F493389

General Info

Members Datasets Scaffolds Average Seq Length
1368 318 2736 174

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100002791|Ga0070680_1000027916
Length 174
Sequence MIYRIVKYLNNPILERPAESVTEFGTPELAELVESMFETMYSARGIGLAAPQIDIAKRITVIDITGGEEGHEPEKLVLINPEVIAKEGKITEEEGCLSIPGIREPVTRARKVTIRAQNTEGEWYEMDGEDLLARAFQHEIDHLNGILFVNHLSALKRDLIRRRIRKLQKAGEWE

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
180 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
181 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
238 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 2.19
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 10.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100002791 3300005336 Bacteria 12972
2 rootH2_10053643 3300003320 Bacteria 1286
3 rootH2_10136940 3300003320 Bacteria 1432
4 rootH2_10159871 3300003320 Bacteria 1308
5 Ga0070658_10019380 3300005327 Bacteria 5449
6 Ga0070658_10053484 3300005327 Bacteria 3277
7 Ga0070676_10034872 3300005328 Bacteria 2891
8 Ga0070683_100001167 3300005329 Bacteria 19904
9 Ga0070683_100002912 3300005329 Bacteria 13711
10 Ga0070683_100008651 3300005329 Bacteria 8652
11 Ga0070683_100083113 3300005329 Bacteria 2999
12 Ga0070683_100289485 3300005329 Unclassified 1558
13 Ga0070683_100524715 3300005329 Bacteria 1132
14 Ga0070690_100057309 3300005330 Bacteria 2500
15 Ga0070690_100502589 3300005330 Unclassified 907
16 Ga0070670_100076836 3300005331 Bacteria 2869
17 Ga0070670_100175601 3300005331 Bacteria 1859
18 Ga0070670_101016912 3300005331 Bacteria 754
19 Ga0070670_101791560 3300005331 Bacteria 565
20 Ga0068869_100000942 3300005334 Bacteria 16836
21 Ga0068869_100079658 3300005334 Bacteria 2441
22 Ga0068869_100368329 3300005334 Bacteria 1175
23 Ga0070666_10002688 3300005335 Bacteria 10728
24 Ga0070666_10009199 3300005335 Bacteria 6158
25 Ga0070666_10030825 3300005335 Unclassified 3536
26 Ga0070666_10577050 3300005335 Bacteria 819
27 Ga0070680_100089413 3300005336 Bacteria 2548
28 Ga0070680_100290466 3300005336 Bacteria 1386
29 Ga0070680_100881916 3300005336 Unclassified 772
30 Ga0070682_100423091 3300005337 Bacteria 1013
31 Ga0070682_100776895 3300005337 Bacteria 776
32 Ga0070682_101022043 3300005337 Unclassified 687
33 Ga0068868_100013761 3300005338 Bacteria 5944
34 Ga0068868_100018247 3300005338 Bacteria 5242
35 Ga0068868_100043783 3300005338 Bacteria 3497
36 Ga0068868_100046800 3300005338 Bacteria 3386
37 Ga0068868_100069082 3300005338 Bacteria 2815
38 Ga0068868_100263578 3300005338 Bacteria 1454
39 Ga0068868_100299193 3300005338 Bacteria 1366
40 Ga0070660_100000964 3300005339 Bacteria 19258
41 Ga0070660_100006653 3300005339 Bacteria 8018
42 Ga0070660_100529265 3300005339 Bacteria 982
43 Ga0070660_100596049 3300005339 Unclassified 924
44 Ga0070689_100633242 3300005340 Bacteria 929
45 Ga0070689_100906050 3300005340 Bacteria 780
46 Ga0070691_10004660 3300005341 Bacteria 6236
47 Ga0070687_100171656 3300005343 Bacteria 1291
48 Ga0070661_100013734 3300005344 Bacteria 5689
49 Ga0070661_100077289 3300005344 Bacteria 2454
50 Ga0070661_100177594 3300005344 Bacteria 1619
51 Ga0070661_100518613 3300005344 Unclassified 956
52 Ga0070661_100531497 3300005344 Unclassified 944
53 Ga0070668_100229617 3300005347 Bacteria 1534
54 Ga0070669_100209189 3300005353 Bacteria 1538
55 Ga0070671_100003769 3300005355 Bacteria 11903
56 Ga0070671_100031352 3300005355 Bacteria 4391
57 Ga0070674_100210053 3300005356 Bacteria 1508
58 Ga0070673_100018718 3300005364 Bacteria 4956
59 Ga0070673_100193511 3300005364 Unclassified 1748
60 Ga0070688_100105636 3300005365 Bacteria 1864
61 Ga0070667_100004496 3300005367 Bacteria 11766
62 Ga0070667_100067516 3300005367 Bacteria 3040
63 Ga0070667_100138801 3300005367 Bacteria 2127
64 Ga0070667_100164146 3300005367 Bacteria 1958
65 Ga0070667_100406939 3300005367 Bacteria 1239
66 Ga0070709_10037194 3300005434 Bacteria 2971
67 Ga0070709_10060853 3300005434 Bacteria 2402
68 Ga0070709_10098663 3300005434 Bacteria 1942
69 Ga0070709_10149426 3300005434 Bacteria 1613
70 Ga0070709_10219933 3300005434 Bacteria 1354
71 Ga0070714_100001316 3300005435 Bacteria 17938
72 Ga0070714_100033191 3300005435 Bacteria 4315
73 Ga0070714_100033743 3300005435 Bacteria 4281
74 Ga0070714_100206698 3300005435 Bacteria 1798
75 Ga0070713_100005133 3300005436 Bacteria 8914
76 Ga0070713_100010293 3300005436 Bacteria 6751
77 Ga0070713_100024734 3300005436 Bacteria 4685
78 Ga0070713_100028339 3300005436 Bacteria 4422
79 Ga0070713_100167635 3300005436 Bacteria 1965
80 Ga0070713_100202402 3300005436 Bacteria 1794
81 Ga0070713_100255553 3300005436 Bacteria 1600
82 Ga0070713_100277842 3300005436 Bacteria 1535
83 Ga0070713_100295859 3300005436 Bacteria 1489
84 Ga0070713_100447142 3300005436 Bacteria 1213
85 Ga0070713_100471936 3300005436 Bacteria 1181
86 Ga0070713_100989574 3300005436 Unclassified 811
87 Ga0070710_10144946 3300005437 Unclassified 1460
88 Ga0070711_100029736 3300005439 Bacteria 3609
89 Ga0070711_100233389 3300005439 Unclassified 1435
90 Ga0070711_100346142 3300005439 Bacteria 1194
91 Ga0070711_100386413 3300005439 Bacteria 1133
92 Ga0070711_100544696 3300005439 Bacteria 962
93 Ga0070705_100003409 3300005440 Bacteria 7794
94 Ga0070705_100371453 3300005440 Unclassified 1050
95 Ga0070705_101247200 3300005440 Bacteria 614
96 Ga0070694_100325204 3300005444 Bacteria 1184
97 Ga0070694_100681716 3300005444 Bacteria 834
98 Ga0070708_100018727 3300005445 Bacteria 5796
99 Ga0070708_100033475 3300005445 Bacteria 4465
100 Ga0070708_100317356 3300005445 Bacteria 1468
101 Ga0070663_100227775 3300005455 Unclassified 1466
102 Ga0070663_101357914 3300005455 Bacteria 628
103 Ga0070678_100017959 3300005456 Bacteria 4572
104 Ga0070678_100066963 3300005456 Bacteria 2671
105 Ga0070678_100148689 3300005456 Bacteria 1884
106 Ga0070662_100075733 3300005457 Bacteria 2492
107 Ga0070681_10002161 3300005458 Bacteria 17886
108 Ga0070681_10019157 3300005458 Bacteria 6848
109 Ga0070681_10021511 3300005458 Bacteria 6465
110 Ga0070681_10038122 3300005458 Bacteria 4819
111 Ga0070681_10079381 3300005458 Bacteria 3239
112 Ga0070681_10598281 3300005458 Bacteria 1017
113 Ga0070681_10905225 3300005458 Bacteria 801
114 Ga0068867_100020449 3300005459 Bacteria 4718
115 Ga0068867_100146161 3300005459 Bacteria 1853
116 Ga0068867_101075786 3300005459 Bacteria 733
117 Ga0070685_10509934 3300005466 Bacteria 852
118 Ga0070706_100024650 3300005467 Bacteria 5539
119 Ga0070706_100043943 3300005467 Bacteria 4128
120 Ga0070707_100019652 3300005468 Bacteria 6366
121 Ga0070707_100245014 3300005468 Bacteria 1744
122 Ga0070707_100258567 3300005468 Bacteria 1694
123 Ga0070707_100624856 3300005468 Bacteria 1040
124 Ga0070707_100659271 3300005468 Unclassified 1009
125 Ga0070707_101559869 3300005468 Unclassified 627
126 Ga0070698_100005081 3300005471 Bacteria 14407
127 Ga0070698_100158095 3300005471 Bacteria 2212
128 Ga0070698_100320787 3300005471 Bacteria 1480
129 Ga0070699_100011938 3300005518 Bacteria 7498
130 Ga0070699_100088836 3300005518 Bacteria 2700
131 Ga0070699_100111350 3300005518 Bacteria 2404
132 Ga0070699_100158831 3300005518 Unclassified 2000
133 Ga0070699_100542531 3300005518 Bacteria 1058
134 Ga0070699_101166507 3300005518 Unclassified 707
135 Ga0070679_100000717 3300005530 Bacteria 28561
136 Ga0070679_100004611 3300005530 Bacteria 12725
137 Ga0070679_100024699 3300005530 Bacteria 5888
138 Ga0070679_100037689 3300005530 Bacteria 4804
139 Ga0070679_100059369 3300005530 Bacteria 3813
140 Ga0070679_100172159 3300005530 Bacteria 2138
141 Ga0070679_100214698 3300005530 Bacteria 1886
142 Ga0070679_100407162 3300005530 Bacteria 1306
143 Ga0070679_100515083 3300005530 Bacteria 1140
144 Ga0070679_100939514 3300005530 Bacteria 808
145 Ga0070684_100005071 3300005535 Bacteria 10060
146 Ga0070684_100007752 3300005535 Bacteria 8369
147 Ga0070684_100028468 3300005535 Bacteria 4727
148 Ga0070684_100030818 3300005535 Bacteria 4562
149 Ga0070684_100034594 3300005535 Bacteria 4320
150 Ga0070684_100064595 3300005535 Bacteria 3211
151 Ga0070684_100167652 3300005535 Bacteria 1994
152 Ga0070684_100241549 3300005535 Bacteria 1650
153 Ga0070684_100331854 3300005535 Bacteria 1398
154 Ga0070684_100442358 3300005535 Bacteria 1201
155 Ga0070684_100456417 3300005535 Bacteria 1181
156 Ga0070697_100000263 3300005536 Bacteria 42582
157 Ga0070697_100002908 3300005536 Bacteria 13166
158 Ga0070697_100962960 3300005536 Unclassified 758
159 Ga0068853_100000944 3300005539 Bacteria 20386
160 Ga0068853_100008112 3300005539 Bacteria 8429
161 Ga0068853_100021062 3300005539 Bacteria 5428
162 Ga0068853_100071549 3300005539 Bacteria 3020
163 Ga0068853_100131788 3300005539 Bacteria 2238
164 Ga0068853_100208734 3300005539 Bacteria 1780
165 Ga0068853_100493543 3300005539 Bacteria 1155
166 Ga0068853_100757857 3300005539 Bacteria 928
167 Ga0070672_100009395 3300005543 Bacteria 6740
168 Ga0070695_100002760 3300005545 Bacteria 10186
169 Ga0070695_100354032 3300005545 Bacteria 1101
170 Ga0070695_100699183 3300005545 Bacteria 805
171 Ga0070696_100002545 3300005546 Bacteria 12085
172 Ga0070696_100147831 3300005546 Bacteria 1722
173 Ga0070693_100000019 3300005547 Bacteria 60801
174 Ga0070693_100017961 3300005547 Bacteria 3687
175 Ga0070693_100504600 3300005547 Bacteria 859
176 Ga0070665_100000462 3300005548 Bacteria 59040
177 Ga0070665_100013679 3300005548 Bacteria 8165
178 Ga0070665_100029122 3300005548 Bacteria 5557
179 Ga0070665_100133650 3300005548 Bacteria 2483
180 Ga0070665_101525718 3300005548 Bacteria 676
181 Ga0070665_101590747 3300005548 Bacteria 661
182 Ga0070704_100016339 3300005549 Bacteria 4687
183 Ga0068855_100000623 3300005563 Bacteria 43575
184 Ga0068855_100000881 3300005563 Bacteria 37216
185 Ga0068855_100003034 3300005563 Bacteria 20553
186 Ga0068855_100003302 3300005563 Bacteria 19746
187 Ga0068855_100012148 3300005563 Bacteria 10405
188 Ga0068855_100014232 3300005563 Bacteria 9583
189 Ga0068855_100016829 3300005563 Bacteria 8794
190 Ga0068855_100018146 3300005563 Bacteria 8454
191 Ga0068855_100039853 3300005563 Bacteria 5576
192 Ga0068855_100051393 3300005563 Bacteria 4855
193 Ga0068855_100309955 3300005563 Bacteria 1747
194 Ga0068855_100313375 3300005563 Bacteria 1735
195 Ga0068855_100548416 3300005563 Bacteria 1252
196 Ga0070664_100100786 3300005564 Bacteria 2511
197 Ga0070664_100145461 3300005564 Bacteria 2090
198 Ga0070664_100168669 3300005564 Bacteria 1941
199 Ga0070664_100335160 3300005564 Bacteria 1373
200 Ga0070664_100364621 3300005564 Bacteria 1316
201 Ga0070664_100813239 3300005564 Bacteria 874
202 Ga0070664_101182300 3300005564 Bacteria 721
203 Ga0068857_100017037 3300005577 Bacteria 6364
204 Ga0068857_100021936 3300005577 Bacteria 5621
205 Ga0068857_100022792 3300005577 Bacteria 5509
206 Ga0068857_100025040 3300005577 Bacteria 5256
207 Ga0068857_100044277 3300005577 Bacteria 3948
208 Ga0068857_100053450 3300005577 Bacteria 3583
209 Ga0068857_100111085 3300005577 Bacteria 2464
210 Ga0068857_100111674 3300005577 Bacteria 2457
211 Ga0068857_100209563 3300005577 Bacteria 1778
212 Ga0068857_101302338 3300005577 Bacteria 705
213 Ga0068854_100038491 3300005578 Bacteria 3364
214 Ga0068854_100064472 3300005578 Bacteria 2662
215 Ga0068854_100069176 3300005578 Bacteria 2576
216 Ga0068854_100690831 3300005578 Bacteria 880
217 Ga0068854_101454843 3300005578 Bacteria 621
218 Ga0068856_100001516 3300005614 Bacteria 24367
219 Ga0068856_100005713 3300005614 Bacteria 12251
220 Ga0068856_100014367 3300005614 Bacteria 7654
221 Ga0068856_100025657 3300005614 Bacteria 5747
222 Ga0068856_100027890 3300005614 Bacteria 5508
223 Ga0068856_100068514 3300005614 Bacteria 3508
224 Ga0068856_100105509 3300005614 Bacteria 2812
225 Ga0068856_100137875 3300005614 Bacteria 2446
226 Ga0068856_100230190 3300005614 Bacteria 1869
227 Ga0068856_100236337 3300005614 Bacteria 1843
228 Ga0068856_100272778 3300005614 Bacteria 1708
229 Ga0068856_100334001 3300005614 Bacteria 1533
230 Ga0068856_100424855 3300005614 Bacteria 1349
231 Ga0068856_100569240 3300005614 Bacteria 1154
232 Ga0068856_100589450 3300005614 Bacteria 1133
233 Ga0068856_101353748 3300005614 Bacteria 727
234 Ga0070702_100494083 3300005615 Bacteria 897
235 Ga0068852_100000049 3300005616 Bacteria 86882
236 Ga0068852_100000095 3300005616 Bacteria 59631
237 Ga0068852_100001588 3300005616 Bacteria 15454
238 Ga0068852_100072304 3300005616 Unclassified 3031
239 Ga0068852_100085203 3300005616 Bacteria 2814
240 Ga0068852_100132326 3300005616 Bacteria 2298
241 Ga0068852_100135084 3300005616 Bacteria 2277
242 Ga0068852_100282096 3300005616 Bacteria 1602
243 Ga0068852_100356742 3300005616 Bacteria 1429
244 Ga0068852_100419687 3300005616 Unclassified 1319
245 Ga0068852_100561054 3300005616 Bacteria 1143
246 Ga0068852_100663889 3300005616 Bacteria 1051
