F493349

General Info

Members Datasets Scaffolds Average Seq Length
1362 1070 523 436

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306092|2551738467
Length 469
Sequence RARLALSGYRWLGTAVYPFFWSYLALRAAKGKEDPARRRERYGYASAPRPQGPLVWFHAASVGETNAVTPLIKEIRRRGIAVVLTTGTTTSARVAAERLGSAVVHQYVPLDFKPAVSRFLEYWQPDLAIIAESEIWPMTIIELGRRHIPQVLVNGRLSDRTFARWRRRPSLADALFENLALVIAQSDVDAERFRTLGALPVTVSGNLKVDNEAPPHDPRDLREYRQQIGARKTWAAISTFEGEENAAGTVHQALKERTGLLTIIVPRHPERCDAIEAALVAKGLKVARRTRGDPVTPEVDILLGDTIGEMGLYLRLTEVAFVGRSLFAEGGQNXPLEPAMLGCAVLSGGNVQNFRETYQMLAKNGSAKIVRDTEMLAKGVNYLLANDDMRRSMINAGLETVQQMRGALTATMKGLDPYINPLVVKARLXSRALKPENRSLKPRFWKGSCPQRNRSPAYCSTRTAPFSIM

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
33 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
34 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
35 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
36 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
37 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
38 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
39 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
40 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
41 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
42 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
43 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
44 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
45 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
46 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
47 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
48 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
49 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
50 2516143018 Ensifer sp. BR816 Isolate Nodule
51 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
52 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
53 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
54 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
55 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
56 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
57 2519899620 Rhizobium sp. Pop5 Isolate Nodule
58 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
59 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
60 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
61 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
62 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
63 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
64 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
65 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
66 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
67 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
68 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
69 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
70 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
71 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
72 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
73 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
74 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
75 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
76 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
77 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
78 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
79 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
80 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
81 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
82 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
83 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
84 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
85 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
86 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
87 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
88 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
89 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
90 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
91 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
92 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
93 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
94 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
95 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
96 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
97 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
98 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
99 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
100 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
101 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
102 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
103 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
104 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
105 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
106 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
107 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
108 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
109 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
110 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
111 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
112 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
113 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
114 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
115 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
116 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
117 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
118 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
119 2643221557 Ensifer sp. Root558 Isolate Unclassified
120 2643221558 Rhizobium sp. Root149 Isolate Unclassified
121 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
122 2643221568 Rhizobium sp. Root564 Isolate Unclassified
123 2643221582 Rhizobium sp. Root651 Isolate Unclassified
124 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
125 2643221599 Rhizobium sp. Root708 Isolate Unclassified
126 2643221607 Rhizobium sp. Root73 Isolate Unclassified
127 2643221610 Ensifer sp. Root74 Isolate Unclassified
128 2643221618 Ensifer sp. Root231 Isolate Unclassified
129 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
130 2643221626 Ensifer sp. Root31 Isolate Unclassified
131 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
132 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
133 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
134 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
135 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
136 2643221655 Ensifer sp. Root1252 Isolate Unclassified
137 2643221659 Ensifer sp. Root127 Isolate Unclassified
138 2643221668 Ensifer sp. Root423 Isolate Unclassified
139 2643221675 Ensifer sp. Root1298 Isolate Unclassified
140 2643221680 Ensifer sp. Root1312 Isolate Unclassified
141 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
142 2643221688 Rhizobium sp. Root482 Isolate Unclassified
143 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
144 2643221693 Rhizobium sp. Root491 Isolate Unclassified
145 2643221698 Ensifer sp. Root142 Isolate Unclassified
146 2643221712 Ensifer sp. Root258 Isolate Unclassified
147 2643221719 Rhizobium sp. Root274 Isolate Unclassified
148 2643221723 Ensifer sp. Root278 Isolate Unclassified
149 2643221726 Ensifer sp. Root954 Isolate Unclassified
150 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
151 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
152 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
153 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
154 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
155 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
156 2718217882 Rhizobium sp. N741 Isolate Nodule
157 2718217927 Rhizobium sp. N324 Isolate Nodule
158 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
159 2718218009 Rhizobium sp. N561 Isolate Nodule
160 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
161 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
162 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
163 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
164 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
165 2718218363 Rhizobium sp. N113 Isolate Nodule
166 2718218365 Rhizobium sp. N731 Isolate Nodule
167 2718218366 Rhizobium sp. N621 Isolate Nodule
168 2718218423 Rhizobium sp. N941 Isolate Nodule
169 2721755514 Rhizobium sp. N6212 Isolate Nodule
170 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
171 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
172 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
173 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
174 2721755809 Rhizobium sp. N541 Isolate Nodule
175 2721755810 Rhizobium sp. N871 Isolate Nodule
176 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
177 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
178 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
179 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
180 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
181 2728369365 Rhizobium sp. N1341 Isolate Nodule
182 2728369397 Rhizobium sp. N1314 Isolate Nodule
183 2738541293 Rhizobium sp. GV031 Isolate Unclassified
184 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
185 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
186 2738543024 Aminobacter sp. AP02 Isolate Unclassified
187 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
188 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
189 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
190 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
191 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
192 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
193 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
194 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
195 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
196 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
197 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
198 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
199 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
200 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
201 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
202 2791355256 Rhizobium sp. M10 Isolate Nodule
203 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
204 2791355260 Rhizobium sp. L9 Isolate Nodule
205 2791355261 Rhizobium sp. J15 Isolate Nodule
206 2791355262 Rhizobium sp. M1 Isolate Nodule
207 2791355263 Rhizobium chutanense C5 Isolate Nodule
208 2791355264 Rhizobium sp. S9 Isolate Nodule
209 2791355265 Rhizobium sp. H4 Isolate Nodule
210 2791355266 Rhizobium sp. L43 Isolate Nodule
211 2791355267 Rhizobium sp. L18 Isolate Nodule
212 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
213 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
214 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
215 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
216 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
217 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
218 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
219 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
220 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
221 2802429633 Rhizobium anhuiense J3 Isolate Nodule
222 2802429634 Rhizobium anhuiense S10 Isolate Nodule
223 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
224 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
225 2802429637 Rhizobium anhuiense C15 Isolate Nodule
226 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
227 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
228 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
229 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
230 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
231 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
232 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
233 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
234 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
235 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
236 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
237 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
238 2838048938 Rhizobium pisi 27/80 Isolate Nodule
239 2838061910 Rhizobium phaseoli L15 Isolate Nodule
240 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
241 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
242 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
243 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
244 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
245 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
246 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
247 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
248 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
249 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
250 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
251 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
252 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
253 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
254 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
255 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
256 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
257 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
258 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
259 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
260 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
261 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
262 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
263 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
264 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
265 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
266 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
267 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
268 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
269 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
270 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
271 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
272 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
273 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
274 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
275 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
276 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
277 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
278 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
279 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
280 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
281 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
282 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
283 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
284 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
285 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
286 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
287 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
288 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
289 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
290 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
291 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
292 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
293 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
294 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
295 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
296 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
297 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
298 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
299 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
300 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
301 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
302 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
303 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
304 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
305 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
306 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
307 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
308 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
309 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
310 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
311 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
312 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
313 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
314 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
315 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
316 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
317 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
318 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
319 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
320 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
321 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
322 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
323 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
324 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
325 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
326 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
327 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
328 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
329 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
330 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
331 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
332 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
333 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
334 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
335 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
336 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
337 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
338 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
339 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
340 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
341 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
342 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
343 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
344 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
345 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
346 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
347 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
348 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
349 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
350 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
351 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
352 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
353 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
354 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
355 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
356 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
357 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
358 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
359 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
360 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
361 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
362 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
363 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
364 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
365 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
366 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
367 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
368 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
369 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
370 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
