Ga0207687_10003603 | |||
| 2150 | Ga0207687_10022716 | |||
| 2151 | Ga0207687_10062250 | |||
| 2152 | Ga0207687_10081065 | |||
| 2153 | Ga0207687_10138547 | |||
| 2154 | Ga0207687_10161699 | |||
| 2155 | Ga0207687_10314447 | |||
| 2156 | Ga0207687_10386954 | |||
| 2157 | Ga0207687_10639357 | |||
| 2158 | Ga0207687_11607907 | |||
| 2159 | Ga0207700_10002914 | |||
| 2160 | Ga0207700_10028252 | |||
| 2161 | Ga0207700_10044198 | |||
| 2162 | Ga0207700_10084438 | |||
| 2163 | Ga0207700_10299647 | |||
| 2164 | Ga0207664_10012235 | |||
| 2165 | Ga0207664_10037869 | |||
| 2166 | Ga0207664_10110490 | |||
| 2167 | Ga0207664_10461067 | |||
| 2168 | Ga0207664_10513134 | |||
| 2169 | Ga0207664_10917148 | |||
| 2170 | Ga0207644_10005916 | |||
| 2171 | Ga0207644_10034067 | |||
| 2172 | Ga0207644_10040055 | |||
| 2173 | Ga0207644_10098279 | |||
| 2174 | Ga0207644_10215420 | |||
| 2175 | Ga0207690_10011567 | |||
| 2176 | Ga0207706_10003066 | |||
| 2177 | Ga0207686_10017121 | |||
| 2178 | Ga0207686_10024345 | |||
| 2179 | Ga0207686_10032314 | |||
| 2180 | Ga0207686_10052481 | |||
| 2181 | Ga0207686_10055003 | |||
| 2182 | Ga0207686_10062170 | |||
| 2183 | Ga0207686_10080178 | |||
| 2184 | Ga0207686_10090364 | |||
| 2185 | Ga0207686_10505978 | |||
| 2186 | Ga0207686_10995416 | |||
| 2187 | Ga0207709_10084879 | |||
| 2188 | Ga0207709_10128424 | |||
| 2189 | Ga0207709_10208062 | |||
| 2190 | Ga0207709_10519165 | |||
| 2191 | Ga0207670_10371559 | |||
| 2192 | Ga0207669_10240422 | |||
| 2193 | Ga0207704_10132754 | |||
| 2194 | Ga0207704_10173336 | |||
| 2195 | Ga0207665_10000011 | |||
| 2196 | Ga0207665_10001886 | |||
| 2197 | Ga0207665_10039627 | |||
| 2198 | Ga0207665_10052707 | |||
| 2199 | Ga0207665_10053545 | |||
| 2200 | Ga0207665_10282994 | |||
| 2201 | Ga0207665_10436406 | |||
| 2202 | Ga0207691_10014464 | |||
| 2203 | Ga0207691_10653931 | |||
| 2204 | Ga0207711_10000701 | |||
| 2205 | Ga0207711_10002368 | |||
| 2206 | Ga0207711_10004561 | |||
| 2207 | Ga0207711_10035393 | |||
| 2208 | Ga0207711_10082332 | |||
| 2209 | Ga0207711_10092261 | |||
| 2210 | Ga0207711_10095353 | |||
| 2211 | Ga0207711_10104413 | |||
| 2212 | Ga0207711_10137510 | |||
| 2213 | Ga0207711_10186154 | |||
| 2214 | Ga0207711_10427783 | |||
| 2215 | Ga0207689_10000639 | |||
| 2216 | Ga0207689_10031696 | |||
| 2217 | Ga0207689_10115440 | |||
| 2218 | Ga0207689_10286448 | |||
| 2219 | Ga0207689_10302332 | |||
| 2220 | Ga0207689_10308211 | |||
| 2221 | Ga0207661_10002207 | |||
| 2222 | Ga0207661_10008706 | |||
| 2223 | Ga0207661_10015272 | |||
| 2224 | Ga0207661_10017408 | |||
| 2225 | Ga0207661_10020722 | |||
| 2226 | Ga0207661_10078725 | |||
| 2227 | Ga0207661_10081609 | |||