247 Ga0068859_100010731 3300005617 Bacteria 9219
248 Ga0068859_100076870 3300005617 Bacteria 3379
249 Ga0068859_100087987 3300005617 Bacteria 3155
250 Ga0068859_100154705 3300005617 Bacteria 2370
251 Ga0068859_100563875 3300005617 Bacteria 1233
252 Ga0068859_101330067 3300005617 Unclassified 792
253 Ga0068864_100067962 3300005618 Bacteria 3095
254 Ga0068864_100174155 3300005618 Bacteria 1963
255 Ga0068864_100321593 3300005618 Bacteria 1453
256 Ga0068864_100545486 3300005618 Bacteria 1120
257 Ga0068864_100569611 3300005618 Unclassified 1096
258 Ga0068851_10003156 3300005834 Bacteria 7310
259 Ga0068851_10007873 3300005834 Bacteria 4905
260 Ga0068851_10019714 3300005834 Bacteria 3260
261 Ga0068851_10185900 3300005834 Bacteria 1153
262 Ga0068851_10403132 3300005834 Bacteria 805
263 Ga0068863_100001861 3300005841 Bacteria 20976
264 Ga0068863_100002734 3300005841 Bacteria 17441
265 Ga0068863_100013281 3300005841 Bacteria 7947
266 Ga0068863_100038542 3300005841 Unclassified 4547
267 Ga0068863_100074220 3300005841 Bacteria 3218
268 Ga0068863_100109556 3300005841 Bacteria 2629
269 Ga0068863_100321056 3300005841 Bacteria 1504
270 Ga0068863_100342390 3300005841 Bacteria 1455
271 Ga0068858_100000841 3300005842 Bacteria 31803
272 Ga0068858_100020811 3300005842 Bacteria 6132
273 Ga0068858_100043484 3300005842 Bacteria 4165
274 Ga0068858_100405203 3300005842 Bacteria 1311
275 Ga0068858_100659821 3300005842 Bacteria 1017
276 Ga0068860_100001780 3300005843 Bacteria 22937
277 Ga0068860_100030529 3300005843 Bacteria 5183
278 Ga0068860_100045391 3300005843 Bacteria 4190
279 Ga0068860_100227633 3300005843 Bacteria 1811
280 Ga0068860_100429416 3300005843 Bacteria 1311
281 Ga0068860_100915634 3300005843 Bacteria 893
282 Ga0068862_100021633 3300005844 Bacteria 5377
283 Ga0081540_1117804 3300005983 Bacteria 1109
284 Ga0070717_10002283 3300006028 Bacteria 13442
285 Ga0070717_10005514 3300006028 Bacteria 9235
286 Ga0070717_10011465 3300006028 Bacteria 6734
287 Ga0070717_10073027 3300006028 Bacteria 2866
288 Ga0070717_10176352 3300006028 Bacteria 1861
289 Ga0070717_10613410 3300006028 Bacteria 987
290 Ga0070715_10008583 3300006163 Bacteria 3565
291 Ga0070715_10062105 3300006163 Bacteria 1642
292 Ga0070715_10178689 3300006163 Unclassified 1063
293 Ga0070715_10337399 3300006163 Bacteria 819
294 Ga0070715_10635841 3300006163 Bacteria 630
295 Ga0070716_100001038 3300006173 Bacteria 12171
296 Ga0070716_100013740 3300006173 Bacteria 4134
297 Ga0070716_100078419 3300006173 Bacteria 1964
298 Ga0070716_100530411 3300006173 Bacteria 874
299 Ga0070712_100034335 3300006175 Bacteria 3437
300 Ga0070712_100042614 3300006175 Bacteria 3122
301 Ga0070712_100097671 3300006175 Unclassified 2165
302 Ga0070712_100265432 3300006175 Bacteria 1377
303 Ga0097621_100035301 3300006237 Bacteria 3995
304 Ga0097621_100057496 3300006237 Bacteria 3181
305 Ga0097621_100058819 3300006237 Bacteria 3145
306 Ga0097621_100073085 3300006237 Bacteria 2838
307 Ga0097621_100092443 3300006237 Bacteria 2534
308 Ga0097621_100103991 3300006237 Bacteria 2392
309 Ga0097621_100160140 3300006237 Unclassified 1934
310 Ga0097621_100205394 3300006237 Bacteria 1712
311 Ga0097621_100318938 3300006237 Bacteria 1376
312 Ga0097621_100361780 3300006237 Bacteria 1293
313 Ga0097621_100379108 3300006237 Bacteria 1263
314 Ga0097621_100404149 3300006237 Bacteria 1223
315 Ga0097621_100454023 3300006237 Bacteria 1155
316 Ga0097621_100638933 3300006237 Bacteria 976
317 Ga0097621_101068484 3300006237 Unclassified 757
318 Ga0068871_100005207 3300006358 Bacteria 9092
319 Ga0068871_100028148 3300006358 Bacteria 4403
320 Ga0068871_100029558 3300006358 Unclassified 4305
321 Ga0068871_100042290 3300006358 Bacteria 3657
322 Ga0068871_100066082 3300006358 Bacteria 2964
323 Ga0068871_100074706 3300006358 Bacteria 2797
324 Ga0068871_100235591 3300006358 Bacteria 1590
325 Ga0068871_100241901 3300006358 Bacteria 1569
326 Ga0068871_100351006 3300006358 Bacteria 1305
327 Ga0068871_100362797 3300006358 Bacteria 1283
328 Ga0068871_100925860 3300006358 Unclassified 809
329 Ga0075433_10087365 3300006852 Bacteria 2754
330 Ga0075434_100049162 3300006871 Bacteria 4186
331 Ga0075434_100073522 3300006871 Bacteria 3411
332 Ga0068865_100064219 3300006881 Bacteria 2583
333 Ga0075436_100000559 3300006914 Bacteria 24291
334 Ga0075436_100012467 3300006914 Bacteria 5825
335 Ga0075436_100019468 3300006914 Bacteria 4652
336 Ga0075436_100110523 3300006914 Bacteria 1918
337 Ga0097620_100010731 3300006931 Bacteria 9219
338 Ga0097620_100076873 3300006931 Bacteria 3379
339 Ga0097620_100087983 3300006931 Bacteria 3155
340 Ga0097620_100154702 3300006931 Bacteria 2370
341 Ga0097620_100563863 3300006931 Bacteria 1233
342 Ga0097620_101330252 3300006931 Unclassified 792
343 Ga0075435_100139853 3300007076 Bacteria 2031
344 Ga0075435_100544134 3300007076 Bacteria 1005
345 Ga0099794_10008896 3300007265 Bacteria 4185
346 Ga0099794_10018002 3300007265 Bacteria 3160
347 Ga0099794_10047024 3300007265 Bacteria 2068
348 Ga0099794_10052137 3300007265 Bacteria 1972
349 Ga0099794_10101377 3300007265 Bacteria 1437
350 Ga0099794_10188614 3300007265 Unclassified 1054
351 Ga0099794_10199598 3300007265 Unclassified 1024
352 Ga0099794_10255239 3300007265 Unclassified 904
353 Ga0099794_10310098 3300007265 Bacteria 818
354 Ga0099794_10351365 3300007265 Bacteria 767
355 Ga0099794_10452395 3300007265 Bacteria 673
356 Ga0099795_10006652 3300007788 Bacteria 3169
357 Ga0099795_10201743 3300007788 Bacteria 839
358 Ga0105240_10000002 3300009093 Bacteria 1924170
359 Ga0105240_10000839 3300009093 Bacteria 55340
360 Ga0105240_10000904 3300009093 Bacteria 53010
361 Ga0105240_10001150 3300009093 Bacteria 46310
362 Ga0105240_10001167 3300009093 Bacteria 46058
363 Ga0105240_10001456 3300009093 Bacteria 40471
364 Ga0105240_10003229 3300009093 Bacteria 25527
365 Ga0105240_10004689 3300009093 Bacteria 20669
366 Ga0105240_10005098 3300009093 Bacteria 19683
367 Ga0105240_10006651 3300009093 Bacteria 16964
368 Ga0105240_10007154 3300009093 Bacteria 16258
369 Ga0105240_10029233 3300009093 Bacteria 7185
370 Ga0105240_10099435 3300009093 Bacteria 3540
371 Ga0105240_10114317 3300009093 Bacteria 3261
372 Ga0105240_10154906 3300009093 Bacteria 2726
373 Ga0105240_10174958 3300009093 Bacteria 2538
374 Ga0105240_10203660 3300009093 Bacteria 2317
375 Ga0105240_10238967 3300009093 Bacteria 2107
376 Ga0105240_10240351 3300009093 Bacteria 2100
377 Ga0105240_10256960 3300009093 Bacteria 2017
378 Ga0105240_10580644 3300009093 Bacteria 1236
379 Ga0105240_10588221 3300009093 Bacteria 1227
380 Ga0105240_10652870 3300009093 Bacteria 1153
381 Ga0105240_11253303 3300009093 Bacteria 783
382 Ga0105240_11711543 3300009093 Bacteria 656
383 Ga0105245_10002156 3300009098 Bacteria 17826
384 Ga0105245_10009911 3300009098 Bacteria 8298
385 Ga0105245_10012128 3300009098 Bacteria 7494
386 Ga0105245_10019044 3300009098 Bacteria 6008
387 Ga0105245_10028926 3300009098 Bacteria 4892
388 Ga0105245_10036183 3300009098 Bacteria 4384
389 Ga0105245_10072027 3300009098 Bacteria 3139
390 Ga0105245_10127612 3300009098 Bacteria 2383
391 Ga0105245_10205987 3300009098 Bacteria 1891
392 Ga0105245_10378823 3300009098 Bacteria 1409
393 Ga0105245_10907997 3300009098 Bacteria 922
394 Ga0105245_11001472 3300009098 Bacteria 880
395 Ga0105247_10009974 3300009101 Bacteria 5752
396 Ga0105247_10030120 3300009101 Bacteria 3290
397 Ga0105247_10104596 3300009101 Bacteria 1814
398 Ga0105247_10363699 3300009101 Bacteria 1021
399 Ga0105247_10597619 3300009101 Bacteria 818
400 Ga0105247_10695124 3300009101 Bacteria 765
401 Ga0114129_11987220 3300009147 Bacteria 703
402 Ga0105243_10056567 3300009148 Bacteria 3120
403 Ga0105243_10134055 3300009148 Bacteria 2105
404 Ga0105243_10222771 3300009148 Unclassified 1668
405 Ga0105243_10224694 3300009148 Bacteria 1662
406 Ga0105243_10588120 3300009148 Bacteria 1069
407 Ga0105241_10000014 3300009174 Bacteria 171306
408 Ga0105241_10004691 3300009174 Bacteria 10092
409 Ga0105241_10005338 3300009174 Bacteria 9494
410 Ga0105241_10007806 3300009174 Bacteria 7867
411 Ga0105241_10009235 3300009174 Bacteria 7252
412 Ga0105241_10019492 3300009174 Bacteria 5002
413 Ga0105241_10057417 3300009174 Bacteria 2986
414 Ga0105241_10058284 3300009174 Bacteria 2966
415 Ga0105241_10082039 3300009174 Bacteria 2527
416 Ga0105241_10107535 3300009174 Bacteria 2228
417 Ga0105241_10119461 3300009174 Bacteria 2120
418 Ga0105241_10225789 3300009174 Bacteria 1576
419 Ga0105241_10335764 3300009174 Unclassified 1308
420 Ga0105241_10469447 3300009174 Bacteria 1116
421 Ga0105241_10643576 3300009174 Unclassified 962
422 Ga0105241_10740925 3300009174 Bacteria 900
423 Ga0105241_10893930 3300009174 Unclassified 824
424 Ga0105242_10011241 3300009176 Bacteria 6881
425 Ga0105242_10035741 3300009176 Bacteria 3984
426 Ga0105242_10107437 3300009176 Unclassified 2373
427 Ga0105242_10112272 3300009176 Bacteria 2325
428 Ga0105242_10112723 3300009176 Bacteria 2321
429 Ga0105242_10113453 3300009176 Bacteria 2314
430 Ga0105242_10256249 3300009176 Bacteria 1578
431 Ga0105242_10317198 3300009176 Bacteria 1428
432 Ga0105242_10424834 3300009176 Bacteria 1246
433 Ga0105242_10552998 3300009176 Bacteria 1104
434 Ga0105242_10613814 3300009176 Bacteria 1052
435 Ga0105242_10940387 3300009176 Bacteria 868
436 Ga0105242_11368688 3300009176 Unclassified 734
437 Ga0105248_10004322 3300009177 Bacteria 15718
438 Ga0105248_10023504 3300009177 Bacteria 6846
439 Ga0105248_10036438 3300009177 Bacteria 5501
440 Ga0105248_10059800 3300009177 Bacteria 4280
441 Ga0105248_10080095 3300009177 Bacteria 3670
442 Ga0105248_10117786 3300009177 Bacteria 2996
443 Ga0105248_10160799 3300009177 Bacteria 2533
444 Ga0105248_10445357 3300009177 Bacteria 1459
445 Ga0105248_10589521 3300009177 Unclassified 1254
446 Ga0105248_10633792 3300009177 Bacteria 1206
447 Ga0105248_10764333 3300009177 Bacteria 1090
448 Ga0105248_11075935 3300009177 Bacteria 909
449 Ga0105237_10003893 3300009545 Bacteria 17520
450 Ga0105237_10007736 3300009545 Bacteria 11734
451 Ga0105237_10010226 3300009545 Bacteria 9998
452 Ga0105237_10023341 3300009545 Bacteria 6339
453 Ga0105237_10029243 3300009545 Bacteria 5605
454 Ga0105237_10092676 3300009545 Bacteria 3011
455 Ga0105237_10122584 3300009545 Bacteria 2593
456 Ga0105237_10265275 3300009545 Bacteria 1720
457 Ga0105237_10628732 3300009545 Bacteria 1080
458 Ga0105237_10742186 3300009545 Bacteria 988
459 Ga0105237_11692647 3300009545 Bacteria 640
460 Ga0105238_10000658 3300009551 Bacteria 36203
461 Ga0105238_10001077 3300009551 Bacteria 27578
462 Ga0105238_10003880 3300009551 Bacteria 14842
463 Ga0105238_10009399 3300009551 Bacteria 9787
464 Ga0105238_10009529 3300009551 Bacteria 9720
465 Ga0105238_10024560 3300009551 Bacteria 6143
466 Ga0105238_10025711 3300009551 Bacteria 6003
467 Ga0105238_10032757 3300009551 Bacteria 5290
468 Ga0105238_10038804 3300009551 Bacteria 4836
469 Ga0105238_10071939 3300009551 Bacteria 3455
470 Ga0105238_10258961 3300009551 Bacteria 1719
471 Ga0105238_11202481 3300009551 Bacteria 782
472 Ga0105238_11647251 3300009551 Bacteria 672
473 Ga0105249_10009429 3300009553 Bacteria 8544
474 Ga0105249_10051778 3300009553 Bacteria 3747
475 Ga0105249_10076853 3300009553 Bacteria 3095
476 Ga0105249_10704935 3300009553 Bacteria 1070
477 Ga0099796_10004116 3300010159 Bacteria 3477
478 Ga0105239_10002219 3300010375 Bacteria 24922
479 Ga0105239_10006418 3300010375 Bacteria 13650
480 Ga0105239_10007915 3300010375 Bacteria 12152
481 Ga0105239_10010547 3300010375 Bacteria 10332
482 Ga0105239_10013129 3300010375 Bacteria 9204
483 Ga0105239_10017993 3300010375 Bacteria 7814
484 Ga0105239_10076896 3300010375 Bacteria 3672
485 Ga0105239_10123673 3300010375 Bacteria 2874
486 Ga0105239_10154445 3300010375 Unclassified 2562
487 Ga0105239_10205403 3300010375 Bacteria 2208
488 Ga0105239_10210253 3300010375 Bacteria 2181
489 Ga0105246_10001710 3300011119 Bacteria 13105
490 Ga0105246_10004304 3300011119 Bacteria 8660
491 Ga0105246_10146269 3300011119 Bacteria 1783
492 Ga0105246_10662824 3300011119 Unclassified 910
493 Ga0157373_10064781 3300013100 Bacteria 2587
494 Ga0157373_10846679 3300013100 Bacteria 676
495 Ga0157373_10896115 3300013100 Bacteria 658
496 Ga0157371_10314099 3300013102 Bacteria 1136
497 Ga0157371_10373274 3300013102 Bacteria 1041
498 Ga0157371_10451024 3300013102 Bacteria 946
499 Ga0157370_10000005 3300013104 Bacteria 288514
500 Ga0157370_10002893 3300013104 Bacteria 20474
501 Ga0157370_10003670 3300013104 Bacteria 17924
502 Ga0157370_10004975 3300013104 Bacteria 15044
503 Ga0157370_10035401 3300013104 Bacteria 4853
504 Ga0157370_10074183 3300013104 Bacteria 3209
505 Ga0157370_10121051 3300013104 Bacteria 2443
506 Ga0157370_10551093 3300013104 Unclassified 1057
507 Ga0157370_10768674 3300013104 Bacteria 877