371 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
372 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
373 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
374 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
375 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
376 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
377 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
378 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
379 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
380 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
381 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
382 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
383 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
384 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
385 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
386 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
387 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
388 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
389 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
390 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
391 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
392 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
393 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
394 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
395 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
396 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
397 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
398 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
399 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
400 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
401 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
402 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
403 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
404 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
405 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
406 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
407 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
408 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
409 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
410 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
411 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
412 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
413 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
414 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
415 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
416 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
417 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
418 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
419 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
420 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
421 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
422 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
423 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
424 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
425 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
426 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
427 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
428 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
429 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
430 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
431 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
432 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
433 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
434 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
435 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
436 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
437 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
438 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
439 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
440 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
441 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
442 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
443 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
444 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
445 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
446 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
447 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
448 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
449 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
450 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
451 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
452 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
453 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
454 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
455 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
456 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
457 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
458 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
459 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
460 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
461 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
462 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
463 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
464 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
465 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
466 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
467 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
468 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
469 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
470 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
471 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
472 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
473 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
474 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
475 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
476 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
477 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
478 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
479 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
480 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
481 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
482 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
483 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
484 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
485 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
486 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
487 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
488 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
489 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
490 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
491 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
492 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
493 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
494 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
495 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
496 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
497 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
498 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
499 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
500 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
501 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
502 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
503 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
504 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
505 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
506 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
507 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
508 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
509 2933599457 Rhizobium phaseoli M3 Isolate Nodule
510 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
511 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
512 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
513 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
514 2936381700 Rhizobium chutanense C16 Isolate Unclassified
515 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
516 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
517 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
518 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
519 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
520 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
521 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
522 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
523 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
524 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
525 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
526 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
527 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
528 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
529 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
530 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
531 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
532 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
533 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
534 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
535 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
536 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
537 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
538 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
539 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
540 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
541 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
542 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
543 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
544 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
545 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
546 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
547 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
548 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
549 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
550 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
551 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
552 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
553 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
554 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
555 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
556 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
557 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
558 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
559 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
560 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
561 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
562 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
563 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
564 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
565 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
566 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
567 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
568 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
569 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
570 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
571 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
572 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
573 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
574 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
575 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
576 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
577 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
578 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
579 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
580 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
581 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
582 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
583 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
584 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
585 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
586 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
587 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
588 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
589 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
590 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
591 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
592 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
593 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
594 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
595 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
596 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
597 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
598 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
599 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
600 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
601 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
602 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
603 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
604 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
605 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
606 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
607 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
608 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
609 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
610 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
611 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
612 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
613 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
614 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
615 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
616 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
617 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
618 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
619 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
620 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
621 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
622 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
623 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
624 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
625 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
626 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
627 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
628 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
629 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
630 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
631 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
632 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
633 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
634 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
635 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
636 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
637 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
638 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
639 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
640 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
641 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
642 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
643 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
644 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
645 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
646 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
647 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
648 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
649 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
650 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
651 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
652 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
653 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
654 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
655 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
656 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
657 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
658 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
659 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
660 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
661 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
662 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
663 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
664 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
665 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
666 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
667 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
668 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
669 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
670 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
671 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
672 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
673 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
674 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
675 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
676 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
677 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
678 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
679 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
680 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
681 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
682 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
683 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
684 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
685 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
686 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
687 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
688 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
689 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
690 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
691 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
692 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
693 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
694 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
695 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
696 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
697 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
698 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
699 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
700 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
701 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
702 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
703 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
704 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
705 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
706 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
707 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
708 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
709 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
710 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
711 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
712 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
713 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
714 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