| 2228 | Ga0207661_10140583 | |||
| 2229 | Ga0207661_10210067 | |||
| 2230 | Ga0207661_10397972 | |||
| 2231 | Ga0207679_10269403 | |||
| 2232 | Ga0207679_10290095 | |||
| 2233 | Ga0207679_11231617 | |||
| 2234 | Ga0207679_11262962 | |||
| 2235 | Ga0207679_11521645 | |||
| 2236 | Ga0207667_10000704 | |||
| 2237 | Ga0207667_10001298 | |||
| 2238 | Ga0207667_10001669 | |||
| 2239 | Ga0207667_10003842 | |||
| 2240 | Ga0207667_10005331 | |||
| 2241 | Ga0207667_10021374 | |||
| 2242 | Ga0207667_10022036 | |||
| 2243 | Ga0207667_10024356 | |||
| 2244 | Ga0207667_10043726 | |||
| 2245 | Ga0207667_10045348 | |||
| 2246 | Ga0207667_10053693 | |||
| 2247 | Ga0207667_10057480 | |||
| 2248 | Ga0207667_10175601 | |||
| 2249 | Ga0207667_10631988 | |||
| 2250 | Ga0207667_10832265 | |||
| 2251 | Ga0207667_10871885 | |||
| 2252 | Ga0207651_10012262 | |||
| 2253 | Ga0207651_10160017 | |||
| 2254 | Ga0207712_10020844 | |||
| 2255 | Ga0207712_10530544 | |||
| 2256 | Ga0207640_10015561 | |||
| 2257 | Ga0207640_10028252 | |||
| 2258 | Ga0207640_10771451 | |||
| 2259 | Ga0207640_10843378 | |||
| 2260 | Ga0207640_11305646 | |||
| 2261 | Ga0207640_11568133 | |||
| 2262 | Ga0207658_10008830 | |||
| 2263 | Ga0207658_10341552 | |||
| 2264 | Ga0207677_10003199 | |||
| 2265 | Ga0207677_10015604 | |||
| 2266 | Ga0207677_10019576 | |||
| 2267 | Ga0207677_10040980 | |||
| 2268 | Ga0207703_10014435 | |||
| 2269 | Ga0207703_10018747 | |||
| 2270 | Ga0207703_10033447 | |||
| 2271 | Ga0207703_10093727 | |||
| 2272 | Ga0207703_10348419 | |||
| 2273 | Ga0207703_10484078 | |||
| 2274 | Ga0207703_11114920 | |||
| 2275 | Ga0207639_10000063 | |||
| 2276 | Ga0207639_10001850 | |||
| 2277 | Ga0207639_10027801 | |||
| 2278 | Ga0207639_10070705 | |||
| 2279 | Ga0207639_10127893 | |||
| 2280 | Ga0207639_10128467 | |||
| 2281 | Ga0207639_10132262 | |||
| 2282 | Ga0207639_10133353 | |||
| 2283 | Ga0207639_10220462 | |||
| 2284 | Ga0207639_11272420 | |||
| 2285 | Ga0207639_11381542 | |||
| 2286 | Ga0207678_10547836 | |||
| 2287 | Ga0207678_11001226 | |||
| 2288 | Ga0207708_10725289 | |||
| 2289 | Ga0207702_10001530 | |||
| 2290 | Ga0207702_10003431 | |||
| 2291 | Ga0207702_10004553 | |||
| 2292 | Ga0207702_10026789 | |||
| 2293 | Ga0207702_10033402 | |||
| 2294 | Ga0207702_10059910 | |||
| 2295 | Ga0207702_10118771 | |||
| 2296 | Ga0207702_10175867 | |||
| 2297 | Ga0207702_10186544 | |||
| 2298 | Ga0207702_10189269 | |||
| 2299 | Ga0207702_10238822 | |||
| 2300 | Ga0207702_10300631 | |||
| 2301 | Ga0207702_10518200 | |||
| 2302 | Ga0207702_10806703 | |||
| 2303 | Ga0207702_11105141 | |||
| 2304 | Ga0207641_10003572 | |||
| 2305 | Ga0207641_10013528 | |||