508 Ga0157370_11128978 3300013104 Bacteria 708
509 Ga0157369_10000266 3300013105 Bacteria 70735
510 Ga0157369_10003469 3300013105 Bacteria 18709
511 Ga0157369_10003568 3300013105 Bacteria 18484
512 Ga0157369_10018391 3300013105 Bacteria 7835
513 Ga0157369_10027298 3300013105 Bacteria 6330
514 Ga0157369_10028160 3300013105 Bacteria 6219
515 Ga0157369_10030376 3300013105 Bacteria 5959
516 Ga0157369_10034284 3300013105 Bacteria 5572
517 Ga0157369_10039645 3300013105 Bacteria 5147
518 Ga0157369_10079146 3300013105 Bacteria 3521
519 Ga0157369_10101391 3300013105 Bacteria 3067
520 Ga0157369_10139154 3300013105 Bacteria 2569
521 Ga0157369_10201143 3300013105 Bacteria 2091
522 Ga0157369_10220341 3300013105 Bacteria 1986
523 Ga0157369_10242034 3300013105 Unclassified 1884
524 Ga0157369_10285702 3300013105 Bacteria 1718
525 Ga0157369_10288127 3300013105 Bacteria 1710
526 Ga0157369_10498646 3300013105 Bacteria 1260
527 Ga0157374_10002719 3300013296 Bacteria 14857
528 Ga0157374_10002942 3300013296 Bacteria 14272
529 Ga0157374_10003429 3300013296 Bacteria 13323
530 Ga0157374_10072850 3300013296 Unclassified 3242
531 Ga0157374_10109021 3300013296 Bacteria 2662
532 Ga0157374_10131929 3300013296 Bacteria 2418
533 Ga0157374_10139231 3300013296 Bacteria 2355
534 Ga0157374_10208387 3300013296 Bacteria 1916
535 Ga0157374_10311589 3300013296 Unclassified 1558
536 Ga0157374_10497724 3300013296 Bacteria 1223
537 Ga0157374_10676973 3300013296 Bacteria 1044
538 Ga0157374_10857486 3300013296 Unclassified 925
539 Ga0157374_10942614 3300013296 Bacteria 882
540 Ga0157374_11474199 3300013296 Bacteria 704
541 Ga0157374_11860916 3300013296 Bacteria 627
542 Ga0157378_10000316 3300013297 Bacteria 47349
543 Ga0157378_10009939 3300013297 Bacteria 8296
544 Ga0157378_10017618 3300013297 Bacteria 6271
545 Ga0157378_10045935 3300013297 Bacteria 3882
546 Ga0157378_10124410 3300013297 Bacteria 2381
547 Ga0157378_10210903 3300013297 Bacteria 1842
548 Ga0157378_10510080 3300013297 Bacteria 1203
549 Ga0157378_10561282 3300013297 Unclassified 1148
550 Ga0157378_10590058 3300013297 Bacteria 1121
551 Ga0157378_10596771 3300013297 Bacteria 1115
552 Ga0157378_10792232 3300013297 Unclassified 973
553 Ga0157378_10803673 3300013297 Bacteria 966
554 Ga0157378_10809115 3300013297 Bacteria 963
555 Ga0157378_10854551 3300013297 Bacteria 938
556 Ga0163162_10004608 3300013306 Bacteria 13286
557 Ga0163162_10017631 3300013306 Bacteria 6985
558 Ga0163162_10020819 3300013306 Bacteria 6448
559 Ga0163162_10042380 3300013306 Bacteria 4556
560 Ga0163162_10427055 3300013306 Unclassified 1457
561 Ga0163162_10437004 3300013306 Bacteria 1441
562 Ga0163162_10480415 3300013306 Bacteria 1374
563 Ga0163162_10689098 3300013306 Bacteria 1144
564 Ga0163162_11706160 3300013306 Bacteria 719
565 Ga0163162_12110012 3300013306 Bacteria 646
566 Ga0157372_10000755 3300013307 Bacteria 35052
567 Ga0157372_10002651 3300013307 Bacteria 19391
568 Ga0157372_10005248 3300013307 Bacteria 13762
569 Ga0157372_10009747 3300013307 Bacteria 10216
570 Ga0157372_10013164 3300013307 Bacteria 8826
571 Ga0157372_10016918 3300013307 Bacteria 7829
572 Ga0157372_10025746 3300013307 Bacteria 6400
573 Ga0157372_10041998 3300013307 Bacteria 5056
574 Ga0157372_10055961 3300013307 Bacteria 4407
575 Ga0157372_10056203 3300013307 Bacteria 4397
576 Ga0157372_10118521 3300013307 Bacteria 3038
577 Ga0157372_10136260 3300013307 Bacteria 2827
578 Ga0157372_10474625 3300013307 Bacteria 1458
579 Ga0157372_10606817 3300013307 Unclassified 1276
580 Ga0157372_10669648 3300013307 Bacteria 1208
581 Ga0157372_10832683 3300013307 Bacteria 1071
582 Ga0157372_11059881 3300013307 Bacteria 938
583 Ga0157372_11097825 3300013307 Bacteria 920
584 Ga0157372_11355445 3300013307 Bacteria 820
585 Ga0157372_11685072 3300013307 Bacteria 729
586 Ga0157372_12225339 3300013307 Bacteria 630
587 Ga0157375_10009399 3300013308 Bacteria 8583
588 Ga0157375_10019853 3300013308 Bacteria 6126
589 Ga0157375_10072366 3300013308 Bacteria 3464
590 Ga0157375_10198083 3300013308 Bacteria 2164
591 Ga0157375_10346612 3300013308 Bacteria 1651
592 Ga0157375_10355611 3300013308 Bacteria 1631
593 Ga0157375_10388376 3300013308 Bacteria 1563
594 Ga0157375_11132328 3300013308 Unclassified 917
595 Ga0163163_10001566 3300014325 Bacteria 19297
596 Ga0163163_10003008 3300014325 Bacteria 14268
597 Ga0163163_10049024 3300014325 Bacteria 4155
598 Ga0163163_10083023 3300014325 Bacteria 3209
599 Ga0163163_10178213 3300014325 Bacteria 2172
600 Ga0163163_10216082 3300014325 Bacteria 1966
601 Ga0163163_10248958 3300014325 Unclassified 1827
602 Ga0163163_10297226 3300014325 Unclassified 1667
603 Ga0163163_10304263 3300014325 Bacteria 1647
604 Ga0163163_10396601 3300014325 Bacteria 1438
605 Ga0163163_10436062 3300014325 Bacteria 1369
606 Ga0163163_10497457 3300014325 Bacteria 1281
607 Ga0163163_10716468 3300014325 Bacteria 1064
608 Ga0157377_10084310 3300014745 Bacteria 1864
609 Ga0157379_10039454 3300014968 Bacteria 4213
610 Ga0157379_10083192 3300014968 Bacteria 2869
611 Ga0157379_10084780 3300014968 Unclassified 2839
612 Ga0157379_10091751 3300014968 Bacteria 2725
613 Ga0157379_10117979 3300014968 Bacteria 2387
614 Ga0157379_10223685 3300014968 Bacteria 1705
615 Ga0157379_10306748 3300014968 Bacteria 1447
616 Ga0157379_10409085 3300014968 Bacteria 1248
617 Ga0157379_10631359 3300014968 Bacteria 1002
618 Ga0157379_10769929 3300014968 Unclassified 907
619 Ga0157376_10000040 3300014969 Bacteria 121140
620 Ga0157376_10010806 3300014969 Bacteria 6701
621 Ga0157376_10059744 3300014969 Bacteria 3197
622 Ga0157376_10075430 3300014969 Unclassified 2878
623 Ga0157376_10232919 3300014969 Unclassified 1712
624 Ga0157376_10243819 3300014969 Bacteria 1675
625 Ga0157376_10680440 3300014969 Bacteria 1032
626 Ga0157376_10685054 3300014969 Bacteria 1029
627 Ga0157376_10749769 3300014969 Bacteria 985
628 Ga0157376_10754546 3300014969 Bacteria 982
629 Ga0157376_11163105 3300014969 Unclassified 799
630 Ga0157376_11552305 3300014969 Bacteria 696
631 Ga0163161_10044673 3300017792 Bacteria 3192
632 Ga0206351_10035105 3300020077 Bacteria 733
633 Ga0213874_10190105 3300021377 Unclassified 734
634 Ga0213876_10017317 3300021384 Bacteria 3804
635 Ga0213876_10458249 3300021384 Bacteria 678
636 Ga0213876_10486054 3300021384 Unclassified 657
637 Ga0224572_1025417 3300024225 Unclassified 1137
638 Ga0228598_1012620 3300024227 Bacteria 1678
639 Ga0228598_1063680 3300024227 Bacteria 735
640 Ga0209437_115078 3300025233 Bacteria 1063
641 Ga0209233_1005124 3300025261 Bacteria 4383
642 Ga0207697_10096556 3300025315 Bacteria 1257
643 Ga0207697_10188643 3300025315 Unclassified 905
644 Ga0207656_10002473 3300025321 Bacteria 6236
645 Ga0207656_10012793 3300025321 Unclassified 3194
646 Ga0207656_10122151 3300025321 Bacteria 1213
647 Ga0207656_10129802 3300025321 Bacteria 1180
648 Ga0207656_10132156 3300025321 Bacteria 1170
649 Ga0207653_10003592 3300025885 Bacteria 4883
650 Ga0207692_10084276 3300025898 Bacteria 1707
651 Ga0207692_10324155 3300025898 Bacteria 943
652 Ga0207710_10001958 3300025900 Bacteria 9844
653 Ga0207710_10066889 3300025900 Bacteria 1640
654 Ga0207710_10094597 3300025900 Unclassified 1403
655 Ga0207680_10001465 3300025903 Bacteria 11179
656 Ga0207680_10030433 3300025903 Bacteria 3045
657 Ga0207680_10119514 3300025903 Bacteria 1721
658 Ga0207685_10177109 3300025905 Bacteria 986
659 Ga0207685_10189675 3300025905 Unclassified 959
660 Ga0207699_10011702 3300025906 Bacteria 4441
661 Ga0207699_10012146 3300025906 Unclassified 4374
662 Ga0207699_10056306 3300025906 Bacteria 2343
663 Ga0207699_10130620 3300025906 Bacteria 1638
664 Ga0207645_10068410 3300025907 Bacteria 2271
665 Ga0207705_10005460 3300025909 Bacteria 9505
666 Ga0207705_10099448 3300025909 Bacteria 2138
667 Ga0207705_10730318 3300025909 Bacteria 769
668 Ga0207684_10008000 3300025910 Bacteria 9445
669 Ga0207684_10358390 3300025910 Bacteria 1255
670 Ga0207684_10434044 3300025910 Bacteria 1128
671 Ga0207654_10000018 3300025911 Bacteria 173245
672 Ga0207654_10000559 3300025911 Bacteria 21075
673 Ga0207654_10002749 3300025911 Bacteria 8928
674 Ga0207654_10003369 3300025911 Bacteria 8095
675 Ga0207654_10015104 3300025911 Unclassified 3999
676 Ga0207654_10029747 3300025911 Bacteria 2993
677 Ga0207654_10078749 3300025911 Bacteria 1978
678 Ga0207654_10112676 3300025911 Bacteria 1695
679 Ga0207654_10255465 3300025911 Bacteria 1176
680 Ga0207654_10288296 3300025911 Bacteria 1112
681 Ga0207707_10002540 3300025912 Bacteria 16376
682 Ga0207707_10013981 3300025912 Bacteria 6999
683 Ga0207707_10024120 3300025912 Bacteria 5320
684 Ga0207707_10026986 3300025912 Bacteria 5019
685 Ga0207707_10087217 3300025912 Bacteria 2727
686 Ga0207707_10290186 3300025912 Unclassified 1415
687 Ga0207707_10489208 3300025912 Unclassified 1050
688 Ga0207695_10000167 3300025913 Bacteria 194371
689 Ga0207695_10000297 3300025913 Bacteria 123067
690 Ga0207695_10000384 3300025913 Bacteria 100121
691 Ga0207695_10000539 3300025913 Bacteria 78884
692 Ga0207695_10000770 3300025913 Bacteria 60994
693 Ga0207695_10000825 3300025913 Bacteria 57395
694 Ga0207695_10000942 3300025913 Bacteria 51840
695 Ga0207695_10003871 3300025913 Bacteria 20713
696 Ga0207695_10006112 3300025913 Bacteria 15710
697 Ga0207695_10015143 3300025913 Bacteria 9095
698 Ga0207695_10039408 3300025913 Bacteria 5079
699 Ga0207695_10078908 3300025913 Bacteria 3339
700 Ga0207695_10120599 3300025913 Bacteria 2591
701 Ga0207695_10260635 3300025913 Bacteria 1631
702 Ga0207695_10314767 3300025913 Bacteria 1455
703 Ga0207695_10323390 3300025913 Bacteria 1432
704 Ga0207695_10323537 3300025913 Bacteria 1431
705 Ga0207695_10376491 3300025913 Bacteria 1305
706 Ga0207695_10395491 3300025913 Bacteria 1267
707 Ga0207695_10420130 3300025913 Bacteria 1221
708 Ga0207695_10545255 3300025913 Bacteria 1041
709 Ga0207695_10642066 3300025913 Unclassified 942
710 Ga0207695_10952207 3300025913 Unclassified 738
711 Ga0207671_10000207 3300025914 Bacteria 88886
712 Ga0207671_10000211 3300025914 Bacteria 88074
713 Ga0207671_10005189 3300025914 Bacteria 12108
714 Ga0207671_10015635 3300025914 Bacteria 5933
715 Ga0207671_10041861 3300025914 Unclassified 3391
716 Ga0207671_10135677 3300025914 Bacteria 1892
717 Ga0207671_10196651 3300025914 Bacteria 1573
718 Ga0207671_10299234 3300025914 Bacteria 1271
719 Ga0207671_10335874 3300025914 Bacteria 1197
720 Ga0207671_10723480 3300025914 Bacteria 791
721 Ga0207671_10851874 3300025914 Unclassified 722
722 Ga0207671_10890423 3300025914 Unclassified 704
723 Ga0207693_10098395 3300025915 Bacteria 2294
724 Ga0207693_10111920 3300025915 Bacteria 2141
725 Ga0207693_10176508 3300025915 Bacteria 1681
726 Ga0207693_10183606 3300025915 Bacteria 1646
727 Ga0207693_10320981 3300025915 Bacteria 1212
728 Ga0207663_10102556 3300025916 Bacteria 1925
729 Ga0207663_10449234 3300025916 Bacteria 994
730 Ga0207663_10530111 3300025916 Bacteria 918
731 Ga0207663_10576954 3300025916 Bacteria 882
732 Ga0207663_11084614 3300025916 Bacteria 643
733 Ga0207660_10003140 3300025917 Bacteria 10806
734 Ga0207660_10024648 3300025917 Bacteria 4075
735 Ga0207660_10231891 3300025917 Bacteria 1452
736 Ga0207660_10311890 3300025917 Bacteria 1254
737 Ga0207660_10551360 3300025917 Unclassified 937
738 Ga0207657_10002306 3300025919 Bacteria 20684
739 Ga0207657_10082827 3300025919 Bacteria 2692
740 Ga0207657_10116390 3300025919 Bacteria 2203
741 Ga0207649_10007995 3300025920 Bacteria 5754
742 Ga0207649_10100879 3300025920 Bacteria 1910
743 Ga0207649_10108322 3300025920 Bacteria 1852
744 Ga0207649_10303202 3300025920 Bacteria 1168
745 Ga0207649_10313814 3300025920 Bacteria 1150
746 Ga0207649_10476582 3300025920 Bacteria 946
747 Ga0207649_10562911 3300025920 Bacteria 873
748 Ga0207652_10004686 3300025921 Bacteria 11088
749 Ga0207652_10006572 3300025921 Bacteria 9372
750 Ga0207652_10009897 3300025921 Bacteria 7671
751 Ga0207652_10138131 3300025921 Bacteria 2178
752 Ga0207652_10147122 3300025921 Unclassified 2109
753 Ga0207652_10285803 3300025921 Bacteria 1488
754 Ga0207652_10784655 3300025921 Bacteria 847
755 Ga0207646_10045435 3300025922 Bacteria 3943
756 Ga0207646_10123715 3300025922 Unclassified 2325
757 Ga0207646_10155479 3300025922 Bacteria 2062
758 Ga0207646_10160426 3300025922 Bacteria 2029
759 Ga0207646_10185887 3300025922 Bacteria 1877
760 Ga0207646_10358215 3300025922 Bacteria 1318
761 Ga0207646_10539089 3300025922 Bacteria 1050
762 Ga0207646_11156013 3300025922 Bacteria 680
763 Ga0207681_10191336 3300025923 Bacteria 1566
764 Ga0207681_10359015 3300025923 Bacteria 1168
765 Ga0207694_10000118 3300025924 Bacteria 83927
766 Ga0207694_10000484 3300025924 Bacteria 36222
767 Ga0207694_10000823 3300025924 Bacteria 27668
768 Ga0207694_10001030 3300025924 Bacteria 24309