715 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
716 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
717 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
718 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
719 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
720 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
721 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
722 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
723 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
724 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
725 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
726 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
727 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
728 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
729 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
730 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
731 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
732 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
733 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
734 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
735 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
736 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
737 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
738 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
739 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
740 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
741 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
742 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
743 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
744 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
745 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
746 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
747 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
748 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
749 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
750 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
751 2996887358 Rhizobium sp. R711 Isolate Nodule
752 2996893221 Rhizobium sp. R635 Isolate Nodule
753 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
754 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
755 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
756 3004167301 Mesorhizobium loti 582 Isolate Unclassified
757 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
758 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
759 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
760 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
761 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
762 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
763 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
764 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
765 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
766 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
767 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
768 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
769 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
770 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
771 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
772 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
773 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
774 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
775 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
776 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
777 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
778 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
779 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
780 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
781 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
782 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
783 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
784 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
785 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
786 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
787 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
788 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
789 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
790 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
791 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
792 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
793 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
794 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
795 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
796 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
797 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
798 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
799 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
800 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
801 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
802 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
803 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
804 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
805 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
806 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
807 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
808 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
809 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
810 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
811 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
812 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
813 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
814 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
815 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
816 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
817 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
818 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
819 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
820 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
821 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
822 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
823 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
824 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
825 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
826 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
827 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
828 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
829 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
830 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
831 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
832 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
833 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
834 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
835 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
836 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
837 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
838 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
839 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
840 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
841 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
842 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
843 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
844 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
845 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
846 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
847 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
848 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
849 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
850 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
851 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
852 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
853 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
854 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
855 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
856 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
857 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
858 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
859 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
860 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
861 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
862 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
863 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
864 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
865 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
866 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
867 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
868 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
869 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
870 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
871 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
872 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
873 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
874 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
875 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
876 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
877 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
878 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
879 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
880 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
881 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
882 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
883 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
884 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
885 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
886 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
887 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
888 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
889 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
890 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
891 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
892 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
893 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
894 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
895 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
896 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
897 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
898 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
899 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
900 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
901 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
902 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
903 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
904 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
905 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
906 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
907 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
908 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
909 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
910 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
911 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
912 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
913 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
914 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
915 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
916 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
917 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
918 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
919 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
920 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
921 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
922 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
923 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
924 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
925 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
926 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
927 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
928 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
929 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
930 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
931 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
932 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
933 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
934 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
935 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
936 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
937 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
938 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
939 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
940 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
941 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
942 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
943 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
944 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
945 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
946 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
947 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
948 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
949 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
950 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
951 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
952 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
953 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
954 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
955 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
956 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
957 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
958 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
959 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
960 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
961 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
962 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
963 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
964 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
965 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
966 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
967 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
968 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
969 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
970 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
971 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
972 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
973 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
974 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
975 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
976 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
977 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
978 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
979 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
980 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
981 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
982 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
983 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
984 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
985 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
986 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
987 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
988 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
989 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
990 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
991 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
992 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
993 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
994 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
995 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
996 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
997 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
998 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
999 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1000 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1001 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1002 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1003 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1004 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1005 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1006 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1007 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1008 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1009 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1010 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1011 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1012 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1013 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1014 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1015 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1016 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1017 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1018 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1019 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1020 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1021 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1022 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1023 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1024 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1025 8005258706 Rhizobium sp. R693 Isolate Nodule
1026 8005275841 Rhizobium sp. N4311 Isolate Nodule
1027 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1028 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1029 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1030 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1031 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1032 8005321885 Rhizobium sp. R72 Isolate Nodule
1033 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1034 8005382845 Rhizobium sp. R634 Isolate Nodule
1035 8005395548 Rhizobium sp. R339 Isolate Nodule
1036 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1037 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1038 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1039 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1040 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1041 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1042 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1043 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1044 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1045 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1046 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1047 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1048 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1049 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1050 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1051 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1052 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1053 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1054 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1055 8018176218 Rhizobium sp. N122 Isolate Nodule
1056 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1057 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1058 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1059 8024501048 Rhizobium sp. H4 Isolate Nodule