| 2306 | Ga0207641_10017715 | |||
| 2307 | Ga0207641_10027289 | |||
| 2308 | Ga0207641_10028508 | |||
| 2309 | Ga0207641_10058025 | |||
| 2310 | Ga0207641_10358549 | |||
| 2311 | Ga0207648_10020471 | |||
| 2312 | Ga0207648_10154584 | |||
| 2313 | Ga0207648_10214990 | |||
| 2314 | Ga0207676_10010814 | |||
| 2315 | Ga0207676_10066221 | |||
| 2316 | Ga0207676_10094899 | |||
| 2317 | Ga0207676_10333225 | |||
| 2318 | Ga0207676_10416416 | |||
| 2319 | Ga0207674_10004642 | |||
| 2320 | Ga0207674_10006628 | |||
| 2321 | Ga0207674_10007498 | |||
| 2322 | Ga0207674_10010952 | |||
| 2323 | Ga0207674_10018657 | |||
| 2324 | Ga0207674_10112333 | |||
| 2325 | Ga0207674_10139870 | |||
| 2326 | Ga0207674_10366269 | |||
| 2327 | Ga0207674_11605502 | |||
| 2328 | Ga0207675_100916811 | |||
| 2329 | Ga0207683_10001872 | |||
| 2330 | Ga0207683_10494253 | |||
| 2331 | Ga0207698_10000003 | |||
| 2332 | Ga0207698_10000093 | |||
| 2333 | Ga0207698_10002110 | |||
| 2334 | Ga0207698_10006244 | |||
| 2335 | Ga0207698_10028874 | |||
| 2336 | Ga0207698_10081346 | |||
| 2337 | Ga0207698_10112650 | |||
| 2338 | Ga0207698_10166165 | |||
| 2339 | Ga0207698_10248121 | |||
| 2340 | Ga0207698_10479779 | |||
| 2341 | Ga0207698_10735715 | |||
| 2342 | Ga0207698_10925705 | |||
| 2343 | Ga0209179_1020399 | |||
| 2344 | Ga0209588_1001606 | |||
| 2345 | Ga0209588_1007654 | |||
| 2346 | Ga0209588_1010308 | |||
| 2347 | Ga0209588_1153886 | |||
| 2348 | Ga0265354_1000512 | |||
| 2349 | Ga0265356_1004788 | |||
| 2350 | Ga0265357_1000491 | |||
| 2351 | Ga0268266_10001991 | |||
| 2352 | Ga0268266_10008821 | |||
| 2353 | Ga0268266_10028158 | |||
| 2354 | Ga0268266_10064079 | |||
| 2355 | Ga0268266_10071655 | |||
| 2356 | Ga0268266_10114572 | |||
| 2357 | Ga0268266_10176606 | |||
| 2358 | Ga0268265_10014315 | |||
| 2359 | Ga0268264_10014414 | |||
| 2360 | Ga0268264_10018806 | |||
| 2361 | Ga0268264_10059391 | |||
| 2362 | Ga0268264_10144101 | |||
| 2363 | Ga0268264_10179435 | |||
| 2364 | Ga0268264_10291504 | |||
| 2365 | Ga0268264_10678520 | |||
| 2366 | Ga0265319_1002192 | |||
| 2367 | Ga0265318_10000076 | |||
| 2368 | Ga0265336_10091630 | |||
| 2369 | Ga0265338_10032424 | |||
| 2370 | Ga0265338_10069513 | |||
| 2371 | Ga0265338_10327361 | |||
| 2372 | Ga0265338_10501979 | |||
| 2373 | Ga0265338_10591459 | |||
| 2374 | Ga0265338_10772056 | |||
| 2375 | Ga0265770_1004703 | |||
| 2376 | Ga0265765_1000870 | |||
| 2377 | Ga0265760_10000022 | |||
| 2378 | Ga0265760_10001426 | |||
| 2379 | Ga0265760_10009836 | |||
| 2380 | Ga0265760_10010281 | |||
| 2381 | Ga0265760_10065013 | |||
| 2382 | Ga0265330_10155665 | |||
| 2383 | Ga0265330_10322605 | |||