769 Ga0207694_10005449 3300025924 Bacteria 9789
770 Ga0207694_10024333 3300025924 Bacteria 4598
771 Ga0207694_10029031 3300025924 Bacteria 4218
772 Ga0207694_10031174 3300025924 Bacteria 4072
773 Ga0207694_10035630 3300025924 Bacteria 3819
774 Ga0207694_10046448 3300025924 Bacteria 3356
775 Ga0207694_10095502 3300025924 Bacteria 2350
776 Ga0207694_10125980 3300025924 Bacteria 2049
777 Ga0207694_10328220 3300025924 Bacteria 1264
778 Ga0207650_10155100 3300025925 Bacteria 1810
779 Ga0207650_11540121 3300025925 Bacteria 565
780 Ga0207659_10109918 3300025926 Bacteria 2094
781 Ga0207687_10003603 3300025927 Bacteria 10427
782 Ga0207687_10022716 3300025927 Bacteria 4177
783 Ga0207687_10062250 3300025927 Bacteria 2638
784 Ga0207687_10081065 3300025927 Bacteria 2344
785 Ga0207687_10138547 3300025927 Bacteria 1843
786 Ga0207687_10161699 3300025927 Bacteria 1719
787 Ga0207687_10314447 3300025927 Bacteria 1266
788 Ga0207687_10386954 3300025927 Bacteria 1147
789 Ga0207687_10639357 3300025927 Bacteria 899
790 Ga0207687_11607907 3300025927 Unclassified 558
791 Ga0207700_10002914 3300025928 Bacteria 9859
792 Ga0207700_10028252 3300025928 Bacteria 3941
793 Ga0207700_10044198 3300025928 Bacteria 3278
794 Ga0207700_10084438 3300025928 Bacteria 2489
795 Ga0207700_10299647 3300025928 Bacteria 1388
796 Ga0207664_10012235 3300025929 Bacteria 6132
797 Ga0207664_10037869 3300025929 Bacteria 3735
798 Ga0207664_10110490 3300025929 Bacteria 2286
799 Ga0207664_10461067 3300025929 Bacteria 1135
800 Ga0207664_10513134 3300025929 Bacteria 1074
801 Ga0207664_10917148 3300025929 Bacteria 786
802 Ga0207644_10005916 3300025931 Bacteria 7975
803 Ga0207644_10034067 3300025931 Bacteria 3563
804 Ga0207644_10040055 3300025931 Bacteria 3310
805 Ga0207644_10098279 3300025931 Bacteria 2194
806 Ga0207644_10215420 3300025931 Bacteria 1520
807 Ga0207690_10011567 3300025932 Bacteria 5271
808 Ga0207706_10003066 3300025933 Bacteria 16084
809 Ga0207686_10017121 3300025934 Bacteria 4078
810 Ga0207686_10024345 3300025934 Bacteria 3507
811 Ga0207686_10032314 3300025934 Bacteria 3114
812 Ga0207686_10052481 3300025934 Bacteria 2545
813 Ga0207686_10055003 3300025934 Bacteria 2495
814 Ga0207686_10062170 3300025934 Bacteria 2370
815 Ga0207686_10080178 3300025934 Unclassified 2127
816 Ga0207686_10090364 3300025934 Bacteria 2020
817 Ga0207686_10505978 3300025934 Bacteria 938
818 Ga0207686_10995416 3300025934 Bacteria 680
819 Ga0207709_10084879 3300025935 Bacteria 2051
820 Ga0207709_10128424 3300025935 Unclassified 1723
821 Ga0207709_10208062 3300025935 Bacteria 1402
822 Ga0207709_10519165 3300025935 Bacteria 932
823 Ga0207670_10371559 3300025936 Unclassified 1137
824 Ga0207669_10240422 3300025937 Bacteria 1342
825 Ga0207704_10132754 3300025938 Bacteria 1728
826 Ga0207704_10173336 3300025938 Bacteria 1550
827 Ga0207665_10000011 3300025939 Bacteria 145201
828 Ga0207665_10001886 3300025939 Bacteria 14134
829 Ga0207665_10039627 3300025939 Bacteria 3141
830 Ga0207665_10052707 3300025939 Bacteria 2741
831 Ga0207665_10053545 3300025939 Bacteria 2720
832 Ga0207665_10282994 3300025939 Bacteria 1234
833 Ga0207665_10436406 3300025939 Bacteria 1003
834 Ga0207691_10014464 3300025940 Bacteria 7523
835 Ga0207691_10653931 3300025940 Bacteria 888
836 Ga0207711_10000701 3300025941 Bacteria 33020
837 Ga0207711_10002368 3300025941 Bacteria 16873
838 Ga0207711_10004561 3300025941 Bacteria 11782
839 Ga0207711_10035393 3300025941 Bacteria 4232
840 Ga0207711_10082332 3300025941 Bacteria 2813
841 Ga0207711_10092261 3300025941 Bacteria 2665
842 Ga0207711_10095353 3300025941 Bacteria 2624
843 Ga0207711_10104413 3300025941 Unclassified 2511
844 Ga0207711_10137510 3300025941 Bacteria 2195
845 Ga0207711_10186154 3300025941 Bacteria 1890
846 Ga0207711_10427783 3300025941 Bacteria 1232
847 Ga0207689_10000639 3300025942 Bacteria 33456
848 Ga0207689_10031696 3300025942 Bacteria 4398
849 Ga0207689_10115440 3300025942 Bacteria 2207
850 Ga0207689_10286448 3300025942 Bacteria 1364
851 Ga0207689_10302332 3300025942 Unclassified 1326
852 Ga0207689_10308211 3300025942 Bacteria 1313
853 Ga0207661_10002207 3300025944 Bacteria 13431
854 Ga0207661_10008706 3300025944 Bacteria 7255
855 Ga0207661_10015272 3300025944 Bacteria 5647
856 Ga0207661_10017408 3300025944 Bacteria 5318
857 Ga0207661_10020722 3300025944 Bacteria 4919
858 Ga0207661_10078725 3300025944 Bacteria 2715
859 Ga0207661_10081609 3300025944 Bacteria 2671
860 Ga0207661_10140583 3300025944 Bacteria 2077
861 Ga0207661_10210067 3300025944 Unclassified 1715
862 Ga0207661_10397972 3300025944 Bacteria 1249
863 Ga0207679_10269403 3300025945 Bacteria 1456
864 Ga0207679_10290095 3300025945 Unclassified 1406
865 Ga0207679_11231617 3300025945 Bacteria 687
866 Ga0207679_11262962 3300025945 Bacteria 678
867 Ga0207679_11521645 3300025945 Unclassified 613
868 Ga0207667_10000704 3300025949 Bacteria 43381
869 Ga0207667_10001298 3300025949 Bacteria 31322
870 Ga0207667_10001669 3300025949 Bacteria 27969
871 Ga0207667_10003842 3300025949 Bacteria 18465
872 Ga0207667_10005331 3300025949 Bacteria 15672
873 Ga0207667_10021374 3300025949 Bacteria 7171
874 Ga0207667_10022036 3300025949 Bacteria 7049
875 Ga0207667_10024356 3300025949 Bacteria 6646
876 Ga0207667_10043726 3300025949 Bacteria 4752
877 Ga0207667_10045348 3300025949 Bacteria 4657
878 Ga0207667_10053693 3300025949 Bacteria 4239
879 Ga0207667_10057480 3300025949 Bacteria 4083
880 Ga0207667_10175601 3300025949 Bacteria 2201
881 Ga0207667_10631988 3300025949 Bacteria 1077
882 Ga0207667_10832265 3300025949 Bacteria 918
883 Ga0207667_10871885 3300025949 Bacteria 893
884 Ga0207651_10012262 3300025960 Bacteria 4842
885 Ga0207651_10160017 3300025960 Bacteria 1764
886 Ga0207712_10020844 3300025961 Bacteria 4299
887 Ga0207712_10530544 3300025961 Bacteria 1010
888 Ga0207640_10015561 3300025981 Bacteria 4407
889 Ga0207640_10028252 3300025981 Bacteria 3428
890 Ga0207640_10771451 3300025981 Bacteria 831
891 Ga0207640_10843378 3300025981 Bacteria 797
892 Ga0207640_11305646 3300025981 Bacteria 648
893 Ga0207640_11568133 3300025981 Bacteria 593
894 Ga0207658_10008830 3300025986 Bacteria 6838
895 Ga0207658_10341552 3300025986 Bacteria 1301
896 Ga0207677_10003199 3300026023 Bacteria 8638
897 Ga0207677_10015604 3300026023 Bacteria 4474
898 Ga0207677_10019576 3300026023 Bacteria 4091
899 Ga0207677_10040980 3300026023 Bacteria 3059
900 Ga0207703_10014435 3300026035 Bacteria 6159
901 Ga0207703_10018747 3300026035 Bacteria 5405
902 Ga0207703_10033447 3300026035 Bacteria 4076
903 Ga0207703_10093727 3300026035 Bacteria 2529
904 Ga0207703_10348419 3300026035 Bacteria 1363
905 Ga0207703_10484078 3300026035 Bacteria 1160
906 Ga0207703_11114920 3300026035 Bacteria 758
907 Ga0207639_10000063 3300026041 Bacteria 100309
908 Ga0207639_10001850 3300026041 Bacteria 14229
909 Ga0207639_10027801 3300026041 Bacteria 4124
910 Ga0207639_10070705 3300026041 Bacteria 2727
911 Ga0207639_10127893 3300026041 Bacteria 2098
912 Ga0207639_10128467 3300026041 Bacteria 2094
913 Ga0207639_10132262 3300026041 Bacteria 2067
914 Ga0207639_10133353 3300026041 Bacteria 2059
915 Ga0207639_10220462 3300026041 Bacteria 1638
916 Ga0207639_11272420 3300026041 Bacteria 690
917 Ga0207639_11381542 3300026041 Bacteria 661
918 Ga0207678_10547836 3300026067 Bacteria 1011
919 Ga0207678_11001226 3300026067 Bacteria 740
920 Ga0207708_10725289 3300026075 Unclassified 851
921 Ga0207702_10001530 3300026078 Bacteria 22891
922 Ga0207702_10003431 3300026078 Bacteria 14477
923 Ga0207702_10004553 3300026078 Bacteria 12288
924 Ga0207702_10026789 3300026078 Bacteria 4787
925 Ga0207702_10033402 3300026078 Bacteria 4297
926 Ga0207702_10059910 3300026078 Bacteria 3244
927 Ga0207702_10118771 3300026078 Bacteria 2363
928 Ga0207702_10175867 3300026078 Bacteria 1967
929 Ga0207702_10186544 3300026078 Unclassified 1913
930 Ga0207702_10189269 3300026078 Bacteria 1900
931 Ga0207702_10238822 3300026078 Bacteria 1702
932 Ga0207702_10300631 3300026078 Bacteria 1523
933 Ga0207702_10518200 3300026078 Bacteria 1164
934 Ga0207702_10806703 3300026078 Bacteria 928
935 Ga0207702_11105141 3300026078 Bacteria 787
936 Ga0207641_10003572 3300026088 Bacteria 13744
937 Ga0207641_10013528 3300026088 Bacteria 6694
938 Ga0207641_10017715 3300026088 Bacteria 5835
939 Ga0207641_10027289 3300026088 Unclassified 4716
940 Ga0207641_10028508 3300026088 Bacteria 4614
941 Ga0207641_10058025 3300026088 Bacteria 3293
942 Ga0207641_10358549 3300026088 Bacteria 1391
943 Ga0207648_10020471 3300026089 Bacteria 5957
944 Ga0207648_10154584 3300026089 Bacteria 2025
945 Ga0207648_10214990 3300026089 Bacteria 1707
946 Ga0207676_10010814 3300026095 Bacteria 6508
947 Ga0207676_10066221 3300026095 Bacteria 2880
948 Ga0207676_10094899 3300026095 Bacteria 2459
949 Ga0207676_10333225 3300026095 Bacteria 1397
950 Ga0207676_10416416 3300026095 Bacteria 1259
951 Ga0207674_10004642 3300026116 Bacteria 16498
952 Ga0207674_10006628 3300026116 Bacteria 13604
953 Ga0207674_10007498 3300026116 Bacteria 12718
954 Ga0207674_10010952 3300026116 Bacteria 10207
955 Ga0207674_10018657 3300026116 Bacteria 7535
956 Ga0207674_10112333 3300026116 Bacteria 2698
957 Ga0207674_10139870 3300026116 Bacteria 2381
958 Ga0207674_10366269 3300026116 Bacteria 1393
959 Ga0207674_11605502 3300026116 Bacteria 619
960 Ga0207675_100916811 3300026118 Bacteria 893
961 Ga0207683_10001872 3300026121 Bacteria 18606
962 Ga0207683_10494253 3300026121 Bacteria 1130
963 Ga0207698_10000003 3300026142 Bacteria 321303
964 Ga0207698_10000093 3300026142 Bacteria 57865
965 Ga0207698_10002110 3300026142 Bacteria 11725
966 Ga0207698_10006244 3300026142 Bacteria 7419
967 Ga0207698_10028874 3300026142 Bacteria 3963
968 Ga0207698_10081346 3300026142 Unclassified 2614
969 Ga0207698_10112650 3300026142 Bacteria 2284
970 Ga0207698_10166165 3300026142 Bacteria 1937
971 Ga0207698_10248121 3300026142 Bacteria 1627
972 Ga0207698_10479779 3300026142 Bacteria 1206
973 Ga0207698_10735715 3300026142 Bacteria 984
974 Ga0207698_10925705 3300026142 Bacteria 880
975 Ga0209179_1020399 3300027512 Bacteria 1285
976 Ga0209588_1001606 3300027671 Bacteria 5954
977 Ga0209588_1007654 3300027671 Bacteria 3185
978 Ga0209588_1010308 3300027671 Bacteria 2808
979 Ga0209588_1153886 3300027671 Unclassified 728
980 Ga0265354_1000512 3300028016 Bacteria 6673
981 Ga0265356_1004788 3300028017 Bacteria 1641
982 Ga0265357_1000491 3300028023 Unclassified 2325
983 Ga0268266_10001991 3300028379 Bacteria 22890
984 Ga0268266_10008821 3300028379 Bacteria 8928
985 Ga0268266_10028158 3300028379 Bacteria 4777
986 Ga0268266_10064079 3300028379 Bacteria 3174
987 Ga0268266_10071655 3300028379 Bacteria 3004
988 Ga0268266_10114572 3300028379 Unclassified 2392
989 Ga0268266_10176606 3300028379 Bacteria 1942
990 Ga0268265_10014315 3300028380 Bacteria 5402
991 Ga0268264_10014414 3300028381 Bacteria 6496
992 Ga0268264_10018806 3300028381 Bacteria 5649
993 Ga0268264_10059391 3300028381 Bacteria 3204
994 Ga0268264_10144101 3300028381 Bacteria 2128
995 Ga0268264_10179435 3300028381 Bacteria 1922
996 Ga0268264_10291504 3300028381 Bacteria 1533
997 Ga0268264_10678520 3300028381 Bacteria 1022
998 Ga0265319_1002192 3300028563 Bacteria 10881
999 Ga0265318_10000076 3300028577 Bacteria 94026
1000 Ga0265336_10091630 3300028666 Bacteria 906
1001 Ga0265338_10032424 3300028800 Bacteria 5096
1002 Ga0265338_10069513 3300028800 Unclassified 3025
1003 Ga0265338_10327361 3300028800 Bacteria 1107
1004 Ga0265338_10501979 3300028800 Bacteria 854
1005 Ga0265338_10591459 3300028800 Bacteria 773
1006 Ga0265338_10772056 3300028800 Bacteria 660
1007 Ga0265770_1004703 3300030878 Unclassified 1867
1008 Ga0265765_1000870 3300030879 Bacteria 2627
1009 Ga0265760_10000022 3300031090 Bacteria 68294
1010 Ga0265760_10001426 3300031090 Bacteria 7037
1011 Ga0265760_10009836 3300031090 Bacteria 2728
1012 Ga0265760_10010281 3300031090 Unclassified 2671
1013 Ga0265760_10065013 3300031090 Bacteria 1113
1014 Ga0265330_10155665 3300031235 Bacteria 971
1015 Ga0265330_10322605 3300031235 Bacteria 652
1016 Ga0265332_10057676 3300031238 Bacteria 1663
1017 Ga0265328_10001785 3300031239 Bacteria 9809
1018 Ga0265328_10075243 3300031239 Bacteria 1242
1019 Ga0265320_10000031 3300031240 Bacteria 147045
1020 Ga0265320_10146702 3300031240 Bacteria 1067
1021 Ga0265325_10004183 3300031241 Bacteria 9174
1022 Ga0265325_10004533 3300031241 Bacteria 8752
1023 Ga0265325_10011266 3300031241 Bacteria 5140
1024 Ga0265325_10140662 3300031241 Bacteria 1148
1025 Ga0265329_10000860 3300031242 Bacteria 15331
1026 Ga0265340_10002347 3300031247 Bacteria 10797
1027 Ga0265340_10239107 3300031247 Bacteria 811
1028 Ga0265339_10000031 3300031249 Bacteria 133838
1029 Ga0265339_10003292 3300031249 Bacteria 11308
1030 Ga0265339_10023552 3300031249 Bacteria 3557