1060 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1061 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1062 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1063 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1064 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1065 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1066 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1067 8056382006 Rhizobium croatiense 13T Isolate Nodule
1068 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1069 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1070 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.33
Metatranscriptomes 0.07
Isolates 61.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 12.19
Nodule 48.16
Rhizoplane 1.4
Rhizosphere 21.81
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002672 3300001979 Bacteria 8004
2 JGI24739J22299_10032207 3300001989 Bacteria 1805
3 JGI25155J39150_1000006 3300002704 Bacteria 244109
4 JGI25156J39149_1000019 3300002705 Bacteria 160845
5 JGI25156J39149_1004645 3300002705 Bacteria 4132
6 JGI25162J39368_1000177 3300002737 Bacteria 68786
7 JGI25162J39368_1000381 3300002737 Bacteria 37770
8 JGI25154J39366_1000177 3300002738 Bacteria 49732
9 JGI25157J39369_1000024 3300002741 Bacteria 160844
10 JGI25157J39369_1002670 3300002741 Bacteria 4162
11 JGI25152J39213_1000299 3300002773 Bacteria 32046
12 JGI25152J39213_1001977 3300002773 Bacteria 8116
13 JGI25152J39213_1002166 3300002773 Bacteria 7697
14 JGI25150J39212_1000042 3300002774 Bacteria 84513
15 JGI25159J45721_1000021 3300002987 Bacteria 119754
16 JGI25159J45721_1001496 3300002987 Bacteria 9581
17 JGI25151J46595_10000099 3300003187 Bacteria 117428
18 JGI25151J46595_10000707 3300003187 Bacteria 27959
19 JGI25151J46595_10009360 3300003187 Bacteria 4645
20 JGI25406J46586_10010757 3300003203 Bacteria 4042
21 JGI25165J46597_1000070 3300003214 Bacteria 193557
22 JGI25165J46597_1000480 3300003214 Bacteria 38783
23 JGI25165J46597_1001692 3300003214 Bacteria 9956
24 JGI25153J46596_10007987 3300003215 Bacteria 5119
25 JGI25153J46596_10009490 3300003215 Bacteria 4512
26 rootH2_10081828 3300003320 Bacteria 5381
27 rootL2_10006203 3300003322 Bacteria 26671
28 rootH1_10006221 3300003323 Bacteria 6749
29 rootH1_10080966 3300003323 Bacteria 4672
30 JGI25160J50197_1000002 3300003354 Bacteria 561707
31 JGI25160J50197_1000046 3300003354 Bacteria 141352
32 JGI25160J50197_1008028 3300003354 Bacteria 4057
33 JGI25161J50226_1000031 3300003374 Bacteria 141352
34 JGI25161J50226_1001568 3300003374 Bacteria 6698
35 Ga0055542_1000344 3300003762 Bacteria 49138
36 Ga0055529_1007055 3300003763 Bacteria 1540
37 Ga0055526_1003166 3300003771 Bacteria 10656
38 Ga0055524_1001940 3300003775 Bacteria 11138
39 Ga0055524_1004569 3300003775 Bacteria 6367
40 Ga0055536_1003131 3300003781 Bacteria 8982
41 Ga0055536_1007911 3300003781 Bacteria 4668
42 Ga0055528_1002755 3300003790 Bacteria 9207
43 Ga0055528_1019902 3300003790 Bacteria 2199
44 Ga0055540_1000269 3300003792 Bacteria 47006
45 Ga0055540_1004730 3300003792 Bacteria 6011
46 Ga0055540_1007822 3300003792 Bacteria 3958
47 Ga0055531_10001859 3300003794 Bacteria 14817
48 Ga0055531_10013431 3300003794 Bacteria 3773
49 Ga0058692_1002755 3300003856 Bacteria 5777
50 Ga0058692_1010264 3300003856 Bacteria 2321
51 Ga0055543_1000278 3300004625 Bacteria 37671
52 Ga0055543_1000306 3300004625 Bacteria 34217
53 Ga0055543_1004016 3300004625 Bacteria 4130
54 Ga0065165_1000058 3300005262 Bacteria 184784
55 Ga0065165_1000693 3300005262 Bacteria 48076
56 Ga0065165_1004713 3300005262 Bacteria 8193
57 Ga0065165_1010993 3300005262 Bacteria 3836
58 Ga0065165_1013516 3300005262 Bacteria 3239
59 Ga0070668_100042434 3300005347 Bacteria 3487
60 Ga0070671_100043211 3300005355 Bacteria 3745
61 Ga0070663_100011297 3300005455 Bacteria 5599
62 Ga0070663_100133810 3300005455 Bacteria 1886
63 Ga0068853_100007135 3300005539 Bacteria 8936
64 Ga0068853_100154814 3300005539 Bacteria 2065
65 Ga0070665_100038883 3300005548 Bacteria 4783
66 Ga0070665_100040022 3300005548 Bacteria 4712
67 Ga0070665_100059703 3300005548 Bacteria 3823
68 Ga0070665_100080233 3300005548 Bacteria 3268
69 Ga0070665_100151867 3300005548 Bacteria 2319
70 Ga0068855_100109516 3300005563 Bacteria 3172
71 Ga0068855_100245902 3300005563 Bacteria 1997
72 Ga0068857_100106827 3300005577 Bacteria 2514
73 Ga0081540_1012530 3300005983 Bacteria 5573
74 Ga0081539_10003940 3300005985 Bacteria 17202
75 Ga0075365_10003722 3300006038 Bacteria 7928
76 Ga0075365_10007235 3300006038 Bacteria 6201
77 Ga0075365_10017983 3300006038 Bacteria 4337
78 Ga0075365_10029225 3300006038 Bacteria 3521
79 Ga0075365_10050727 3300006038 Bacteria 2738
80 Ga0075365_10052489 3300006038 Bacteria 2697
81 Ga0075365_10059189 3300006038 Bacteria 2552
82 Ga0075365_10125496 3300006038 Bacteria 1773
83 Ga0075368_10001844 3300006042 Bacteria 6814
84 Ga0075363_100041351 3300006048 Bacteria 2431
85 Ga0075363_100122317 3300006048 Bacteria 1454
86 Ga0075364_10000416 3300006051 Bacteria 21322
87 Ga0075364_10033396 3300006051 Bacteria 3313
88 Ga0075362_10017477 3300006177 Bacteria 2955
89 Ga0075362_10022993 3300006177 Bacteria 2631
90 Ga0075367_10012811 3300006178 Bacteria 4488
91 Ga0075367_10045013 3300006178 Bacteria 2589
92 Ga0075367_10054584 3300006178 Bacteria 2369
93 Ga0075369_10000599 3300006186 Bacteria 11441
94 Ga0075369_10007943 3300006186 Bacteria 4066
95 Ga0075369_10012428 3300006186 Bacteria 3364
96 Ga0075370_10007858 3300006353 Bacteria 5458
97 Ga0079104_1000069 3300006946 Bacteria 153993
98 Ga0099826_10000327 3300006948 Bacteria 21659
99 Ga0099826_10029864 3300006948 Bacteria 3966
100 Ga0105250_10008165 3300009092 Bacteria 4458
101 Ga0105240_10003684 3300009093 Bacteria 23694
102 Ga0105243_10018026 3300009148 Bacteria 5342
103 Ga0105243_10049161 3300009148 Bacteria 3326
104 Ga0105248_10084414 3300009177 Bacteria 3573
105 Ga0105237_10002476 3300009545 Bacteria 22919
106 Ga0105237_10014009 3300009545 Bacteria 8391
107 Ga0105238_10006570 3300009551 Bacteria 11582
108 Ga0123341_1009192 3300009765 Bacteria 9041
109 Ga0123342_1010831 3300009766 Bacteria 10258
110 Ga0105239_10003906 3300010375 Bacteria 18071
111 Ga0157373_10020610 3300013100 Bacteria 4790
112 Ga0157371_10000058 3300013102 Bacteria 171756
113 Ga0157371_10008296 3300013102 Bacteria 8297
114 Ga0157370_10000030 3300013104 Bacteria 145571
115 Ga0157370_10003932 3300013104 Bacteria 17294
116 Ga0157370_10163277 3300013104 Bacteria 2072
117 Ga0157369_10098581 3300013105 Bacteria 3116
118 Ga0157369_10280081 3300013105 Bacteria 1737
119 Ga0171463_1001 3300013249 Bacteria 1406070
120 Ga0182008_10008080 3300014497 Bacteria 5762
121 Ga0182008_10072680 3300014497 Bacteria 1692
122 Ga0182007_10000598 3300015262 Bacteria 21106
123 Ga0182007_10022213 3300015262 Bacteria 2243
124 Ga0182005_1006003 3300015265 Bacteria 3753
125 Ga0183363_1186 3300015690 Bacteria 13383
126 Ga0214544_1000008 3300021320 Bacteria 326027
127 Ga0214542_1000010 3300021321 Bacteria 262816
128 Ga0214543_1000003 3300021327 Bacteria 692327
129 Ga0214543_1000004 3300021327 Bacteria 527190
130 Ga0228711_1000137 3300022739 Bacteria 66265
131 Ga0228710_1000031 3300022740 Bacteria 95534
132 Ga0209435_100011 3300025206 Bacteria 413027
133 Ga0209436_100128 3300025208 Bacteria 37455
134 Ga0209437_100036 3300025233 Bacteria 469153
135 Ga0209437_100086 3300025233 Bacteria 254578
136 Ga0207425_1000012 3300025245 Bacteria 528324
137 Ga0207425_1003062 3300025245 Bacteria 5541
138 Ga0209646_1000024 3300025246 Bacteria 413027
139 Ga0209026_1000002 3300025250 Bacteria 1136158
140 Ga0209026_1000030 3300025250 Bacteria 329811
141 Ga0209677_100862 3300025253 Bacteria 14985
142 Ga0209148_1000123 3300025254 Bacteria 185406
143 Ga0209759_1000011 3300025256 Bacteria 413027
144 Ga0209759_1000381 3300025256 Bacteria 55381
145 Ga0209129_1000086 3300025258 Bacteria 181543
146 Ga0209129_1000407 3300025258 Bacteria 33939
147 Ga0209129_1000606 3300025258 Bacteria 24232
148 Ga0209129_1007997 3300025258 Bacteria 3018
149 Ga0209233_1000110 3300025261 Bacteria 260825
150 Ga0209233_1000131 3300025261 Bacteria 205257
151 Ga0209233_1000166 3300025261 Bacteria 152270
152 Ga0209233_1000390 3300025261 Bacteria 37314
153 Ga0209455_1000129 3300025272 Bacteria 161691
154 Ga0209673_1000015 3300025273 Bacteria 530618
155 Ga0209673_1000091 3300025273 Bacteria 201875
156 Ga0209673_1003094 3300025273 Bacteria 10203
157 Ga0209673_1004627 3300025273 Bacteria 7283
158 Ga0209673_1015431 3300025273 Bacteria 2903
159 Ga0209130_1000008 3300025284 Bacteria 581232
160 Ga0209130_1000312 3300025284 Bacteria 57303
161 Ga0209676_1005846 3300025292 Bacteria 6278
162 Ga0209676_1008200 3300025292 Bacteria 4712
163 Ga0209025_1000024 3300025294 Bacteria 528324
164 Ga0209025_1000118 3300025294 Bacteria 214009
165 Ga0209025_1000549 3300025294 Bacteria 70203
166 Ga0209025_1000956 3300025294 Bacteria 43592
167 Ga0209025_1000980 3300025294 Bacteria 42613
168 Ga0209025_1005096 3300025294 Bacteria 10928
169 Ga0209025_1009494 3300025294 Bacteria 6763
170 Ga0209025_1017886 3300025294 Bacteria 4060
171 Ga0209564_1000091 3300025295 Bacteria 249103
172 Ga0209564_1000742 3300025295 Bacteria 46299
173 Ga0209564_1003340 3300025295 Bacteria 11124
174 Ga0209564_1008708 3300025295 Bacteria 4954
175 Ga0209564_1012297 3300025295 Bacteria 3744
176 Ga0209758_1000046 3300025297 Bacteria 364931
177 Ga0209758_1000191 3300025297 Bacteria 136984
178 Ga0209758_1000325 3300025297 Bacteria 91078
179 Ga0209758_1007462 3300025297 Bacteria 7430
180 Ga0209758_1008441 3300025297 Bacteria 6670
181 Ga0209050_1003450 3300025298 Bacteria 11633
182 Ga0209256_1000169 3300025299 Bacteria 131077
183 Ga0209256_1000858 3300025299 Bacteria 37944
184 Ga0209256_1001975 3300025299 Bacteria 18470
185 Ga0209256_1002377 3300025299 Bacteria 15520
186 Ga0209256_1005090 3300025299 Bacteria 7808
187 Ga0209256_1005247 3300025299 Bacteria 7578
188 Ga0207426_1000012 3300025302 Bacteria 730942
189 Ga0207426_1000016 3300025302 Bacteria 581232
190 Ga0207426_1000063 3300025302 Bacteria 358920
191 Ga0207426_1000457 3300025302 Bacteria 64140
192 Ga0209051_1000084 3300025303 Bacteria 190324
193 Ga0209051_1000860 3300025303 Bacteria 30937
194 Ga0209051_1004764 3300025303 Bacteria 8200
195 Ga0209051_1010007 3300025303 Bacteria 4829
196 Ga0209051_1014165 3300025303 Bacteria 3737
197 Ga0209051_1041554 3300025303 Bacteria 1634
198 Ga0209257_1001225 3300025304 Bacteria 31975
199 Ga0209257_1004315 3300025304 Bacteria 11169
200 Ga0209257_1005237 3300025304 Bacteria 9276
201 Ga0207647_10005582 3300025904 Bacteria 9200
202 Ga0207647_10033555 3300025904 Bacteria 3286
203 Ga0207695_10003123 3300025913 Bacteria 23696
204 Ga0207695_10078835 3300025913 Bacteria 3341
205 Ga0207671_10000176 3300025914 Bacteria 98289
206 Ga0207671_10006724 3300025914 Bacteria 10182
207 Ga0207694_10008378 3300025924 Bacteria 7810
208 Ga0207650_10002037 3300025925 Bacteria 14152
209 Ga0207690_10077815 3300025932 Bacteria 2306
210 Ga0207667_10133513 3300025949 Bacteria 2557
211 Ga0207639_10003928 3300026041 Bacteria 10034
212 Ga0207678_10009958 3300026067 Bacteria 8340
213 Ga0207678_10059370 3300026067 Bacteria 3291
214 Ga0207702_10073938 3300026078 Bacteria 2940
215 Ga0207674_10060733 3300026116 Bacteria 3822
216 Ga0207674_10087471 3300026116 Bacteria 3109
217 Ga0207698_10075067 3300026142 Bacteria 2700
218 Ga0209281_1000155 3300027111 Bacteria 164423
219 Ga0209281_1000253 3300027111 Bacteria 105600
220 Ga0209281_1001059 3300027111 Bacteria 20700
221 Ga0209371_1000009 3300027312 Bacteria 963030
222 Ga0209371_1001145 3300027312 Bacteria 19403
223 Ga0209371_1002735 3300027312 Bacteria 9476
224 Ga0209282_1000025 3300027666 Bacteria 168676
225 Ga0209282_1000908 3300027666 Bacteria 15442
226 Ga0209282_1022896 3300027666 Bacteria 3930
227 Ga0268266_10028826 3300028379 Bacteria 4719
228 Ga0268266_10089010 3300028379 Bacteria 2702
229 Ga0268266_10090430 3300028379 Bacteria 2683
230 Ga0268266_10111561 3300028379 Bacteria 2423
231 Ga0268266_10193345 3300028379 Bacteria 1859
232 Ga0307515_10000154 3300028794 Bacteria 166582
233 Ga0307515_10006246 3300028794 Bacteria 23911
234 Ga0307515_10043638 3300028794 Bacteria 6961
235 Ga0268256_1000010 3300030500 Bacteria 963034
236 Ga0268256_1003517 3300030500 Bacteria 7023
237 Ga0268256_1015207 3300030500 Bacteria 2255
238 Ga0307513_10001054 3300031456 Bacteria 40089
239 Ga0307408_100089591 3300031548 Bacteria 2319
240 Ga0307406_10083835 3300031901 Bacteria 2127
241 Ga0307412_10007356 3300031911 Bacteria 6244
242 Ga0307412_10049598 3300031911 Bacteria 2767
243 Ga0315914_1000620 3300031967 Bacteria 46971
244 Ga0307409_100031636 3300031995 Bacteria 3823
245 Ga0315913_1000150 3300033430 Bacteria 47059
246 Ga0315915_1000015 3300033464 Bacteria 168491
247 Ga0395899_0000073 3300037312 Bacteria 181387
248 Ga0395899_0055606 3300037312 Bacteria 2927
249 Ga0395900_0000027 3300037418 Bacteria 285957
250 Ga0395900_0027451 3300037418 Bacteria 5832
251 Ga0395900_0173782 3300037418 Bacteria 2192
252 Ga0395898_0000255 3300037466 Bacteria 131017
253 Ga0395905_0000032 3300037471 Bacteria 285932
254 Ga0395901_0000110 3300038443 Bacteria 112682
255 Ga0395901_0014679 3300038443 Bacteria 7960
256 Ga0395901_0034079 3300038443 Bacteria 5258
257 Ga0439436_0005742 3300041404 Bacteria 3804
258 Ga0439465_0002164 3300041413 Bacteria 6458
259 Ga0451835_0651872 3300041492 Bacteria 1883
260 Ga0439449_0029318 3300042007 Bacteria 2050
261 Ga0450907_008680 3300042146 Bacteria 1685
262 Ga0450918_004827 3300042531 Bacteria 2439
263 Ga0466963_0002783 3300044694 Bacteria 9861
264 Ga0466958_0007058 3300045836 Bacteria 6148
265 Ga0495629_0014910 3300046459 Bacteria 5587
266 Ga0495638_0001215 3300046460 Bacteria 24561
267 Ga0495638_0012359 3300046460 Bacteria 5854
268 Ga0495605_0001185 3300046474 Bacteria 17342
269 Ga0495662_0015369 3300046476 Bacteria 3718
270 Ga0495585_0001367 3300046492 Bacteria 19313
271 Ga0495585_0012209 3300046492 Bacteria 5062
272 Ga0495585_0017543 3300046492 Bacteria 4135
273 Ga0495607_0045498 3300046501 Bacteria 2581
274 Ga0495583_0001517 3300046506 Bacteria 23050
275 Ga0495583_0013986 3300046506 Bacteria 4445
276 Ga0495606_0021406 3300046507 Bacteria 4736
277 Ga0495606_0081419 3300046507 Bacteria 2012
278 Ga0495610_0000975 3300046512 Bacteria 26429
279 Ga0495620_0006890 3300046515 Bacteria 6209
280 Ga0495620_0009193 3300046515 Bacteria 5268
281 Ga0495620_0018738 3300046515 Bacteria 3423
282 Ga0495620_0041739 3300046515 Bacteria 2010
283 Ga0495620_0045964 3300046515 Bacteria 1888
284 Ga0495620_0055028 3300046515 Bacteria 1678
285 Ga0495631_0000622 3300046518 Bacteria 23323
286 Ga0495632_0003225 3300046519 Bacteria 11714
287 Ga0495632_0025761 3300046519 Bacteria 3107
288 Ga0495654_0000320 3300046530 Bacteria 42124
289 Ga0495609_0027309 3300046538 Bacteria 2609
290 Ga0495622_0004894 3300046557 Bacteria 6204
291 Ga0495633_0010509 3300046558 Bacteria 5046
292 Ga0495668_0001429 3300046616 Bacteria 23122
293 Ga0495634_0113523 3300046642 Bacteria 1740
294 Ga0495625_0001674 3300046660 Bacteria 25895
295 Ga0495625_0066799 3300046660 Bacteria 2532
296 Ga0495635_0009879 3300046663 Bacteria 6669
297 Ga0495588_0001635 3300046674 Bacteria 9593
298 Ga0495588_0009713 3300046674 Bacteria 4459
299 Ga0495588_0026724 3300046674 Bacteria 2883
300 Ga0495657_0011072 3300046675 Bacteria 6763
301 Ga0495671_0025493 3300046692 Bacteria 3073
302 Ga0495671_0108881 3300046692 Bacteria 1353
303 Ga0495636_0029664 3300047318 Bacteria 2234
304 Ga0495672_0003865 3300047320 Bacteria 12592
305 Ga0495687_026666 3300047443 Bacteria 2716
306 Ga0495687_041534 3300047443 Bacteria 2017
307 Ga0495681_0005896 3300047470 Bacteria 8130
308 Ga0495686_0001812 3300047472 Bacteria 21578
309 Ga0495686_0003176 3300047472 Bacteria 14482
310 Ga0495686_0049030 3300047472 Bacteria 2659
311 Ga0495686_0052452 3300047472 Bacteria 2557
312 Ga0496104_0321642 3300048907 Bacteria 1460
313 Ga0496105_0084897 3300048908 Bacteria 2616
314 Ga0496110_0087364 3300048913 Bacteria 2785
315 Ga0496111_0003497 3300048914 Bacteria 9719
316 Ga0496112_0004721 3300048915 Bacteria 11612
317 Ga0496113_0130227 3300048916 Bacteria 1973
318 Ga0496114_0038222 3300048917 Bacteria 3971
319 Ga0496116_0000080 3300048919 Bacteria 224530
320 Ga0496116_0002774 3300048919 Bacteria 18003
321 Ga0496116_0004619 3300048919 Bacteria 13052
322 Ga0496116_0004929 3300048919 Bacteria 12577
323 Ga0496116_0006070 3300048919 Bacteria 11054
324 Ga0496117_0000002 3300048920 Bacteria 2483758
325 Ga0496117_0002938 3300048920 Bacteria 20628
326 Ga0496117_0003435 3300048920 Bacteria 18428
327 Ga0496117_0004016 3300048920 Bacteria 16589
328 Ga0496117_0028812 3300048920 Bacteria 4292
329 Ga0496117_0052801 3300048920 Bacteria 2860
330 Ga0496117_0065162 3300048920 Bacteria 2479
331 Ga0496117_0072659 3300048920 Bacteria 2298
332 Ga0496118_0001656 3300048921 Bacteria 32720
333 Ga0496118_0002528 3300048921 Bacteria 24531
334 Ga0496118_0004982 3300048921 Bacteria 15351
335 Ga0496118_0015790 3300048921 Bacteria 6966
336 Ga0496118_0036260 3300048921 Bacteria 3990
337 Ga0496118_0045335 3300048921 Bacteria 3434
338 Ga0496119_0003135 3300048922 Bacteria 17414
339 Ga0496119_0012020 3300048922 Bacteria 7083
340 Ga0496119_0053279 3300048922 Bacteria 2472
341 Ga0496119_0053616 3300048922 Bacteria 2462
342 Ga0496119_0074573 3300048922 Bacteria 1975
343 Ga0496120_0000021 3300048923 Bacteria 250966
344 Ga0496120_0001808 3300048923 Bacteria 23949
345 Ga0496120_0004424 3300048923 Bacteria 11795
346 Ga0496120_0051187 3300048923 Bacteria 2360
347 Ga0496121_0000001 3300048924 Bacteria 1830318
348 Ga0496121_0000459 3300048924 Bacteria 80085
349 Ga0496121_0001940 3300048924 Bacteria 32987
350 Ga0496121_0016156 3300048924 Bacteria 7730
351 Ga0496121_0022977 3300048924 Bacteria 6025
352 Ga0496121_0063677 3300048924 Bacteria 3011
353 Ga0496122_0000001 3300048925 Bacteria 1827766
354 Ga0496122_0000009 3300048925 Bacteria 584024
355 Ga0496122_0000247 3300048925 Bacteria 121291
356 Ga0496122_0002082 3300048925 Bacteria 29663
357 Ga0496122_0006417 3300048925 Bacteria 13508
358 Ga0496122_0006956 3300048925 Bacteria 12745
359 Ga0496122_0010026 3300048925 Bacteria 9855
360 Ga0496122_0013353 3300048925 Bacteria 8045
361 Ga0496123_0000001 3300048926 Bacteria 1831497
362 Ga0496123_0000020 3300048926 Bacteria 388748
363 Ga0496123_0000222 3300048926 Bacteria 115482
364 Ga0496123_0011146 3300048926 Bacteria 7831
365 Ga0496123_0013913 3300048926 Bacteria 6702
366 Ga0496123_0111412 3300048926 Bacteria 1563
367 Ga0496124_0000063 3300048927 Bacteria 229705
368 Ga0496124_0000592 3300048927 Bacteria 61048
369 Ga0496124_0002394 3300048927 Bacteria 24664
370 Ga0496124_0009274 3300048927 Bacteria 10150
371 Ga0496124_0010148 3300048927 Bacteria 9583
372 Ga0496124_0038494 3300048927 Bacteria 4152
373 Ga0496124_0039327 3300048927 Bacteria 4101
374 Ga0496124_0055913 3300048927 Bacteria 3332
375 Ga0496124_0098010 3300048927 Bacteria 2379
376 Ga0496124_0133848 3300048927 Bacteria 1965
377 Ga0496125_0000001 3300048928 Bacteria 1766138
378 Ga0496125_0000557 3300048928 Bacteria 64217
379 Ga0496125_0005358 3300048928 Bacteria 14312
380 Ga0496125_0007390 3300048928 Bacteria 11692
381 Ga0496125_0057046 3300048928 Bacteria 3166
382 Ga0496125_0085081 3300048928 Bacteria 2398
383 Ga0496125_0157560 3300048928 Bacteria 1548
384 Ga0496126_0000438 3300048929 Bacteria 83060
385 Ga0496126_0001405 3300048929 Bacteria 38083
386 Ga0496126_0052716 3300048929 Bacteria 3695
387 Ga0496126_0063940 3300048929 Bacteria 3297
388 Ga0495678_009868 3300049459 Bacteria 4683
389 Ga0501031_0000037 3300049568 Bacteria 73210
390 Ga0501031_0015024 3300049568 Bacteria 5029
391 Ga0501032_0000081 3300049569 Bacteria 82613
392 Ga0501032_0000116 3300049569 Bacteria 67350
393 Ga0501032_0038383 3300049569 Bacteria 3262
394 Ga0501032_0051622 3300049569 Bacteria 2772
395 Ga0501032_0159737 3300049569 Bacteria 1480
396 Ga0501033_0000097 3300049570 Bacteria 83228
397 Ga0501033_0000171 3300049570 Bacteria 61888
398 Ga0501033_0000501 3300049570 Bacteria 36835