| 2384 | Ga0265332_10057676 | |||
| 2385 | Ga0265328_10001785 | |||
| 2386 | Ga0265328_10075243 | |||
| 2387 | Ga0265320_10000031 | |||
| 2388 | Ga0265320_10146702 | |||
| 2389 | Ga0265325_10004183 | |||
| 2390 | Ga0265325_10004533 | |||
| 2391 | Ga0265325_10011266 | |||
| 2392 | Ga0265325_10140662 | |||
| 2393 | Ga0265329_10000860 | |||
| 2394 | Ga0265340_10002347 | |||
| 2395 | Ga0265340_10239107 | |||
| 2396 | Ga0265339_10000031 | |||
| 2397 | Ga0265339_10003292 | |||
| 2398 | Ga0265339_10023552 | |||
| 2399 | Ga0265331_10000039 | |||
| 2400 | Ga0265331_10010269 | |||
| 2401 | Ga0265316_10000662 | |||
| 2402 | Ga0265316_10002301 | |||
| 2403 | Ga0265316_10003285 | |||
| 2404 | Ga0265316_10011125 | |||
| 2405 | Ga0265316_10015019 | |||
| 2406 | Ga0265316_10022182 | |||
| 2407 | Ga0265316_10057908 | |||
| 2408 | Ga0265316_10159995 | |||
| 2409 | Ga0307509_10175889 | |||
| 2410 | Ga0265313_10005224 | |||
| 2411 | Ga0265313_10016048 | |||
| 2412 | Ga0265314_10000067 | |||
| 2413 | Ga0265314_10001577 | |||
| 2414 | Ga0265314_10012255 | |||
| 2415 | Ga0265314_10019058 | |||
| 2416 | Ga0265314_10029215 | |||
| 2417 | Ga0265314_10197417 | |||
| 2418 | Ga0265342_10000920 | |||
| 2419 | Ga0265342_10003163 | |||
| 2420 | Ga0265342_10046882 | |||
| 2421 | Ga0307409_100243827 | |||
| 2422 | Ga0316212_1002189 | |||
| 2423 | Ga0373926_0005499 | |||
| 2424 | Ga0373934_0014871 | |||
| 2425 | Ga0373934_0081629 | |||
| 2426 | Ga0373923_0055647 | |||
| 2427 | Ga0373923_0125536 | |||
| 2428 | Ga0373936_0289558 | |||
| 2429 | Ga0373953_0014045 | |||
| 2430 | Ga0373953_0260444 | |||
| 2431 | Ga0373954_0000984 | |||
| 2432 | Ga0373954_0056017 | |||
| 2433 | Ga0373956_0012605 | |||
| 2434 | Ga0373956_0081120 | |||
| 2435 | Ga0373956_0280286 | |||
| 2436 | Ga0373957_0109451 | |||
| 2437 | Ga0373943_0040866 | |||
| 2438 | Ga0373946_0002371 | |||
| 2439 | Ga0373946_0092099 | |||
| 2440 | Ga0373946_0237453 | |||
| 2441 | Ga0373955_0055891 | |||
| 2442 | Ga0373955_0354363 | |||
| 2443 | Ga0373931_0032724 | |||
| 2444 | Ga0373935_0026595 | |||
| 2445 | Ga0373927_0000212 | |||
| 2446 | Ga0373927_0000614 | |||
| 2447 | Ga0373927_0007240 | |||
| 2448 | Ga0373927_0046800 | |||
| 2449 | Ga0373927_0120406 | |||
| 2450 | Ga0373927_0126976 | |||
| 2451 | Ga0373933_0000367 | |||
| 2452 | Ga0373933_0015424 | |||
| 2453 | Ga0373933_0101328 | |||
| 2454 | Ga0373933_0356160 | |||
| 2455 | Ga0373933_0957281 | |||
| 2456 | Ga0373947_0026681 | |||
| 2457 | Ga0373947_0071247 | |||
| 2458 | Ga0373937_0002124 | |||
| 2459 | Ga0373937_0004512 | |||
| 2460 | Ga0373937_0006149 | |||
| 2461 | Ga0373937_0006208 | |||
| 2462 | Ga0373937_0048327 | |||
| 2463 | Ga0373937_0059532 | |||