1031 Ga0265331_10000039 3300031250 Bacteria 194439
1032 Ga0265331_10010269 3300031250 Bacteria 5190
1033 Ga0265316_10000662 3300031344 Bacteria 38352
1034 Ga0265316_10002301 3300031344 Bacteria 19963
1035 Ga0265316_10003285 3300031344 Bacteria 16411
1036 Ga0265316_10011125 3300031344 Bacteria 8144
1037 Ga0265316_10015019 3300031344 Bacteria 6789
1038 Ga0265316_10022182 3300031344 Bacteria 5361
1039 Ga0265316_10057908 3300031344 Bacteria 3020
1040 Ga0265316_10159995 3300031344 Unclassified 1684
1041 Ga0307509_10175889 3300031507 Bacteria 2013
1042 Ga0265313_10005224 3300031595 Bacteria 9620
1043 Ga0265313_10016048 3300031595 Bacteria 4328
1044 Ga0265314_10000067 3300031711 Bacteria 156225
1045 Ga0265314_10001577 3300031711 Bacteria 25037
1046 Ga0265314_10012255 3300031711 Bacteria 7014
1047 Ga0265314_10019058 3300031711 Bacteria 5323
1048 Ga0265314_10029215 3300031711 Bacteria 4101
1049 Ga0265314_10197417 3300031711 Bacteria 1192
1050 Ga0265342_10000920 3300031712 Bacteria 29215
1051 Ga0265342_10003163 3300031712 Bacteria 13714
1052 Ga0265342_10046882 3300031712 Bacteria 2596
1053 Ga0307409_100243827 3300031995 Bacteria 1638
1054 Ga0316212_1002189 3300033547 Unclassified 2762
1055 Ga0373926_0005499 3300035083 Unclassified 4180
1056 Ga0373934_0014871 3300035086 Bacteria 2948
1057 Ga0373934_0081629 3300035086 Bacteria 1299
1058 Ga0373923_0055647 3300035111 Bacteria 1668
1059 Ga0373923_0125536 3300035111 Bacteria 1150
1060 Ga0373936_0289558 3300035113 Bacteria 737
1061 Ga0373953_0014045 3300035117 Bacteria 2873
1062 Ga0373953_0260444 3300035117 Bacteria 754
1063 Ga0373954_0000984 3300035118 Bacteria 11222
1064 Ga0373954_0056017 3300035118 Unclassified 1855
1065 Ga0373956_0012605 3300035119 Unclassified 3507
1066 Ga0373956_0081120 3300035119 Unclassified 1489
1067 Ga0373956_0280286 3300035119 Bacteria 793
1068 Ga0373957_0109451 3300035120 Bacteria 1112
1069 Ga0373943_0040866 3300035170 Bacteria 2240
1070 Ga0373946_0002371 3300035171 Bacteria 6661
1071 Ga0373946_0092099 3300035171 Bacteria 1345
1072 Ga0373946_0237453 3300035171 Bacteria 885
1073 Ga0373955_0055891 3300035172 Bacteria 2163
1074 Ga0373955_0354363 3300035172 Unclassified 889
1075 Ga0373931_0032724 3300035691 Bacteria 2692
1076 Ga0373935_0026595 3300035692 Bacteria 3573
1077 Ga0373927_0000212 3300035695 Bacteria 46178
1078 Ga0373927_0000614 3300035695 Bacteria 27048
1079 Ga0373927_0007240 3300035695 Bacteria 7526
1080 Ga0373927_0046800 3300035695 Bacteria 2798
1081 Ga0373927_0120406 3300035695 Bacteria 1713
1082 Ga0373927_0126976 3300035695 Bacteria 1665
1083 Ga0373933_0000367 3300035724 Bacteria 28838
1084 Ga0373933_0015424 3300035724 Bacteria 4258
1085 Ga0373933_0101328 3300035724 Bacteria 1787
1086 Ga0373933_0356160 3300035724 Unclassified 951
1087 Ga0373933_0957281 3300035724 Bacteria 564
1088 Ga0373947_0026681 3300035725 Bacteria 3378
1089 Ga0373947_0071247 3300035725 Bacteria 2131
1090 Ga0373937_0002124 3300036401 Bacteria 16565
1091 Ga0373937_0004512 3300036401 Bacteria 11824
1092 Ga0373937_0006149 3300036401 Bacteria 10338
1093 Ga0373937_0006208 3300036401 Bacteria 10296
1094 Ga0373937_0048327 3300036401 Bacteria 3895
1095 Ga0373937_0059532 3300036401 Bacteria 3510
1096 Ga0373937_0439175 3300036401 Bacteria 1239
1097 Ga0373937_0441669 3300036401 Bacteria 1235
1098 Ga0373937_0786259 3300036401 Bacteria 899
1099 Ga0373937_1174169 3300036401 Bacteria 716
1100 Ga0373925_0000487 3300037068 Bacteria 39835
1101 Ga0373925_0009147 3300037068 Bacteria 7209
1102 Ga0373925_0063308 3300037068 Bacteria 2783
1103 Ga0373925_0173252 3300037068 Bacteria 1704
1104 Ga0373925_0303700 3300037068 Bacteria 1289
1105 Ga0373925_0487661 3300037068 Unclassified 1011
1106 Ga0395899_0300915 3300037312 Bacteria 1085
1107 Ga0395899_0319120 3300037312 Bacteria 1047
1108 Ga0395900_0028406 3300037418 Bacteria 5729
1109 Ga0395900_0058272 3300037418 Bacteria 3976
1110 Ga0395900_0357847 3300037418 Bacteria 1432
1111 Ga0395898_0101022 3300037466 Bacteria 2770
1112 Ga0395898_0178528 3300037466 Unclassified 2029
1113 Ga0395898_0474578 3300037466 Bacteria 1190
1114 Ga0395905_0667277 3300037471 Bacteria 942
1115 Ga0436364_0708475 3300037853 Bacteria 732
1116 Ga0395901_0545268 3300038443 Bacteria 1176
1117 Ga0436365_0320037 3300039437 Bacteria 4465
1118 Ga0436365_0352286 3300039437 Unclassified 779
1119 Ga0436365_1092844 3300039437 Unclassified 633
1120 Ga0436365_1396730 3300039437 Bacteria 683
1121 Ga0436360_0025204 3300039438 Bacteria 662
1122 Ga0436363_0413293 3300039450 Unclassified 998
1123 Ga0436363_1122484 3300039450 Bacteria 1855
1124 Ga0436362_0678365 3300039453 Bacteria 1083
1125 Ga0436362_0796667 3300039453 Bacteria 1371
1126 Ga0451791_0662513 3300041451 Bacteria 917
1127 Ga0451797_0373435 3300041453 Unclassified 976
1128 Ga0451837_1137245 3300041494 Bacteria 1626
1129 Ga0451577_0000054 3300042876 Bacteria 278798
1130 Ga0451577_0563173 3300042876 Bacteria 1034
1131 Ga0453683_0012500 3300044673 Bacteria 5564
1132 Ga0453683_0660509 3300044673 Bacteria 684
1133 Ga0466966_0191978 3300044684 Bacteria 1237
1134 Ga0466963_0003591 3300044694 Bacteria 8916
1135 Ga0466963_0236383 3300044694 Bacteria 1281
1136 Ga0453684_0000366 3300044712 Bacteria 186117
1137 Ga0453684_0860484 3300044712 Bacteria 974
1138 Ga0466971_0382292 3300044719 Bacteria 684
1139 Ga0466957_0160777 3300044842 Bacteria 1459
1140 Ga0466959_0003780 3300045049 Bacteria 10032
1141 Ga0451576_0002744 3300045051 Bacteria 25540
1142 Ga0451576_0081985 3300045051 Bacteria 3354
1143 Ga0451576_1298025 3300045051 Bacteria 759
1144 Ga0466967_0010770 3300045976 Bacteria 6876
1145 Ga0495592_0020926 3300046454 Bacteria 4976
1146 Ga0495592_0145802 3300046454 Unclassified 1642
1147 Ga0495592_0516637 3300046454 Bacteria 739
1148 Ga0495603_0033957 3300046455 Unclassified 3069
1149 Ga0495603_0255773 3300046455 Bacteria 1008
1150 Ga0495629_0009423 3300046459 Bacteria 7141
1151 Ga0495629_0021039 3300046459 Bacteria 4655
1152 Ga0495629_0194719 3300046459 Unclassified 1402
1153 Ga0495629_0553159 3300046459 Bacteria 772
1154 Ga0495651_0005310 3300046462 Bacteria 9823
1155 Ga0495651_0023595 3300046462 Bacteria 4783
1156 Ga0495651_0029074 3300046462 Bacteria 4311
1157 Ga0495651_0055560 3300046462 Bacteria 3042
1158 Ga0495651_0067662 3300046462 Bacteria 2724
1159 Ga0495651_0194208 3300046462 Bacteria 1426
1160 Ga0495651_0477887 3300046462 Bacteria 801
1161 Ga0495651_0572032 3300046462 Bacteria 716
1162 Ga0495653_0004837 3300046463 Bacteria 10921
1163 Ga0495653_0096955 3300046463 Bacteria 2143
1164 Ga0495653_0127636 3300046463 Bacteria 1804
1165 Ga0495580_0001970 3300046472 Bacteria 18028
1166 Ga0495580_0008565 3300046472 Bacteria 8117
1167 Ga0495580_0034985 3300046472 Unclassified 3614
1168 Ga0495580_0075316 3300046472 Bacteria 2355
1169 Ga0495580_0095136 3300046472 Bacteria 2072
1170 Ga0495580_0203451 3300046472 Bacteria 1364
1171 Ga0495580_0290830 3300046472 Bacteria 1114
1172 Ga0495580_0349593 3300046472 Bacteria 1002
1173 Ga0495582_0000255 3300046473 Bacteria 29705
1174 Ga0495582_0023087 3300046473 Bacteria 3403
1175 Ga0495582_0052653 3300046473 Unclassified 2244
1176 Ga0495582_0069851 3300046473 Bacteria 1942
1177 Ga0495582_0302795 3300046473 Unclassified 919
1178 Ga0495639_0031000 3300046475 Bacteria 2378
1179 Ga0495662_0042048 3300046476 Unclassified 2206
1180 Ga0495662_0316233 3300046476 Bacteria 768
1181 Ga0495664_0094229 3300046477 Bacteria 1802
1182 Ga0495664_0145950 3300046477 Bacteria 1435
1183 Ga0495664_0168741 3300046477 Bacteria 1328
1184 Ga0495664_0198865 3300046477 Bacteria 1215
1185 Ga0495664_0245294 3300046477 Bacteria 1083
1186 Ga0495664_0398055 3300046477 Bacteria 827
1187 Ga0495594_0049642 3300046499 Bacteria 2307
1188 Ga0495594_0158855 3300046499 Bacteria 1285
1189 Ga0495583_0011240 3300046506 Bacteria 5153
1190 Ga0495606_0242505 3300046507 Bacteria 1004
1191 Ga0495608_0016320 3300046511 Bacteria 5137
1192 Ga0495608_0060218 3300046511 Bacteria 2499
1193 Ga0495628_0018232 3300046516 Bacteria 5819
1194 Ga0495628_0040792 3300046516 Bacteria 3708
1195 Ga0495628_0068289 3300046516 Unclassified 2774
1196 Ga0495628_0098366 3300046516 Bacteria 2260
1197 Ga0495628_0192910 3300046516 Bacteria 1538
1198 Ga0495628_0670598 3300046516 Bacteria 735
1199 Ga0495630_0012890 3300046517 Bacteria 6073
1200 Ga0495630_0668974 3300046517 Bacteria 795
1201 Ga0495630_1137874 3300046517 Bacteria 591
1202 Ga0495632_0106888 3300046519 Bacteria 1316
1203 Ga0495666_0017540 3300046526 Unclassified 3565
1204 Ga0495666_0068896 3300046526 Bacteria 1684
1205 Ga0495652_0006027 3300046529 Bacteria 11340
1206 Ga0495652_0014296 3300046529 Bacteria 7128
1207 Ga0495652_0109741 3300046529 Bacteria 2221
1208 Ga0495652_0119825 3300046529 Bacteria 2101
1209 Ga0495652_0125081 3300046529 Bacteria 2044
1210 Ga0495652_0271395 3300046529 Bacteria 1246
1211 Ga0495652_0532657 3300046529 Bacteria 810
1212 Ga0495665_0002414 3300046531 Bacteria 10097
1213 Ga0495665_0043319 3300046531 Unclassified 2394
1214 Ga0495665_0055060 3300046531 Bacteria 2101
1215 Ga0495665_0081644 3300046531 Bacteria 1700
1216 Ga0495665_0120067 3300046531 Bacteria 1377
1217 Ga0495665_0240075 3300046531 Bacteria 934
1218 Ga0495665_0301994 3300046531 Unclassified 820
1219 Ga0495640_0007376 3300046533 Bacteria 8656
1220 Ga0495586_0004250 3300046535 Bacteria 7660
1221 Ga0495586_0025331 3300046535 Unclassified 3174
1222 Ga0495586_0033544 3300046535 Bacteria 2755
1223 Ga0495586_0038456 3300046535 Unclassified 2570
1224 Ga0495586_0192584 3300046535 Bacteria 1155
1225 Ga0495586_0247178 3300046535 Bacteria 1017
1226 Ga0495587_0010437 3300046536 Bacteria 5912
1227 Ga0495587_0024075 3300046536 Bacteria 3736
1228 Ga0495587_0062628 3300046536 Bacteria 2177
1229 Ga0495587_0070383 3300046536 Bacteria 2036
1230 Ga0495587_0280994 3300046536 Bacteria 933
1231 Ga0495587_0364515 3300046536 Unclassified 804
1232 Ga0495587_0380575 3300046536 Bacteria 785
1233 Ga0495645_0002621 3300046543 Bacteria 12232
1234 Ga0495645_0006398 3300046543 Bacteria 8174
1235 Ga0495645_0143585 3300046543 Bacteria 1663
1236 Ga0495645_0238778 3300046543 Unclassified 1213
1237 Ga0495645_0265425 3300046543 Unclassified 1135
1238 Ga0495645_0281918 3300046543 Bacteria 1092
1239 Ga0495622_0076440 3300046557 Bacteria 1543
1240 Ga0495667_0019551 3300046559 Bacteria 4569
1241 Ga0495667_0102175 3300046559 Bacteria 1854
1242 Ga0495667_0340618 3300046559 Bacteria 948
1243 Ga0495634_0087026 3300046642 Bacteria 2034
1244 Ga0495625_0017254 3300046660 Bacteria 5653
1245 Ga0495625_0097932 3300046660 Bacteria 2018
1246 Ga0495635_0019092 3300046663 Bacteria 4786
1247 Ga0495635_0072239 3300046663 Bacteria 2365
1248 Ga0495635_0385825 3300046663 Unclassified 932
1249 Ga0495657_0153492 3300046675 Bacteria 1429
1250 Ga0495657_0169218 3300046675 Bacteria 1347
1251 Ga0495657_0374905 3300046675 Bacteria 840
1252 Ga0495657_0392233 3300046675 Unclassified 818
1253 Ga0495599_0071000 3300046678 Bacteria 2174
1254 Ga0495599_0206931 3300046678 Bacteria 1204
1255 Ga0495599_0277381 3300046678 Bacteria 1016
1256 Ga0495623_0002771 3300046679 Bacteria 11582
1257 Ga0495623_0033445 3300046679 Bacteria 3299
1258 Ga0495623_0037763 3300046679 Bacteria 3089
1259 Ga0495646_0056392 3300046680 Bacteria 2355
1260 Ga0495646_0074022 3300046680 Unclassified 2000
1261 Ga0495646_0266390 3300046680 Bacteria 914
1262 Ga0495658_0028290 3300046683 Unclassified 3024
1263 Ga0495658_0043246 3300046683 Bacteria 2519
1264 Ga0495658_0048485 3300046683 Bacteria 2395
1265 Ga0495658_0513598 3300046683 Unclassified 767
1266 Ga0495613_0063132 3300046689 Bacteria 2710
1267 Ga0495613_0064422 3300046689 Unclassified 2680
1268 Ga0495613_0104281 3300046689 Bacteria 2047
1269 Ga0495613_0295192 3300046689 Unclassified 1123
1270 Ga0495613_0296976 3300046689 Bacteria 1119
1271 Ga0495624_0016828 3300046690 Bacteria 4919
1272 Ga0495624_0036034 3300046690 Bacteria 3192
1273 Ga0495670_0242982 3300046691 Bacteria 959
1274 Ga0495600_0043393 3300046809 Bacteria 2933
1275 Ga0495600_0052437 3300046809 Bacteria 2664
1276 Ga0495600_0057638 3300046809 Bacteria 2537
1277 Ga0495600_0098945 3300046809 Bacteria 1901
1278 Ga0495600_0159044 3300046809 Bacteria 1461
1279 Ga0495581_0045922 3300047315 Unclassified 2524
1280 Ga0495581_0223333 3300047315 Unclassified 1101
1281 Ga0495604_0007664 3300047317 Bacteria 8548
1282 Ga0495604_0101146 3300047317 Bacteria 2118
1283 Ga0495604_0176312 3300047317 Bacteria 1498
1284 Ga0495604_0340131 3300047317 Bacteria 999
1285 Ga0495604_0596347 3300047317 Unclassified 709
1286 Ga0495674_0030006 3300047319 Unclassified 4947
1287 Ga0495674_0088420 3300047319 Bacteria 2650
1288 Ga0495674_0098283 3300047319 Bacteria 2493
1289 Ga0495674_0107724 3300047319 Unclassified 2365
1290 Ga0495674_0129386 3300047319 Unclassified 2128
1291 Ga0495674_0207527 3300047319 Bacteria 1624