399 Ga0501033_0001994 3300049570 Bacteria 17795
400 Ga0501033_0003939 3300049570 Bacteria 12043
401 Ga0501033_0008539 3300049570 Bacteria 7923
402 Ga0501033_0040448 3300049570 Bacteria 3480
403 Ga0501033_0099030 3300049570 Bacteria 2129
404 Ga0501033_0165221 3300049570 Bacteria 1591
405 Ga0501034_0000186 3300049571 Bacteria 116500
406 Ga0501034_0003453 3300049571 Bacteria 18014
407 Ga0501034_0004432 3300049571 Bacteria 15628
408 Ga0501034_0006126 3300049571 Bacteria 12976
409 Ga0501034_0025197 3300049571 Bacteria 6054
410 Ga0501034_0200783 3300049571 Bacteria 1952
411 Ga0501036_0000002 3300049572 Bacteria 293106
412 Ga0501036_0000117 3300049572 Bacteria 49511
413 Ga0501037_0000095 3300049573 Bacteria 82641
414 Ga0501037_0000108 3300049573 Bacteria 77753
415 Ga0501037_0000451 3300049573 Bacteria 33602
416 Ga0501037_0029877 3300049573 Bacteria 4026
417 Ga0501037_0149457 3300049573 Bacteria 1670
418 Ga0501038_0000002 3300049574 Bacteria 330446
419 Ga0501038_0000126 3300049574 Bacteria 64756
420 Ga0501038_0031440 3300049574 Bacteria 4691
421 Ga0501038_0098426 3300049574 Bacteria 2439
422 Ga0501039_0000002 3300049575 Bacteria 375152
423 Ga0501039_0000003 3300049575 Bacteria 357424
424 Ga0501039_0056119 3300049575 Bacteria 3051
425 Ga0501040_0004757 3300049576 Bacteria 8803
426 Ga0501040_0034502 3300049576 Bacteria 3427
427 Ga0501040_0184914 3300049576 Bacteria 1478
428 Ga0501041_0020926 3300049577 Bacteria 3917
429 Ga0501042_0031541 3300049578 Bacteria 3749
430 Ga0501043_0000081 3300049579 Bacteria 85059
431 Ga0501043_0000140 3300049579 Bacteria 67478
432 Ga0501043_0000162 3300049579 Bacteria 60676
433 Ga0501043_0046250 3300049579 Bacteria 3422
434 Ga0501043_0120863 3300049579 Bacteria 2054
435 Ga0501046_0007521 3300049580 Bacteria 9557
436 Ga0501047_0001069 3300049581 Bacteria 27308
437 Ga0501047_0008935 3300049581 Bacteria 9461
438 Ga0501047_0020656 3300049581 Bacteria 6322
439 Ga0501047_0084377 3300049581 Bacteria 3053
440 Ga0501047_0100696 3300049581 Bacteria 2769
441 Ga0501047_0150278 3300049581 Bacteria 2205
442 Ga0501047_0164809 3300049581 Bacteria 2087
443 Ga0501047_0245424 3300049581 Bacteria 1640
444 Ga0501069_0000118 3300049585 Bacteria 35026
445 Ga0501069_0058040 3300049585 Bacteria 2158
446 Ga0501070_0000127 3300049586 Bacteria 68100
447 Ga0501070_0002038 3300049586 Bacteria 17765
448 Ga0501070_0010186 3300049586 Bacteria 7955
449 Ga0501070_0016008 3300049586 Bacteria 6301
450 Ga0501070_0044569 3300049586 Bacteria 3690
451 Ga0501070_0057259 3300049586 Bacteria 3231
452 Ga0501070_0079084 3300049586 Bacteria 2721
453 Ga0501070_0087750 3300049586 Bacteria 2575
454 Ga0501070_0345512 3300049586 Bacteria 1208
455 Ga0501071_0041718 3300049587 Bacteria 3287
456 Ga0501073_0031877 3300049589 Bacteria 3760
457 Ga0501073_0044664 3300049589 Bacteria 3123
458 Ga0501074_0000062 3300049590 Bacteria 51831
459 Ga0501074_0017250 3300049590 Bacteria 5238
460 Ga0501080_0000254 3300049742 Bacteria 40217
461 Ga0501080_0026203 3300049742 Bacteria 5417
462 Ga0501083_0000453 3300049744 Bacteria 26265
463 Ga0501083_0032262 3300049744 Bacteria 3594
464 Ga0501280_002482 3300049776 Bacteria 3057
465 Ga0501035_0000017 3300049822 Bacteria 241915
466 Ga0501035_0000100 3300049822 Bacteria 107321
467 Ga0501035_0001153 3300049822 Bacteria 27594
468 Ga0501035_0001764 3300049822 Bacteria 21833
469 Ga0501035_0002971 3300049822 Bacteria 16304
470 Ga0501035_0058917 3300049822 Bacteria 3420
471 Ga0501035_0076851 3300049822 Bacteria 2951
472 Ga0501035_0195360 3300049822 Bacteria 1738
473 Ga0501044_0000002 3300049823 Bacteria 375152
474 Ga0501044_0000751 3300049823 Bacteria 39231
475 Ga0501044_0030478 3300049823 Bacteria 5684
476 Ga0501044_0040211 3300049823 Bacteria 4874
477 Ga0501044_0041123 3300049823 Bacteria 4813
478 Ga0501044_0044749 3300049823 Bacteria 4591
479 Ga0501044_0056676 3300049823 Bacteria 4023
480 Ga0501044_0090220 3300049823 Bacteria 3092
481 Ga0501044_0110800 3300049823 Bacteria 2753
482 Ga0501044_0161467 3300049823 Bacteria 2217
483 nmdc:mga03683_18138_c1 3300050489 Bacteria 2672
484 nmdc:mga00v17_40101_c1 3300050491 Bacteria 2808
485 nmdc:mga00v17_690_c1 3300050491 Bacteria 18535
486 nmdc:mga00v17_90_c1 3300050491 Bacteria 53278
487 nmdc:mga00v17_92752_c1 3300050491 Bacteria 1898
488 nmdc:mga0yw44_1586_c1 3300050492 Bacteria 9129
489 nmdc:mga0yw44_6030_c1 3300050492 Bacteria 5806
490 nmdc:mga0yw44_79671_c1 3300050492 Bacteria 2050
491 nmdc:mga0yw44_937_c1 3300050492 Bacteria 7973
492 nmdc:mga06z11_152809_c1 3300050494 Bacteria 1314
493 nmdc:mga06z11_34216_c1 3300050494 Bacteria 2493
494 nmdc:mga06z11_69452_c1 3300050494 Bacteria 1860
495 nmdc:mga07m45_136486_c1 3300050496 Bacteria 1420
496 nmdc:mga0sz30_11731_c1 3300050516 Bacteria 3393
497 nmdc:mga0sz30_14203_c1 3300050516 Bacteria 3130
498 nmdc:mga0sz30_711_c2 3300050516 Bacteria 11673
499 Ga0495655_0004667 3300053083 Bacteria 2364
500 Ga0500578_0037488 3300053086 Bacteria 3114
501 Ga0500643_018034 3300053087 Bacteria 2351
502 Ga0500560_012286 3300053107 Bacteria 2214
503 Ga0500569_000527 3300053109 Bacteria 6373
504 Ga0500594_0001679 3300053118 Bacteria 4822
505 Ga0500618_000132 3300053125 Bacteria 62415
506 Ga0500618_000360 3300053125 Bacteria 31678
507 Ga0500642_0076166 3300053130 Bacteria 1534
508 Ga0500658_0005556 3300053134 Bacteria 4691
509 Ga0500561_0000208 3300053137 Bacteria 10664
510 Ga0500568_0000048 3300053139 Bacteria 119025
511 Ga0500568_0000533 3300053139 Bacteria 28047
512 Ga0500573_0000746 3300053140 Bacteria 14543
513 Ga0500590_002289 3300053148 Bacteria 8415
514 Ga0500616_0000191 3300053153 Bacteria 100381
515 Ga0500616_0001527 3300053153 Bacteria 21789
516 Ga0500616_0029737 3300053153 Bacteria 3004
517 Ga0500620_000553 3300053155 Bacteria 6440
518 Ga0500627_0061574 3300053158 Bacteria 1651
519 Ga0500633_0034441 3300053160 Bacteria 1661
520 Ga0500634_0000129 3300053161 Bacteria 27162
521 Ga0500636_0000010 3300053177 Bacteria 145932
522 Ga0587072_003865 3300059643 Bacteria 2137
523 Ga0501082_0034529 3300060353 Bacteria 4359

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2906393657 2906400435 374
2 iso_pu_bacteria 3004289098 3004291175 376
3 3300049579 Ga0501043_0120863 Ga0501043_0120863_11_1153 379
4 3300049586 Ga0501070_0345512 Ga0501070_0345512_19_1161 379
5 3300049823 Ga0501044_0161467 Ga0501044_0161467_1014_2156 379
6 3300049570 Ga0501033_0165221 Ga0501033_0165221_273_1430 384
7 iso_pu_bacteria 2906354277 2906362902 398
8 iso_pu_bacteria 2965089291 2965092326 405
9 iso_pu_bacteria 2924710171 2924717691 407
10 iso_pu_bacteria 2979779861 2979782932 411
11 3300048913 Ga0496110_0087364 Ga0496110_0087364_642_1970 415
12 3300048914 Ga0496111_0003497 Ga0496111_0003497_1614_2942 415
13 3300048925 Ga0496122_0010026 Ga0496122_0010026_5820_7148 415
14 3300050494 nmdc:mga06z11_152809_c1 nmdc:mga06z11_152809_c1_29_1279 415
15 iso_pu_bacteria 2899803654 2899804384 415
16 iso_pu_bacteria 2938014810 2938015355 418
17 iso_pu_bacteria 2906378014 2906378742 420
18 3300046692 Ga0495671_0108881 Ga0495671_0108881_23_1288 421
19 3300047318 Ga0495636_0029664 Ga0495636_0029664_27_1292 421
20 3300049576 Ga0501040_0184914 Ga0501040_0184914_110_1435 424
21 3300049571 Ga0501034_0200783 Ga0501034_0200783_62_1387 427
22 iso_pu_bacteria 2551306087 2551699839 428
23 3300048908 Ga0496105_0084897 Ga0496105_0084897_659_1951 429
24 3300049576 Ga0501040_0034502 Ga0501040_0034502_2113_3405 429
25 iso_pu_bacteria 2643221558 2643810454 429
26 iso_pu_bacteria 2913308742 2913310632 430
27 3300025292 Ga0209676_1005846 Ga0209676_10058463 431
28 3300025297 Ga0209758_1000191 Ga0209758_1000191130 431
29 3300025298 Ga0209050_1003450 Ga0209050_10034509 431
30 3300025303 Ga0209051_1000860 Ga0209051_100086026 431
31 3300025304 Ga0209257_1001225 Ga0209257_100122519 431
32 3300048927 Ga0496124_0133848 Ga0496124_0133848_21_1319 431
33 3300049822 Ga0501035_0195360 Ga0501035_0195360_202_1500 431
34 3300053153 Ga0500616_0000191 Ga0500616_0000191_79101_80399 431
35 iso_pu_bacteria 2838042994 2838047201 431
36 iso_pu_bacteria 2838048938 2838053914 431
37 iso_pu_bacteria 2838680041 2838680704 431
38 iso_pu_bacteria 2838694306 2838695263 431
39 iso_pu_bacteria 2838707686 2838708639 431
40 iso_pu_bacteria 2841864319 2841866702 431
41 iso_pu_bacteria 2842077413 2842080126 431
42 iso_pu_bacteria 2842118031 2842120746 431
43 iso_pu_bacteria 2842237096 2842238051 431
44 iso_pu_bacteria 2842291075 2842293786 431
45 iso_pu_bacteria 2842341865 2842342967 431
46 iso_pu_bacteria 2842363717 2842367311 431
47 iso_pu_bacteria 2842370503 2842371167 431
48 iso_pu_bacteria 2842377471 2842380182 431
49 iso_pu_bacteria 2842384541 2842387254 431
50 iso_pu_bacteria 2996336353 2996338165 431
51 3300049569 Ga0501032_0038383 Ga0501032_0038383_1011_2333 432
52 3300049573 Ga0501037_0149457 Ga0501037_0149457_219_1541 432
53 3300049581 Ga0501047_0008935 Ga0501047_0008935_3850_5172 432
54 3300049585 Ga0501069_0058040 Ga0501069_0058040_43_1365 432
55 3300049586 Ga0501070_0016008 Ga0501070_0016008_2496_3818 432
56 3300049589 Ga0501073_0044664 Ga0501073_0044664_1315_2637 432
57 3300049742 Ga0501080_0026203 Ga0501080_0026203_1632_2954 432
58 3300049822 Ga0501035_0058917 Ga0501035_0058917_1554_2876 432
59 3300049823 Ga0501044_0041123 Ga0501044_0041123_1033_2355 432
60 iso_pu_bacteria 2513237159 2513999849 432
61 iso_pu_bacteria 2842521101 2842526422 432
62 iso_pu_bacteria 2989771324 2989774059 432
63 3300046460 Ga0495638_0012359 Ga0495638_0012359_2343_3665 433
64 iso_pu_bacteria 2503198000 2503203100 433
65 iso_pu_bacteria 2508501122 2509107196 433
66 iso_pu_bacteria 2508501123 2509114885 433
67 iso_pu_bacteria 2508501127 2509143356 433
68 iso_pu_bacteria 2509276018 2509372678 433
69 iso_pu_bacteria 2509276019 2509374838 433
70 iso_pu_bacteria 2509276022 2509397562 433
71 iso_pu_bacteria 2510065057 2510304894 433
72 iso_pu_bacteria 2510065059 2510319749 433
73 iso_pu_bacteria 2511231052 2511500684 433
74 iso_pu_bacteria 2512047086 2512532104 433
75 iso_pu_bacteria 2512875016 2512930091 433
76 iso_pu_bacteria 2512875024 2512964775 433
77 iso_pu_bacteria 2512875026 2512972563 433
78 iso_pu_bacteria 2513237086 2513585751 433
79 iso_pu_bacteria 2513237089 2513606663 433
80 iso_pu_bacteria 2513237090 2513611836 433
81 iso_pu_bacteria 2513237091 2513616824 433
82 iso_pu_bacteria 2513237140 2513880762 433
83 iso_pu_bacteria 2513237143 2513903756 433
84 iso_pu_bacteria 2513237156 2513986145 433
85 iso_pu_bacteria 2513237160 2514007559 433
86 iso_pu_bacteria 2513237164 2514033126 433
87 iso_pu_bacteria 2513237351 2514589720 433
88 iso_pu_bacteria 2515154107 2515607818 433
89 iso_pu_bacteria 2516143018 2516208560 433
90 iso_pu_bacteria 2516653046 2516891959 433
91 iso_pu_bacteria 2517487022 2517568772 433
92 iso_pu_bacteria 2519899620 2520379988 433
93 iso_pu_bacteria 2524023207 2524450009 433
94 iso_pu_bacteria 2551306084 2551676532 433
95 iso_pu_bacteria 2551306085 2551686924 433
96 iso_pu_bacteria 2551306086 2551695778 433
97 iso_pu_bacteria 2551306089 2551709887 433
98 iso_pu_bacteria 2551306090 2551723489 433
99 iso_pu_bacteria 2551306091 2551728074 433
100 iso_pu_bacteria 2558860100 2558863830 433
101 iso_pu_bacteria 2582581283 2585165108 433
102 iso_pu_bacteria 2582581306 2585266681 433
103 iso_pu_bacteria 2582581865 2585387697 433
104 iso_pu_bacteria 2582581866 2585394290 433
105 iso_pu_bacteria 2588253730 2588515707 433
106 iso_pu_bacteria 2597489875 2597814831 433
107 iso_pu_bacteria 2599185156 2599333138 433
108 iso_pu_bacteria 2599185301 2599937337 433
109 iso_pu_bacteria 2599185352 2600191558 433
110 iso_pu_bacteria 2600254933 2600374813 433
111 iso_pu_bacteria 2643221550 2643773539 433
112 iso_pu_bacteria 2643221551 2643775720 433
113 iso_pu_bacteria 2643221555 2643794167 433
114 iso_pu_bacteria 2643221557 2643807590 433
115 iso_pu_bacteria 2643221564 2643837263 433
116 iso_pu_bacteria 2643221568 2643856279 433
117 iso_pu_bacteria 2643221595 2643986610 433
118 iso_pu_bacteria 2643221607 2644047034 433
119 iso_pu_bacteria 2643221610 2644070002 433
120 iso_pu_bacteria 2643221618 2644103084 433
121 iso_pu_bacteria 2643221623 2644133020 433
122 iso_pu_bacteria 2643221626 2644151987 433
123 iso_pu_bacteria 2643221627 2644157545 433
124 iso_pu_bacteria 2643221636 2644203527 433
125 iso_pu_bacteria 2643221655 2644306011 433
126 iso_pu_bacteria 2643221659 2644330319 433
127 iso_pu_bacteria 2643221668 2644380973 433
128 iso_pu_bacteria 2643221675 2644414879 433
129 iso_pu_bacteria 2643221680 2644448536 433
130 iso_pu_bacteria 2643221686 2644479823 433
131 iso_pu_bacteria 2643221688 2644493760 433
132 iso_pu_bacteria 2643221689 2644496634 433
133 iso_pu_bacteria 2643221698 2644542934 433
134 iso_pu_bacteria 2643221712 2644619038 433
135 iso_pu_bacteria 2643221723 2644673929 433
136 iso_pu_bacteria 2643221726 2644689157 433
137 iso_pu_bacteria 2657244999 2657681994 433
138 iso_pu_bacteria 2687453392 2688599959 433
139 iso_pu_bacteria 2690316117 2692317153 433
140 iso_pu_bacteria 2693429783 2694634027 433
141 iso_pu_bacteria 2693429784 2694638602 433
142 iso_pu_bacteria 2721755686 2723576754 433
143 iso_pu_bacteria 2738543024 2739306356 433
144 iso_pu_bacteria 2756170246 2756673493 433
145 iso_pu_bacteria 2757320392 2757569278 433
146 iso_pu_bacteria 2791355091 2792622354 433
147 iso_pu_bacteria 2791355092 2792628080 433
148 iso_pu_bacteria 2791355094 2792638665 433
149 iso_pu_bacteria 2791355123 2792748940 433
150 iso_pu_bacteria 2802428858 2802717415 433
151 iso_pu_bacteria 2802428859 2802723658 433
152 iso_pu_bacteria 2802428860 2802730893 433
153 iso_pu_bacteria 2802428861 2802735900 433
154 iso_pu_bacteria 2802428862 2802743891 433
155 iso_pu_bacteria 2802428863 2802752891 433
156 iso_pu_bacteria 2802429268 2804751012 433
157 iso_pu_bacteria 2838074704 2838075462 433
158 iso_pu_bacteria 2841734538 2841740915 433
159 iso_pu_bacteria 2842922631 2842923443 433
160 iso_pu_bacteria 2844002411 2844005959 433
161 iso_pu_bacteria 2844009547 2844015225 433
162 iso_pu_bacteria 2847417321 2847417776 433
163 iso_pu_bacteria 2847670302 2847671185 433
164 iso_pu_bacteria 2847686936 2847687330 433
165 iso_pu_bacteria 2848992105 2848992622 433
166 iso_pu_bacteria 2850079185 2850080132 433
167 iso_pu_bacteria 2855825444 2855831877 433
168 iso_pu_bacteria 2855839649 2855840164 433
169 iso_pu_bacteria 2855872281 2855873176 433
170 iso_pu_bacteria 2856314179 2856316699 433
171 iso_pu_bacteria 2856320880 2856324576 433
172 iso_pu_bacteria 2856328259 2856333211 433
173 iso_pu_bacteria 2856334872 2856338680 433
174 iso_pu_bacteria 2856342000 2856344581 433
175 iso_pu_bacteria 2856349417 2856349666 433
176 iso_pu_bacteria 2856364286 2856370948 433
177 iso_pu_bacteria 2857349434 2857355245 433
178 iso_pu_bacteria 2857367948 2857370572 433
179 iso_pu_bacteria 2858800743 2858804069 433
180 iso_pu_bacteria 2869169390 2869176773 433
181 iso_pu_bacteria 2869234852 2869240941 433
182 iso_pu_bacteria 2869242130 2869245692 433
183 iso_pu_bacteria 2869249662 2869251440 433
184 iso_pu_bacteria 2869256925 2869260921 433
185 iso_pu_bacteria 2869264136 2869269825 433
186 iso_pu_bacteria 2869278585 2869281426 433
187 iso_pu_bacteria 2869285874 2869292159 433
188 iso_pu_bacteria 2871429161 2871435366 433
189 iso_pu_bacteria 2871435913 2871441389 433
190 iso_pu_bacteria 2871444079 2871449961 433
191 iso_pu_bacteria 2871451962 2871458996 433
192 iso_pu_bacteria 2871459585 2871465448 433
193 iso_pu_bacteria 2871474448 2871474956 433
194 iso_pu_bacteria 2871488783 2871489260 433
195 iso_pu_bacteria 2871495908 2871495958 433
196 iso_pu_bacteria 2874102143 2874107125 433
197 iso_pu_bacteria 2874109183 2874110495 433
198 iso_pu_bacteria 2874116593 2874118757 433
199 iso_pu_bacteria 2874123672 2874131164 433
200 iso_pu_bacteria 2874131515 2874138469 433
201 iso_pu_bacteria 2874139085 2874140908 433
202 iso_pu_bacteria 2874146452 2874155067 433
203 iso_pu_bacteria 2874155637 2874161386 433
204 iso_pu_bacteria 2874162495 2874164599 433
205 iso_pu_bacteria 2874168670 2874170442 433
206 iso_pu_bacteria 2876363079 2876366345 433
207 iso_pu_bacteria 2876369609 2876376869 433
208 iso_pu_bacteria 2876377896 2876383541 433
209 iso_pu_bacteria 2876386047 2876387886 433
210 iso_pu_bacteria 2876392853 2876395542 433
211 iso_pu_bacteria 2876399893 2876404008 433
212 iso_pu_bacteria 2876406927 2876412674 433
213 iso_pu_bacteria 2876413966 2876420523 433
214 iso_pu_bacteria 2876420981 2876427038 433
215 iso_pu_bacteria 2878035449 2878036909 433
216 iso_pu_bacteria 2878738818 2878742686 433
217 iso_pu_bacteria 2878745973 2878752501 433
218 iso_pu_bacteria 2878753008 2878753796 433
219 iso_pu_bacteria 2878760144 2878760191 433
220 iso_pu_bacteria 2878767105 2878767151 433
221 iso_pu_bacteria 2878774303 2878776733 433
222 iso_pu_bacteria 2881147464 2881152268 433
223 iso_pu_bacteria 2881155292 2881156720 433
224 iso_pu_bacteria 2881161766 2881162135 433
225 iso_pu_bacteria 2881845957 2881852407 433
226 iso_pu_bacteria 2881853255 2881856748 433
227 iso_pu_bacteria 2881861095 2881865080 433
228 iso_pu_bacteria 2882632389 2882633457 433
229 iso_pu_bacteria 2885305155 2885310975 433
230 iso_pu_bacteria 2885312484 2885316569 433
231 iso_pu_bacteria 2885318864 2885321377 433
232 iso_pu_bacteria 2885326080 2885329832 433
233 iso_pu_bacteria 2885342637 2885347743 433
234 iso_pu_bacteria 2885350715 2885354050 433
235 iso_pu_bacteria 2888337043 2888341138 433
236 iso_pu_bacteria 2888343758 2888348317 433
237 iso_pu_bacteria 2888350351 2888357321 433
238 iso_pu_bacteria 2889010040 2889012275 433
239 iso_pu_bacteria 2889016732 2889022833 433
240 iso_pu_bacteria 2891373044 2891376260 433
241 iso_pu_bacteria 2896384573 2896385433 433
242 iso_pu_bacteria 2903448605 2903452605 433
243 iso_pu_bacteria 2903492973 2903497140 433
244 iso_pu_bacteria 2903492973 2903505326 433
245 iso_pu_bacteria 2903521522 2903524213 433
246 iso_pu_bacteria 2903528002 2903533604 433
247 iso_pu_bacteria 2903540706 2903540753 433
248 iso_pu_bacteria 2904659560 2904662173 433
249 iso_pu_bacteria 2906308376 2906314895 433
250 iso_pu_bacteria 2906321335 2906328067 433
251 iso_pu_bacteria 2906328253 2906332663 433
252 iso_pu_bacteria 2906363423 2906366780 433
253 iso_pu_bacteria 2906386501 2906391646 433
254 iso_pu_bacteria 2906401398 2906404248 433
255 iso_pu_bacteria 2906408224 2906413484 433
256 iso_pu_bacteria 2906414383 2906416836 433
257 iso_pu_bacteria 2913295892 2913297884 433
258 iso_pu_bacteria 2915980308 2915982325 433
259 iso_pu_bacteria 2915986958 2915989371 433
260 iso_pu_bacteria 2915993759 2915999528 433
261 iso_pu_bacteria 2916000859 2916001497 433
262 iso_pu_bacteria 2916007675 2916010952 433
263 iso_pu_bacteria 2916014648 2916015280 433
264 iso_pu_bacteria 2916021584 2916022179 433
265 iso_pu_bacteria 2916028427 2916032698 433
266 iso_pu_bacteria 2916035215 2916041475 433
267 iso_pu_bacteria 2916041962 2916045895 433
268 iso_pu_bacteria 2916048683 2916051641 433
269 iso_pu_bacteria 2916055098 2916059412 433
270 iso_pu_bacteria 2916061851 2916062662 433
271 iso_pu_bacteria 2916068649 2916069521 433
272 iso_pu_bacteria 2916076590 2916082726 433
273 iso_pu_bacteria 2919166419 2919166954 433
274 iso_pu_bacteria 2920760137 2920763224 433
275 iso_pu_bacteria 2920822456 2920823476 433
276 iso_pu_bacteria 2921201388 2921205684 433
277 iso_pu_bacteria 2921208531 2921210795 433
278 iso_pu_bacteria 2921237296 2921237729 433
279 iso_pu_bacteria 2921244191 2921250562 433
280 iso_pu_bacteria 2921250672 2921250677 433
281 iso_pu_bacteria 2921257292 2921257998 433
282 iso_pu_bacteria 2921263974 2921268394 433
283 iso_pu_bacteria 2921282425 2921284163 433
284 iso_pu_bacteria 2921289301 2921295745 433
285 iso_pu_bacteria 2921296804 2921303644 433
286 iso_pu_bacteria 2922130491 2922137183 433
287 iso_pu_bacteria 2922151315 2922155239 433
288 iso_pu_bacteria 2922172374 2922177709 433
289 iso_pu_bacteria 2922178524 2922178892 433
290 iso_pu_bacteria 2922185730 2922194045 433
291 iso_pu_bacteria 2924144063 2924150525 433
292 iso_pu_bacteria 2924150972 2924155742 433
293 iso_pu_bacteria 2924158325 2924161356 433