| 2464 | Ga0373937_0439175 | |||
| 2465 | Ga0373937_0441669 | |||
| 2466 | Ga0373937_0786259 | |||
| 2467 | Ga0373937_1174169 | |||
| 2468 | Ga0373925_0000487 | |||
| 2469 | Ga0373925_0009147 | |||
| 2470 | Ga0373925_0063308 | |||
| 2471 | Ga0373925_0173252 | |||
| 2472 | Ga0373925_0303700 | |||
| 2473 | Ga0373925_0487661 | |||
| 2474 | Ga0395899_0300915 | |||
| 2475 | Ga0395899_0319120 | |||
| 2476 | Ga0395900_0028406 | |||
| 2477 | Ga0395900_0058272 | |||
| 2478 | Ga0395900_0357847 | |||
| 2479 | Ga0395898_0101022 | |||
| 2480 | Ga0395898_0178528 | |||
| 2481 | Ga0395898_0474578 | |||
| 2482 | Ga0395905_0667277 | |||
| 2483 | Ga0436364_0708475 | |||
| 2484 | Ga0395901_0545268 | |||
| 2485 | Ga0436365_0320037 | |||
| 2486 | Ga0436365_0352286 | |||
| 2487 | Ga0436365_1092844 | |||
| 2488 | Ga0436365_1396730 | |||
| 2489 | Ga0436360_0025204 | |||
| 2490 | Ga0436363_0413293 | |||
| 2491 | Ga0436363_1122484 | |||
| 2492 | Ga0436362_0678365 | |||
| 2493 | Ga0436362_0796667 | |||
| 2494 | Ga0451791_0662513 | |||
| 2495 | Ga0451797_0373435 | |||
| 2496 | Ga0451837_1137245 | |||
| 2497 | Ga0451577_0000054 | |||
| 2498 | Ga0451577_0563173 | |||
| 2499 | Ga0453683_0012500 | |||
| 2500 | Ga0453683_0660509 | |||
| 2501 | Ga0466966_0191978 | |||
| 2502 | Ga0466963_0003591 | |||
| 2503 | Ga0466963_0236383 | |||
| 2504 | Ga0453684_0000366 | |||
| 2505 | Ga0453684_0860484 | |||
| 2506 | Ga0466971_0382292 | |||
| 2507 | Ga0466957_0160777 | |||
| 2508 | Ga0466959_0003780 | |||
| 2509 | Ga0451576_0002744 | |||
| 2510 | Ga0451576_0081985 | |||
| 2511 | Ga0451576_1298025 | |||
| 2512 | Ga0466967_0010770 | |||
| 2513 | Ga0495592_0020926 | |||
| 2514 | Ga0495592_0145802 | |||
| 2515 | Ga0495592_0516637 | |||
| 2516 | Ga0495603_0033957 | |||
| 2517 | Ga0495603_0255773 | |||
| 2518 | Ga0495629_0009423 | |||
| 2519 | Ga0495629_0021039 | |||
| 2520 | Ga0495629_0194719 | |||
| 2521 | Ga0495629_0553159 | |||
| 2522 | Ga0495651_0005310 | |||
| 2523 | Ga0495651_0023595 | |||
| 2524 | Ga0495651_0029074 | |||
| 2525 | Ga0495651_0055560 | |||
| 2526 | Ga0495651_0067662 | |||
| 2527 | Ga0495651_0194208 | |||
| 2528 | Ga0495651_0477887 | |||
| 2529 | Ga0495651_0572032 | |||
| 2530 | Ga0495653_0004837 | |||
| 2531 | Ga0495653_0096955 | |||
| 2532 | Ga0495653_0127636 | |||
| 2533 | Ga0495580_0001970 | |||
| 2534 | Ga0495580_0008565 | |||
| 2535 | Ga0495580_0034985 | |||
| 2536 | Ga0495580_0075316 | |||
| 2537 | Ga0495580_0095136 | |||
| 2538 | Ga0495580_0203451 | |||
| 2539 | Ga0495580_0290830 | |||
| 2540 | Ga0495580_0349593 | |||
| 2541 | Ga0495582_0000255 | |||
| 2542 | Ga0495582_0023087 | |||
| 2543 | Ga0495582_0052653 | |||
| 2544 | Ga0495582_0069851 | |||