1292 Ga0495674_0230055 3300047319 Bacteria 1530
1293 Ga0495674_0693323 3300047319 Bacteria 800
1294 Ga0495676_0042036 3300047321 Unclassified 3756
1295 Ga0495676_0332809 3300047321 Bacteria 1018
1296 Ga0495676_0439261 3300047321 Bacteria 862
1297 Ga0495680_0000244 3300047322 Bacteria 60043
1298 Ga0495680_0034311 3300047322 Unclassified 4099
1299 Ga0495680_0062978 3300047322 Bacteria 2849
1300 Ga0495683_0161671 3300047323 Bacteria 1035
1301 Ga0495675_0009163 3300047444 Bacteria 6155
1302 Ga0495675_0017775 3300047444 Bacteria 4509
1303 Ga0495675_0259432 3300047444 Bacteria 1041
1304 Ga0495684_0001166 3300047471 Bacteria 21130
1305 Ga0495684_0010165 3300047471 Bacteria 7280
1306 Ga0495684_0031692 3300047471 Bacteria 4060
1307 Ga0495684_0047861 3300047471 Bacteria 3269
1308 Ga0495684_0059328 3300047471 Bacteria 2914
1309 Ga0495684_0267878 3300047471 Bacteria 1237
1310 Ga0495684_0268226 3300047471 Bacteria 1236
1311 Ga0495593_0040537 3300047673 Bacteria 2507
1312 Ga0495602_0001165 3300048088 Bacteria 25733
1313 Ga0495602_0078715 3300048088 Bacteria 2783
1314 Ga0495602_0091649 3300048088 Bacteria 2520
1315 Ga0495602_0131209 3300048088 Bacteria 1998
1316 Ga0495602_0337080 3300048088 Unclassified 1092
1317 Ga0495602_0435835 3300048088 Bacteria 928
1318 Ga0495602_0786959 3300048088 Bacteria 640
1319 Ga0495614_0050465 3300048089 Bacteria 1782
1320 Ga0495614_0101854 3300048089 Bacteria 1256
1321 Ga0496100_0792357 3300048903 Bacteria 742
1322 Ga0496101_0199652 3300048904 Bacteria 1546
1323 Ga0496102_0221000 3300048905 Bacteria 1786
1324 Ga0496102_0564365 3300048905 Bacteria 1061
1325 Ga0496104_0007093 3300048907 Bacteria 9878
1326 Ga0496104_0239219 3300048907 Bacteria 1728
1327 Ga0496104_0251254 3300048907 Unclassified 1681
1328 Ga0496105_0007132 3300048908 Bacteria 8621
1329 Ga0496105_0265831 3300048908 Bacteria 1386
1330 Ga0496105_0773714 3300048908 Unclassified 732
1331 Ga0496107_0824620 3300048910 Bacteria 678
1332 Ga0496108_1177876 3300048911 Bacteria 649
1333 Ga0496112_0005998 3300048915 Bacteria 10604
1334 Ga0496112_0029023 3300048915 Bacteria 5347
1335 Ga0496112_0061991 3300048915 Bacteria 3688
1336 Ga0496112_0285842 3300048915 Bacteria 1596
1337 Ga0496112_0376130 3300048915 Bacteria 1362
1338 Ga0496112_0970945 3300048915 Unclassified 770
1339 Ga0496114_0008506 3300048917 Bacteria 8136
1340 Ga0496114_0013414 3300048917 Bacteria 6571
1341 Ga0496114_0267583 3300048917 Bacteria 1506
1342 Ga0496115_0004389 3300048918 Bacteria 10213
1343 Ga0496115_0110730 3300048918 Bacteria 2255
1344 Ga0496115_0125732 3300048918 Bacteria 2112
1345 Ga0496115_0150820 3300048918 Bacteria 1919
1346 Ga0496115_0159335 3300048918 Bacteria 1865
1347 Ga0496115_0487826 3300048918 Bacteria 991
1348 Ga0496115_0629992 3300048918 Bacteria 850
1349 Ga0496126_0000063 3300048929 Bacteria 256841
1350 Ga0495682_0037587 3300049460 Bacteria 1781
1351 nmdc:mga0n895_55727_c1 3300050512 Bacteria 3891
1352 nmdc:mga0n895_60052_c1 3300050512 Bacteria 3751
1353 nmdc:mga0n895_62602_c1 3300050512 Bacteria 3678
1354 nmdc:mga0rr50_12928_c1 3300050513 Bacteria 5414
1355 nmdc:mga0rr50_384601_c1 3300050513 Bacteria 1184
1356 nmdc:mga08x19_113_c1 3300050514 Bacteria 71736
1357 nmdc:mga08x19_33799_c1 3300050514 Bacteria 3229
1358 nmdc:mga08x19_6177_c1 3300050514 Bacteria 7084
1359 nmdc:mga0a205_104383_c1 3300050515 Bacteria 2733
1360 Ga0495601_0040152 3300053077 Bacteria 2931
1361 Ga0495601_0067755 3300053077 Bacteria 2274
1362 Ga0495601_0089897 3300053077 Bacteria 1975
1363 Ga0495601_0190439 3300053077 Bacteria 1341
1364 Ga0495612_0000322 3300053078 Bacteria 19413
1365 Ga0495619_0095903 3300053085 Bacteria 2013
1366 Ga0495619_0151232 3300053085 Bacteria 1601
1367 Ga0500568_0001844 3300053139 Bacteria 13063
1368 Ga0466962_0194109 3300061719 Unclassified 991
1369 Ga0070680_100002791
1370 rootH2_10053643
1371 rootH2_10136940
1372 rootH2_10159871
1373 Ga0070658_10019380
1374 Ga0070658_10053484
1375 Ga0070676_10034872
1376 Ga0070683_100001167
1377 Ga0070683_100002912
1378 Ga0070683_100008651
1379 Ga0070683_100083113
1380 Ga0070683_100289485
1381 Ga0070683_100524715
1382 Ga0070690_100057309
1383 Ga0070690_100502589
1384 Ga0070670_100076836
1385 Ga0070670_100175601
1386 Ga0070670_101016912
1387 Ga0070670_101791560
1388 Ga0068869_100000942
1389 Ga0068869_100079658
1390 Ga0068869_100368329
1391 Ga0070666_10002688
1392 Ga0070666_10009199
1393 Ga0070666_10030825
1394 Ga0070666_10577050
1395 Ga0070680_100089413
1396 Ga0070680_100290466
1397 Ga0070680_100881916
1398 Ga0070682_100423091
1399 Ga0070682_100776895
1400 Ga0070682_101022043
1401 Ga0068868_100013761
1402 Ga0068868_100018247
1403 Ga0068868_100043783
1404 Ga0068868_100046800
1405 Ga0068868_100069082
1406 Ga0068868_100263578
1407 Ga0068868_100299193
1408 Ga0070660_100000964
1409 Ga0070660_100006653
1410 Ga0070660_100529265
1411 Ga0070660_100596049
1412 Ga0070689_100633242
1413 Ga0070689_100906050
1414 Ga0070691_10004660
1415 Ga0070687_100171656
1416 Ga0070661_100013734
1417 Ga0070661_100077289
1418 Ga0070661_100177594
1419 Ga0070661_100518613
1420 Ga0070661_100531497
1421 Ga0070668_100229617
1422 Ga0070669_100209189
1423 Ga0070671_100003769
1424 Ga0070671_100031352
1425 Ga0070674_100210053
1426 Ga0070673_100018718
1427 Ga0070673_100193511
1428 Ga0070688_100105636
1429 Ga0070667_100004496
1430 Ga0070667_100067516
1431 Ga0070667_100138801
1432 Ga0070667_100164146
1433 Ga0070667_100406939
1434 Ga0070709_10037194
1435 Ga0070709_10060853
1436 Ga0070709_10098663
1437 Ga0070709_10149426
1438 Ga0070709_10219933
1439 Ga0070714_100001316
1440 Ga0070714_100033191
1441 Ga0070714_100033743
1442 Ga0070714_100206698
1443 Ga0070713_100005133
1444 Ga0070713_100010293
1445 Ga0070713_100024734
1446 Ga0070713_100028339
1447 Ga0070713_100167635
1448 Ga0070713_100202402
1449 Ga0070713_100255553
1450 Ga0070713_100277842
1451 Ga0070713_100295859
1452 Ga0070713_100447142
1453 Ga0070713_100471936
1454 Ga0070713_100989574
1455 Ga0070710_10144946
1456 Ga0070711_100029736
1457 Ga0070711_100233389
1458 Ga0070711_100346142
1459 Ga0070711_100386413
1460 Ga0070711_100544696
1461 Ga0070705_100003409
1462 Ga0070705_100371453
1463 Ga0070705_101247200
1464 Ga0070694_100325204
1465 Ga0070694_100681716
1466 Ga0070708_100018727
1467 Ga0070708_100033475
1468 Ga0070708_100317356
1469 Ga0070663_100227775
1470 Ga0070663_101357914
1471 Ga0070678_100017959
1472 Ga0070678_100066963
1473 Ga0070678_100148689
1474 Ga0070662_100075733
1475 Ga0070681_10002161
1476 Ga0070681_10019157
1477 Ga0070681_10021511
1478 Ga0070681_10038122
1479 Ga0070681_10079381
1480 Ga0070681_10598281
1481 Ga0070681_10905225
1482 Ga0068867_100020449
1483 Ga0068867_100146161
1484 Ga0068867_101075786
1485 Ga0070685_10509934
1486 Ga0070706_100024650
1487 Ga0070706_100043943
1488 Ga0070707_100019652
1489 Ga0070707_100245014
1490 Ga0070707_100258567
1491 Ga0070707_100624856
1492 Ga0070707_100659271
1493 Ga0070707_101559869
1494 Ga0070698_100005081
1495 Ga0070698_100158095
1496 Ga0070698_100320787
1497 Ga0070699_100011938
1498 Ga0070699_100088836
1499 Ga0070699_100111350
1500 Ga0070699_100158831
1501 Ga0070699_100542531
1502 Ga0070699_101166507
1503 Ga0070679_100000717
1504 Ga0070679_100004611
1505 Ga0070679_100024699
1506 Ga0070679_100037689
1507 Ga0070679_100059369
1508 Ga0070679_100172159
1509 Ga0070679_100214698
1510 Ga0070679_100407162
1511 Ga0070679_100515083
1512 Ga0070679_100939514
1513 Ga0070684_100005071
1514 Ga0070684_100007752
1515 Ga0070684_100028468
1516 Ga0070684_100030818
1517 Ga0070684_100034594
1518 Ga0070684_100064595
1519 Ga0070684_100167652
1520 Ga0070684_100241549
1521 Ga0070684_100331854
1522 Ga0070684_100442358
1523 Ga0070684_100456417
1524 Ga0070697_100000263
1525 Ga0070697_100002908
1526 Ga0070697_100962960
1527 Ga0068853_100000944
1528 Ga0068853_100008112
1529 Ga0068853_100021062
1530 Ga0068853_100071549
1531 Ga0068853_100131788
1532 Ga0068853_100208734
1533 Ga0068853_100493543
1534 Ga0068853_100757857
1535 Ga0070672_100009395
1536 Ga0070695_100002760
1537 Ga0070695_100354032
1538 Ga0070695_100699183
1539 Ga0070696_100002545
1540 Ga0070696_100147831
1541 Ga0070693_100000019
1542 Ga0070693_100017961
1543 Ga0070693_100504600
1544 Ga0070665_100000462
1545 Ga0070665_100013679
1546 Ga0070665_100029122
1547 Ga0070665_100133650
1548 Ga0070665_101525718
1549 Ga0070665_101590747
1550 Ga0070704_100016339
1551 Ga0068855_100000623
1552 Ga0068855_100000881
1553 Ga0068855_100003034
1554 Ga0068855_100003302
1555 Ga0068855_100012148
1556 Ga0068855_100014232
1557 Ga0068855_100016829
1558 Ga0068855_100018146
1559 Ga0068855_100039853
1560 Ga0068855_100051393
1561 Ga0068855_100309955
1562 Ga0068855_100313375
1563 Ga0068855_100548416
1564 Ga0070664_100100786
1565 Ga0070664_100145461
1566 Ga0070664_100168669
1567 Ga0070664_100335160
1568 Ga0070664_100364621
1569 Ga0070664_100813239
1570 Ga0070664_101182300
1571 Ga0068857_100017037
1572 Ga0068857_100021936
1573 Ga0068857_100022792
1574 Ga0068857_100025040
1575 Ga0068857_100044277
1576 Ga0068857_100053450
1577 Ga0068857_100111085
1578 Ga0068857_100111674
1579 Ga0068857_100209563
1580 Ga0068857_101302338
1581 Ga0068854_100038491
1582 Ga0068854_100064472
1583 Ga0068854_100069176
1584 Ga0068854_100690831
1585 Ga0068854_101454843
1586 Ga0068856_100001516
1587 Ga0068856_100005713
1588 Ga0068856_100014367
1589 Ga0068856_100025657
1590 Ga0068856_100027890
1591 Ga0068856_100068514
1592 Ga0068856_100105509
1593 Ga0068856_100137875
1594 Ga0068856_100230190
1595 Ga0068856_100236337
1596 Ga0068856_100272778
1597 Ga0068856_100334001
1598 Ga0068856_100424855
1599 Ga0068856_100569240
1600 Ga0068856_100589450
1601 Ga0068856_101353748
1602 Ga0070702_100494083
1603 Ga0068852_100000049
1604 Ga0068852_100000095
1605 Ga0068852_100001588
1606 Ga0068852_100072304
1607 Ga0068852_100085203
1608 Ga0068852_100132326
1609 Ga0068852_100135084
1610 Ga0068852_100282096
1611 Ga0068852_100356742
1612 Ga0068852_100419687
1613 Ga0068852_100561054
1614 Ga0068852_100663889
1615 Ga0068859_100010731
1616 Ga0068859_100076870
1617 Ga0068859_100087987
1618 Ga0068859_100154705
1619 Ga0068859_100563875
1620 Ga0068859_101330067
1621 Ga0068864_100067962
1622 Ga0068864_100174155
1623 Ga0068864_100321593
1624 Ga0068864_100545486
1625 Ga0068864_100569611
1626 Ga0068851_10003156
1627 Ga0068851_10007873
1628 Ga0068851_10019714
1629 Ga0068851_10185900
1630 Ga0068851_10403132
1631 Ga0068863_100001861
1632 Ga0068863_100002734
1633 Ga0068863_100013281
1634 Ga0068863_100038542
1635 Ga0068863_100074220
1636 Ga0068863_100109556
1637 Ga0068863_100321056
1638 Ga0068863_100342390
1639 Ga0068858_100000841
1640 Ga0068858_100020811
1641 Ga0068858_100043484
1642 Ga0068858_100405203
1643 Ga0068858_100659821
1644 Ga0068860_100001780
1645 Ga0068860_100030529
1646 Ga0068860_100045391
1647 Ga0068860_100227633
1648 Ga0068860_100429416
1649 Ga0068860_100915634
1650 Ga0068862_100021633
1651 Ga0081540_1117804
1652 Ga0070717_10002283
1653 Ga0070717_10005514
1654 Ga0070717_10011465
1655 Ga0070717_10073027
1656 Ga0070717_10176352
1657 Ga0070717_10613410
1658 Ga0070715_10008583
1659 Ga0070715_10062105
1660 Ga0070715_10178689
1661 Ga0070715_10337399
1662 Ga0070715_10635841
1663 Ga0070716_100001038
1664 Ga0070716_100013740
1665 Ga0070716_100078419
1666 Ga0070716_100530411
1667 Ga0070712_100034335
1668 Ga0070712_100042614
1669 Ga0070712_100097671
1670 Ga0070712_100265432
1671 Ga0097621_100035301
1672 Ga0097621_100057496
1673 Ga0097621_100058819
1674 Ga0097621_100073085
1675 Ga0097621_100092443
1676 Ga0097621_100103991
1677 Ga0097621_100160140
1678 Ga0097621_100205394
1679 Ga0097621_100318938
1680 Ga0097621_100361780
1681 Ga0097621_100379108
1682 Ga0097621_100404149
1683 Ga0097621_100454023
1684 Ga0097621_100638933
1685 Ga0097621_101068484
1686 Ga0068871_100005207
1687 Ga0068871_100028148
1688 Ga0068871_100029558
1689 Ga0068871_100042290
1690 Ga0068871_100066082
1691 Ga0068871_100074706
1692 Ga0068871_100235591
1693 Ga0068871_100241901
1694 Ga0068871_100351006
1695 Ga0068871_100362797
1696 Ga0068871_100925860
1697 Ga0075433_10087365
1698 Ga0075434_100049162
1699 Ga0075434_100073522
1700 Ga0068865_100064219
1701 Ga0075436_100000559
1702 Ga0075436_100012467
1703 Ga0075436_100019468
1704 Ga0075436_100110523
1705 Ga0097620_100010731
1706 Ga0097620_100076873
1707 Ga0097620_100087983
1708 Ga0097620_100154702
1709 Ga0097620_100563863
1710 Ga0097620_101330252
1711 Ga0075435_100139853
1712 Ga0075435_100544134
1713 Ga0099794_10008896
1714 Ga0099794_10018002
1715 Ga0099794_10047024
1716 Ga0099794_10052137
1717 Ga0099794_10101377
1718 Ga0099794_10188614
1719 Ga0099794_10199598
1720 Ga0099794_10255239
1721 Ga0099794_10310098
1722 Ga0099794_10351365
1723 Ga0099794_10452395
1724 Ga0099795_10006652
1725 Ga0099795_10201743
1726 Ga0105240_10000002
1727 Ga0105240_10000839
1728 Ga0105240_10000904
1729 Ga0105240_10001150
1730 Ga0105240_10001167
1731 Ga0105240_10001456
1732 Ga0105240_10003229
1733 Ga0105240_10004689
1734 Ga0105240_10005098
1735 Ga0105240_10006651
1736 Ga0105240_10007154
1737 Ga0105240_10029233
1738 Ga0105240_10099435
1739 Ga0105240_10114317
1740 Ga0105240_10154906
1741 Ga0105240_10174958
1742 Ga0105240_10203660
1743 Ga0105240_10238967
1744 Ga0105240_10240351
1745 Ga0105240_10256960
1746 Ga0105240_10580644
1747 Ga0105240_10588221
1748 Ga0105240_10652870
1749 Ga0105240_11253303
1750 Ga0105240_11711543
1751 Ga0105245_10002156
1752 Ga0105245_10009911
1753 Ga0105245_10012128
1754 Ga0105245_10019044
1755 Ga0105245_10028926
1756 Ga0105245_10036183
1757 Ga0105245_10072027
1758 Ga0105245_10127612
1759 Ga0105245_10205987
1760 Ga0105245_10378823
1761 Ga0105245_10907997
1762 Ga0105245_11001472
1763 Ga0105247_10009974
1764 Ga0105247_10030120
1765 Ga0105247_10104596
1766 Ga0105247_10363699
1767 Ga0105247_10597619
1768 Ga0105247_10695124
1769 Ga0114129_11987220
1770 Ga0105243_10056567
1771 Ga0105243_10134055
1772 Ga0105243_10222771
1773 Ga0105243_10224694
1774 Ga0105243_10588120
1775 Ga0105241_10000014
1776 Ga0105241_10004691
1777 Ga0105241_10005338
1778 Ga0105241_10007806
1779 Ga0105241_10009235
1780 Ga0105241_10019492
1781 Ga0105241_10057417
1782 Ga0105241_10058284
1783 Ga0105241_10082039
1784 Ga0105241_10107535
1785 Ga0105241_10119461
1786 Ga0105241_10225789
1787 Ga0105241_10335764
1788 Ga0105241_10469447
1789 Ga0105241_10643576
1790 Ga0105241_10740925
1791 Ga0105241_10893930
1792 Ga0105242_10011241
1793 Ga0105242_10035741
1794 Ga0105242_10107437
1795 Ga0105242_10112272
1796 Ga0105242_10112723
1797 Ga0105242_10113453
1798 Ga0105242_10256249
1799 Ga0105242_10317198
1800 Ga0105242_10424834
1801 Ga0105242_10552998
1802 Ga0105242_10613814
1803 Ga0105242_10940387
1804 Ga0105242_11368688
1805 Ga0105248_10004322
1806 Ga0105248_10023504
1807 Ga0105248_10036438
1808 Ga0105248_10059800
1809 Ga0105248_10080095
1810 Ga0105248_10117786
1811 Ga0105248_10160799
1812 Ga0105248_10445357
1813 Ga0105248_10589521
1814 Ga0105248_10633792
1815 Ga0105248_10764333
1816 Ga0105248_11075935
1817 Ga0105237_10003893
1818 Ga0105237_10007736
1819 Ga0105237_10010226
1820 Ga0105237_10023341
1821 Ga0105237_10029243
1822 Ga0105237_10092676
1823 Ga0105237_10122584
1824 Ga0105237_10265275
1825 Ga0105237_10628732
1826 Ga0105237_10742186
1827 Ga0105237_11692647
1828 Ga0105238_10000658
1829 Ga0105238_10001077
1830 Ga0105238_10003880
1831 Ga0105238_10009399
1832 Ga0105238_10009529
1833 Ga0105238_10024560
1834 Ga0105238_10025711
1835 Ga0105238_10032757
1836 Ga0105238_10038804
1837 Ga0105238_10071939
1838 Ga0105238_10258961
1839 Ga0105238_11202481
1840 Ga0105238_11647251
1841 Ga0105249_10009429
1842 Ga0105249_10051778
1843 Ga0105249_10076853
1844 Ga0105249_10704935
1845 Ga0099796_10004116
1846 Ga0105239_10002219
1847 Ga0105239_10006418
1848 Ga0105239_10007915
1849 Ga0105239_10010547
1850 Ga0105239_10013129
1851 Ga0105239_10017993
1852 Ga0105239_10076896
1853 Ga0105239_10123673
1854 Ga0105239_10154445
1855 Ga0105239_10205403
1856 Ga0105239_10210253
1857 Ga0105246_10001710
1858 Ga0105246_10004304
1859 Ga0105246_10146269
1860 Ga0105246_10662824
1861 Ga0157373_10064781
1862 Ga0157373_10846679
1863 Ga0157373_10896115
1864 Ga0157371_10314099
1865 Ga0157371_10373274
1866 Ga0157371_10451024
1867 Ga0157370_10000005
1868 Ga0157370_10002893
1869 Ga0157370_10003670
1870 Ga0157370_10004975
1871 Ga0157370_10035401
1872 Ga0157370_10074183
1873 Ga0157370_10121051
1874 Ga0157370_10551093
1875 Ga0157370_10768674
1876 Ga0157370_11128978
1877 Ga0157369_10000266
1878 Ga0157369_10003469
1879 Ga0157369_10003568
1880 Ga0157369_10018391
1881 Ga0157369_10027298
1882 Ga0157369_10028160
1883 Ga0157369_10030376
1884 Ga0157369_10034284
1885 Ga0157369_10039645
1886 Ga0157369_10079146
1887 Ga0157369_10101391
1888 Ga0157369_10139154
1889 Ga0157369_10201143
1890 Ga0157369_10220341
1891 Ga0157369_10242034
1892 Ga0157369_10285702
1893 Ga0157369_10288127
1894 Ga0157369_10498646
1895 Ga0157374_10002719
1896 Ga0157374_10002942
1897 Ga0157374_10003429
1898 Ga0157374_10072850
1899 Ga0157374_10109021
1900 Ga0157374_10131929
1901 Ga0157374_10139231
1902 Ga0157374_10208387
1903 Ga0157374_10311589
1904 Ga0157374_10497724
1905 Ga0157374_10676973
1906 Ga0157374_10857486
1907 Ga0157374_10942614
1908 Ga0157374_11474199
1909 Ga0157374_11860916
1910 Ga0157378_10000316
1911 Ga0157378_10009939
1912 Ga0157378_10017618
1913 Ga0157378_10045935
1914 Ga0157378_10124410
1915 Ga0157378_10210903
1916 Ga0157378_10510080
1917 Ga0157378_10561282
1918 Ga0157378_10590058
1919 Ga0157378_10596771
1920 Ga0157378_10792232
1921 Ga0157378_10803673
1922 Ga0157378_10809115
1923 Ga0157378_10854551
1924 Ga0163162_10004608
1925 Ga0163162_10017631
1926 Ga0163162_10020819
1927 Ga0163162_10042380
1928 Ga0163162_10427055
1929 Ga0163162_10437004
1930 Ga0163162_10480415
1931 Ga0163162_10689098
1932 Ga0163162_11706160
1933 Ga0163162_12110012
1934 Ga0157372_10000755
1935 Ga0157372_10002651
1936 Ga0157372_10005248
1937 Ga0157372_10009747
1938 Ga0157372_10013164
1939 Ga0157372_10016918
1940 Ga0157372_10025746
1941 Ga0157372_10041998
1942 Ga0157372_10055961
1943 Ga0157372_10056203
1944 Ga0157372_10118521
1945 Ga0157372_10136260
1946 Ga0157372_10474625
1947 Ga0157372_10606817
1948 Ga0157372_10669648
1949 Ga0157372_10832683
1950 Ga0157372_11059881
1951 Ga0157372_11097825
1952 Ga0157372_11355445
1953 Ga0157372_11685072
1954 Ga0157372_12225339
1955 Ga0157375_10009399
1956 Ga0157375_10019853
1957 Ga0157375_10072366
1958 Ga0157375_10198083
1959 Ga0157375_10346612
1960 Ga0157375_10355611
1961 Ga0157375_10388376
1962 Ga0157375_11132328
1963 Ga0163163_10001566
1964 Ga0163163_10003008
1965 Ga0163163_10049024
1966 Ga0163163_10083023
1967 Ga0163163_10178213
1968 Ga0163163_10216082
1969 Ga0163163_10248958
1970 Ga0163163_10297226
1971 Ga0163163_10304263
1972 Ga0163163_10396601
1973 Ga0163163_10436062
1974 Ga0163163_10497457
1975 Ga0163163_10716468
1976 Ga0157377_10084310
1977 Ga0157379_10039454
1978 Ga0157379_10083192
1979 Ga0157379_10084780
1980 Ga0157379_10091751
1981 Ga0157379_10117979
1982 Ga0157379_10223685
1983 Ga0157379_10306748
1984 Ga0157379_10409085
1985 Ga0157379_10631359
1986 Ga0157379_10769929
1987 Ga0157376_10000040
1988 Ga0157376_10010806
1989 Ga0157376_10059744
1990 Ga0157376_10075430
1991 Ga0157376_10232919
1992 Ga0157376_10243819
1993 Ga0157376_10680440
1994 Ga0157376_10685054
1995 Ga0157376_10749769
1996 Ga0157376_10754546
1997 Ga0157376_11163105
1998 Ga0157376_11552305
1999 Ga0163161_10044673
2000 Ga0206351_10035105
2001 Ga0213874_10190105
2002 Ga0213876_10017317
2003 Ga0213876_10458249
2004 Ga0213876_10486054
2005 Ga0224572_1025417
2006 Ga0228598_1012620
2007 Ga0228598_1063680
2008 Ga0209437_115078
2009 Ga0209233_1005124
2010 Ga0207697_10096556
2011 Ga0207697_10188643
2012 Ga0207656_10002473
2013 Ga0207656_10012793
2014 Ga0207656_10122151
2015 Ga0207656_10129802
2016 Ga0207656_10132156
2017 Ga0207653_10003592
2018 Ga0207692_10084276
2019 Ga0207692_10324155
2020 Ga0207710_10001958
2021 Ga0207710_10066889
2022 Ga0207710_10094597
2023 Ga0207680_10001465
2024 Ga0207680_10030433
2025 Ga0207680_10119514
2026 Ga0207685_10177109
2027 Ga0207685_10189675
2028 Ga0207699_10011702
2029 Ga0207699_10012146
2030 Ga0207699_10056306
2031 Ga0207699_10130620
2032 Ga0207645_10068410
2033 Ga0207705_10005460
2034 Ga0207705_10099448
2035 Ga0207705_10730318
2036 Ga0207684_10008000
2037 Ga0207684_10358390
2038 Ga0207684_10434044
2039 Ga0207654_10000018
2040 Ga0207654_10000559
2041 Ga0207654_10002749
2042 Ga0207654_10003369
2043 Ga0207654_10015104
2044 Ga0207654_10029747
2045 Ga0207654_10078749
2046 Ga0207654_10112676
2047 Ga0207654_10255465
2048 Ga0207654_10288296
2049 Ga0207707_10002540
2050 Ga0207707_10013981
2051 Ga0207707_10024120
2052 Ga0207707_10026986
2053 Ga0207707_10087217
2054 Ga0207707_10290186
2055 Ga0207707_10489208
2056 Ga0207695_10000167
2057 Ga0207695_10000297
2058 Ga0207695_10000384
2059 Ga0207695_10000539
2060 Ga0207695_10000770
2061 Ga0207695_10000825
2062 Ga0207695_10000942
2063 Ga0207695_10003871
2064 Ga0207695_10006112
2065 Ga0207695_10015143
2066 Ga0207695_10039408
2067 Ga0207695_10078908
2068 Ga0207695_10120599
2069 Ga0207695_10260635
2070 Ga0207695_10314767
2071 Ga0207695_10323390
2072 Ga0207695_10323537
2073 Ga0207695_10376491
2074 Ga0207695_10395491
2075 Ga0207695_10420130
2076 Ga0207695_10545255
2077 Ga0207695_10642066
2078 Ga0207695_10952207
2079 Ga0207671_10000207
2080 Ga0207671_10000211
2081 Ga0207671_10005189
2082 Ga0207671_10015635
2083 Ga0207671_10041861
2084 Ga0207671_10135677
2085 Ga0207671_10196651
2086 Ga0207671_10299234
2087 Ga0207671_10335874
2088 Ga0207671_10723480
2089 Ga0207671_10851874
2090 Ga0207671_10890423
2091 Ga0207693_10098395
2092 Ga0207693_10111920
2093 Ga0207693_10176508
2094 Ga0207693_10183606
2095 Ga0207693_10320981
2096 Ga0207663_10102556
2097 Ga0207663_10449234
2098 Ga0207663_10530111
2099 Ga0207663_10576954
2100 Ga0207663_11084614
2101 Ga0207660_10003140
2102 Ga0207660_10024648
2103 Ga0207660_10231891
2104 Ga0207660_10311890
2105 Ga0207660_10551360
2106 Ga0207657_10002306
2107 Ga0207657_10082827
2108 Ga0207657_10116390
2109 Ga0207649_10007995
2110 Ga0207649_10100879
2111 Ga0207649_10108322
2112 Ga0207649_10303202
2113 Ga0207649_10313814
2114 Ga0207649_10476582
2115 Ga0207649_10562911
2116 Ga0207652_10004686
2117 Ga0207652_10006572
2118 Ga0207652_10009897
2119 Ga0207652_10138131
2120 Ga0207652_10147122
2121 Ga0207652_10285803
2122 Ga0207652_10784655
2123 Ga0207646_10045435
2124 Ga0207646_10123715
2125 Ga0207646_10155479
2126 Ga0207646_10160426
2127 Ga0207646_10185887
2128 Ga0207646_10358215
2129 Ga0207646_10539089
2130 Ga0207646_11156013
2131 Ga0207681_10191336
2132 Ga0207681_10359015
2133 Ga0207694_10000118
2134 Ga0207694_10000484
2135 Ga0207694_10000823
2136 Ga0207694_10001030
2137 Ga0207694_10005449
2138 Ga0207694_10024333
2139 Ga0207694_10029031
2140 Ga0207694_10031174
2141 Ga0207694_10035630
2142 Ga0207694_10046448
2143 Ga0207694_10095502
2144 Ga0207694_10125980
2145 Ga0207694_10328220
2146 Ga0207650_10155100
2147 Ga0207650_11540121
2148 Ga0207659_10109918
2149 Ga0207687_10003603
2150 Ga0207687_10022716
2151 Ga0207687_10062250
2152 Ga0207687_10081065
2153 Ga0207687_10138547
2154 Ga0207687_10161699
2155 Ga0207687_10314447
2156 Ga0207687_10386954
2157 Ga0207687_10639357
2158 Ga0207687_11607907
2159 Ga0207700_10002914
2160 Ga0207700_10028252
2161 Ga0207700_10044198
2162 Ga0207700_10084438
2163 Ga0207700_10299647
2164 Ga0207664_10012235
2165 Ga0207664_10037869
2166 Ga0207664_10110490
2167 Ga0207664_10461067
2168 Ga0207664_10513134
2169 Ga0207664_10917148
2170 Ga0207644_10005916
2171 Ga0207644_10034067
2172 Ga0207644_10040055
2173 Ga0207644_10098279
2174 Ga0207644_10215420
2175 Ga0207690_10011567
2176 Ga0207706_10003066
2177 Ga0207686_10017121
2178 Ga0207686_10024345
2179 Ga0207686_10032314
2180 Ga0207686_10052481
2181 Ga0207686_10055003
2182 Ga0207686_10062170
2183 Ga0207686_10080178
2184 Ga0207686_10090364
2185 Ga0207686_10505978
2186 Ga0207686_10995416
2187 Ga0207709_10084879
2188 Ga0207709_10128424
2189 Ga0207709_10208062
2190 Ga0207709_10519165
2191 Ga0207670_10371559
2192 Ga0207669_10240422
2193 Ga0207704_10132754
2194 Ga0207704_10173336
2195 Ga0207665_10000011
2196 Ga0207665_10001886
2197 Ga0207665_10039627
2198 Ga0207665_10052707
2199 Ga0207665_10053545
2200 Ga0207665_10282994
2201 Ga0207665_10436406
2202 Ga0207691_10014464
2203 Ga0207691_10653931
2204 Ga0207711_10000701
2205 Ga0207711_10002368
2206 Ga0207711_10004561
2207 Ga0207711_10035393
2208 Ga0207711_10082332
2209 Ga0207711_10092261
2210 Ga0207711_10095353
2211 Ga0207711_10104413
2212 Ga0207711_10137510
2213 Ga0207711_10186154
2214 Ga0207711_10427783
2215 Ga0207689_10000639
2216 Ga0207689_10031696
2217 Ga0207689_10115440
2218 Ga0207689_10286448
2219 Ga0207689_10302332
2220 Ga0207689_10308211
2221 Ga0207661_10002207
2222 Ga0207661_10008706
2223 Ga0207661_10015272
2224 Ga0207661_10017408
2225 Ga0207661_10020722
2226 Ga0207661_10078725
2227 Ga0207661_10081609
2228 Ga0207661_10140583
2229 Ga0207661_10210067
2230 Ga0207661_10397972
2231 Ga0207679_10269403
2232 Ga0207679_10290095
2233 Ga0207679_11231617
2234 Ga0207679_11262962
2235 Ga0207679_11521645
2236 Ga0207667_10000704
2237 Ga0207667_10001298
2238 Ga0207667_10001669
2239 Ga0207667_10003842
2240 Ga0207667_10005331
2241 Ga0207667_10021374
2242 Ga0207667_10022036
2243 Ga0207667_10024356
2244 Ga0207667_10043726
2245 Ga0207667_10045348
2246 Ga0207667_10053693
2247 Ga0207667_10057480
2248 Ga0207667_10175601
2249 Ga0207667_10631988
2250 Ga0207667_10832265
2251 Ga0207667_10871885
2252 Ga0207651_10012262
2253 Ga0207651_10160017
2254 Ga0207712_10020844
2255 Ga0207712_10530544
2256 Ga0207640_10015561
2257 Ga0207640_10028252
2258 Ga0207640_10771451
2259 Ga0207640_10843378
2260 Ga0207640_11305646
2261 Ga0207640_11568133
2262 Ga0207658_10008830
2263 Ga0207658_10341552
2264 Ga0207677_10003199
2265 Ga0207677_10015604
2266 Ga0207677_10019576
2267 Ga0207677_10040980
2268 Ga0207703_10014435
2269 Ga0207703_10018747
2270 Ga0207703_10033447
2271 Ga0207703_10093727
2272 Ga0207703_10348419
2273 Ga0207703_10484078
2274 Ga0207703_11114920
2275 Ga0207639_10000063
2276 Ga0207639_10001850
2277 Ga0207639_10027801
2278 Ga0207639_10070705
2279 Ga0207639_10127893
2280 Ga0207639_10128467
2281 Ga0207639_10132262
2282 Ga0207639_10133353
2283 Ga0207639_10220462
2284 Ga0207639_11272420
2285 Ga0207639_11381542
2286 Ga0207678_10547836
2287 Ga0207678_11001226
2288 Ga0207708_10725289
2289 Ga0207702_10001530
2290 Ga0207702_10003431
2291 Ga0207702_10004553
2292 Ga0207702_10026789
2293 Ga0207702_10033402
2294 Ga0207702_10059910
2295 Ga0207702_10118771
2296 Ga0207702_10175867
2297 Ga0207702_10186544
2298 Ga0207702_10189269
2299 Ga0207702_10238822
2300 Ga0207702_10300631
2301 Ga0207702_10518200
2302 Ga0207702_10806703
2303 Ga0207702_11105141
2304 Ga0207641_10003572
2305 Ga0207641_10013528
2306 Ga0207641_10017715
2307 Ga0207641_10027289
2308 Ga0207641_10028508
2309 Ga0207641_10058025
2310 Ga0207641_10358549
2311 Ga0207648_10020471
2312 Ga0207648_10154584
2313 Ga0207648_10214990
2314 Ga0207676_10010814
2315 Ga0207676_10066221
2316 Ga0207676_10094899
2317 Ga0207676_10333225
2318 Ga0207676_10416416
2319 Ga0207674_10004642
2320 Ga0207674_10006628
2321 Ga0207674_10007498
2322 Ga0207674_10010952
2323 Ga0207674_10018657
2324 Ga0207674_10112333
2325 Ga0207674_10139870
2326 Ga0207674_10366269
2327 Ga0207674_11605502
2328 Ga0207675_100916811
2329 Ga0207683_10001872
2330 Ga0207683_10494253
2331 Ga0207698_10000003
2332 Ga0207698_10000093
2333 Ga0207698_10002110
2334 Ga0207698_10006244
2335 Ga0207698_10028874
2336 Ga0207698_10081346
2337 Ga0207698_10112650
2338 Ga0207698_10166165
2339 Ga0207698_10248121
2340 Ga0207698_10479779
2341 Ga0207698_10735715
2342 Ga0207698_10925705
2343 Ga0209179_1020399
2344 Ga0209588_1001606
2345 Ga0209588_1007654
2346 Ga0209588_1010308
2347 Ga0209588_1153886
2348 Ga0265354_1000512
2349 Ga0265356_1004788
2350 Ga0265357_1000491
2351 Ga0268266_10001991
2352 Ga0268266_10008821
2353 Ga0268266_10028158
2354 Ga0268266_10064079
2355 Ga0268266_10071655
2356 Ga0268266_10114572
2357 Ga0268266_10176606
2358 Ga0268265_10014315
2359 Ga0268264_10014414
2360 Ga0268264_10018806
2361 Ga0268264_10059391
2362 Ga0268264_10144101
2363 Ga0268264_10179435
2364 Ga0268264_10291504
2365 Ga0268264_10678520
2366 Ga0265319_1002192
2367 Ga0265318_10000076
2368 Ga0265336_10091630
2369 Ga0265338_10032424
2370 Ga0265338_10069513
2371 Ga0265338_10327361
2372 Ga0265338_10501979
2373 Ga0265338_10591459
2374 Ga0265338_10772056
2375 Ga0265770_1004703
2376 Ga0265765_1000870
2377 Ga0265760_10000022
2378 Ga0265760_10001426
2379 Ga0265760_10009836
2380 Ga0265760_10010281
2381 Ga0265760_10065013
2382 Ga0265330_10155665
2383 Ga0265330_10322605
2384 Ga0265332_10057676
2385 Ga0265328_10001785
2386 Ga0265328_10075243
2387 Ga0265320_10000031
2388 Ga0265320_10146702
2389 Ga0265325_10004183
2390 Ga0265325_10004533
2391 Ga0265325_10011266
2392 Ga0265325_10140662
2393 Ga0265329_10000860
2394 Ga0265340_10002347
2395 Ga0265340_10239107
2396 Ga0265339_10000031
2397 Ga0265339_10003292
2398 Ga0265339_10023552
2399 Ga0265331_10000039
2400 Ga0265331_10010269
2401 Ga0265316_10000662
2402 Ga0265316_10002301
2403 Ga0265316_10003285
2404 Ga0265316_10011125
2405 Ga0265316_10015019
2406 Ga0265316_10022182
2407 Ga0265316_10057908
2408 Ga0265316_10159995
2409 Ga0307509_10175889
2410 Ga0265313_10005224
2411 Ga0265313_10016048
2412 Ga0265314_10000067
2413 Ga0265314_10001577
2414 Ga0265314_10012255
2415 Ga0265314_10019058
2416 Ga0265314_10029215
2417 Ga0265314_10197417
2418 Ga0265342_10000920
2419 Ga0265342_10003163
2420 Ga0265342_10046882
2421 Ga0307409_100243827
2422 Ga0316212_1002189
2423 Ga0373926_0005499
2424 Ga0373934_0014871
2425 Ga0373934_0081629
2426 Ga0373923_0055647
2427 Ga0373923_0125536
2428 Ga0373936_0289558
2429 Ga0373953_0014045
2430 Ga0373953_0260444
2431 Ga0373954_0000984
2432 Ga0373954_0056017
2433 Ga0373956_0012605
2434 Ga0373956_0081120
2435 Ga0373956_0280286
2436 Ga0373957_0109451
2437 Ga0373943_0040866
2438 Ga0373946_0002371
2439 Ga0373946_0092099
2440 Ga0373946_0237453
2441 Ga0373955_0055891
2442 Ga0373955_0354363
2443 Ga0373931_0032724
2444 Ga0373935_0026595
2445 Ga0373927_0000212
2446 Ga0373927_0000614
2447 Ga0373927_0007240
2448 Ga0373927_0046800
2449 Ga0373927_0120406
2450 Ga0373927_0126976
2451 Ga0373933_0000367
2452 Ga0373933_0015424
2453 Ga0373933_0101328
2454 Ga0373933_0356160
2455 Ga0373933_0957281
2456 Ga0373947_0026681
2457 Ga0373947_0071247
2458 Ga0373937_0002124
2459 Ga0373937_0004512
2460 Ga0373937_0006149
2461 Ga0373937_0006208
2462 Ga0373937_0048327
2463 Ga0373937_0059532
2464 Ga0373937_0439175
2465 Ga0373937_0441669
2466 Ga0373937_0786259
2467 Ga0373937_1174169
2468 Ga0373925_0000487
2469 Ga0373925_0009147
2470 Ga0373925_0063308
2471 Ga0373925_0173252
2472 Ga0373925_0303700
2473 Ga0373925_0487661
2474 Ga0395899_0300915
2475 Ga0395899_0319120
2476 Ga0395900_0028406
2477 Ga0395900_0058272
2478 Ga0395900_0357847
2479 Ga0395898_0101022
2480 Ga0395898_0178528
2481 Ga0395898_0474578
2482 Ga0395905_0667277
2483 Ga0436364_0708475
2484 Ga0395901_0545268
2485 Ga0436365_0320037
2486 Ga0436365_0352286
2487 Ga0436365_1092844
2488 Ga0436365_1396730
2489 Ga0436360_0025204
2490 Ga0436363_0413293
2491 Ga0436363_1122484
2492 Ga0436362_0678365
2493 Ga0436362_0796667
2494 Ga0451791_0662513
2495 Ga0451797_0373435
2496 Ga0451837_1137245
2497 Ga0451577_0000054
2498 Ga0451577_0563173
2499 Ga0453683_0012500
2500 Ga0453683_0660509
2501 Ga0466966_0191978
2502 Ga0466963_0003591
2503 Ga0466963_0236383
2504 Ga0453684_0000366
2505 Ga0453684_0860484
2506 Ga0466971_0382292
2507 Ga0466957_0160777
2508 Ga0466959_0003780
2509 Ga0451576_0002744
2510 Ga0451576_0081985
2511 Ga0451576_1298025
2512 Ga0466967_0010770
2513 Ga0495592_0020926
2514 Ga0495592_0145802
2515 Ga0495592_0516637
2516 Ga0495603_0033957
2517 Ga0495603_0255773
2518 Ga0495629_0009423
2519 Ga0495629_0021039
2520 Ga0495629_0194719
2521 Ga0495629_0553159
2522 Ga0495651_0005310
2523 Ga0495651_0023595
2524 Ga0495651_0029074
2525 Ga0495651_0055560
2526 Ga0495651_0067662
2527 Ga0495651_0194208
2528 Ga0495651_0477887
2529 Ga0495651_0572032
2530 Ga0495653_0004837
2531 Ga0495653_0096955
2532 Ga0495653_0127636
2533 Ga0495580_0001970
2534 Ga0495580_0008565
2535 Ga0495580_0034985
2536 Ga0495580_0075316
2537 Ga0495580_0095136
2538 Ga0495580_0203451
2539 Ga0495580_0290830
2540 Ga0495580_0349593
2541 Ga0495582_0000255
2542 Ga0495582_0023087
2543 Ga0495582_0052653
2544 Ga0495582_0069851
2545 Ga0495582_0302795
2546 Ga0495639_0031000
2547 Ga0495662_0042048
2548 Ga0495662_0316233
2549 Ga0495664_0094229
2550 Ga0495664_0145950
2551 Ga0495664_0168741
2552 Ga0495664_0198865
2553 Ga0495664_0245294
2554 Ga0495664_0398055
2555 Ga0495594_0049642
2556 Ga0495594_0158855
2557 Ga0495583_0011240
2558 Ga0495606_0242505
2559 Ga0495608_0016320
2560 Ga0495608_0060218
2561 Ga0495628_0018232
2562 Ga0495628_0040792
2563 Ga0495628_0068289
2564 Ga0495628_0098366
2565 Ga0495628_0192910
2566 Ga0495628_0670598
2567 Ga0495630_0012890
2568 Ga0495630_0668974
2569 Ga0495630_1137874
2570 Ga0495632_0106888
2571 Ga0495666_0017540
2572 Ga0495666_0068896
2573 Ga0495652_0006027
2574 Ga0495652_0014296
2575 Ga0495652_0109741
2576 Ga0495652_0119825
2577 Ga0495652_0125081
2578 Ga0495652_0271395
2579 Ga0495652_0532657
2580 Ga0495665_0002414
2581 Ga0495665_0043319
2582 Ga0495665_0055060
2583 Ga0495665_0081644
2584 Ga0495665_0120067
2585 Ga0495665_0240075
2586 Ga0495665_0301994
2587 Ga0495640_0007376
2588 Ga0495586_0004250
2589 Ga0495586_0025331
2590 Ga0495586_0033544
2591 Ga0495586_0038456
2592 Ga0495586_0192584
2593 Ga0495586_0247178
2594 Ga0495587_0010437
2595 Ga0495587_0024075
2596 Ga0495587_0062628
2597 Ga0495587_0070383
2598 Ga0495587_0280994
2599 Ga0495587_0364515
2600 Ga0495587_0380575
2601 Ga0495645_0002621
2602 Ga0495645_0006398
2603 Ga0495645_0143585
2604 Ga0495645_0238778
2605 Ga0495645_0265425
2606 Ga0495645_0281918
2607 Ga0495622_0076440
2608 Ga0495667_0019551
2609 Ga0495667_0102175
2610 Ga0495667_0340618
2611 Ga0495634_0087026
2612 Ga0495625_0017254
2613 Ga0495625_0097932
2614 Ga0495635_0019092
2615 Ga0495635_0072239
2616 Ga0495635_0385825
2617 Ga0495657_0153492
2618 Ga0495657_0169218
2619 Ga0495657_0374905
2620 Ga0495657_0392233
2621 Ga0495599_0071000
2622 Ga0495599_0206931
2623 Ga0495599_0277381
2624 Ga0495623_0002771
2625 Ga0495623_0033445
2626 Ga0495623_0037763
2627 Ga0495646_0056392
2628 Ga0495646_0074022
2629 Ga0495646_0266390
2630 Ga0495658_0028290
2631 Ga0495658_0043246
2632 Ga0495658_0048485
2633 Ga0495658_0513598
2634 Ga0495613_0063132
2635 Ga0495613_0064422
2636 Ga0495613_0104281
2637 Ga0495613_0295192
2638 Ga0495613_0296976
2639 Ga0495624_0016828
2640 Ga0495624_0036034
2641 Ga0495670_0242982
2642 Ga0495600_0043393
2643 Ga0495600_0052437
2644 Ga0495600_0057638
2645 Ga0495600_0098945
2646 Ga0495600_0159044
2647 Ga0495581_0045922
2648 Ga0495581_0223333
2649 Ga0495604_0007664
2650 Ga0495604_0101146
2651 Ga0495604_0176312
2652 Ga0495604_0340131
2653 Ga0495604_0596347
2654 Ga0495674_0030006
2655 Ga0495674_0088420
2656 Ga0495674_0098283
2657 Ga0495674_0107724
2658 Ga0495674_0129386
2659 Ga0495674_0207527
2660 Ga0495674_0230055
2661 Ga0495674_0693323
2662 Ga0495676_0042036
2663 Ga0495676_0332809
2664 Ga0495676_0439261
2665 Ga0495680_0000244
2666 Ga0495680_0034311
2667 Ga0495680_0062978
2668 Ga0495683_0161671
2669 Ga0495675_0009163
2670 Ga0495675_0017775
2671 Ga0495675_0259432
2672 Ga0495684_0001166
2673 Ga0495684_0010165
2674 Ga0495684_0031692
2675 Ga0495684_0047861
2676 Ga0495684_0059328
2677 Ga0495684_0267878
2678 Ga0495684_0268226
2679 Ga0495593_0040537
2680 Ga0495602_0001165
2681 Ga0495602_0078715
2682 Ga0495602_0091649
2683 Ga0495602_0131209
2684 Ga0495602_0337080
2685 Ga0495602_0435835
2686 Ga0495602_0786959
2687 Ga0495614_0050465
2688 Ga0495614_0101854
2689 Ga0496100_0792357
2690 Ga0496101_0199652
2691 Ga0496102_0221000
2692 Ga0496102_0564365
2693 Ga0496104_0007093
2694 Ga0496104_0239219
2695 Ga0496104_0251254
2696 Ga0496105_0007132
2697 Ga0496105_0265831
2698 Ga0496105_0773714
2699 Ga0496107_0824620
2700 Ga0496108_1177876
2701 Ga0496112_0005998
2702 Ga0496112_0029023
2703 Ga0496112_0061991
2704 Ga0496112_0285842
2705 Ga0496112_0376130
2706 Ga0496112_0970945
2707 Ga0496114_0008506
2708 Ga0496114_0013414
2709 Ga0496114_0267583
2710 Ga0496115_0004389
2711 Ga0496115_0110730
2712 Ga0496115_0125732
2713 Ga0496115_0150820
2714 Ga0496115_0159335
2715 Ga0496115_0487826
2716 Ga0496115_0629992
2717 Ga0496126_0000063
2718 Ga0495682_0037587
2719 nmdc:mga0n895_55727_c1
2720 nmdc:mga0n895_60052_c1
2721 nmdc:mga0n895_62602_c1
2722 nmdc:mga0rr50_12928_c1
2723 nmdc:mga0rr50_384601_c1
2724 nmdc:mga08x19_113_c1
2725 nmdc:mga08x19_33799_c1
2726 nmdc:mga08x19_6177_c1
2727 nmdc:mga0a205_104383_c1
2728 Ga0495601_0040152
2729 Ga0495601_0067755
2730 Ga0495601_0089897
2731 Ga0495601_0190439
2732 Ga0495612_0000322
2733 Ga0495619_0095903
2734 Ga0495619_0151232
2735 Ga0500568_0001844
2736 Ga0466962_0194109

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

2

158

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9781 1 149
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9669 1 149
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.955 3 160
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9533 1 165
4dr8-assembly4.cif.gz_D crystal structure of a peptide deformylase from synechococcus elongatus 0.9505 3 159
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9781 1 149 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9666 1 149 3.90.45.10
af_A0A0R0ELH1_60_189_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9533 1 105 3.90.45.10
4dr9B00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9491 3 159 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9472 1 149 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A5M8SEY9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9998 1 169 GO:0006412
GO:0042586
GO:0046872
AF-A0A7D8BBN9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9991 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V9AZN5-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9991 2 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A1Q7KAR0-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9989 2 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V9IGY4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9976 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map