294 iso_pu_bacteria 2924165586 2924169551 433
295 iso_pu_bacteria 2924172951 2924177075 433
296 iso_pu_bacteria 2924179722 2924180394 433
297 iso_pu_bacteria 2924186466 2924190523 433
298 iso_pu_bacteria 2924193448 2924199774 433
299 iso_pu_bacteria 2924200457 2924206730 433
300 iso_pu_bacteria 2924207177 2924213667 433
301 iso_pu_bacteria 2924214083 2924216741 433
302 iso_pu_bacteria 2924221636 2924225521 433
303 iso_pu_bacteria 2924228884 2924229517 433
304 iso_pu_bacteria 2924718760 2924721737 433
305 iso_pu_bacteria 2924726620 2924727972 433
306 iso_pu_bacteria 2924733363 2924735207 433
307 iso_pu_bacteria 2924748358 2924753625 433
308 iso_pu_bacteria 2924762789 2924765754 433
309 iso_pu_bacteria 2924776078 2924780486 433
310 iso_pu_bacteria 2924784321 2924791957 433
311 iso_pu_bacteria 2936996657 2936999287 433
312 iso_pu_bacteria 2937002841 2937009403 433
313 iso_pu_bacteria 2937009748 2937016024 433
314 iso_pu_bacteria 2937016420 2937022465 433
315 iso_pu_bacteria 2937023124 2937026805 433
316 iso_pu_bacteria 2937029754 2937030146 433
317 iso_pu_bacteria 2937036028 2937037862 433
318 iso_pu_bacteria 2937042894 2937043580 433
319 iso_pu_bacteria 2937049772 2937053805 433
320 iso_pu_bacteria 2937056579 2937060901 433
321 iso_pu_bacteria 2937063883 2937070678 433
322 iso_pu_bacteria 2937071275 2937078350 433
323 iso_pu_bacteria 2937078374 2937080221 433
324 iso_pu_bacteria 2937084907 2937087194 433
325 iso_pu_bacteria 2937091812 2937094634 433
326 iso_pu_bacteria 2937098957 2937102041 433
327 iso_pu_bacteria 2937106411 2937109645 433
328 iso_pu_bacteria 2937113482 2937117017 433
329 iso_pu_bacteria 2937119839 2937125653 433
330 iso_pu_bacteria 2937126314 2937132363 433
331 iso_pu_bacteria 2937813078 2937821293 433
332 iso_pu_bacteria 2937822353 2937823200 433
333 iso_pu_bacteria 2937836603 2937839482 433
334 iso_pu_bacteria 2937848649 2937855278 433
335 iso_pu_bacteria 2937861824 2937866072 433
336 iso_pu_bacteria 2937877337 2937883013 433
337 iso_pu_bacteria 2937891427 2937895972 433
338 iso_pu_bacteria 2937972304 2937973765 433
339 iso_pu_bacteria 2937980651 2937983527 433
340 iso_pu_bacteria 2937994558 2937994608 433
341 iso_pu_bacteria 2941499720 2941500617 433
342 iso_pu_bacteria 2957375807 2957377482 433
343 iso_pu_bacteria 2957382221 2957388130 433
344 iso_pu_bacteria 2957388812 2957392614 433
345 iso_pu_bacteria 2957395598 2957398496 433
346 iso_pu_bacteria 2957402308 2957408186 433
347 iso_pu_bacteria 2957408893 2957414617 433
348 iso_pu_bacteria 2957415311 2957415670 433
349 iso_pu_bacteria 2957422303 2957428362 433
350 iso_pu_bacteria 2957430029 2957433808 433
351 iso_pu_bacteria 2957437181 2957443602 433
352 iso_pu_bacteria 2957443900 2957446394 433
353 iso_pu_bacteria 2957450854 2957457277 433
354 iso_pu_bacteria 2957457609 2957458185 433
355 iso_pu_bacteria 2957464669 2957470720 433
356 iso_pu_bacteria 2957471148 2957474784 433
357 iso_pu_bacteria 2957478035 2957484404 433
358 iso_pu_bacteria 2957484790 2957488389 433
359 iso_pu_bacteria 2957491536 2957495457 433
360 iso_pu_bacteria 2957498199 2957502243 433
361 iso_pu_bacteria 2957505466 2957509332 433
362 iso_pu_bacteria 2958034702 2958037388 433
363 iso_pu_bacteria 2958041894 2958047100 433
364 iso_pu_bacteria 2958064165 2958069633 433
365 iso_pu_bacteria 2958071322 2958076645 433
366 iso_pu_bacteria 2958084443 2958090139 433
367 iso_pu_bacteria 2958092219 2958098886 433
368 iso_pu_bacteria 2958100919 2958105673 433
369 iso_pu_bacteria 2958108152 2958112630 433
370 iso_pu_bacteria 2958115193 2958117690 433
371 iso_pu_bacteria 2958122699 2958122886 433
372 iso_pu_bacteria 2958130278 2958136559 433
373 iso_pu_bacteria 2958158011 2958162240 433
374 iso_pu_bacteria 2958165035 2958165086 433
375 iso_pu_bacteria 2958172287 2958174899 433
376 iso_pu_bacteria 2958179912 2958186053 433
377 iso_pu_bacteria 2960584000 2960586284 433
378 iso_pu_bacteria 2960591022 2960593690 433
379 iso_pu_bacteria 2960597568 2960603167 433
380 iso_pu_bacteria 2960603979 2960604443 433
381 iso_pu_bacteria 2960610863 2960614870 433
382 iso_pu_bacteria 2960617483 2960621105 433
383 iso_pu_bacteria 2960624210 2960628496 433
384 iso_pu_bacteria 2960631154 2960632999 433
385 iso_pu_bacteria 2960637947 2960638273 433
386 iso_pu_bacteria 2960645483 2960650348 433
387 iso_pu_bacteria 2960652885 2960653644 433
388 iso_pu_bacteria 2960660292 2960664720 433
389 iso_pu_bacteria 2960667422 2960668324 433
390 iso_pu_bacteria 2960674078 2960675901 433
391 iso_pu_bacteria 2960680706 2960685563 433
392 iso_pu_bacteria 2960687367 2960691617 433
393 iso_pu_bacteria 2960693952 2960695576 433
394 iso_pu_bacteria 2961077736 2961084534 433
395 iso_pu_bacteria 2961114664 2961117327 433
396 iso_pu_bacteria 2961127735 2961129874 433
397 iso_pu_bacteria 2961163497 2961163546 433
398 iso_pu_bacteria 2961170736 2961171598 433
399 iso_pu_bacteria 2961183825 2961186691 433
400 iso_pu_bacteria 2963644680 2963649141 433
401 iso_pu_bacteria 2964607997 2964615243 433
402 iso_pu_bacteria 2964615318 2964619568 433
403 iso_pu_bacteria 2964621998 2964622642 433
404 iso_pu_bacteria 2964628898 2964633612 433
405 iso_pu_bacteria 2964636051 2964638511 433
406 iso_pu_bacteria 2964643177 2964649565 433
407 iso_pu_bacteria 2964649959 2964653546 433
408 iso_pu_bacteria 2964656573 2964661822 433
409 iso_pu_bacteria 2964663802 2964670439 433
410 iso_pu_bacteria 2964670856 2964677982 433
411 iso_pu_bacteria 2964678106 2964681361 433
412 iso_pu_bacteria 2964685014 2964685493 433
413 iso_pu_bacteria 2964691889 2964692247 433
414 iso_pu_bacteria 2964698721 2964700646 433
415 iso_pu_bacteria 2964705432 2964712584 433
416 iso_pu_bacteria 2964712639 2964715720 433
417 iso_pu_bacteria 2964719344 2964725156 433
418 iso_pu_bacteria 2965018300 2965018349 433
419 iso_pu_bacteria 2965025482 2965030483 433
420 iso_pu_bacteria 2965032056 2965038853 433
421 iso_pu_bacteria 2965040258 2965044579 433
422 iso_pu_bacteria 2965047637 2965053080 433
423 iso_pu_bacteria 2965062239 2965065888 433
424 iso_pu_bacteria 2967664464 2967666149 433
425 iso_pu_bacteria 2967671571 2967672063 433
426 iso_pu_bacteria 2967678726 2967683309 433
427 iso_pu_bacteria 2967686174 2967691841 433
428 iso_pu_bacteria 2967693043 2967696622 433
429 iso_pu_bacteria 2967699805 2967702385 433
430 iso_pu_bacteria 2967706974 2967711770 433
431 iso_pu_bacteria 2967714385 2967718186 433
432 iso_pu_bacteria 2967721400 2967725988 433
433 iso_pu_bacteria 2967728569 2967729893 433
434 iso_pu_bacteria 2967735183 2967738218 433
435 iso_pu_bacteria 2967742019 2967744781 433
436 iso_pu_bacteria 2967748971 2967755106 433
437 iso_pu_bacteria 2967755722 2967756685 433
438 iso_pu_bacteria 2967762386 2967767078 433
439 iso_pu_bacteria 2967769361 2967775337 433
440 iso_pu_bacteria 2967775926 2967777399 433
441 iso_pu_bacteria 2967996073 2967996325 433
442 iso_pu_bacteria 2968003550 2968004558 433
443 iso_pu_bacteria 2968016561 2968019772 433
444 iso_pu_bacteria 2968083720 2968084386 433
445 iso_pu_bacteria 2968091066 2968096704 433
446 iso_pu_bacteria 2968097103 2968099906 433
447 iso_pu_bacteria 2968110612 2968113235 433
448 iso_pu_bacteria 2968117919 2968123594 433
449 iso_pu_bacteria 2968128360 2968132871 433
450 iso_pu_bacteria 2968171901 2968171949 433
451 iso_pu_bacteria 2970019648 2970024809 433
452 iso_pu_bacteria 2970026789 2970032500 433
453 iso_pu_bacteria 2970033650 2970037609 433
454 iso_pu_bacteria 2970040964 2970045277 433
455 iso_pu_bacteria 2970047711 2970054087 433
456 iso_pu_bacteria 2970054988 2970058781 433
457 iso_pu_bacteria 2970061556 2970063758 433
458 iso_pu_bacteria 2970068827 2970072795 433
459 iso_pu_bacteria 2970076120 2970081531 433
460 iso_pu_bacteria 2970082768 2970086240 433
461 iso_pu_bacteria 2970088815 2970095356 433
462 iso_pu_bacteria 2970095765 2970096222 433
463 iso_pu_bacteria 2970102677 2970106380 433
464 iso_pu_bacteria 2970109326 2970113575 433
465 iso_pu_bacteria 2970116247 2970120309 433
466 iso_pu_bacteria 2970122695 2970123806 433
467 iso_pu_bacteria 2970129317 2970132900 433
468 iso_pu_bacteria 2970136068 2970139864 433
469 iso_pu_bacteria 2970143518 2970145585 433
470 iso_pu_bacteria 2970149975 2970153700 433
471 iso_pu_bacteria 2970156795 2970161651 433
472 iso_pu_bacteria 2970164137 2970170275 433
473 iso_pu_bacteria 2970170962 2970177496 433
474 iso_pu_bacteria 2970177841 2970181446 433
475 iso_pu_bacteria 2970184632 2970190944 433
476 iso_pu_bacteria 2970191845 2970195849 433
477 iso_pu_bacteria 2970469710 2970473093 433
478 iso_pu_bacteria 2970489779 2970495241 433
479 iso_pu_bacteria 2970503327 2970504025 433
480 iso_pu_bacteria 2970510686 2970515703 433
481 iso_pu_bacteria 2970524798 2970531330 433
482 iso_pu_bacteria 2970540015 2970541644 433
483 iso_pu_bacteria 2970547951 2970553536 433
484 iso_pu_bacteria 2970554993 2970555042 433
485 iso_pu_bacteria 2970593180 2970596030 433
486 iso_pu_bacteria 2970619444 2970626277 433
487 iso_pu_bacteria 2970627176 2970631630 433
488 iso_pu_bacteria 2977516862 2977520654 433
489 iso_pu_bacteria 2977523885 2977530397 433
490 iso_pu_bacteria 2977530762 2977537631 433
491 iso_pu_bacteria 2977537788 2977544014 433
492 iso_pu_bacteria 2977544691 2977549875 433
493 iso_pu_bacteria 2977551784 2977555720 433
494 iso_pu_bacteria 2977558990 2977559516 433
495 iso_pu_bacteria 2977565890 2977572285 433
496 iso_pu_bacteria 2977572785 2977577604 433
497 iso_pu_bacteria 2977579622 2977583972 433
498 iso_pu_bacteria 2977821940 2977823014 433
499 iso_pu_bacteria 2977843712 2977849506 433
500 iso_pu_bacteria 2977851361 2977857893 433
501 iso_pu_bacteria 2977858184 2977864589 433
502 iso_pu_bacteria 2977864932 2977866426 433
503 iso_pu_bacteria 2977872689 2977875902 433
504 iso_pu_bacteria 2977907340 2977912357 433
505 iso_pu_bacteria 2977915119 2977920731 433
506 iso_pu_bacteria 2977922695 2977926959 433
507 iso_pu_bacteria 2977935797 2977939382 433
508 iso_pu_bacteria 2977942078 2977948789 433
509 iso_pu_bacteria 2977957713 2977961711 433
510 iso_pu_bacteria 2977971508 2977971692 433
511 iso_pu_bacteria 2977986579 2977987389 433
512 iso_pu_bacteria 2978969890 2978973373 433
513 iso_pu_bacteria 2979710463 2979713542 433
514 iso_pu_bacteria 2979742915 2979744911 433
515 iso_pu_bacteria 2979764755 2979768944 433
516 iso_pu_bacteria 2979772303 2979774018 433
517 iso_pu_bacteria 2979808191 2979808660 433
518 iso_pu_bacteria 2984587000 2984591655 433
519 iso_pu_bacteria 2987636660 2987640378 433
520 iso_pu_bacteria 2987645492 2987647356 433
521 iso_pu_bacteria 2987652177 2987659141 433
522 iso_pu_bacteria 2987659509 2987659554 433
523 iso_pu_bacteria 2987666974 2987673079 433
524 iso_pu_bacteria 2987673487 2987679046 433
525 iso_pu_bacteria 2989349275 2989355414 433
526 iso_pu_bacteria 2996310559 2996316675 433
527 iso_pu_bacteria 2996341866 2996347245 433
528 iso_pu_bacteria 2996348954 2996351783 433
529 iso_pu_bacteria 2996386984 2996390615 433
530 iso_pu_bacteria 3000135777 3000139054 433
531 iso_pu_bacteria 3003930520 3003932192 433
532 iso_pu_bacteria 3004167301 3004170710 433
533 iso_pu_bacteria 3004188549 3004188597 433
534 iso_pu_bacteria 3004203850 3004208576 433
535 iso_pu_bacteria 3004211236 3004214830 433
536 iso_pu_bacteria 3004218560 3004222579 433
537 iso_pu_bacteria 3004232784 3004237610 433
538 iso_pu_bacteria 3004248173 3004251729 433
539 iso_pu_bacteria 3004268573 3004271699 433
540 iso_pu_bacteria 3004275668 3004278482 433
541 iso_pu_bacteria 3004334049 3004339626 433
542 iso_pu_bacteria 637000159 637079873 433
543 iso_pu_bacteria 643692032 643824633 433
544 iso_pu_bacteria 648276728 648741465 433
545 iso_pu_bacteria 649633066 649874437 433
546 iso_pu_bacteria 8002285264 8002287685 433
547 iso_pu_bacteria 8003992118 8003992577 433
548 iso_pu_bacteria 8003999396 8003999899 433
549 iso_pu_bacteria 8004300914 8004303404 433
550 iso_pu_bacteria 8004312739 8004315443 433
551 iso_pu_bacteria 8004361976 8004367223 433
552 iso_pu_bacteria 8004374579 8004375370 433
553 iso_pu_bacteria 8004387939 8004394861 433
554 iso_pu_bacteria 8004395343 8004401869 433
555 iso_pu_bacteria 8004445564 8004451202 433
556 iso_pu_bacteria 8004633249 8004635367 433
557 iso_pu_bacteria 8004640170 8004642805 433
558 iso_pu_bacteria 8004703790 8004711573 433
559 iso_pu_bacteria 8004714634 8004721156 433
560 iso_pu_bacteria 8004727605 8004731153 433
561 iso_pu_bacteria 8054460903 8054461375 433
562 iso_pu_bacteria 8054558443 8054563089 433
563 iso_pu_bacteria 8055617313 8055622510 433
564 3300013105 Ga0157369_10098581 Ga0157369_100985812 434
565 3300046492 Ga0495585_0012209 Ga0495585_0012209_1472_2776 434
566 3300046515 Ga0495620_0018738 Ga0495620_0018738_1418_2722 434
567 3300049570 Ga0501033_0000171 Ga0501033_0000171_11958_13262 434
568 3300049822 Ga0501035_0002971 Ga0501035_0002971_7793_9097 434
569 3300053125 Ga0500618_000360 Ga0500618_000360_23696_25003 434
570 iso_pu_bacteria 2510917026 2511170151 434
571 iso_pu_bacteria 2511231027 2511390775 434
572 iso_pu_bacteria 2558860983 2561467335 434
573 iso_pu_bacteria 2582581304 2585257101 434
574 iso_pu_bacteria 2643221634 2644190699 434
575 iso_pu_bacteria 2738541317 2738945686 434
576 iso_pu_bacteria 2765235802 2765464394 434
577 iso_pu_bacteria 2767802442 2770194751 434
578 iso_pu_bacteria 2775506902 2776272460 434
579 iso_pu_bacteria 2775506904 2776284400 434
580 iso_pu_bacteria 2791355253 2793281952 434
581 iso_pu_bacteria 2839993093 2839994305 434
582 iso_pu_bacteria 2840764183 2840769283 434
583 iso_pu_bacteria 2842871566 2842873522 434
584 iso_pu_bacteria 2852387548 2852388593 434
585 iso_pu_bacteria 2854896431 2854898383 434
586 iso_pu_bacteria 2854916844 2854919097 434
587 iso_pu_bacteria 2894652903 2894655318 434
588 iso_pu_bacteria 2904578770 2904579019 434
589 iso_pu_bacteria 2919119836 2919122154 434
590 iso_pu_bacteria 2919171160 2919171967 434
591 iso_pu_bacteria 2928521798 2928521909 434
592 iso_pu_bacteria 2929138655 2929139049 434
593 iso_pu_bacteria 2954011201 2954014734 434
594 iso_pu_bacteria 3002141150 3002142710 434
595 iso_pu_bacteria 8005658619 8005660429 434
596 iso_pu_bacteria 8055431914 8055433378 434
597 iso_pu_bacteria 8056875544 8056879232 434
598 3300005548 Ga0070665_100080233 Ga0070665_1000802334 435
599 3300009177 Ga0105248_10084414 Ga0105248_100844144 435
600 3300009765 Ga0123341_1009192 Ga0123341_10091922 435
601 3300009766 Ga0123342_1010831 Ga0123342_10108319 435
602 3300041492 Ga0451835_0651872 Ga0451835_0651872_232_1539 435
603 3300046492 Ga0495585_0017543 Ga0495585_0017543_2058_3365 435
604 3300046501 Ga0495607_0045498 Ga0495607_0045498_604_1911 435
605 3300046507 Ga0495606_0081419 Ga0495606_0081419_570_1877 435
606 3300046512 Ga0495610_0000975 Ga0495610_0000975_3322_4629 435
607 3300046515 Ga0495620_0006890 Ga0495620_0006890_2050_3357 435
608 3300046515 Ga0495620_0009193 Ga0495620_0009193_1180_2487 435
609 3300046515 Ga0495620_0055028 Ga0495620_0055028_181_1488 435
610 3300046519 Ga0495632_0003225 Ga0495632_0003225_4675_5982 435
611 3300046558 Ga0495633_0010509 Ga0495633_0010509_3418_4725 435
612 3300046660 Ga0495625_0066799 Ga0495625_0066799_805_2112 435
613 3300047443 Ga0495687_026666 Ga0495687_026666_740_2047 435
614 3300047472 Ga0495686_0003176 Ga0495686_0003176_3034_4341 435
615 3300047472 Ga0495686_0052452 Ga0495686_0052452_508_1815 435
616 3300048929 Ga0496126_0063940 Ga0496126_0063940_1219_2526 435
617 3300049459 Ga0495678_009868 Ga0495678_009868_1494_2801 435
618 3300050489 nmdc:mga03683_18138_c1 nmdc:mga03683_18138_c1_1193_2500 435
619 3300050492 nmdc:mga0yw44_6030_c1 nmdc:mga0yw44_6030_c1_2773_4080 435
620 3300050496 nmdc:mga07m45_136486_c1 nmdc:mga07m45_136486_c1_44_1351 435
621 3300050516 nmdc:mga0sz30_14203_c1 nmdc:mga0sz30_14203_c1_1017_2324 435
622 3300053134 Ga0500658_0005556 Ga0500658_0005556_322_1629 435
623 3300053153 Ga0500616_0029737 Ga0500616_0029737_144_1451 435
624 3300053160 Ga0500633_0034441 Ga0500633_0034441_251_1558 435
625 iso_pu_bacteria 2509276021 2509388312 435
626 iso_pu_bacteria 2509276033 2509443879 435
627 iso_pu_bacteria 2510065019 2510131588 435
628 iso_pu_bacteria 2510461076 2510897882 435
629 iso_pu_bacteria 2510917022 2511136180 435
630 iso_pu_bacteria 2510917028 2511185591 435
631 iso_pu_bacteria 2513237084 2513571167 435
632 iso_pu_bacteria 2513237085 2513579289 435
633 iso_pu_bacteria 2513237088 2513598549 435
634 iso_pu_bacteria 2513237093 2513632262 435
635 iso_pu_bacteria 2513237103 2513713254 435
636 iso_pu_bacteria 2513237138 2513866372 435
637 iso_pu_bacteria 2513237144 2513907990 435
638 iso_pu_bacteria 2513237146 2513927646 435
639 iso_pu_bacteria 2513237162 2514020912 435
640 iso_pu_bacteria 2515075009 2515110511 435
641 iso_pu_bacteria 2515154113 2515636889 435
642 iso_pu_bacteria 2515154114 2515646808 435
643 iso_pu_bacteria 2515154116 2515659506 435
644 iso_pu_bacteria 2515154134 2515742979 435
645 iso_pu_bacteria 2516653077 2517039213 435
646 iso_pu_bacteria 2516653085 2517079456 435
647 iso_pu_bacteria 2517093000 2517093401 435
648 iso_pu_bacteria 2517287029 2517405098 435
649 iso_pu_bacteria 2524023209 2524457613 435
650 iso_pu_bacteria 2529292951 2530647695 435
651 iso_pu_bacteria 2534681796 2535515197 435
652 iso_pu_bacteria 2537561587 2537874352 435
653 iso_pu_bacteria 2554235003 2554246725 435
654 iso_pu_bacteria 2558860242 2559293952 435
655 iso_pu_bacteria 2582581294 2585203775 435
656 iso_pu_bacteria 2582581299 2585229085 435
657 iso_pu_bacteria 2582581307 2585275346 435
658 iso_pu_bacteria 2582581308 2585283473 435
659 iso_pu_bacteria 2582581315 2585325882 435
660 iso_pu_bacteria 2582581316 2585330054 435
661 iso_pu_bacteria 2582581867 2585398451 435
662 iso_pu_bacteria 2585427526 2585528413 435
663 iso_pu_bacteria 2585427527 2585536413 435
664 iso_pu_bacteria 2585427528 2585539806 435
665 iso_pu_bacteria 2585427530 2585556916 435
666 iso_pu_bacteria 2585427531 2585560211 435
667 iso_pu_bacteria 2585427590 2585819402 435
668 iso_pu_bacteria 2585427593 2585837787 435
669 iso_pu_bacteria 2585427594 2585844545 435
670 iso_pu_bacteria 2585427608 2585901522 435
671 iso_pu_bacteria 2585427609 2585905607 435
672 iso_pu_bacteria 2585428125 2587979277 435
673 iso_pu_bacteria 2599185170 2599419077 435
674 iso_pu_bacteria 2599185210 2599605505 435
675 iso_pu_bacteria 2600255279 2601609074 435
676 iso_pu_bacteria 2600255308 2601745849 435
677 iso_pu_bacteria 2615840624 2616295774 435
678 iso_pu_bacteria 2615840626 2616306226 435
679 iso_pu_bacteria 2615840698 2616553513 435
680 iso_pu_bacteria 2617270742 2617382569 435
681 iso_pu_bacteria 2643221582 2643921060 435
682 iso_pu_bacteria 2643221599 2644007447 435
683 iso_pu_bacteria 2643221643 2644241447 435
684 iso_pu_bacteria 2643221693 2644519133 435
685 iso_pu_bacteria 2667528174 2671112465 435
686 iso_pu_bacteria 2718217882 2719179674 435
687 iso_pu_bacteria 2718217927 2719384286 435
688 iso_pu_bacteria 2718217997 2719664020 435
689 iso_pu_bacteria 2718218009 2719730344 435
690 iso_pu_bacteria 2718218199 2720490439 435
691 iso_pu_bacteria 2718218232 2720611821 435
692 iso_pu_bacteria 2718218233 2720618676 435
693 iso_pu_bacteria 2718218235 2720630075 435
694 iso_pu_bacteria 2718218269 2720773770 435
695 iso_pu_bacteria 2718218363 2721145767 435
696 iso_pu_bacteria 2718218365 2721157299 435
697 iso_pu_bacteria 2718218366 2721162646 435
698 iso_pu_bacteria 2718218423 2721398000 435
699 iso_pu_bacteria 2721755514 2722838816 435
700 iso_pu_bacteria 2721755556 2723025440 435
701 iso_pu_bacteria 2721755684 2723559023 435
702 iso_pu_bacteria 2721755685 2723565630 435
703 iso_pu_bacteria 2721755809 2724036810 435
704 iso_pu_bacteria 2721755810 2724043100 435
705 iso_pu_bacteria 2721755819 2724088377 435
706 iso_pu_bacteria 2721755822 2724102895 435
707 iso_pu_bacteria 2721755823 2724108760 435
708 iso_pu_bacteria 2724679232 2725950136 435
709 iso_pu_bacteria 2728369352 2730106376 435
710 iso_pu_bacteria 2728369365 2730162911 435
711 iso_pu_bacteria 2728369397 2730296931 435
712 iso_pu_bacteria 2738541293 2738803728 435
713 iso_pu_bacteria 2738541333 2739034663 435
714 iso_pu_bacteria 2765235942 2766065589 435