| 2545 | Ga0495582_0302795 | |||
| 2546 | Ga0495639_0031000 | |||
| 2547 | Ga0495662_0042048 | |||
| 2548 | Ga0495662_0316233 | |||
| 2549 | Ga0495664_0094229 | |||
| 2550 | Ga0495664_0145950 | |||
| 2551 | Ga0495664_0168741 | |||
| 2552 | Ga0495664_0198865 | |||
| 2553 | Ga0495664_0245294 | |||
| 2554 | Ga0495664_0398055 | |||
| 2555 | Ga0495594_0049642 | |||
| 2556 | Ga0495594_0158855 | |||
| 2557 | Ga0495583_0011240 | |||
| 2558 | Ga0495606_0242505 | |||
| 2559 | Ga0495608_0016320 | |||
| 2560 | Ga0495608_0060218 | |||
| 2561 | Ga0495628_0018232 | |||
| 2562 | Ga0495628_0040792 | |||
| 2563 | Ga0495628_0068289 | |||
| 2564 | Ga0495628_0098366 | |||
| 2565 | Ga0495628_0192910 | |||
| 2566 | Ga0495628_0670598 | |||
| 2567 | Ga0495630_0012890 | |||
| 2568 | Ga0495630_0668974 | |||
| 2569 | Ga0495630_1137874 | |||
| 2570 | Ga0495632_0106888 | |||
| 2571 | Ga0495666_0017540 | |||
| 2572 | Ga0495666_0068896 | |||
| 2573 | Ga0495652_0006027 | |||
| 2574 | Ga0495652_0014296 | |||
| 2575 | Ga0495652_0109741 | |||
| 2576 | Ga0495652_0119825 | |||
| 2577 | Ga0495652_0125081 | |||
| 2578 | Ga0495652_0271395 | |||
| 2579 | Ga0495652_0532657 | |||
| 2580 | Ga0495665_0002414 | |||
| 2581 | Ga0495665_0043319 | |||
| 2582 | Ga0495665_0055060 | |||
| 2583 | Ga0495665_0081644 | |||
| 2584 | Ga0495665_0120067 | |||
| 2585 | Ga0495665_0240075 | |||
| 2586 | Ga0495665_0301994 | |||
| 2587 | Ga0495640_0007376 | |||
| 2588 | Ga0495586_0004250 | |||
| 2589 | Ga0495586_0025331 | |||
| 2590 | Ga0495586_0033544 | |||
| 2591 | Ga0495586_0038456 | |||
| 2592 | Ga0495586_0192584 | |||
| 2593 | Ga0495586_0247178 | |||
| 2594 | Ga0495587_0010437 | |||
| 2595 | Ga0495587_0024075 | |||
| 2596 | Ga0495587_0062628 | |||
| 2597 | Ga0495587_0070383 | |||
| 2598 | Ga0495587_0280994 | |||
| 2599 | Ga0495587_0364515 | |||
| 2600 | Ga0495587_0380575 | |||
| 2601 | Ga0495645_0002621 | |||
| 2602 | Ga0495645_0006398 | |||
| 2603 | Ga0495645_0143585 | |||
| 2604 | Ga0495645_0238778 | |||
| 2605 | Ga0495645_0265425 | |||
| 2606 | Ga0495645_0281918 | |||
| 2607 | Ga0495622_0076440 | |||
| 2608 | Ga0495667_0019551 | |||
| 2609 | Ga0495667_0102175 | |||
| 2610 | Ga0495667_0340618 | |||
| 2611 | Ga0495634_0087026 | |||
| 2612 | Ga0495625_0017254 | |||
| 2613 | Ga0495625_0097932 | |||
| 2614 | Ga0495635_0019092 | |||
| 2615 | Ga0495635_0072239 | |||
| 2616 | Ga0495635_0385825 | |||
| 2617 | Ga0495657_0153492 | |||
| 2618 | Ga0495657_0169218 | |||
| 2619 | Ga0495657_0374905 | |||
| 2620 | Ga0495657_0392233 | |||
| 2621 | Ga0495599_0071000 | |||
| 2622 | Ga0495599_0206931 | |||
| 2623 | Ga0495599_0277381 | |||
| 2624 | Ga0495623_0002771 | |||