715 iso_pu_bacteria 2775507266 2778174267 435
716 iso_pu_bacteria 2791355256 2793295109 435
717 iso_pu_bacteria 2791355259 2793315321 435
718 iso_pu_bacteria 2791355260 2793320176 435
719 iso_pu_bacteria 2791355261 2793326044 435
720 iso_pu_bacteria 2791355262 2793332537 435
721 iso_pu_bacteria 2791355263 2793343224 435
722 iso_pu_bacteria 2791355264 2793351019 435
723 iso_pu_bacteria 2791355265 2793353276 435
724 iso_pu_bacteria 2791355266 2793362657 435
725 iso_pu_bacteria 2791355267 2793364786 435
726 iso_pu_bacteria 2802429605 2805927479 435
727 iso_pu_bacteria 2802429606 2805932263 435
728 iso_pu_bacteria 2802429633 2806043962 435
729 iso_pu_bacteria 2802429634 2806052220 435
730 iso_pu_bacteria 2802429635 2806058521 435
731 iso_pu_bacteria 2802429636 2806067019 435
732 iso_pu_bacteria 2802429637 2806074762 435
733 iso_pu_bacteria 2808606387 2808986271 435
734 iso_pu_bacteria 2818991439 2819556403 435
735 iso_pu_bacteria 2818991448 2819608308 435
736 iso_pu_bacteria 2818991453 2819643427 435
737 iso_pu_bacteria 2838016132 2838022127 435
738 iso_pu_bacteria 2838022645 2838024539 435
739 iso_pu_bacteria 2838029111 2838029198 435
740 iso_pu_bacteria 2838035591 2838037236 435
741 iso_pu_bacteria 2838061910 2838066685 435
742 iso_pu_bacteria 2838068647 2838073740 435
743 iso_pu_bacteria 2838661181 2838663576 435
744 iso_pu_bacteria 2838668709 2838673169 435
745 iso_pu_bacteria 2838675328 2838677132 435
746 iso_pu_bacteria 2838686498 2838692640 435
747 iso_pu_bacteria 2838701080 2838703971 435
748 iso_pu_bacteria 2838714209 2838716019 435
749 iso_pu_bacteria 2838719591 2838720180 435
750 iso_pu_bacteria 2838724970 2838726772 435
751 iso_pu_bacteria 2838729681 2838732712 435
752 iso_pu_bacteria 2838742623 2838745607 435
753 iso_pu_bacteria 2841846520 2841847114 435
754 iso_pu_bacteria 2841851746 2841855251 435
755 iso_pu_bacteria 2841859092 2841860353 435
756 iso_pu_bacteria 2842110456 2842112319 435
757 iso_pu_bacteria 2842124991 2842126857 435
758 iso_pu_bacteria 2842130223 2842132025 435
759 iso_pu_bacteria 2842146304 2842148237 435
760 iso_pu_bacteria 2842152218 2842152806 435
761 iso_pu_bacteria 2842156927 2842161719 435
762 iso_pu_bacteria 2842163707 2842170122 435
763 iso_pu_bacteria 2842170452 2842172265 435
764 iso_pu_bacteria 2842175837 2842176425 435
765 iso_pu_bacteria 2842180545 2842185336 435
766 iso_pu_bacteria 2842187318 2842189127 435
767 iso_pu_bacteria 2842192696 2842193010 435
768 iso_pu_bacteria 2842198810 2842200356 435
769 iso_pu_bacteria 2842205361 2842206824 435
770 iso_pu_bacteria 2842211629 2842213441 435
771 iso_pu_bacteria 2842217011 2842218683 435
772 iso_pu_bacteria 2842224351 2842224941 435
773 iso_pu_bacteria 2842229732 2842233274 435
774 iso_pu_bacteria 2842243621 2842248722 435
775 iso_pu_bacteria 2842250916 2842253303 435
776 iso_pu_bacteria 2842257432 2842261865 435
777 iso_pu_bacteria 2842264693 2842267336 435
778 iso_pu_bacteria 2842271015 2842277071 435
779 iso_pu_bacteria 2842278818 2842280483 435
780 iso_pu_bacteria 2842285085 2842289433 435
781 iso_pu_bacteria 2842298080 2842300773 435
782 iso_pu_bacteria 2842304105 2842306372 435
783 iso_pu_bacteria 2842311132 2842312518 435
784 iso_pu_bacteria 2842317721 2842322549 435
785 iso_pu_bacteria 2842357229 2842358108 435
786 iso_pu_bacteria 2842395702 2842401278 435
787 iso_pu_bacteria 2842402390 2842406781 435
788 iso_pu_bacteria 2842409023 2842413722 435
789 iso_pu_bacteria 2842415677 2842420315 435
790 iso_pu_bacteria 2842422224 2842427188 435
791 iso_pu_bacteria 2842428310 2842431412 435
792 iso_pu_bacteria 2842434925 2842437747 435
793 iso_pu_bacteria 2842441272 2842444562 435
794 iso_pu_bacteria 2842447887 2842450310 435
795 iso_pu_bacteria 2842462802 2842465610 435
796 iso_pu_bacteria 2842469257 2842472420 435
797 iso_pu_bacteria 2842475841 2842476372 435
798 iso_pu_bacteria 2842482326 2842482446 435
799 iso_pu_bacteria 2842489311 2842492352 435
800 iso_pu_bacteria 2842495871 2842500917 435
801 iso_pu_bacteria 2842502639 2842502726 435
802 iso_pu_bacteria 2842509118 2842509302 435
803 iso_pu_bacteria 2842515876 2842517138 435
804 iso_pu_bacteria 2844454524 2844455866 435
805 iso_pu_bacteria 2857516855 2857522201 435
806 iso_pu_bacteria 2889790730 2889794935 435
807 iso_pu_bacteria 2889914905 2889918300 435
808 iso_pu_bacteria 2899792073 2899792420 435
809 iso_pu_bacteria 2899845264 2899846689 435
810 iso_pu_bacteria 2919114240 2919116223 435
811 iso_pu_bacteria 2919408235 2919408898 435
812 iso_pu_bacteria 2923556063 2923557294 435
813 iso_pu_bacteria 2926754445 2926757177 435
814 iso_pu_bacteria 2926760298 2926761394 435
815 iso_pu_bacteria 2933006813 2933007451 435
816 iso_pu_bacteria 2933011516 2933012219 435
817 iso_pu_bacteria 2933016740 2933022374 435
818 iso_pu_bacteria 2933570622 2933573441 435
819 iso_pu_bacteria 2933586486 2933587648 435
820 iso_pu_bacteria 2933594066 2933594662 435
821 iso_pu_bacteria 2933599457 2933604168 435
822 iso_pu_bacteria 2935894831 2935895786 435
823 iso_pu_bacteria 2935901341 2935907761 435
824 iso_pu_bacteria 2936367885 2936368808 435
825 iso_pu_bacteria 2936375103 2936377114 435
826 iso_pu_bacteria 2936381700 2936387351 435
827 iso_pu_bacteria 2979089926 2979093322 435
828 iso_pu_bacteria 2979095461 2979099294 435
829 iso_pu_bacteria 2979100975 2979105292 435
830 iso_pu_bacteria 2984509177 2984512852 435
831 iso_pu_bacteria 2984518228 2984520784 435
832 iso_pu_bacteria 2984537506 2984540079 435
833 iso_pu_bacteria 2984601300 2984602270 435
834 iso_pu_bacteria 2996887358 2996892084 435
835 iso_pu_bacteria 2996893221 2996893562 435
836 iso_pu_bacteria 3005416602 3005422714 435
837 iso_pu_bacteria 3005452660 3005452939 435
838 iso_pu_bacteria 639633055 639646784 435
839 iso_pu_bacteria 650716007 650739143 435
840 iso_pu_bacteria 8003570095 8003570149 435
841 iso_pu_bacteria 8005258706 8005263590 435
842 iso_pu_bacteria 8005275841 8005279001 435
843 iso_pu_bacteria 8005282627 8005283688 435
844 iso_pu_bacteria 8005289223 8005291817 435
845 iso_pu_bacteria 8005301065 8005303956 435
846 iso_pu_bacteria 8005307578 8005308774 435
847 iso_pu_bacteria 8005314921 8005321750 435
848 iso_pu_bacteria 8005321885 8005326611 435
849 iso_pu_bacteria 8005376324 8005377313 435
850 iso_pu_bacteria 8005382845 8005387183 435
851 iso_pu_bacteria 8005395548 8005401942 435
852 iso_pu_bacteria 8005430974 8005433038 435
853 iso_pu_bacteria 8005460587 8005461151 435
854 iso_pu_bacteria 8005484373 8005486044 435
855 iso_pu_bacteria 8005497431 8005498764 435
856 iso_pu_bacteria 8005542996 8005543875 435
857 iso_pu_bacteria 8005556819 8005560752 435
858 iso_pu_bacteria 8005563573 8005569734 435
859 iso_pu_bacteria 8005570704 8005577039 435
860 iso_pu_bacteria 8005619151 8005619958 435
861 iso_pu_bacteria 8005626139 8005628557 435
862 iso_pu_bacteria 8005645114 8005646571 435
863 iso_pu_bacteria 8005668836 8005670175 435
864 iso_pu_bacteria 8005682033 8005685017 435
865 iso_pu_bacteria 8005688590 8005690382 435
866 iso_pu_bacteria 8005695170 8005700264 435
867 iso_pu_bacteria 8018127388 8018133236 435
868 iso_pu_bacteria 8018150411 8018151738 435
869 iso_pu_bacteria 8018163183 8018167777 435
870 iso_pu_bacteria 8018176218 8018180203 435
871 iso_pu_bacteria 8023680758 8023684102 435
872 iso_pu_bacteria 8024479707 8024480407 435
873 iso_pu_bacteria 8024486573 8024489362 435
874 iso_pu_bacteria 8024501048 8024503570 435
875 iso_pu_bacteria 8046767195 8046771070 435
876 iso_pu_bacteria 8056375014 8056375743 435
877 iso_pu_bacteria 8056382006 8056386061 435
878 iso_pu_bacteria 8057575449 8057579836 435
879 iso_pu_bacteria 8057874678 8057881037 435
880 3300041404 Ga0439436_0005742 Ga0439436_0005742_1917_3227 436
881 3300042146 Ga0450907_008680 Ga0450907_008680_287_1597 436
882 3300042531 Ga0450918_004827 Ga0450918_004827_262_1572 436
883 iso_pu_bacteria 2510461069 2510839863 436
884 iso_pu_bacteria 2643221653 2644297462 436
885 iso_pu_bacteria 2643221719 2644655715 436
886 iso_pu_bacteria 2775507049 2776912249 436
887 iso_pu_bacteria 2818991461 2819684607 436
888 iso_pu_bacteria 2989776772 2989777616 436
889 iso_pu_bacteria 8005246636 8005247215 436
890 3300001989 JGI24739J22299_10032207 JGI24739J22299_100322073 437
891 3300002705 JGI25156J39149_1004645 JGI25156J39149_10046452 437
892 3300002741 JGI25157J39369_1002670 JGI25157J39369_10026702 437
893 3300002987 JGI25159J45721_1000021 JGI25159J45721_100002191 437
894 3300003214 JGI25165J46597_1000070 JGI25165J46597_100007094 437
895 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002384 437
896 3300003374 JGI25161J50226_1001568 JGI25161J50226_10015686 437
897 3300003762 Ga0055542_1000344 Ga0055542_100034413 437
898 3300003763 Ga0055529_1007055 Ga0055529_10070551 437
899 3300003775 Ga0055524_1001940 Ga0055524_10019405 437
900 3300003781 Ga0055536_1003131 Ga0055536_10031317 437
901 3300003781 Ga0055536_1007911 Ga0055536_10079114 437
902 3300003794 Ga0055531_10013431 Ga0055531_100134314 437
903 3300004625 Ga0055543_1000306 Ga0055543_10003064 437
904 3300005262 Ga0065165_1000058 Ga0065165_100005810 437
905 3300005539 Ga0068853_100007135 Ga0068853_1000071356 437
906 3300005548 Ga0070665_100038883 Ga0070665_1000388835 437
907 3300005563 Ga0068855_100245902 Ga0068855_1002459022 437
908 3300005577 Ga0068857_100106827 Ga0068857_1001068273 437
909 3300006038 Ga0075365_10003722 Ga0075365_100037222 437
910 3300006038 Ga0075365_10017983 Ga0075365_100179834 437
911 3300006038 Ga0075365_10050727 Ga0075365_100507272 437
912 3300006038 Ga0075365_10125496 Ga0075365_101254962 437
913 3300006051 Ga0075364_10000416 Ga0075364_1000041616 437
914 3300006178 Ga0075367_10045013 Ga0075367_100450133 437
915 3300006178 Ga0075367_10054584 Ga0075367_100545842 437
916 3300006186 Ga0075369_10007943 Ga0075369_100079435 437
917 3300009148 Ga0105243_10049161 Ga0105243_100491612 437
918 3300009545 Ga0105237_10014009 Ga0105237_100140097 437
919 3300009551 Ga0105238_10006570 Ga0105238_100065705 437
920 3300013102 Ga0157371_10008296 Ga0157371_100082962 437
921 3300013104 Ga0157370_10163277 Ga0157370_101632772 437
922 3300013105 Ga0157369_10280081 Ga0157369_102800811 437
923 3300013249 Ga0171463_1001 Ga0171463_1001597 437
924 3300014497 Ga0182008_10072680 Ga0182008_100726802 437
925 3300015262 Ga0182007_10022213 Ga0182007_100222132 437
926 3300015690 Ga0183363_1186 Ga0183363_11867 437
927 3300021320 Ga0214544_1000008 Ga0214544_1000008263 437
928 3300021321 Ga0214542_1000010 Ga0214542_1000010220 437
929 3300021327 Ga0214543_1000003 Ga0214543_1000003128 437
930 3300021327 Ga0214543_1000004 Ga0214543_1000004242 437
931 3300022739 Ga0228711_1000137 Ga0228711_100013747 437
932 3300022740 Ga0228710_1000031 Ga0228710_100003116 437
933 3300025208 Ga0209436_100128 Ga0209436_1001285 437
934 3300025250 Ga0209026_1000002 Ga0209026_10000021047 437
935 3300025254 Ga0209148_1000123 Ga0209148_1000123150 437
936 3300025256 Ga0209759_1000381 Ga0209759_100038136 437
937 3300025261 Ga0209233_1000131 Ga0209233_1000131108 437
938 3300025272 Ga0209455_1000129 Ga0209455_1000129119 437
939 3300025284 Ga0209130_1000008 Ga0209130_1000008160 437
940 3300025292 Ga0209676_1008200 Ga0209676_10082003 437
941 3300025294 Ga0209025_1000118 Ga0209025_100011819 437
942 3300025294 Ga0209025_1000956 Ga0209025_100095615 437
943 3300025295 Ga0209564_1000091 Ga0209564_100009172 437
944 3300025297 Ga0209758_1007462 Ga0209758_10074627 437
945 3300025299 Ga0209256_1000169 Ga0209256_1000169106 437
946 3300025299 Ga0209256_1002377 Ga0209256_10023779 437
947 3300025302 Ga0207426_1000016 Ga0207426_1000016401 437
948 3300025303 Ga0209051_1010007 Ga0209051_10100073 437
949 3300025304 Ga0209257_1004315 Ga0209257_10043156 437
950 3300025904 Ga0207647_10005582 Ga0207647_100055822 437
951 3300025904 Ga0207647_10033555 Ga0207647_100335553 437
952 3300025913 Ga0207695_10078835 Ga0207695_100788352 437
953 3300025914 Ga0207671_10006724 Ga0207671_100067243 437
954 3300025924 Ga0207694_10008378 Ga0207694_100083785 437
955 3300025949 Ga0207667_10133513 Ga0207667_101335132 437
956 3300026041 Ga0207639_10003928 Ga0207639_100039283 437
957 3300026078 Ga0207702_10073938 Ga0207702_100739383 437
958 3300026116 Ga0207674_10060733 Ga0207674_100607334 437
959 3300026116 Ga0207674_10087471 Ga0207674_100874714 437
960 3300026142 Ga0207698_10075067 Ga0207698_100750672 437
961 3300027111 Ga0209281_1000155 Ga0209281_100015517 437
962 3300027111 Ga0209281_1001059 Ga0209281_100105918 437
963 3300027666 Ga0209282_1000025 Ga0209282_1000025147 437
964 3300028379 Ga0268266_10089010 Ga0268266_100890104 437
965 3300028379 Ga0268266_10111561 Ga0268266_101115611 437
966 3300028379 Ga0268266_10193345 Ga0268266_101933452 437
967 3300028794 Ga0307515_10000154 Ga0307515_1000015475 437
968 3300028794 Ga0307515_10043638 Ga0307515_100436385 437
969 3300031456 Ga0307513_10001054 Ga0307513_1000105417 437
970 3300031911 Ga0307412_10049598 Ga0307412_100495982 437
971 3300031967 Ga0315914_1000620 Ga0315914_100062027 437
972 3300031995 Ga0307409_100031636 Ga0307409_1000316364 437
973 3300033430 Ga0315913_1000150 Ga0315913_100015017 437
974 3300033464 Ga0315915_1000015 Ga0315915_100001516 437
975 3300037312 Ga0395899_0000073 Ga0395899_0000073_143899_145215 437
976 3300037312 Ga0395899_0055606 Ga0395899_0055606_234_1550 437
977 3300037418 Ga0395900_0000027 Ga0395900_0000027_248469_249785 437
978 3300037418 Ga0395900_0027451 Ga0395900_0027451_2895_4211 437
979 3300037418 Ga0395900_0173782 Ga0395900_0173782_161_1477 437
980 3300037466 Ga0395898_0000255 Ga0395898_0000255_93529_94845 437
981 3300037471 Ga0395905_0000032 Ga0395905_0000032_36148_37464 437
982 3300038443 Ga0395901_0000110 Ga0395901_0000110_36173_37489 437
983 3300038443 Ga0395901_0014679 Ga0395901_0014679_3177_4493 437
984 3300038443 Ga0395901_0034079 Ga0395901_0034079_3293_4609 437
985 3300042007 Ga0439449_0029318 Ga0439449_0029318_276_1589 437
986 3300046515 Ga0495620_0045964 Ga0495620_0045964_259_1575 437
987 3300047443 Ga0495687_041534 Ga0495687_041534_266_1582 437
988 3300048915 Ga0496112_0004721 Ga0496112_0004721_7257_8573 437
989 3300048919 Ga0496116_0000080 Ga0496116_0000080_83121_84437 437
990 3300048920 Ga0496117_0002938 Ga0496117_0002938_11064_12380 437
991 3300048920 Ga0496117_0065162 Ga0496117_0065162_294_1610 437
992 3300048921 Ga0496118_0036260 Ga0496118_0036260_998_2314 437
993 3300048922 Ga0496119_0053279 Ga0496119_0053279_532_1848 437
994 3300048922 Ga0496119_0074573 Ga0496119_0074573_575_1891 437
995 3300048923 Ga0496120_0001808 Ga0496120_0001808_19729_21045 437
996 3300048924 Ga0496121_0000459 Ga0496121_0000459_20073_21389 437
997 3300048924 Ga0496121_0063677 Ga0496121_0063677_642_1958 437
998 3300048925 Ga0496122_0000247 Ga0496122_0000247_66824_68140 437
999 3300048925 Ga0496122_0002082 Ga0496122_0002082_16053_17369 437
1000 3300048926 Ga0496123_0000222 Ga0496123_0000222_66485_67801 437
1001 3300048927 Ga0496124_0000063 Ga0496124_0000063_29474_30790 437
1002 3300048927 Ga0496124_0000592 Ga0496124_0000592_47496_48812 437
1003 3300048928 Ga0496125_0000557 Ga0496125_0000557_47379_48695 437
1004 3300048928 Ga0496125_0057046 Ga0496125_0057046_1837_3153 437
1005 3300048928 Ga0496125_0085081 Ga0496125_0085081_289_1605 437
1006 3300048928 Ga0496125_0157560 Ga0496125_0157560_78_1394 437
1007 3300048929 Ga0496126_0000438 Ga0496126_0000438_69542_70858 437
1008 3300048929 Ga0496126_0001405 Ga0496126_0001405_7097_8413 437
1009 3300049569 Ga0501032_0051622 Ga0501032_0051622_779_2095 437
1010 3300049570 Ga0501033_0008539 Ga0501033_0008539_6345_7661 437
1011 3300049571 Ga0501034_0006126 Ga0501034_0006126_5231_6547 437
1012 3300049573 Ga0501037_0029877 Ga0501037_0029877_150_1466 437
1013 3300049578 Ga0501042_0031541 Ga0501042_0031541_1850_3166 437
1014 3300049580 Ga0501046_0007521 Ga0501046_0007521_6992_8308 437
1015 3300049581 Ga0501047_0164809 Ga0501047_0164809_377_1693 437
1016 3300049586 Ga0501070_0057259 Ga0501070_0057259_1593_2909 437
1017 3300049586 Ga0501070_0087750 Ga0501070_0087750_310_1626 437
1018 3300049587 Ga0501071_0041718 Ga0501071_0041718_37_1353 437
1019 3300049590 Ga0501074_0017250 Ga0501074_0017250_2693_4009 437
1020 3300049822 Ga0501035_0076851 Ga0501035_0076851_779_2095 437
1021 3300049823 Ga0501044_0030478 Ga0501044_0030478_2309_3625 437
1022 3300050491 nmdc:mga00v17_690_c1 nmdc:mga00v17_690_c1_5657_6973 437
1023 3300050492 nmdc:mga0yw44_79671_c1 nmdc:mga0yw44_79671_c1_150_1466 437
1024 3300050494 nmdc:mga06z11_69452_c1 nmdc:mga06z11_69452_c1_325_1641 437
1025 3300050516 nmdc:mga0sz30_11731_c1 nmdc:mga0sz30_11731_c1_93_1409 437
1026 3300053083 Ga0495655_0004667 Ga0495655_0004667_529_1845 437
1027 3300053087 Ga0500643_018034 Ga0500643_018034_590_1906 437
1028 3300053139 Ga0500568_0000048 Ga0500568_0000048_67108_68424 437
1029 3300053155 Ga0500620_000553 Ga0500620_000553_515_1831 437
1030 3300053158 Ga0500627_0061574 Ga0500627_0061574_69_1385 437
1031 3300053161 Ga0500634_0000129 Ga0500634_0000129_22143_23459 437
1032 3300053177 Ga0500636_0000010 Ga0500636_0000010_31617_32933 437
1033 iso_pu_bacteria 2599185236 2599719459 437
1034 iso_pu_bacteria 2791355082 2792583846 437
1035 iso_pu_bacteria 2821123053 2821123738 437
1036 iso_pu_bacteria 2838736955 2838739232 437
1037 iso_pu_bacteria 2841840854 2841843130 437
1038 iso_pu_bacteria 2842140634 2842142912 437
1039 iso_pu_bacteria 2857531043 2857531300 437
1040 iso_pu_bacteria 2968138860 2968145495 437
1041 iso_pu_bacteria 8004695233 8004702987 437
1042 iso_pu_bacteria 8049293176 8049293589 437
1043 3300002773 JGI25152J39213_1001977 JGI25152J39213_10019771 438
1044 3300003792 Ga0055540_1004730 Ga0055540_10047305 438
1045 3300003794 Ga0055531_10001859 Ga0055531_100018593 438
1046 3300005262 Ga0065165_1004713 Ga0065165_10047137 438
1047 3300005262 Ga0065165_1010993 Ga0065165_10109932 438
1048 3300005539 Ga0068853_100154814 Ga0068853_1001548141 438
1049 3300005983 Ga0081540_1012530 Ga0081540_10125304 438
1050 3300006038 Ga0075365_10059189 Ga0075365_100591894 438
1051 3300006051 Ga0075364_10033396 Ga0075364_100333963 438
1052 3300025258 Ga0209129_1000407 Ga0209129_100040723 438
1053 3300025273 Ga0209673_1000015 Ga0209673_1000015258 438
1054 3300025294 Ga0209025_1005096 Ga0209025_10050962 438
1055 3300025295 Ga0209564_1012297 Ga0209564_10122972 438
1056 3300025299 Ga0209256_1001975 Ga0209256_10019754 438
1057 3300025303 Ga0209051_1041554 Ga0209051_10415541 438
1058 3300025925 Ga0207650_10002037 Ga0207650_1000203711 438
1059 3300046507 Ga0495606_0021406 Ga0495606_0021406_940_2304 438
1060 3300047472 Ga0495686_0001812 Ga0495686_0001812_9936_11252 438
1061 3300047472 Ga0495686_0049030 Ga0495686_0049030_212_1528 438
1062 3300048917 Ga0496114_0038222 Ga0496114_0038222_1628_2992 438
1063 3300048920 Ga0496117_0052801 Ga0496117_0052801_933_2252 438
1064 3300048921 Ga0496118_0045335 Ga0496118_0045335_389_1708 438
1065 3300048923 Ga0496120_0051187 Ga0496120_0051187_748_2067 438
1066 3300048924 Ga0496121_0000001 Ga0496121_0000001_504715_506034 438
1067 3300048925 Ga0496122_0000009 Ga0496122_0000009_421702_423039 438
1068 3300048926 Ga0496123_0000020 Ga0496123_0000020_226154_227491 438
1069 3300048927 Ga0496124_0039327 Ga0496124_0039327_163_1500 438
1070 3300048928 Ga0496125_0000001 Ga0496125_0000001_616797_618116 438
1071 3300049568 Ga0501031_0015024 Ga0501031_0015024_756_2075 438
1072 3300049569 Ga0501032_0000116 Ga0501032_0000116_11182_12501 438
1073 3300049570 Ga0501033_0001994 Ga0501033_0001994_3256_4575 438
1074 3300049571 Ga0501034_0003453 Ga0501034_0003453_2307_3626 438
1075 3300049571 Ga0501034_0004432 Ga0501034_0004432_11054_12373 438
1076 3300049571 Ga0501034_0025197 Ga0501034_0025197_1650_2969 438
1077 3300049572 Ga0501036_0000117 Ga0501036_0000117_1132_2451 438
1078 3300049573 Ga0501037_0000108 Ga0501037_0000108_26096_27415 438
1079 3300049574 Ga0501038_0000126 Ga0501038_0000126_11054_12373 438
1080 3300049575 Ga0501039_0000003 Ga0501039_0000003_177176_178495 438
1081 3300049575 Ga0501039_0056119 Ga0501039_0056119_449_1768 438
1082 3300049577 Ga0501041_0020926 Ga0501041_0020926_1895_3214 438
1083 3300049579 Ga0501043_0000140 Ga0501043_0000140_61668_62987 438
1084 3300049581 Ga0501047_0100696 Ga0501047_0100696_769_2088 438
1085 3300049776 Ga0501280_002482 Ga0501280_002482_740_2065 438
1086 3300049822 Ga0501035_0001153 Ga0501035_0001153_3384_4703 438
1087 3300049823 Ga0501044_0040211 Ga0501044_0040211_499_1818 438
1088 3300050491 nmdc:mga00v17_40101_c1 nmdc:mga00v17_40101_c1_370_1689 438
1089 3300053140 Ga0500573_0000746 Ga0500573_0000746_12159_13478 438
1090 iso_pu_bacteria 2585427633 2585994576 438
1091 iso_pu_bacteria 2585427634 2585999064 438
1092 iso_pu_bacteria 2937843397 2937844251 438
1093 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006228 439
1094 3300002705 JGI25156J39149_1000019 JGI25156J39149_100001919 439
1095 3300002737 JGI25162J39368_1000177 JGI25162J39368_100017761 439
1096 3300002737 JGI25162J39368_1000381 JGI25162J39368_100038115 439
1097 3300002738 JGI25154J39366_1000177 JGI25154J39366_100017719 439
1098 3300002741 JGI25157J39369_1000024 JGI25157J39369_1000024145 439
1099 3300002773 JGI25152J39213_1000299 JGI25152J39213_100029927 439
1100 3300002773 JGI25152J39213_1002166 JGI25152J39213_10021665 439
1101 3300002774 JGI25150J39212_1000042 JGI25150J39212_100004257 439
1102 3300002987 JGI25159J45721_1001496 JGI25159J45721_10014968 439
1103 3300003187 JGI25151J46595_10000099 JGI25151J46595_1000009922 439
1104 3300003187 JGI25151J46595_10000707 JGI25151J46595_100007075 439
1105 3300003187 JGI25151J46595_10009360 JGI25151J46595_100093604 439
1106 3300003203 JGI25406J46586_10010757 JGI25406J46586_100107575 439
1107 3300003214 JGI25165J46597_1000480 JGI25165J46597_100048018 439
1108 3300003214 JGI25165J46597_1001692 JGI25165J46597_10016922 439
1109 3300003215 JGI25153J46596_10007987 JGI25153J46596_100079873 439
1110 3300003215 JGI25153J46596_10009490 JGI25153J46596_100094902 439
1111 3300003320 rootH2_10081828 rootH2_100818283 439
1112 3300003322 rootL2_10006203 rootL2_100062034 439
1113 3300003323 rootH1_10006221 rootH1_100062214 439
1114 3300003323 rootH1_10080966 rootH1_100809663 439
1115 3300003354 JGI25160J50197_1000046 JGI25160J50197_10000467 439
1116 3300003354 JGI25160J50197_1008028 JGI25160J50197_10080284 439
1117 3300003374 JGI25161J50226_1000031 JGI25161J50226_10000317 439
1118 3300003771 Ga0055526_1003166 Ga0055526_10031664 439
1119 3300003775 Ga0055524_1004569 Ga0055524_10045694 439
1120 3300003790 Ga0055528_1002755 Ga0055528_10027554 439
1121 3300003790 Ga0055528_1019902 Ga0055528_10199022 439
1122 3300003792 Ga0055540_1000269 Ga0055540_100026911 439
1123 3300003792 Ga0055540_1007822 Ga0055540_10078222 439
1124 3300003856 Ga0058692_1002755 Ga0058692_10027553 439
1125 3300003856 Ga0058692_1010264 Ga0058692_10102641 439
1126 3300004625 Ga0055543_1000278 Ga0055543_100027828 439
1127 3300004625 Ga0055543_1004016 Ga0055543_10040163 439
1128 3300005262 Ga0065165_1000693 Ga0065165_10006938 439
1129 3300005262 Ga0065165_1013516 Ga0065165_10135163 439
1130 3300005347 Ga0070668_100042434 Ga0070668_1000424342 439
1131 3300005355 Ga0070671_100043211 Ga0070671_1000432113 439
1132 3300005455 Ga0070663_100011297 Ga0070663_1000112972 439
1133 3300005455 Ga0070663_100133810 Ga0070663_1001338101 439
1134 3300005548 Ga0070665_100040022 Ga0070665_1000400225 439
1135 3300005548 Ga0070665_100059703 Ga0070665_1000597033 439
1136 3300005548 Ga0070665_100151867 Ga0070665_1001518672 439
1137 3300005563 Ga0068855_100109516 Ga0068855_1001095164 439
1138 3300005985 Ga0081539_10003940 Ga0081539_100039405 439
1139 3300006038 Ga0075365_10007235 Ga0075365_100072355 439
1140 3300006038 Ga0075365_10052489 Ga0075365_100524893 439
1141 3300006042 Ga0075368_10001844 Ga0075368_100018445 439
1142 3300006048 Ga0075363_100041351 Ga0075363_1000413512 439
1143 3300006048 Ga0075363_100122317 Ga0075363_1001223171 439
1144 3300006177 Ga0075362_10017477 Ga0075362_100174771 439
1145 3300006177 Ga0075362_10022993 Ga0075362_100229932 439
1146 3300006178 Ga0075367_10012811 Ga0075367_100128114 439
1147 3300006186 Ga0075369_10000599 Ga0075369_100005998 439
1148 3300006186 Ga0075369_10012428 Ga0075369_100124283 439
1149 3300006353 Ga0075370_10007858 Ga0075370_100078584 439
1150 3300006948 Ga0099826_10000327 Ga0099826_1000032716 439
1151 3300006948 Ga0099826_10029864 Ga0099826_100298644 439
1152 3300009092 Ga0105250_10008165 Ga0105250_100081655 439
1153 3300009093 Ga0105240_10003684 Ga0105240_100036843 439
1154 3300009148 Ga0105243_10018026 Ga0105243_100180264 439
1155 3300009545 Ga0105237_10002476 Ga0105237_100024765 439
1156 3300010375 Ga0105239_10003906 Ga0105239_1000390614 439
1157 3300013100 Ga0157373_10020610 Ga0157373_100206104 439
1158 3300013102 Ga0157371_10000058 Ga0157371_1000005898 439
1159 3300013104 Ga0157370_10000030 Ga0157370_10000030121 439
1160 3300013104 Ga0157370_10003932 Ga0157370_1000393212 439
1161 3300014497 Ga0182008_10008080 Ga0182008_100080804 439
1162 3300015262 Ga0182007_10000598 Ga0182007_1000059811 439
1163 3300015265 Ga0182005_1006003 Ga0182005_10060034 439
1164 3300025206 Ga0209435_100011 Ga0209435_100011225 439
1165 3300025233 Ga0209437_100036 Ga0209437_100036126 439
1166 3300025233 Ga0209437_100086 Ga0209437_100086124 439
1167 3300025245 Ga0207425_1000012 Ga0207425_1000012442 439
1168 3300025245 Ga0207425_1003062 Ga0207425_10030625 439
1169 3300025246 Ga0209646_1000024 Ga0209646_1000024186 439
1170 3300025250 Ga0209026_1000030 Ga0209026_1000030186 439
1171 3300025253 Ga0209677_100862 Ga0209677_1008622 439
1172 3300025256 Ga0209759_1000011 Ga0209759_1000011225 439
1173 3300025258 Ga0209129_1000086 Ga0209129_1000086100 439
1174 3300025258 Ga0209129_1000606 Ga0209129_100060622 439
1175 3300025258 Ga0209129_1007997 Ga0209129_10079973 439
1176 3300025261 Ga0209233_1000110 Ga0209233_1000110123 439
1177 3300025261 Ga0209233_1000166 Ga0209233_1000166126 439
1178 3300025261 Ga0209233_1000390 Ga0209233_100039012 439
1179 3300025273 Ga0209673_1000091 Ga0209673_1000091134 439
1180 3300025273 Ga0209673_1003094 Ga0209673_10030945 439
1181 3300025273 Ga0209673_1004627 Ga0209673_10046274 439
1182 3300025273 Ga0209673_1015431 Ga0209673_10154312 439
1183 3300025284 Ga0209130_1000312 Ga0209130_10003128 439
1184 3300025294 Ga0209025_1000024 Ga0209025_1000024442 439
1185 3300025294 Ga0209025_1000549 Ga0209025_100054956 439
1186 3300025294 Ga0209025_1000980 Ga0209025_100098032 439
1187 3300025294 Ga0209025_1009494 Ga0209025_10094946 439
1188 3300025294 Ga0209025_1017886 Ga0209025_10178862 439
1189 3300025295 Ga0209564_1000742 Ga0209564_100074218 439
1190 3300025295 Ga0209564_1003340 Ga0209564_10033403 439
1191 3300025295 Ga0209564_1008708 Ga0209564_10087083 439
1192 3300025297 Ga0209758_1000046 Ga0209758_1000046100 439
1193 3300025297 Ga0209758_1000325 Ga0209758_100032568 439
1194 3300025297 Ga0209758_1008441 Ga0209758_10084416 439
1195 3300025299 Ga0209256_1000858 Ga0209256_100085826 439
1196 3300025299 Ga0209256_1005090 Ga0209256_10050904 439
1197 3300025299 Ga0209256_1005247 Ga0209256_10052476 439
1198 3300025302 Ga0207426_1000012 Ga0207426_10000128 439
1199 3300025302 Ga0207426_1000063 Ga0207426_1000063105 439
1200 3300025302 Ga0207426_1000457 Ga0207426_100045727 439
1201 3300025303 Ga0209051_1000084 Ga0209051_100008425 439
1202 3300025303 Ga0209051_1004764 Ga0209051_10047645 439
1203 3300025303 Ga0209051_1014165 Ga0209051_10141654 439
1204 3300025304 Ga0209257_1005237 Ga0209257_10052373 439
1205 3300025913 Ga0207695_10003123 Ga0207695_1000312319 439
1206 3300025914 Ga0207671_10000176 Ga0207671_1000017640 439
1207 3300025932 Ga0207690_10077815 Ga0207690_100778152 439
1208 3300026067 Ga0207678_10009958 Ga0207678_100099584 439
1209 3300026067 Ga0207678_10059370 Ga0207678_100593702 439
1210 3300027312 Ga0209371_1000009 Ga0209371_1000009344 439
1211 3300027312 Ga0209371_1001145 Ga0209371_100114515 439
1212 3300027312 Ga0209371_1002735 Ga0209371_10027356 439
1213 3300027666 Ga0209282_1000908 Ga0209282_10009086 439
1214 3300027666 Ga0209282_1022896 Ga0209282_10228962 439
1215 3300028379 Ga0268266_10028826 Ga0268266_100288263 439
1216 3300028379 Ga0268266_10090430 Ga0268266_100904303 439
1217 3300028794 Ga0307515_10006246 Ga0307515_1000624622 439
1218 3300030500 Ga0268256_1000010 Ga0268256_1000010343 439
1219 3300030500 Ga0268256_1003517 Ga0268256_10035175 439
1220 3300030500 Ga0268256_1015207 Ga0268256_10152071 439
1221 3300031548 Ga0307408_100089591 Ga0307408_1000895911 439
1222 3300031901 Ga0307406_10083835 Ga0307406_100838352 439
1223 3300031911 Ga0307412_10007356 Ga0307412_100073562 439
1224 3300041413 Ga0439465_0002164 Ga0439465_0002164_3751_5070 439
1225 3300044694 Ga0466963_0002783 Ga0466963_0002783_1853_3172 439
1226 3300045836 Ga0466958_0007058 Ga0466958_0007058_1042_2361 439
1227 3300046459 Ga0495629_0014910 Ga0495629_0014910_2776_4098 439
1228 3300046460 Ga0495638_0001215 Ga0495638_0001215_18569_19888 439
1229 3300046474 Ga0495605_0001185 Ga0495605_0001185_15704_17023 439
1230 3300046476 Ga0495662_0015369 Ga0495662_0015369_1818_3140 439
1231 3300046492 Ga0495585_0001367 Ga0495585_0001367_11178_12497 439
1232 3300046506 Ga0495583_0001517 Ga0495583_0001517_4081_5400 439
1233 3300046506 Ga0495583_0013986 Ga0495583_0013986_2456_3775 439
1234 3300046515 Ga0495620_0041739 Ga0495620_0041739_357_1676 439
1235 3300046518 Ga0495631_0000622 Ga0495631_0000622_20913_22232 439
1236 3300046519 Ga0495632_0025761 Ga0495632_0025761_1414_2733 439
1237 3300046538 Ga0495609_0027309 Ga0495609_0027309_915_2234 439
1238 3300046557 Ga0495622_0004894 Ga0495622_0004894_2516_3838 439
1239 3300046616 Ga0495668_0001429 Ga0495668_0001429_7838_9157 439
1240 3300046642 Ga0495634_0113523 Ga0495634_0113523_286_1608 439
1241 3300046660 Ga0495625_0001674 Ga0495625_0001674_14802_16121 439
1242 3300046663 Ga0495635_0009879 Ga0495635_0009879_2963_4285 439
1243 3300046674 Ga0495588_0001635 Ga0495588_0001635_5704_7026 439
1244 3300046674 Ga0495588_0009713 Ga0495588_0009713_1337_2659 439
1245 3300046674 Ga0495588_0026724 Ga0495588_0026724_251_1570 439
1246 3300046675 Ga0495657_0011072 Ga0495657_0011072_1957_3279 439
1247 3300046692 Ga0495671_0025493 Ga0495671_0025493_858_2180 439
1248 3300047320 Ga0495672_0003865 Ga0495672_0003865_9287_10606 439
1249 3300047470 Ga0495681_0005896 Ga0495681_0005896_4783_6105 439
1250 3300048907 Ga0496104_0321642 Ga0496104_0321642_49_1371 439
1251 3300048916 Ga0496113_0130227 Ga0496113_0130227_42_1364 439
1252 3300048919 Ga0496116_0002774 Ga0496116_0002774_1269_2588 439
1253 3300048919 Ga0496116_0004619 Ga0496116_0004619_29_1348 439
1254 3300048919 Ga0496116_0004929 Ga0496116_0004929_10135_11454 439
1255 3300048919 Ga0496116_0006070 Ga0496116_0006070_2767_4086 439
1256 3300048920 Ga0496117_0000002 Ga0496117_0000002_1863917_1865239 439
1257 3300048920 Ga0496117_0003435 Ga0496117_0003435_5837_7156 439
1258 3300048920 Ga0496117_0004016 Ga0496117_0004016_13302_14621 439
1259 3300048920 Ga0496117_0028812 Ga0496117_0028812_125_1444 439
1260 3300048920 Ga0496117_0072659 Ga0496117_0072659_851_2173 439
1261 3300048921 Ga0496118_0001656 Ga0496118_0001656_17282_18604 439
1262 3300048921 Ga0496118_0002528 Ga0496118_0002528_15003_16322 439
1263 3300048921 Ga0496118_0004982 Ga0496118_0004982_1969_3288 439
1264 3300048921 Ga0496118_0015790 Ga0496118_0015790_5479_6798 439
1265 3300048922 Ga0496119_0003135 Ga0496119_0003135_3184_4503 439
1266 3300048922 Ga0496119_0012020 Ga0496119_0012020_1284_2606 439
1267 3300048922 Ga0496119_0053616 Ga0496119_0053616_491_1810 439
1268 3300048923 Ga0496120_0000021 Ga0496120_0000021_201336_202658 439
1269 3300048923 Ga0496120_0004424 Ga0496120_0004424_938_2257 439
1270 3300048924 Ga0496121_0001940 Ga0496121_0001940_13560_14879 439
1271 3300048924 Ga0496121_0016156 Ga0496121_0016156_6370_7689 439
1272 3300048924 Ga0496121_0022977 Ga0496121_0022977_2659_3978 439
1273 3300048925 Ga0496122_0000001 Ga0496122_0000001_1234707_1236029 439
1274 3300048925 Ga0496122_0006417 Ga0496122_0006417_143_1462 439
1275 3300048925 Ga0496122_0006956 Ga0496122_0006956_10122_11489 439
1276 3300048925 Ga0496122_0013353 Ga0496122_0013353_143_1462 439
1277 3300048926 Ga0496123_0000001 Ga0496123_0000001_1238438_1239760 439
1278 3300048926 Ga0496123_0011146 Ga0496123_0011146_143_1462 439
1279 3300048926 Ga0496123_0013913 Ga0496123_0013913_3280_4599 439
1280 3300048926 Ga0496123_0111412 Ga0496123_0111412_143_1462 439
1281 3300048927 Ga0496124_0002394 Ga0496124_0002394_472_1791 439
1282 3300048927 Ga0496124_0009274 Ga0496124_0009274_69_1388 439
1283 3300048927 Ga0496124_0010148 Ga0496124_0010148_6386_7708 439
1284 3300048927 Ga0496124_0038494 Ga0496124_0038494_2127_3446 439
1285 3300048927 Ga0496124_0055913 Ga0496124_0055913_1945_3264 439
1286 3300048927 Ga0496124_0098010 Ga0496124_0098010_648_1967 439
1287 3300048928 Ga0496125_0005358 Ga0496125_0005358_12350_13669 439
1288 3300048928 Ga0496125_0007390 Ga0496125_0007390_9486_10808 439
1289 3300048929 Ga0496126_0052716 Ga0496126_0052716_729_2048 439
1290 3300049568 Ga0501031_0000037 Ga0501031_0000037_28377_29699 439
1291 3300049569 Ga0501032_0000081 Ga0501032_0000081_28621_29943 439
1292 3300049569 Ga0501032_0159737 Ga0501032_0159737_22_1344 439
1293 3300049570 Ga0501033_0000097 Ga0501033_0000097_62488_63810 439
1294 3300049570 Ga0501033_0000501 Ga0501033_0000501_8244_9566 439
1295 3300049570 Ga0501033_0003939 Ga0501033_0003939_9009_10331 439
1296 3300049570 Ga0501033_0040448 Ga0501033_0040448_1723_3045 439
1297 3300049570 Ga0501033_0099030 Ga0501033_0099030_737_2059 439
1298 3300049571 Ga0501034_0000186 Ga0501034_0000186_52689_54011 439
1299 3300049572 Ga0501036_0000002 Ga0501036_0000002_229299_230621 439
1300 3300049573 Ga0501037_0000095 Ga0501037_0000095_28649_29971 439
1301 3300049573 Ga0501037_0000451 Ga0501037_0000451_9104_10426 439
1302 3300049574 Ga0501038_0000002 Ga0501038_0000002_35848_37170 439
1303 3300049574 Ga0501038_0031440 Ga0501038_0031440_2827_4149 439
1304 3300049574 Ga0501038_0098426 Ga0501038_0098426_747_2069 439
1305 3300049575 Ga0501039_0000002 Ga0501039_0000002_311343_312665 439
1306 3300049576 Ga0501040_0004757 Ga0501040_0004757_1149_2471 439
1307 3300049579 Ga0501043_0000081 Ga0501043_0000081_44422_45744 439
1308 3300049579 Ga0501043_0000162 Ga0501043_0000162_28177_29499 439
1309 3300049579 Ga0501043_0046250 Ga0501043_0046250_1684_3006 439
1310 3300049581 Ga0501047_0001069 Ga0501047_0001069_12777_14099 439
1311 3300049581 Ga0501047_0020656 Ga0501047_0020656_216_1538 439
1312 3300049581 Ga0501047_0084377 Ga0501047_0084377_312_1634 439
1313 3300049581 Ga0501047_0150278 Ga0501047_0150278_434_1756 439
1314 3300049581 Ga0501047_0245424 Ga0501047_0245424_197_1519 439
1315 3300049585 Ga0501069_0000118 Ga0501069_0000118_9995_11317 439
1316 3300049586 Ga0501070_0000127 Ga0501070_0000127_64043_65365 439
1317 3300049586 Ga0501070_0002038 Ga0501070_0002038_13230_14552 439
1318 3300049586 Ga0501070_0010186 Ga0501070_0010186_5993_7315 439
1319 3300049586 Ga0501070_0044569 Ga0501070_0044569_711_2033 439
1320 3300049586 Ga0501070_0079084 Ga0501070_0079084_744_2066 439
1321 3300049589 Ga0501073_0031877 Ga0501073_0031877_289_1611 439
1322 3300049590 Ga0501074_0000062 Ga0501074_0000062_21727_23049 439
1323 3300049742 Ga0501080_0000254 Ga0501080_0000254_31766_33088 439
1324 3300049744 Ga0501083_0000453 Ga0501083_0000453_23148_24470 439
1325 3300049744 Ga0501083_0032262 Ga0501083_0032262_1307_2629 439
1326 3300049822 Ga0501035_0000017 Ga0501035_0000017_225541_226863 439
1327 3300049822 Ga0501035_0000100 Ga0501035_0000100_43512_44834 439
1328 3300049822 Ga0501035_0001764 Ga0501035_0001764_13178_14500 439
1329 3300049823 Ga0501044_0000002 Ga0501044_0000002_62488_63810 439
1330 3300049823 Ga0501044_0000751 Ga0501044_0000751_9122_10444 439
1331 3300049823 Ga0501044_0044749 Ga0501044_0044749_1921_3243 439
1332 3300049823 Ga0501044_0056676 Ga0501044_0056676_312_1634 439
1333 3300049823 Ga0501044_0090220 Ga0501044_0090220_1196_2518 439
1334 3300049823 Ga0501044_0110800 Ga0501044_0110800_1394_2716 439
1335 3300050491 nmdc:mga00v17_90_c1 nmdc:mga00v17_90_c1_5207_6529 439
1336 3300050492 nmdc:mga0yw44_1586_c1 nmdc:mga0yw44_1586_c1_5246_6568 439
1337 3300050494 nmdc:mga06z11_34216_c1 nmdc:mga06z11_34216_c1_1082_2404 439
1338 3300050516 nmdc:mga0sz30_711_c2 nmdc:mga0sz30_711_c2_3219_4541 439
1339 3300053086 Ga0500578_0037488 Ga0500578_0037488_1236_2555 439
1340 3300053107 Ga0500560_012286 Ga0500560_012286_480_1802 439
1341 3300053109 Ga0500569_000527 Ga0500569_000527_1595_2914 439
1342 3300053118 Ga0500594_0001679 Ga0500594_0001679_1210_2529 439
1343 3300053130 Ga0500642_0076166 Ga0500642_0076166_38_1357 439
1344 3300053137 Ga0500561_0000208 Ga0500561_0000208_8016_9338 439
1345 3300053139 Ga0500568_0000533 Ga0500568_0000533_20939_22258 439
1346 3300053148 Ga0500590_002289 Ga0500590_002289_2958_4280 439
1347 3300053153 Ga0500616_0001527 Ga0500616_0001527_4887_6206 439
1348 3300059643 Ga0587072_003865 Ga0587072_003865_463_1785 439
1349 3300060353 Ga0501082_0034529 Ga0501082_0034529_644_1966 439
1350 iso_pu_bacteria 2837651117 2837652160 439
1351 3300006038 Ga0075365_10029225 Ga0075365_100292252 440
1352 3300050492 nmdc:mga0yw44_937_c1 nmdc:mga0yw44_937_c1_4577_5902 440
1353 3300006946 Ga0079104_1000069 Ga0079104_1000069131 441
1354 3300027111 Ga0209281_1000253 Ga0209281_100025316 441
1355 3300046530 Ga0495654_0000320 Ga0495654_0000320_19123_20451 441
1356 3300050491 nmdc:mga00v17_92752_c1 nmdc:mga00v17_92752_c1_297_1625 441
1357 3300053125 Ga0500618_000132 Ga0500618_000132_11381_12709 441
1358 iso_pu_bacteria 2891048133 2891051165 449
1359 iso_pu_bacteria 2995392953 2995395485 449
1360 iso_pu_bacteria 2551306092 2551738467 451
1361 iso_pu_bacteria 2551306093 2551742083 451
1362 3300001979 JGI24740J21852_10002672 JGI24740J21852_100026722 467

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04413

Glycos_transf_N

3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase)

36

211

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bfc-assembly1.cif.gz_A crystal structure of the c-terminal cmp-kdo binding domain of waaa from acinetobacter baumannii 0.9214 221 404
4bfc-assembly1.cif.gz_A crystal structure of the c-terminal cmp-kdo binding domain of waaa from acinetobacter baumannii 0.8759 221 404
1o6c-assembly1.cif.gz_A crystal structure of udp-n-acetylglucosamine 2-epimerase 0.6814 55 399
2gek-assembly1.cif.gz_A crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp 0.676 58 424
7vyy-assembly1.cif.gz_B the crystal structure of non-hydrolyzing udpglcnac 2-epimerase 0.6689 55 417
ID Description Score Start End Superfamily
af_P0AC75_216_403_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9595 222 404 3.40.50.2000
af_A0A1D6N6V1_47_223_3.40.50.11720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;3-Deoxy-D-manno-octulosonic-acid transferase, N-terminal domain 0.9586 45 212 3.40.50.11720
af_P0AC75_41_209_3.40.50.11720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;3-Deoxy-D-manno-octulosonic-acid transferase, N-terminal domain 0.9584 48 212 3.40.50.11720
af_I1L969_232_416_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9513 225 403 3.40.50.2000
af_A0A0P0VAM2_51_200_3.40.50.11720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;3-Deoxy-D-manno-octulosonic-acid transferase, N-terminal domain 0.9494 47 188 3.40.50.11720
ID Description Score Start End GO Terms
AF-A0A3S3IGI5-F1-model_v4 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) 0.9899 77 187 GO:0005886
GO:0009244
GO:0009245
GO:0043842
AF-A0A352KRL0-F1-model_v4 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) 0.9744 265 400 GO:0005886
GO:0009244
GO:0009245
GO:0043842
AF-A0A3S3IGI5-F1-model_v4 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) 0.9725 77 187 GO:0005886
GO:0009244
GO:0009245
GO:0043842
AF-A0A3N5ML70-F1-model_v4 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) 0.9714 107 421 GO:0005886
GO:0009244
GO:0009245
GO:0043842
AF-A0A060BLA8-F1-model_v4 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) 0.9681 232 357 GO:0005886
GO:0009244
GO:0009245
GO:0043842

Feature Viewer

pLDDT pTM Quality
85.02 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map