| 2625 | Ga0495623_0033445 | |||
| 2626 | Ga0495623_0037763 | |||
| 2627 | Ga0495646_0056392 | |||
| 2628 | Ga0495646_0074022 | |||
| 2629 | Ga0495646_0266390 | |||
| 2630 | Ga0495658_0028290 | |||
| 2631 | Ga0495658_0043246 | |||
| 2632 | Ga0495658_0048485 | |||
| 2633 | Ga0495658_0513598 | |||
| 2634 | Ga0495613_0063132 | |||
| 2635 | Ga0495613_0064422 | |||
| 2636 | Ga0495613_0104281 | |||
| 2637 | Ga0495613_0295192 | |||
| 2638 | Ga0495613_0296976 | |||
| 2639 | Ga0495624_0016828 | |||
| 2640 | Ga0495624_0036034 | |||
| 2641 | Ga0495670_0242982 | |||
| 2642 | Ga0495600_0043393 | |||
| 2643 | Ga0495600_0052437 | |||
| 2644 | Ga0495600_0057638 | |||
| 2645 | Ga0495600_0098945 | |||
| 2646 | Ga0495600_0159044 | |||
| 2647 | Ga0495581_0045922 | |||
| 2648 | Ga0495581_0223333 | |||
| 2649 | Ga0495604_0007664 | |||
| 2650 | Ga0495604_0101146 | |||
| 2651 | Ga0495604_0176312 | |||
| 2652 | Ga0495604_0340131 | |||
| 2653 | Ga0495604_0596347 | |||
| 2654 | Ga0495674_0030006 | |||
| 2655 | Ga0495674_0088420 | |||
| 2656 | Ga0495674_0098283 | |||
| 2657 | Ga0495674_0107724 | |||
| 2658 | Ga0495674_0129386 | |||
| 2659 | Ga0495674_0207527 | |||
| 2660 | Ga0495674_0230055 | |||
| 2661 | Ga0495674_0693323 | |||
| 2662 | Ga0495676_0042036 | |||
| 2663 | Ga0495676_0332809 | |||
| 2664 | Ga0495676_0439261 | |||
| 2665 | Ga0495680_0000244 | |||
| 2666 | Ga0495680_0034311 | |||
| 2667 | Ga0495680_0062978 | |||
| 2668 | Ga0495683_0161671 | |||
| 2669 | Ga0495675_0009163 | |||
| 2670 | Ga0495675_0017775 | |||
| 2671 | Ga0495675_0259432 | |||
| 2672 | Ga0495684_0001166 | |||
| 2673 | Ga0495684_0010165 | |||
| 2674 | Ga0495684_0031692 | |||
| 2675 | Ga0495684_0047861 | |||
| 2676 | Ga0495684_0059328 | |||
| 2677 | Ga0495684_0267878 | |||
| 2678 | Ga0495684_0268226 | |||
| 2679 | Ga0495593_0040537 | |||
| 2680 | Ga0495602_0001165 | |||
| 2681 | Ga0495602_0078715 | |||
| 2682 | Ga0495602_0091649 | |||
| 2683 | Ga0495602_0131209 | |||
| 2684 | Ga0495602_0337080 | |||
| 2685 | Ga0495602_0435835 | |||
| 2686 | Ga0495602_0786959 | |||
| 2687 | Ga0495614_0050465 | |||
| 2688 | Ga0495614_0101854 | |||
| 2689 | Ga0496100_0792357 | |||
| 2690 | Ga0496101_0199652 | |||
| 2691 | Ga0496102_0221000 | |||
| 2692 | Ga0496102_0564365 | |||
| 2693 | Ga0496104_0007093 | |||
| 2694 | Ga0496104_0239219 | |||
| 2695 | Ga0496104_0251254 | |||
| 2696 | Ga0496105_0007132 | |||
| 2697 | Ga0496105_0265831 | |||
| 2698 | Ga0496105_0773714 | |||
| 2699 | Ga0496107_0824620 | |||
| 2700 | Ga0496108_1177876 | |||
| 2701 | Ga0496112_0005998 | |||
| 2702 | Ga0496112_0029023 | |||
| 2703 | Ga0496112_0061991 | |||
| 2704 | Ga0496112_0285842 | |||
| 2705 | Ga0496112_0376130 | |||
| 2706 | Ga0496112_0970945 | |||
| 2707 | Ga0496114_0008506 | |||
| 2708 | Ga0496114_0013414 | |||
| 2709 | Ga0496114_0267583 | |||
| 2710 | Ga0496115_0004389 | |||
| 2711 | Ga0496115_0110730 | |||
| 2712 | Ga0496115_0125732 | |||
| 2713 | Ga0496115_0150820 | |||
| 2714 | Ga0496115_0159335 | |||
| 2715 | Ga0496115_0487826 | |||
| 2716 | Ga0496115_0629992 | |||
| 2717 | Ga0496126_0000063 | |||
| 2718 | Ga0495682_0037587 | |||
| 2719 | nmdc:mga0n895_55727_c1 | |||
| 2720 | nmdc:mga0n895_60052_c1 | |||
| 2721 | nmdc:mga0n895_62602_c1 | |||
| 2722 | nmdc:mga0rr50_12928_c1 | |||
| 2723 | nmdc:mga0rr50_384601_c1 | |||
| 2724 | nmdc:mga08x19_113_c1 | |||
| 2725 | nmdc:mga08x19_33799_c1 | |||
| 2726 | nmdc:mga08x19_6177_c1 | |||
| 2727 | nmdc:mga0a205_104383_c1 | |||
| 2728 | Ga0495601_0040152 | |||
| 2729 | Ga0495601_0067755 | |||
| 2730 | Ga0495601_0089897 | |||
| 2731 | Ga0495601_0190439 | |||
| 2732 | Ga0495612_0000322 | |||
| 2733 | Ga0495619_0095903 | |||
| 2734 | Ga0495619_0151232 | |||
| 2735 | Ga0500568_0001844 | |||
| 2736 | Ga0466962_0194109 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ws1-assembly1.cif.gz_A | structure analysis of peptide deformylase from bacillus cereus | 0.9781 | 1 | 149 |
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.9669 | 1 | 149 |
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.955 | 3 | 160 |
| 3k6l-assembly1.cif.gz_A | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9533 | 1 | 165 |
| 4dr8-assembly4.cif.gz_D | crystal structure of a peptide deformylase from synechococcus elongatus | 0.9505 | 3 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9781 | 1 | 149 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9666 | 1 | 149 | 3.90.45.10 |
| af_A0A0R0ELH1_60_189_3.90.45.10 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9533 | 1 | 105 | 3.90.45.10 |
| 4dr9B00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9491 | 3 | 159 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9472 | 1 | 149 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M8SEY9-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9998 | 1 | 169 |
GO:0006412
GO:0042586 GO:0046872 |
| AF-A0A7D8BBN9-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9991 | 1 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2V9AZN5-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9991 | 2 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A1Q7KAR0-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9989 | 2 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A2V9IGY4-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9976 | 1 | 169 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |