F493349
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1362 | 1070 | 523 | 436 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2551306092|2551738467 |
| Length | 469 |
| Sequence | RARLALSGYRWLGTAVYPFFWSYLALRAAKGKEDPARRRERYGYASAPRPQGPLVWFHAASVGETNAVTPLIKEIRRRGIAVVLTTGTTTSARVAAERLGSAVVHQYVPLDFKPAVSRFLEYWQPDLAIIAESEIWPMTIIELGRRHIPQVLVNGRLSDRTFARWRRRPSLADALFENLALVIAQSDVDAERFRTLGALPVTVSGNLKVDNEAPPHDPRDLREYRQQIGARKTWAAISTFEGEENAAGTVHQALKERTGLLTIIVPRHPERCDAIEAALVAKGLKVARRTRGDPVTPEVDILLGDTIGEMGLYLRLTEVAFVGRSLFAEGGQNXPLEPAMLGCAVLSGGNVQNFRETYQMLAKNGSAKIVRDTEMLAKGVNYLLANDDMRRSMINAGLETVQQMRGALTATMKGLDPYINPLVVKARLXSRALKPENRSLKPRFWKGSCPQRNRSPAYCSTRTAPFSIM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 13 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 14 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 15 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 16 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 17 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 18 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 19 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 20 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 21 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 22 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 23 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 24 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 25 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 26 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 27 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 28 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 29 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 30 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 31 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 32 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 33 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 34 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 35 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 36 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 37 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 38 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 39 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 40 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 41 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 42 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 43 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 44 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 45 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 46 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 47 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 48 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 49 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 50 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 51 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 52 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 53 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 54 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 55 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 56 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 57 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 58 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 59 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 60 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 61 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 62 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 63 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 64 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 65 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 66 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 67 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 68 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 69 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 70 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 71 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 72 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 73 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 74 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 75 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 76 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 77 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 78 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 79 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 80 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 81 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 82 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 83 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 84 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 85 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 86 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 87 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 88 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 89 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 90 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 91 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 92 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 93 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 94 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 95 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 96 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 97 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 98 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 99 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 100 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 101 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 102 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 103 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 104 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 105 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 106 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 107 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 108 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 109 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 110 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 111 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 112 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 113 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 114 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 115 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 116 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 117 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 118 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 119 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 120 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 121 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 122 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 123 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 124 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 125 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 126 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 127 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 128 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 129 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 130 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 131 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 132 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 133 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 134 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 135 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 136 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 137 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 138 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 139 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 140 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 141 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 142 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 143 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 144 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 145 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 146 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 147 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 148 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 149 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 150 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 151 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 152 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 153 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 154 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 155 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 156 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 157 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 158 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 159 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 160 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 161 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 162 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 163 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 164 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 165 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 166 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 167 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 168 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 169 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 170 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 171 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 172 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 173 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 174 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 175 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 176 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 177 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 178 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 179 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 180 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 181 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 182 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 183 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 184 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 185 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 186 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 187 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 188 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 189 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 190 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 191 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 192 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 193 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 194 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 195 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 196 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 197 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 198 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 199 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 200 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 201 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 202 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 203 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 204 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 205 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 206 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 207 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 208 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 209 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 210 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 211 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 212 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 213 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 214 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 215 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 216 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 217 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 218 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 219 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 220 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 221 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 222 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 223 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 224 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 225 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 226 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 227 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 228 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 229 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 230 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 231 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 232 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 233 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 234 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 235 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 236 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 237 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 238 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 239 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 240 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 241 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 242 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 243 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 244 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 245 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 246 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 247 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 248 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 249 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 250 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 251 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 252 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 253 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 254 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 255 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 256 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 257 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 258 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 259 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 260 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 261 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 262 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 263 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 264 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 265 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 266 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 267 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 268 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 269 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 270 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 271 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 272 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 273 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 274 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 275 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 276 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 277 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 278 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 279 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 280 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 281 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 282 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 283 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 284 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 285 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 286 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 287 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 288 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 289 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 290 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 291 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 292 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 293 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 294 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 295 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 296 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 297 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 298 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 299 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 300 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 301 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 302 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 303 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 304 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 305 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 306 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 307 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 308 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 309 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 310 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 311 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 312 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 313 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 314 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 315 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 316 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 317 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 318 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 319 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 320 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 321 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 322 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 323 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 324 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 325 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 326 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 327 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 328 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 329 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 330 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 331 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 332 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 333 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 334 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 335 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 336 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 337 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 338 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 339 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 340 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 341 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 342 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 343 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 344 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 345 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 346 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 347 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 348 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 349 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 350 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 351 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 352 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 353 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 354 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 355 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 356 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 357 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 358 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 359 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 360 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 361 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 362 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 363 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 364 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 365 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 366 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 367 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 368 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 369 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 370 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 371 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 372 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 373 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 374 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 375 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 376 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 377 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 378 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 379 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 380 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 381 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 382 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 383 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 384 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 385 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 386 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 387 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 388 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 389 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 390 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 391 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 392 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 393 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 394 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 395 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 396 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 397 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 398 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 399 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 400 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 401 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 402 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 403 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 404 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 405 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 406 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 407 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 408 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 409 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 410 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 411 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 412 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 413 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 414 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 415 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 416 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 417 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 418 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 419 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 420 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 421 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 422 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 423 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 424 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 425 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 426 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 427 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 428 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 429 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 430 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 431 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 432 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 433 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 434 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 435 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 436 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 437 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 438 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 439 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 440 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 441 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 442 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 443 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 444 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 445 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 446 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 447 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 448 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 449 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 450 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 451 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 452 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 453 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 454 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 455 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 456 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 457 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 458 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 459 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 460 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 461 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 462 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 463 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 464 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 465 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 466 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 467 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 468 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 469 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 470 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 471 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 472 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 473 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 474 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 475 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 476 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 477 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 478 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 479 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 480 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 481 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 482 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 483 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 484 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 485 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 486 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 487 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 488 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 489 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 490 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 491 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 492 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 493 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 494 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 495 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 496 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 497 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 498 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 499 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 500 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 501 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 502 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 503 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 504 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 505 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 506 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 507 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 508 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 509 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 510 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 511 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 512 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 513 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 514 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 515 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 516 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 517 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 518 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 519 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 520 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 521 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 522 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 523 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 524 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 525 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 526 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 527 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 528 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 529 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 530 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 531 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 532 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 533 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 534 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 535 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 536 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 537 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 538 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 539 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 540 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 541 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 542 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 543 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 544 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 545 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 546 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 547 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 548 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 549 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 550 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 551 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 552 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 553 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 554 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 555 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 556 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 557 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 558 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 559 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 560 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 561 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 562 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 563 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 564 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 565 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 566 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 567 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 568 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 569 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 570 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 571 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 572 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 573 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 574 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 575 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 576 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 577 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 578 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 579 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 580 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 581 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 582 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 583 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 584 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 585 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 586 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 587 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 588 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 589 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 590 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 591 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 592 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 593 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 594 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 595 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 596 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 597 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 598 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 599 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 600 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 601 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 602 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 603 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 604 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 605 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 606 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 607 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 608 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 609 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 610 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 611 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 612 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 613 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 614 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 615 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 616 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 617 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 618 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 619 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 620 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 621 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 622 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 623 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 624 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 625 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 626 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 627 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 628 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 629 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 630 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 631 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 632 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 633 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 634 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 635 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 636 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 637 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 638 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 639 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 640 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 641 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 642 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 643 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 644 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 645 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 646 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 647 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 648 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 649 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 650 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 651 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 652 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 653 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 654 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 655 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 656 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 657 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 658 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 659 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 660 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 661 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 662 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 663 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 664 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 665 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 666 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 667 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 668 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 669 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 670 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 671 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 672 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 673 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 674 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 675 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 676 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 677 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 678 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 679 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 680 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 681 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 682 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 683 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 684 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 685 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 686 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 687 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 688 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 689 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 690 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 691 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 692 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 693 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 694 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 695 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 696 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 697 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 698 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 699 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 700 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 701 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 702 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 703 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 704 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 705 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 706 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 707 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 708 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 709 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 710 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 711 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 712 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 713 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 714 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 715 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 716 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 717 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 718 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 719 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 720 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 721 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 722 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 723 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 724 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 725 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 726 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 727 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 728 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 729 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 730 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 731 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 732 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 733 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 734 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 735 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 736 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 737 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 738 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 739 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 740 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 741 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 742 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 743 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 744 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 745 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 746 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 747 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 748 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 749 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 750 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 751 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 752 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 753 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 754 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 755 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 756 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 757 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 758 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 759 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 760 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 761 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 762 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 763 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 764 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 765 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 766 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 767 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 768 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 769 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 770 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 771 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 772 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 773 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 774 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 775 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 776 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 777 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 778 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 779 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 780 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 781 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 782 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 783 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 784 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 785 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 786 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 787 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 788 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 789 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 790 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 791 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 792 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 793 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 794 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 795 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 796 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 797 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 798 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 799 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 800 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 801 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 802 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 803 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 804 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 805 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 806 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 807 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 808 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 809 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 810 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 811 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 812 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 813 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 814 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 815 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 816 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 817 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 818 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 819 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 820 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 821 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 822 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 823 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 824 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 825 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 826 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 827 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 828 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 829 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 830 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 831 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 832 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 833 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 834 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 835 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 836 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 837 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 838 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 839 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 840 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 841 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 842 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 843 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 844 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 845 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 846 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 847 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 848 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 849 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 850 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 851 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 852 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 853 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 854 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 855 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 856 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 857 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 858 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 859 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 860 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 861 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 862 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 863 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 864 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 865 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 866 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 867 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 868 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 869 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 870 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 871 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 872 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 873 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 874 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 875 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 876 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 877 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 878 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 879 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 880 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 881 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 882 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 883 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 884 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 885 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 886 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 887 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 888 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 889 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 890 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 891 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 892 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 893 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 894 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 895 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 896 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 897 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 898 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 899 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 900 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 901 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 902 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 903 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 904 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 905 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 906 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 907 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 908 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 909 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 910 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 911 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 912 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 916 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 917 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 918 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 919 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 920 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 922 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 932 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 933 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 934 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 935 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 936 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 937 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 938 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 939 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 940 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 941 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 942 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 943 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 944 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 945 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 946 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 947 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 948 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 949 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 950 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 951 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 952 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 953 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 954 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 955 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 956 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 957 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 958 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 959 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 960 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 961 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 962 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 963 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 964 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 965 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 966 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 967 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 968 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 969 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 970 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 971 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 972 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 973 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 974 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 975 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 976 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 977 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 978 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 979 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 980 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 981 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 982 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 983 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 984 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 985 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 986 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 987 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 988 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 989 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 990 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 991 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 992 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 993 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 994 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 995 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 996 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 997 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 998 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 999 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1000 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1001 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1002 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1003 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1004 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1005 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1006 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1007 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1008 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1009 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1010 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1011 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1012 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1013 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1014 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1015 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1016 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1017 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1018 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1019 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1020 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1021 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1022 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1023 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1024 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1025 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1026 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1027 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1028 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1029 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1030 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1031 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1032 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1033 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1034 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1035 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1036 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1037 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1038 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1039 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1040 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1041 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1042 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1043 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1044 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1045 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1046 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1047 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1048 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1049 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1050 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1051 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1052 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1053 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1054 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1055 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1056 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1057 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1058 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1059 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1060 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1061 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1062 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1063 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1064 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1065 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1066 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1067 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1068 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1069 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1070 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 38.33 |
| Metatranscriptomes | 0.07 |
| Isolates | 61.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 12.19 |
| Nodule | 48.16 |
| Rhizoplane | 1.4 |
| Rhizosphere | 21.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002672 | 3300001979 | Bacteria | 8004 |
| 2 | JGI24739J22299_10032207 | 3300001989 | Bacteria | 1805 |
| 3 | JGI25155J39150_1000006 | 3300002704 | Bacteria | 244109 |
| 4 | JGI25156J39149_1000019 | 3300002705 | Bacteria | 160845 |
| 5 | JGI25156J39149_1004645 | 3300002705 | Bacteria | 4132 |
| 6 | JGI25162J39368_1000177 | 3300002737 | Bacteria | 68786 |
| 7 | JGI25162J39368_1000381 | 3300002737 | Bacteria | 37770 |
| 8 | JGI25154J39366_1000177 | 3300002738 | Bacteria | 49732 |
| 9 | JGI25157J39369_1000024 | 3300002741 | Bacteria | 160844 |
| 10 | JGI25157J39369_1002670 | 3300002741 | Bacteria | 4162 |
| 11 | JGI25152J39213_1000299 | 3300002773 | Bacteria | 32046 |
| 12 | JGI25152J39213_1001977 | 3300002773 | Bacteria | 8116 |
| 13 | JGI25152J39213_1002166 | 3300002773 | Bacteria | 7697 |
| 14 | JGI25150J39212_1000042 | 3300002774 | Bacteria | 84513 |
| 15 | JGI25159J45721_1000021 | 3300002987 | Bacteria | 119754 |
| 16 | JGI25159J45721_1001496 | 3300002987 | Bacteria | 9581 |
| 17 | JGI25151J46595_10000099 | 3300003187 | Bacteria | 117428 |
| 18 | JGI25151J46595_10000707 | 3300003187 | Bacteria | 27959 |
| 19 | JGI25151J46595_10009360 | 3300003187 | Bacteria | 4645 |
| 20 | JGI25406J46586_10010757 | 3300003203 | Bacteria | 4042 |
| 21 | JGI25165J46597_1000070 | 3300003214 | Bacteria | 193557 |
| 22 | JGI25165J46597_1000480 | 3300003214 | Bacteria | 38783 |
| 23 | JGI25165J46597_1001692 | 3300003214 | Bacteria | 9956 |
| 24 | JGI25153J46596_10007987 | 3300003215 | Bacteria | 5119 |
| 25 | JGI25153J46596_10009490 | 3300003215 | Bacteria | 4512 |
| 26 | rootH2_10081828 | 3300003320 | Bacteria | 5381 |
| 27 | rootL2_10006203 | 3300003322 | Bacteria | 26671 |
| 28 | rootH1_10006221 | 3300003323 | Bacteria | 6749 |
| 29 | rootH1_10080966 | 3300003323 | Bacteria | 4672 |
| 30 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 31 | JGI25160J50197_1000046 | 3300003354 | Bacteria | 141352 |
| 32 | JGI25160J50197_1008028 | 3300003354 | Bacteria | 4057 |
| 33 | JGI25161J50226_1000031 | 3300003374 | Bacteria | 141352 |
| 34 | JGI25161J50226_1001568 | 3300003374 | Bacteria | 6698 |
| 35 | Ga0055542_1000344 | 3300003762 | Bacteria | 49138 |
| 36 | Ga0055529_1007055 | 3300003763 | Bacteria | 1540 |
| 37 | Ga0055526_1003166 | 3300003771 | Bacteria | 10656 |
| 38 | Ga0055524_1001940 | 3300003775 | Bacteria | 11138 |
| 39 | Ga0055524_1004569 | 3300003775 | Bacteria | 6367 |
| 40 | Ga0055536_1003131 | 3300003781 | Bacteria | 8982 |
| 41 | Ga0055536_1007911 | 3300003781 | Bacteria | 4668 |
| 42 | Ga0055528_1002755 | 3300003790 | Bacteria | 9207 |
| 43 | Ga0055528_1019902 | 3300003790 | Bacteria | 2199 |
| 44 | Ga0055540_1000269 | 3300003792 | Bacteria | 47006 |
| 45 | Ga0055540_1004730 | 3300003792 | Bacteria | 6011 |
| 46 | Ga0055540_1007822 | 3300003792 | Bacteria | 3958 |
| 47 | Ga0055531_10001859 | 3300003794 | Bacteria | 14817 |
| 48 | Ga0055531_10013431 | 3300003794 | Bacteria | 3773 |
| 49 | Ga0058692_1002755 | 3300003856 | Bacteria | 5777 |
| 50 | Ga0058692_1010264 | 3300003856 | Bacteria | 2321 |
| 51 | Ga0055543_1000278 | 3300004625 | Bacteria | 37671 |
| 52 | Ga0055543_1000306 | 3300004625 | Bacteria | 34217 |
| 53 | Ga0055543_1004016 | 3300004625 | Bacteria | 4130 |
| 54 | Ga0065165_1000058 | 3300005262 | Bacteria | 184784 |
| 55 | Ga0065165_1000693 | 3300005262 | Bacteria | 48076 |
| 56 | Ga0065165_1004713 | 3300005262 | Bacteria | 8193 |
| 57 | Ga0065165_1010993 | 3300005262 | Bacteria | 3836 |
| 58 | Ga0065165_1013516 | 3300005262 | Bacteria | 3239 |
| 59 | Ga0070668_100042434 | 3300005347 | Bacteria | 3487 |
| 60 | Ga0070671_100043211 | 3300005355 | Bacteria | 3745 |
| 61 | Ga0070663_100011297 | 3300005455 | Bacteria | 5599 |
| 62 | Ga0070663_100133810 | 3300005455 | Bacteria | 1886 |
| 63 | Ga0068853_100007135 | 3300005539 | Bacteria | 8936 |
| 64 | Ga0068853_100154814 | 3300005539 | Bacteria | 2065 |
| 65 | Ga0070665_100038883 | 3300005548 | Bacteria | 4783 |
| 66 | Ga0070665_100040022 | 3300005548 | Bacteria | 4712 |
| 67 | Ga0070665_100059703 | 3300005548 | Bacteria | 3823 |
| 68 | Ga0070665_100080233 | 3300005548 | Bacteria | 3268 |
| 69 | Ga0070665_100151867 | 3300005548 | Bacteria | 2319 |
| 70 | Ga0068855_100109516 | 3300005563 | Bacteria | 3172 |
| 71 | Ga0068855_100245902 | 3300005563 | Bacteria | 1997 |
| 72 | Ga0068857_100106827 | 3300005577 | Bacteria | 2514 |
| 73 | Ga0081540_1012530 | 3300005983 | Bacteria | 5573 |
| 74 | Ga0081539_10003940 | 3300005985 | Bacteria | 17202 |
| 75 | Ga0075365_10003722 | 3300006038 | Bacteria | 7928 |
| 76 | Ga0075365_10007235 | 3300006038 | Bacteria | 6201 |
| 77 | Ga0075365_10017983 | 3300006038 | Bacteria | 4337 |
| 78 | Ga0075365_10029225 | 3300006038 | Bacteria | 3521 |
| 79 | Ga0075365_10050727 | 3300006038 | Bacteria | 2738 |
| 80 | Ga0075365_10052489 | 3300006038 | Bacteria | 2697 |
| 81 | Ga0075365_10059189 | 3300006038 | Bacteria | 2552 |
| 82 | Ga0075365_10125496 | 3300006038 | Bacteria | 1773 |
| 83 | Ga0075368_10001844 | 3300006042 | Bacteria | 6814 |
| 84 | Ga0075363_100041351 | 3300006048 | Bacteria | 2431 |
| 85 | Ga0075363_100122317 | 3300006048 | Bacteria | 1454 |
| 86 | Ga0075364_10000416 | 3300006051 | Bacteria | 21322 |
| 87 | Ga0075364_10033396 | 3300006051 | Bacteria | 3313 |
| 88 | Ga0075362_10017477 | 3300006177 | Bacteria | 2955 |
| 89 | Ga0075362_10022993 | 3300006177 | Bacteria | 2631 |
| 90 | Ga0075367_10012811 | 3300006178 | Bacteria | 4488 |
| 91 | Ga0075367_10045013 | 3300006178 | Bacteria | 2589 |
| 92 | Ga0075367_10054584 | 3300006178 | Bacteria | 2369 |
| 93 | Ga0075369_10000599 | 3300006186 | Bacteria | 11441 |
| 94 | Ga0075369_10007943 | 3300006186 | Bacteria | 4066 |
| 95 | Ga0075369_10012428 | 3300006186 | Bacteria | 3364 |
| 96 | Ga0075370_10007858 | 3300006353 | Bacteria | 5458 |
| 97 | Ga0079104_1000069 | 3300006946 | Bacteria | 153993 |
| 98 | Ga0099826_10000327 | 3300006948 | Bacteria | 21659 |
| 99 | Ga0099826_10029864 | 3300006948 | Bacteria | 3966 |
| 100 | Ga0105250_10008165 | 3300009092 | Bacteria | 4458 |
| 101 | Ga0105240_10003684 | 3300009093 | Bacteria | 23694 |
| 102 | Ga0105243_10018026 | 3300009148 | Bacteria | 5342 |
| 103 | Ga0105243_10049161 | 3300009148 | Bacteria | 3326 |
| 104 | Ga0105248_10084414 | 3300009177 | Bacteria | 3573 |
| 105 | Ga0105237_10002476 | 3300009545 | Bacteria | 22919 |
| 106 | Ga0105237_10014009 | 3300009545 | Bacteria | 8391 |
| 107 | Ga0105238_10006570 | 3300009551 | Bacteria | 11582 |
| 108 | Ga0123341_1009192 | 3300009765 | Bacteria | 9041 |
| 109 | Ga0123342_1010831 | 3300009766 | Bacteria | 10258 |
| 110 | Ga0105239_10003906 | 3300010375 | Bacteria | 18071 |
| 111 | Ga0157373_10020610 | 3300013100 | Bacteria | 4790 |
| 112 | Ga0157371_10000058 | 3300013102 | Bacteria | 171756 |
| 113 | Ga0157371_10008296 | 3300013102 | Bacteria | 8297 |
| 114 | Ga0157370_10000030 | 3300013104 | Bacteria | 145571 |
| 115 | Ga0157370_10003932 | 3300013104 | Bacteria | 17294 |
| 116 | Ga0157370_10163277 | 3300013104 | Bacteria | 2072 |
| 117 | Ga0157369_10098581 | 3300013105 | Bacteria | 3116 |
| 118 | Ga0157369_10280081 | 3300013105 | Bacteria | 1737 |
| 119 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 120 | Ga0182008_10008080 | 3300014497 | Bacteria | 5762 |
| 121 | Ga0182008_10072680 | 3300014497 | Bacteria | 1692 |
| 122 | Ga0182007_10000598 | 3300015262 | Bacteria | 21106 |
| 123 | Ga0182007_10022213 | 3300015262 | Bacteria | 2243 |
| 124 | Ga0182005_1006003 | 3300015265 | Bacteria | 3753 |
| 125 | Ga0183363_1186 | 3300015690 | Bacteria | 13383 |
| 126 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 127 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 128 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 129 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 130 | Ga0228711_1000137 | 3300022739 | Bacteria | 66265 |
| 131 | Ga0228710_1000031 | 3300022740 | Bacteria | 95534 |
| 132 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 133 | Ga0209436_100128 | 3300025208 | Bacteria | 37455 |
| 134 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 135 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 136 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 137 | Ga0207425_1003062 | 3300025245 | Bacteria | 5541 |
| 138 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 139 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 140 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 141 | Ga0209677_100862 | 3300025253 | Bacteria | 14985 |
| 142 | Ga0209148_1000123 | 3300025254 | Bacteria | 185406 |
| 143 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 144 | Ga0209759_1000381 | 3300025256 | Bacteria | 55381 |
| 145 | Ga0209129_1000086 | 3300025258 | Bacteria | 181543 |
| 146 | Ga0209129_1000407 | 3300025258 | Bacteria | 33939 |
| 147 | Ga0209129_1000606 | 3300025258 | Bacteria | 24232 |
| 148 | Ga0209129_1007997 | 3300025258 | Bacteria | 3018 |
| 149 | Ga0209233_1000110 | 3300025261 | Bacteria | 260825 |
| 150 | Ga0209233_1000131 | 3300025261 | Bacteria | 205257 |
| 151 | Ga0209233_1000166 | 3300025261 | Bacteria | 152270 |
| 152 | Ga0209233_1000390 | 3300025261 | Bacteria | 37314 |
| 153 | Ga0209455_1000129 | 3300025272 | Bacteria | 161691 |
| 154 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 155 | Ga0209673_1000091 | 3300025273 | Bacteria | 201875 |
| 156 | Ga0209673_1003094 | 3300025273 | Bacteria | 10203 |
| 157 | Ga0209673_1004627 | 3300025273 | Bacteria | 7283 |
| 158 | Ga0209673_1015431 | 3300025273 | Bacteria | 2903 |
| 159 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 160 | Ga0209130_1000312 | 3300025284 | Bacteria | 57303 |
| 161 | Ga0209676_1005846 | 3300025292 | Bacteria | 6278 |
| 162 | Ga0209676_1008200 | 3300025292 | Bacteria | 4712 |
| 163 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 164 | Ga0209025_1000118 | 3300025294 | Bacteria | 214009 |
| 165 | Ga0209025_1000549 | 3300025294 | Bacteria | 70203 |
| 166 | Ga0209025_1000956 | 3300025294 | Bacteria | 43592 |
| 167 | Ga0209025_1000980 | 3300025294 | Bacteria | 42613 |
| 168 | Ga0209025_1005096 | 3300025294 | Bacteria | 10928 |
| 169 | Ga0209025_1009494 | 3300025294 | Bacteria | 6763 |
| 170 | Ga0209025_1017886 | 3300025294 | Bacteria | 4060 |
| 171 | Ga0209564_1000091 | 3300025295 | Bacteria | 249103 |
| 172 | Ga0209564_1000742 | 3300025295 | Bacteria | 46299 |
| 173 | Ga0209564_1003340 | 3300025295 | Bacteria | 11124 |
| 174 | Ga0209564_1008708 | 3300025295 | Bacteria | 4954 |
| 175 | Ga0209564_1012297 | 3300025295 | Bacteria | 3744 |
| 176 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 177 | Ga0209758_1000191 | 3300025297 | Bacteria | 136984 |
| 178 | Ga0209758_1000325 | 3300025297 | Bacteria | 91078 |
| 179 | Ga0209758_1007462 | 3300025297 | Bacteria | 7430 |
| 180 | Ga0209758_1008441 | 3300025297 | Bacteria | 6670 |
| 181 | Ga0209050_1003450 | 3300025298 | Bacteria | 11633 |
| 182 | Ga0209256_1000169 | 3300025299 | Bacteria | 131077 |
| 183 | Ga0209256_1000858 | 3300025299 | Bacteria | 37944 |
| 184 | Ga0209256_1001975 | 3300025299 | Bacteria | 18470 |
| 185 | Ga0209256_1002377 | 3300025299 | Bacteria | 15520 |
| 186 | Ga0209256_1005090 | 3300025299 | Bacteria | 7808 |
| 187 | Ga0209256_1005247 | 3300025299 | Bacteria | 7578 |
| 188 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 189 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 190 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 191 | Ga0207426_1000457 | 3300025302 | Bacteria | 64140 |
| 192 | Ga0209051_1000084 | 3300025303 | Bacteria | 190324 |
| 193 | Ga0209051_1000860 | 3300025303 | Bacteria | 30937 |
| 194 | Ga0209051_1004764 | 3300025303 | Bacteria | 8200 |
| 195 | Ga0209051_1010007 | 3300025303 | Bacteria | 4829 |
| 196 | Ga0209051_1014165 | 3300025303 | Bacteria | 3737 |
| 197 | Ga0209051_1041554 | 3300025303 | Bacteria | 1634 |
| 198 | Ga0209257_1001225 | 3300025304 | Bacteria | 31975 |
| 199 | Ga0209257_1004315 | 3300025304 | Bacteria | 11169 |
| 200 | Ga0209257_1005237 | 3300025304 | Bacteria | 9276 |
| 201 | Ga0207647_10005582 | 3300025904 | Bacteria | 9200 |
| 202 | Ga0207647_10033555 | 3300025904 | Bacteria | 3286 |
| 203 | Ga0207695_10003123 | 3300025913 | Bacteria | 23696 |
| 204 | Ga0207695_10078835 | 3300025913 | Bacteria | 3341 |
| 205 | Ga0207671_10000176 | 3300025914 | Bacteria | 98289 |
| 206 | Ga0207671_10006724 | 3300025914 | Bacteria | 10182 |
| 207 | Ga0207694_10008378 | 3300025924 | Bacteria | 7810 |
| 208 | Ga0207650_10002037 | 3300025925 | Bacteria | 14152 |
| 209 | Ga0207690_10077815 | 3300025932 | Bacteria | 2306 |
| 210 | Ga0207667_10133513 | 3300025949 | Bacteria | 2557 |
| 211 | Ga0207639_10003928 | 3300026041 | Bacteria | 10034 |
| 212 | Ga0207678_10009958 | 3300026067 | Bacteria | 8340 |
| 213 | Ga0207678_10059370 | 3300026067 | Bacteria | 3291 |
| 214 | Ga0207702_10073938 | 3300026078 | Bacteria | 2940 |
| 215 | Ga0207674_10060733 | 3300026116 | Bacteria | 3822 |
| 216 | Ga0207674_10087471 | 3300026116 | Bacteria | 3109 |
| 217 | Ga0207698_10075067 | 3300026142 | Bacteria | 2700 |
| 218 | Ga0209281_1000155 | 3300027111 | Bacteria | 164423 |
| 219 | Ga0209281_1000253 | 3300027111 | Bacteria | 105600 |
| 220 | Ga0209281_1001059 | 3300027111 | Bacteria | 20700 |
| 221 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 222 | Ga0209371_1001145 | 3300027312 | Bacteria | 19403 |
| 223 | Ga0209371_1002735 | 3300027312 | Bacteria | 9476 |
| 224 | Ga0209282_1000025 | 3300027666 | Bacteria | 168676 |
| 225 | Ga0209282_1000908 | 3300027666 | Bacteria | 15442 |
| 226 | Ga0209282_1022896 | 3300027666 | Bacteria | 3930 |
| 227 | Ga0268266_10028826 | 3300028379 | Bacteria | 4719 |
| 228 | Ga0268266_10089010 | 3300028379 | Bacteria | 2702 |
| 229 | Ga0268266_10090430 | 3300028379 | Bacteria | 2683 |
| 230 | Ga0268266_10111561 | 3300028379 | Bacteria | 2423 |
| 231 | Ga0268266_10193345 | 3300028379 | Bacteria | 1859 |
| 232 | Ga0307515_10000154 | 3300028794 | Bacteria | 166582 |
| 233 | Ga0307515_10006246 | 3300028794 | Bacteria | 23911 |
| 234 | Ga0307515_10043638 | 3300028794 | Bacteria | 6961 |
| 235 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 236 | Ga0268256_1003517 | 3300030500 | Bacteria | 7023 |
| 237 | Ga0268256_1015207 | 3300030500 | Bacteria | 2255 |
| 238 | Ga0307513_10001054 | 3300031456 | Bacteria | 40089 |
| 239 | Ga0307408_100089591 | 3300031548 | Bacteria | 2319 |
| 240 | Ga0307406_10083835 | 3300031901 | Bacteria | 2127 |
| 241 | Ga0307412_10007356 | 3300031911 | Bacteria | 6244 |
| 242 | Ga0307412_10049598 | 3300031911 | Bacteria | 2767 |
| 243 | Ga0315914_1000620 | 3300031967 | Bacteria | 46971 |
| 244 | Ga0307409_100031636 | 3300031995 | Bacteria | 3823 |
| 245 | Ga0315913_1000150 | 3300033430 | Bacteria | 47059 |
| 246 | Ga0315915_1000015 | 3300033464 | Bacteria | 168491 |
| 247 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 248 | Ga0395899_0055606 | 3300037312 | Bacteria | 2927 |
| 249 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 250 | Ga0395900_0027451 | 3300037418 | Bacteria | 5832 |
| 251 | Ga0395900_0173782 | 3300037418 | Bacteria | 2192 |
| 252 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 253 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 254 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 255 | Ga0395901_0014679 | 3300038443 | Bacteria | 7960 |
| 256 | Ga0395901_0034079 | 3300038443 | Bacteria | 5258 |
| 257 | Ga0439436_0005742 | 3300041404 | Bacteria | 3804 |
| 258 | Ga0439465_0002164 | 3300041413 | Bacteria | 6458 |
| 259 | Ga0451835_0651872 | 3300041492 | Bacteria | 1883 |
| 260 | Ga0439449_0029318 | 3300042007 | Bacteria | 2050 |
| 261 | Ga0450907_008680 | 3300042146 | Bacteria | 1685 |
| 262 | Ga0450918_004827 | 3300042531 | Bacteria | 2439 |
| 263 | Ga0466963_0002783 | 3300044694 | Bacteria | 9861 |
| 264 | Ga0466958_0007058 | 3300045836 | Bacteria | 6148 |
| 265 | Ga0495629_0014910 | 3300046459 | Bacteria | 5587 |
| 266 | Ga0495638_0001215 | 3300046460 | Bacteria | 24561 |
| 267 | Ga0495638_0012359 | 3300046460 | Bacteria | 5854 |
| 268 | Ga0495605_0001185 | 3300046474 | Bacteria | 17342 |
| 269 | Ga0495662_0015369 | 3300046476 | Bacteria | 3718 |
| 270 | Ga0495585_0001367 | 3300046492 | Bacteria | 19313 |
| 271 | Ga0495585_0012209 | 3300046492 | Bacteria | 5062 |
| 272 | Ga0495585_0017543 | 3300046492 | Bacteria | 4135 |
| 273 | Ga0495607_0045498 | 3300046501 | Bacteria | 2581 |
| 274 | Ga0495583_0001517 | 3300046506 | Bacteria | 23050 |
| 275 | Ga0495583_0013986 | 3300046506 | Bacteria | 4445 |
| 276 | Ga0495606_0021406 | 3300046507 | Bacteria | 4736 |
| 277 | Ga0495606_0081419 | 3300046507 | Bacteria | 2012 |
| 278 | Ga0495610_0000975 | 3300046512 | Bacteria | 26429 |
| 279 | Ga0495620_0006890 | 3300046515 | Bacteria | 6209 |
| 280 | Ga0495620_0009193 | 3300046515 | Bacteria | 5268 |
| 281 | Ga0495620_0018738 | 3300046515 | Bacteria | 3423 |
| 282 | Ga0495620_0041739 | 3300046515 | Bacteria | 2010 |
| 283 | Ga0495620_0045964 | 3300046515 | Bacteria | 1888 |
| 284 | Ga0495620_0055028 | 3300046515 | Bacteria | 1678 |
| 285 | Ga0495631_0000622 | 3300046518 | Bacteria | 23323 |
| 286 | Ga0495632_0003225 | 3300046519 | Bacteria | 11714 |
| 287 | Ga0495632_0025761 | 3300046519 | Bacteria | 3107 |
| 288 | Ga0495654_0000320 | 3300046530 | Bacteria | 42124 |
| 289 | Ga0495609_0027309 | 3300046538 | Bacteria | 2609 |
| 290 | Ga0495622_0004894 | 3300046557 | Bacteria | 6204 |
| 291 | Ga0495633_0010509 | 3300046558 | Bacteria | 5046 |
| 292 | Ga0495668_0001429 | 3300046616 | Bacteria | 23122 |
| 293 | Ga0495634_0113523 | 3300046642 | Bacteria | 1740 |
| 294 | Ga0495625_0001674 | 3300046660 | Bacteria | 25895 |
| 295 | Ga0495625_0066799 | 3300046660 | Bacteria | 2532 |
| 296 | Ga0495635_0009879 | 3300046663 | Bacteria | 6669 |
| 297 | Ga0495588_0001635 | 3300046674 | Bacteria | 9593 |
| 298 | Ga0495588_0009713 | 3300046674 | Bacteria | 4459 |
| 299 | Ga0495588_0026724 | 3300046674 | Bacteria | 2883 |
| 300 | Ga0495657_0011072 | 3300046675 | Bacteria | 6763 |
| 301 | Ga0495671_0025493 | 3300046692 | Bacteria | 3073 |
| 302 | Ga0495671_0108881 | 3300046692 | Bacteria | 1353 |
| 303 | Ga0495636_0029664 | 3300047318 | Bacteria | 2234 |
| 304 | Ga0495672_0003865 | 3300047320 | Bacteria | 12592 |
| 305 | Ga0495687_026666 | 3300047443 | Bacteria | 2716 |
| 306 | Ga0495687_041534 | 3300047443 | Bacteria | 2017 |
| 307 | Ga0495681_0005896 | 3300047470 | Bacteria | 8130 |
| 308 | Ga0495686_0001812 | 3300047472 | Bacteria | 21578 |
| 309 | Ga0495686_0003176 | 3300047472 | Bacteria | 14482 |
| 310 | Ga0495686_0049030 | 3300047472 | Bacteria | 2659 |
| 311 | Ga0495686_0052452 | 3300047472 | Bacteria | 2557 |
| 312 | Ga0496104_0321642 | 3300048907 | Bacteria | 1460 |
| 313 | Ga0496105_0084897 | 3300048908 | Bacteria | 2616 |
| 314 | Ga0496110_0087364 | 3300048913 | Bacteria | 2785 |
| 315 | Ga0496111_0003497 | 3300048914 | Bacteria | 9719 |
| 316 | Ga0496112_0004721 | 3300048915 | Bacteria | 11612 |
| 317 | Ga0496113_0130227 | 3300048916 | Bacteria | 1973 |
| 318 | Ga0496114_0038222 | 3300048917 | Bacteria | 3971 |
| 319 | Ga0496116_0000080 | 3300048919 | Bacteria | 224530 |
| 320 | Ga0496116_0002774 | 3300048919 | Bacteria | 18003 |
| 321 | Ga0496116_0004619 | 3300048919 | Bacteria | 13052 |
| 322 | Ga0496116_0004929 | 3300048919 | Bacteria | 12577 |
| 323 | Ga0496116_0006070 | 3300048919 | Bacteria | 11054 |
| 324 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 325 | Ga0496117_0002938 | 3300048920 | Bacteria | 20628 |
| 326 | Ga0496117_0003435 | 3300048920 | Bacteria | 18428 |
| 327 | Ga0496117_0004016 | 3300048920 | Bacteria | 16589 |
| 328 | Ga0496117_0028812 | 3300048920 | Bacteria | 4292 |
| 329 | Ga0496117_0052801 | 3300048920 | Bacteria | 2860 |
| 330 | Ga0496117_0065162 | 3300048920 | Bacteria | 2479 |
| 331 | Ga0496117_0072659 | 3300048920 | Bacteria | 2298 |
| 332 | Ga0496118_0001656 | 3300048921 | Bacteria | 32720 |
| 333 | Ga0496118_0002528 | 3300048921 | Bacteria | 24531 |
| 334 | Ga0496118_0004982 | 3300048921 | Bacteria | 15351 |
| 335 | Ga0496118_0015790 | 3300048921 | Bacteria | 6966 |
| 336 | Ga0496118_0036260 | 3300048921 | Bacteria | 3990 |
| 337 | Ga0496118_0045335 | 3300048921 | Bacteria | 3434 |
| 338 | Ga0496119_0003135 | 3300048922 | Bacteria | 17414 |
| 339 | Ga0496119_0012020 | 3300048922 | Bacteria | 7083 |
| 340 | Ga0496119_0053279 | 3300048922 | Bacteria | 2472 |
| 341 | Ga0496119_0053616 | 3300048922 | Bacteria | 2462 |
| 342 | Ga0496119_0074573 | 3300048922 | Bacteria | 1975 |
| 343 | Ga0496120_0000021 | 3300048923 | Bacteria | 250966 |
| 344 | Ga0496120_0001808 | 3300048923 | Bacteria | 23949 |
| 345 | Ga0496120_0004424 | 3300048923 | Bacteria | 11795 |
| 346 | Ga0496120_0051187 | 3300048923 | Bacteria | 2360 |
| 347 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 348 | Ga0496121_0000459 | 3300048924 | Bacteria | 80085 |
| 349 | Ga0496121_0001940 | 3300048924 | Bacteria | 32987 |
| 350 | Ga0496121_0016156 | 3300048924 | Bacteria | 7730 |
| 351 | Ga0496121_0022977 | 3300048924 | Bacteria | 6025 |
| 352 | Ga0496121_0063677 | 3300048924 | Bacteria | 3011 |
| 353 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 354 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 355 | Ga0496122_0000247 | 3300048925 | Bacteria | 121291 |
| 356 | Ga0496122_0002082 | 3300048925 | Bacteria | 29663 |
| 357 | Ga0496122_0006417 | 3300048925 | Bacteria | 13508 |
| 358 | Ga0496122_0006956 | 3300048925 | Bacteria | 12745 |
| 359 | Ga0496122_0010026 | 3300048925 | Bacteria | 9855 |
| 360 | Ga0496122_0013353 | 3300048925 | Bacteria | 8045 |
| 361 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 362 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 363 | Ga0496123_0000222 | 3300048926 | Bacteria | 115482 |
| 364 | Ga0496123_0011146 | 3300048926 | Bacteria | 7831 |
| 365 | Ga0496123_0013913 | 3300048926 | Bacteria | 6702 |
| 366 | Ga0496123_0111412 | 3300048926 | Bacteria | 1563 |
| 367 | Ga0496124_0000063 | 3300048927 | Bacteria | 229705 |
| 368 | Ga0496124_0000592 | 3300048927 | Bacteria | 61048 |
| 369 | Ga0496124_0002394 | 3300048927 | Bacteria | 24664 |
| 370 | Ga0496124_0009274 | 3300048927 | Bacteria | 10150 |
| 371 | Ga0496124_0010148 | 3300048927 | Bacteria | 9583 |
| 372 | Ga0496124_0038494 | 3300048927 | Bacteria | 4152 |
| 373 | Ga0496124_0039327 | 3300048927 | Bacteria | 4101 |
| 374 | Ga0496124_0055913 | 3300048927 | Bacteria | 3332 |
| 375 | Ga0496124_0098010 | 3300048927 | Bacteria | 2379 |
| 376 | Ga0496124_0133848 | 3300048927 | Bacteria | 1965 |
| 377 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 378 | Ga0496125_0000557 | 3300048928 | Bacteria | 64217 |
| 379 | Ga0496125_0005358 | 3300048928 | Bacteria | 14312 |
| 380 | Ga0496125_0007390 | 3300048928 | Bacteria | 11692 |
| 381 | Ga0496125_0057046 | 3300048928 | Bacteria | 3166 |
| 382 | Ga0496125_0085081 | 3300048928 | Bacteria | 2398 |
| 383 | Ga0496125_0157560 | 3300048928 | Bacteria | 1548 |
| 384 | Ga0496126_0000438 | 3300048929 | Bacteria | 83060 |
| 385 | Ga0496126_0001405 | 3300048929 | Bacteria | 38083 |
| 386 | Ga0496126_0052716 | 3300048929 | Bacteria | 3695 |
| 387 | Ga0496126_0063940 | 3300048929 | Bacteria | 3297 |
| 388 | Ga0495678_009868 | 3300049459 | Bacteria | 4683 |
| 389 | Ga0501031_0000037 | 3300049568 | Bacteria | 73210 |
| 390 | Ga0501031_0015024 | 3300049568 | Bacteria | 5029 |
| 391 | Ga0501032_0000081 | 3300049569 | Bacteria | 82613 |
| 392 | Ga0501032_0000116 | 3300049569 | Bacteria | 67350 |
| 393 | Ga0501032_0038383 | 3300049569 | Bacteria | 3262 |
| 394 | Ga0501032_0051622 | 3300049569 | Bacteria | 2772 |
| 395 | Ga0501032_0159737 | 3300049569 | Bacteria | 1480 |
| 396 | Ga0501033_0000097 | 3300049570 | Bacteria | 83228 |
| 397 | Ga0501033_0000171 | 3300049570 | Bacteria | 61888 |
| 398 | Ga0501033_0000501 | 3300049570 | Bacteria | 36835 |
| 399 | Ga0501033_0001994 | 3300049570 | Bacteria | 17795 |
| 400 | Ga0501033_0003939 | 3300049570 | Bacteria | 12043 |
| 401 | Ga0501033_0008539 | 3300049570 | Bacteria | 7923 |
| 402 | Ga0501033_0040448 | 3300049570 | Bacteria | 3480 |
| 403 | Ga0501033_0099030 | 3300049570 | Bacteria | 2129 |
| 404 | Ga0501033_0165221 | 3300049570 | Bacteria | 1591 |
| 405 | Ga0501034_0000186 | 3300049571 | Bacteria | 116500 |
| 406 | Ga0501034_0003453 | 3300049571 | Bacteria | 18014 |
| 407 | Ga0501034_0004432 | 3300049571 | Bacteria | 15628 |
| 408 | Ga0501034_0006126 | 3300049571 | Bacteria | 12976 |
| 409 | Ga0501034_0025197 | 3300049571 | Bacteria | 6054 |
| 410 | Ga0501034_0200783 | 3300049571 | Bacteria | 1952 |
| 411 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 412 | Ga0501036_0000117 | 3300049572 | Bacteria | 49511 |
| 413 | Ga0501037_0000095 | 3300049573 | Bacteria | 82641 |
| 414 | Ga0501037_0000108 | 3300049573 | Bacteria | 77753 |
| 415 | Ga0501037_0000451 | 3300049573 | Bacteria | 33602 |
| 416 | Ga0501037_0029877 | 3300049573 | Bacteria | 4026 |
| 417 | Ga0501037_0149457 | 3300049573 | Bacteria | 1670 |
| 418 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 419 | Ga0501038_0000126 | 3300049574 | Bacteria | 64756 |
| 420 | Ga0501038_0031440 | 3300049574 | Bacteria | 4691 |
| 421 | Ga0501038_0098426 | 3300049574 | Bacteria | 2439 |
| 422 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 423 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 424 | Ga0501039_0056119 | 3300049575 | Bacteria | 3051 |
| 425 | Ga0501040_0004757 | 3300049576 | Bacteria | 8803 |
| 426 | Ga0501040_0034502 | 3300049576 | Bacteria | 3427 |
| 427 | Ga0501040_0184914 | 3300049576 | Bacteria | 1478 |
| 428 | Ga0501041_0020926 | 3300049577 | Bacteria | 3917 |
| 429 | Ga0501042_0031541 | 3300049578 | Bacteria | 3749 |
| 430 | Ga0501043_0000081 | 3300049579 | Bacteria | 85059 |
| 431 | Ga0501043_0000140 | 3300049579 | Bacteria | 67478 |
| 432 | Ga0501043_0000162 | 3300049579 | Bacteria | 60676 |
| 433 | Ga0501043_0046250 | 3300049579 | Bacteria | 3422 |
| 434 | Ga0501043_0120863 | 3300049579 | Bacteria | 2054 |
| 435 | Ga0501046_0007521 | 3300049580 | Bacteria | 9557 |
| 436 | Ga0501047_0001069 | 3300049581 | Bacteria | 27308 |
| 437 | Ga0501047_0008935 | 3300049581 | Bacteria | 9461 |
| 438 | Ga0501047_0020656 | 3300049581 | Bacteria | 6322 |
| 439 | Ga0501047_0084377 | 3300049581 | Bacteria | 3053 |
| 440 | Ga0501047_0100696 | 3300049581 | Bacteria | 2769 |
| 441 | Ga0501047_0150278 | 3300049581 | Bacteria | 2205 |
| 442 | Ga0501047_0164809 | 3300049581 | Bacteria | 2087 |
| 443 | Ga0501047_0245424 | 3300049581 | Bacteria | 1640 |
| 444 | Ga0501069_0000118 | 3300049585 | Bacteria | 35026 |
| 445 | Ga0501069_0058040 | 3300049585 | Bacteria | 2158 |
| 446 | Ga0501070_0000127 | 3300049586 | Bacteria | 68100 |
| 447 | Ga0501070_0002038 | 3300049586 | Bacteria | 17765 |
| 448 | Ga0501070_0010186 | 3300049586 | Bacteria | 7955 |
| 449 | Ga0501070_0016008 | 3300049586 | Bacteria | 6301 |
| 450 | Ga0501070_0044569 | 3300049586 | Bacteria | 3690 |
| 451 | Ga0501070_0057259 | 3300049586 | Bacteria | 3231 |
| 452 | Ga0501070_0079084 | 3300049586 | Bacteria | 2721 |
| 453 | Ga0501070_0087750 | 3300049586 | Bacteria | 2575 |
| 454 | Ga0501070_0345512 | 3300049586 | Bacteria | 1208 |
| 455 | Ga0501071_0041718 | 3300049587 | Bacteria | 3287 |
| 456 | Ga0501073_0031877 | 3300049589 | Bacteria | 3760 |
| 457 | Ga0501073_0044664 | 3300049589 | Bacteria | 3123 |
| 458 | Ga0501074_0000062 | 3300049590 | Bacteria | 51831 |
| 459 | Ga0501074_0017250 | 3300049590 | Bacteria | 5238 |
| 460 | Ga0501080_0000254 | 3300049742 | Bacteria | 40217 |
| 461 | Ga0501080_0026203 | 3300049742 | Bacteria | 5417 |
| 462 | Ga0501083_0000453 | 3300049744 | Bacteria | 26265 |
| 463 | Ga0501083_0032262 | 3300049744 | Bacteria | 3594 |
| 464 | Ga0501280_002482 | 3300049776 | Bacteria | 3057 |
| 465 | Ga0501035_0000017 | 3300049822 | Bacteria | 241915 |
| 466 | Ga0501035_0000100 | 3300049822 | Bacteria | 107321 |
| 467 | Ga0501035_0001153 | 3300049822 | Bacteria | 27594 |
| 468 | Ga0501035_0001764 | 3300049822 | Bacteria | 21833 |
| 469 | Ga0501035_0002971 | 3300049822 | Bacteria | 16304 |
| 470 | Ga0501035_0058917 | 3300049822 | Bacteria | 3420 |
| 471 | Ga0501035_0076851 | 3300049822 | Bacteria | 2951 |
| 472 | Ga0501035_0195360 | 3300049822 | Bacteria | 1738 |
| 473 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 474 | Ga0501044_0000751 | 3300049823 | Bacteria | 39231 |
| 475 | Ga0501044_0030478 | 3300049823 | Bacteria | 5684 |
| 476 | Ga0501044_0040211 | 3300049823 | Bacteria | 4874 |
| 477 | Ga0501044_0041123 | 3300049823 | Bacteria | 4813 |
| 478 | Ga0501044_0044749 | 3300049823 | Bacteria | 4591 |
| 479 | Ga0501044_0056676 | 3300049823 | Bacteria | 4023 |
| 480 | Ga0501044_0090220 | 3300049823 | Bacteria | 3092 |
| 481 | Ga0501044_0110800 | 3300049823 | Bacteria | 2753 |
| 482 | Ga0501044_0161467 | 3300049823 | Bacteria | 2217 |
| 483 | nmdc:mga03683_18138_c1 | 3300050489 | Bacteria | 2672 |
| 484 | nmdc:mga00v17_40101_c1 | 3300050491 | Bacteria | 2808 |
| 485 | nmdc:mga00v17_690_c1 | 3300050491 | Bacteria | 18535 |
| 486 | nmdc:mga00v17_90_c1 | 3300050491 | Bacteria | 53278 |
| 487 | nmdc:mga00v17_92752_c1 | 3300050491 | Bacteria | 1898 |
| 488 | nmdc:mga0yw44_1586_c1 | 3300050492 | Bacteria | 9129 |
| 489 | nmdc:mga0yw44_6030_c1 | 3300050492 | Bacteria | 5806 |
| 490 | nmdc:mga0yw44_79671_c1 | 3300050492 | Bacteria | 2050 |
| 491 | nmdc:mga0yw44_937_c1 | 3300050492 | Bacteria | 7973 |
| 492 | nmdc:mga06z11_152809_c1 | 3300050494 | Bacteria | 1314 |
| 493 | nmdc:mga06z11_34216_c1 | 3300050494 | Bacteria | 2493 |
| 494 | nmdc:mga06z11_69452_c1 | 3300050494 | Bacteria | 1860 |
| 495 | nmdc:mga07m45_136486_c1 | 3300050496 | Bacteria | 1420 |
| 496 | nmdc:mga0sz30_11731_c1 | 3300050516 | Bacteria | 3393 |
| 497 | nmdc:mga0sz30_14203_c1 | 3300050516 | Bacteria | 3130 |
| 498 | nmdc:mga0sz30_711_c2 | 3300050516 | Bacteria | 11673 |
| 499 | Ga0495655_0004667 | 3300053083 | Bacteria | 2364 |
| 500 | Ga0500578_0037488 | 3300053086 | Bacteria | 3114 |
| 501 | Ga0500643_018034 | 3300053087 | Bacteria | 2351 |
| 502 | Ga0500560_012286 | 3300053107 | Bacteria | 2214 |
| 503 | Ga0500569_000527 | 3300053109 | Bacteria | 6373 |
| 504 | Ga0500594_0001679 | 3300053118 | Bacteria | 4822 |
| 505 | Ga0500618_000132 | 3300053125 | Bacteria | 62415 |
| 506 | Ga0500618_000360 | 3300053125 | Bacteria | 31678 |
| 507 | Ga0500642_0076166 | 3300053130 | Bacteria | 1534 |
| 508 | Ga0500658_0005556 | 3300053134 | Bacteria | 4691 |
| 509 | Ga0500561_0000208 | 3300053137 | Bacteria | 10664 |
| 510 | Ga0500568_0000048 | 3300053139 | Bacteria | 119025 |
| 511 | Ga0500568_0000533 | 3300053139 | Bacteria | 28047 |
| 512 | Ga0500573_0000746 | 3300053140 | Bacteria | 14543 |
| 513 | Ga0500590_002289 | 3300053148 | Bacteria | 8415 |
| 514 | Ga0500616_0000191 | 3300053153 | Bacteria | 100381 |
| 515 | Ga0500616_0001527 | 3300053153 | Bacteria | 21789 |
| 516 | Ga0500616_0029737 | 3300053153 | Bacteria | 3004 |
| 517 | Ga0500620_000553 | 3300053155 | Bacteria | 6440 |
| 518 | Ga0500627_0061574 | 3300053158 | Bacteria | 1651 |
| 519 | Ga0500633_0034441 | 3300053160 | Bacteria | 1661 |
| 520 | Ga0500634_0000129 | 3300053161 | Bacteria | 27162 |
| 521 | Ga0500636_0000010 | 3300053177 | Bacteria | 145932 |
| 522 | Ga0587072_003865 | 3300059643 | Bacteria | 2137 |
| 523 | Ga0501082_0034529 | 3300060353 | Bacteria | 4359 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2906393657 | 2906400435 | 374 |
| 2 | iso_pu_bacteria | 3004289098 | 3004291175 | 376 |
| 3 | 3300049579 | Ga0501043_0120863 | Ga0501043_0120863_11_1153 | 379 |
| 4 | 3300049586 | Ga0501070_0345512 | Ga0501070_0345512_19_1161 | 379 |
| 5 | 3300049823 | Ga0501044_0161467 | Ga0501044_0161467_1014_2156 | 379 |
| 6 | 3300049570 | Ga0501033_0165221 | Ga0501033_0165221_273_1430 | 384 |
| 7 | iso_pu_bacteria | 2906354277 | 2906362902 | 398 |
| 8 | iso_pu_bacteria | 2965089291 | 2965092326 | 405 |
| 9 | iso_pu_bacteria | 2924710171 | 2924717691 | 407 |
| 10 | iso_pu_bacteria | 2979779861 | 2979782932 | 411 |
| 11 | 3300048913 | Ga0496110_0087364 | Ga0496110_0087364_642_1970 | 415 |
| 12 | 3300048914 | Ga0496111_0003497 | Ga0496111_0003497_1614_2942 | 415 |
| 13 | 3300048925 | Ga0496122_0010026 | Ga0496122_0010026_5820_7148 | 415 |
| 14 | 3300050494 | nmdc:mga06z11_152809_c1 | nmdc:mga06z11_152809_c1_29_1279 | 415 |
| 15 | iso_pu_bacteria | 2899803654 | 2899804384 | 415 |
| 16 | iso_pu_bacteria | 2938014810 | 2938015355 | 418 |
| 17 | iso_pu_bacteria | 2906378014 | 2906378742 | 420 |
| 18 | 3300046692 | Ga0495671_0108881 | Ga0495671_0108881_23_1288 | 421 |
| 19 | 3300047318 | Ga0495636_0029664 | Ga0495636_0029664_27_1292 | 421 |
| 20 | 3300049576 | Ga0501040_0184914 | Ga0501040_0184914_110_1435 | 424 |
| 21 | 3300049571 | Ga0501034_0200783 | Ga0501034_0200783_62_1387 | 427 |
| 22 | iso_pu_bacteria | 2551306087 | 2551699839 | 428 |
| 23 | 3300048908 | Ga0496105_0084897 | Ga0496105_0084897_659_1951 | 429 |
| 24 | 3300049576 | Ga0501040_0034502 | Ga0501040_0034502_2113_3405 | 429 |
| 25 | iso_pu_bacteria | 2643221558 | 2643810454 | 429 |
| 26 | iso_pu_bacteria | 2913308742 | 2913310632 | 430 |
| 27 | 3300025292 | Ga0209676_1005846 | Ga0209676_10058463 | 431 |
| 28 | 3300025297 | Ga0209758_1000191 | Ga0209758_1000191130 | 431 |
| 29 | 3300025298 | Ga0209050_1003450 | Ga0209050_10034509 | 431 |
| 30 | 3300025303 | Ga0209051_1000860 | Ga0209051_100086026 | 431 |
| 31 | 3300025304 | Ga0209257_1001225 | Ga0209257_100122519 | 431 |
| 32 | 3300048927 | Ga0496124_0133848 | Ga0496124_0133848_21_1319 | 431 |
| 33 | 3300049822 | Ga0501035_0195360 | Ga0501035_0195360_202_1500 | 431 |
| 34 | 3300053153 | Ga0500616_0000191 | Ga0500616_0000191_79101_80399 | 431 |
| 35 | iso_pu_bacteria | 2838042994 | 2838047201 | 431 |
| 36 | iso_pu_bacteria | 2838048938 | 2838053914 | 431 |
| 37 | iso_pu_bacteria | 2838680041 | 2838680704 | 431 |
| 38 | iso_pu_bacteria | 2838694306 | 2838695263 | 431 |
| 39 | iso_pu_bacteria | 2838707686 | 2838708639 | 431 |
| 40 | iso_pu_bacteria | 2841864319 | 2841866702 | 431 |
| 41 | iso_pu_bacteria | 2842077413 | 2842080126 | 431 |
| 42 | iso_pu_bacteria | 2842118031 | 2842120746 | 431 |
| 43 | iso_pu_bacteria | 2842237096 | 2842238051 | 431 |
| 44 | iso_pu_bacteria | 2842291075 | 2842293786 | 431 |
| 45 | iso_pu_bacteria | 2842341865 | 2842342967 | 431 |
| 46 | iso_pu_bacteria | 2842363717 | 2842367311 | 431 |
| 47 | iso_pu_bacteria | 2842370503 | 2842371167 | 431 |
| 48 | iso_pu_bacteria | 2842377471 | 2842380182 | 431 |
| 49 | iso_pu_bacteria | 2842384541 | 2842387254 | 431 |
| 50 | iso_pu_bacteria | 2996336353 | 2996338165 | 431 |
| 51 | 3300049569 | Ga0501032_0038383 | Ga0501032_0038383_1011_2333 | 432 |
| 52 | 3300049573 | Ga0501037_0149457 | Ga0501037_0149457_219_1541 | 432 |
| 53 | 3300049581 | Ga0501047_0008935 | Ga0501047_0008935_3850_5172 | 432 |
| 54 | 3300049585 | Ga0501069_0058040 | Ga0501069_0058040_43_1365 | 432 |
| 55 | 3300049586 | Ga0501070_0016008 | Ga0501070_0016008_2496_3818 | 432 |
| 56 | 3300049589 | Ga0501073_0044664 | Ga0501073_0044664_1315_2637 | 432 |
| 57 | 3300049742 | Ga0501080_0026203 | Ga0501080_0026203_1632_2954 | 432 |
| 58 | 3300049822 | Ga0501035_0058917 | Ga0501035_0058917_1554_2876 | 432 |
| 59 | 3300049823 | Ga0501044_0041123 | Ga0501044_0041123_1033_2355 | 432 |
| 60 | iso_pu_bacteria | 2513237159 | 2513999849 | 432 |
| 61 | iso_pu_bacteria | 2842521101 | 2842526422 | 432 |
| 62 | iso_pu_bacteria | 2989771324 | 2989774059 | 432 |
| 63 | 3300046460 | Ga0495638_0012359 | Ga0495638_0012359_2343_3665 | 433 |
| 64 | iso_pu_bacteria | 2503198000 | 2503203100 | 433 |
| 65 | iso_pu_bacteria | 2508501122 | 2509107196 | 433 |
| 66 | iso_pu_bacteria | 2508501123 | 2509114885 | 433 |
| 67 | iso_pu_bacteria | 2508501127 | 2509143356 | 433 |
| 68 | iso_pu_bacteria | 2509276018 | 2509372678 | 433 |
| 69 | iso_pu_bacteria | 2509276019 | 2509374838 | 433 |
| 70 | iso_pu_bacteria | 2509276022 | 2509397562 | 433 |
| 71 | iso_pu_bacteria | 2510065057 | 2510304894 | 433 |
| 72 | iso_pu_bacteria | 2510065059 | 2510319749 | 433 |
| 73 | iso_pu_bacteria | 2511231052 | 2511500684 | 433 |
| 74 | iso_pu_bacteria | 2512047086 | 2512532104 | 433 |
| 75 | iso_pu_bacteria | 2512875016 | 2512930091 | 433 |
| 76 | iso_pu_bacteria | 2512875024 | 2512964775 | 433 |
| 77 | iso_pu_bacteria | 2512875026 | 2512972563 | 433 |
| 78 | iso_pu_bacteria | 2513237086 | 2513585751 | 433 |
| 79 | iso_pu_bacteria | 2513237089 | 2513606663 | 433 |
| 80 | iso_pu_bacteria | 2513237090 | 2513611836 | 433 |
| 81 | iso_pu_bacteria | 2513237091 | 2513616824 | 433 |
| 82 | iso_pu_bacteria | 2513237140 | 2513880762 | 433 |
| 83 | iso_pu_bacteria | 2513237143 | 2513903756 | 433 |
| 84 | iso_pu_bacteria | 2513237156 | 2513986145 | 433 |
| 85 | iso_pu_bacteria | 2513237160 | 2514007559 | 433 |
| 86 | iso_pu_bacteria | 2513237164 | 2514033126 | 433 |
| 87 | iso_pu_bacteria | 2513237351 | 2514589720 | 433 |
| 88 | iso_pu_bacteria | 2515154107 | 2515607818 | 433 |
| 89 | iso_pu_bacteria | 2516143018 | 2516208560 | 433 |
| 90 | iso_pu_bacteria | 2516653046 | 2516891959 | 433 |
| 91 | iso_pu_bacteria | 2517487022 | 2517568772 | 433 |
| 92 | iso_pu_bacteria | 2519899620 | 2520379988 | 433 |
| 93 | iso_pu_bacteria | 2524023207 | 2524450009 | 433 |
| 94 | iso_pu_bacteria | 2551306084 | 2551676532 | 433 |
| 95 | iso_pu_bacteria | 2551306085 | 2551686924 | 433 |
| 96 | iso_pu_bacteria | 2551306086 | 2551695778 | 433 |
| 97 | iso_pu_bacteria | 2551306089 | 2551709887 | 433 |
| 98 | iso_pu_bacteria | 2551306090 | 2551723489 | 433 |
| 99 | iso_pu_bacteria | 2551306091 | 2551728074 | 433 |
| 100 | iso_pu_bacteria | 2558860100 | 2558863830 | 433 |
| 101 | iso_pu_bacteria | 2582581283 | 2585165108 | 433 |
| 102 | iso_pu_bacteria | 2582581306 | 2585266681 | 433 |
| 103 | iso_pu_bacteria | 2582581865 | 2585387697 | 433 |
| 104 | iso_pu_bacteria | 2582581866 | 2585394290 | 433 |
| 105 | iso_pu_bacteria | 2588253730 | 2588515707 | 433 |
| 106 | iso_pu_bacteria | 2597489875 | 2597814831 | 433 |
| 107 | iso_pu_bacteria | 2599185156 | 2599333138 | 433 |
| 108 | iso_pu_bacteria | 2599185301 | 2599937337 | 433 |
| 109 | iso_pu_bacteria | 2599185352 | 2600191558 | 433 |
| 110 | iso_pu_bacteria | 2600254933 | 2600374813 | 433 |
| 111 | iso_pu_bacteria | 2643221550 | 2643773539 | 433 |
| 112 | iso_pu_bacteria | 2643221551 | 2643775720 | 433 |
| 113 | iso_pu_bacteria | 2643221555 | 2643794167 | 433 |
| 114 | iso_pu_bacteria | 2643221557 | 2643807590 | 433 |
| 115 | iso_pu_bacteria | 2643221564 | 2643837263 | 433 |
| 116 | iso_pu_bacteria | 2643221568 | 2643856279 | 433 |
| 117 | iso_pu_bacteria | 2643221595 | 2643986610 | 433 |
| 118 | iso_pu_bacteria | 2643221607 | 2644047034 | 433 |
| 119 | iso_pu_bacteria | 2643221610 | 2644070002 | 433 |
| 120 | iso_pu_bacteria | 2643221618 | 2644103084 | 433 |
| 121 | iso_pu_bacteria | 2643221623 | 2644133020 | 433 |
| 122 | iso_pu_bacteria | 2643221626 | 2644151987 | 433 |
| 123 | iso_pu_bacteria | 2643221627 | 2644157545 | 433 |
| 124 | iso_pu_bacteria | 2643221636 | 2644203527 | 433 |
| 125 | iso_pu_bacteria | 2643221655 | 2644306011 | 433 |
| 126 | iso_pu_bacteria | 2643221659 | 2644330319 | 433 |
| 127 | iso_pu_bacteria | 2643221668 | 2644380973 | 433 |
| 128 | iso_pu_bacteria | 2643221675 | 2644414879 | 433 |
| 129 | iso_pu_bacteria | 2643221680 | 2644448536 | 433 |
| 130 | iso_pu_bacteria | 2643221686 | 2644479823 | 433 |
| 131 | iso_pu_bacteria | 2643221688 | 2644493760 | 433 |
| 132 | iso_pu_bacteria | 2643221689 | 2644496634 | 433 |
| 133 | iso_pu_bacteria | 2643221698 | 2644542934 | 433 |
| 134 | iso_pu_bacteria | 2643221712 | 2644619038 | 433 |
| 135 | iso_pu_bacteria | 2643221723 | 2644673929 | 433 |
| 136 | iso_pu_bacteria | 2643221726 | 2644689157 | 433 |
| 137 | iso_pu_bacteria | 2657244999 | 2657681994 | 433 |
| 138 | iso_pu_bacteria | 2687453392 | 2688599959 | 433 |
| 139 | iso_pu_bacteria | 2690316117 | 2692317153 | 433 |
| 140 | iso_pu_bacteria | 2693429783 | 2694634027 | 433 |
| 141 | iso_pu_bacteria | 2693429784 | 2694638602 | 433 |
| 142 | iso_pu_bacteria | 2721755686 | 2723576754 | 433 |
| 143 | iso_pu_bacteria | 2738543024 | 2739306356 | 433 |
| 144 | iso_pu_bacteria | 2756170246 | 2756673493 | 433 |
| 145 | iso_pu_bacteria | 2757320392 | 2757569278 | 433 |
| 146 | iso_pu_bacteria | 2791355091 | 2792622354 | 433 |
| 147 | iso_pu_bacteria | 2791355092 | 2792628080 | 433 |
| 148 | iso_pu_bacteria | 2791355094 | 2792638665 | 433 |
| 149 | iso_pu_bacteria | 2791355123 | 2792748940 | 433 |
| 150 | iso_pu_bacteria | 2802428858 | 2802717415 | 433 |
| 151 | iso_pu_bacteria | 2802428859 | 2802723658 | 433 |
| 152 | iso_pu_bacteria | 2802428860 | 2802730893 | 433 |
| 153 | iso_pu_bacteria | 2802428861 | 2802735900 | 433 |
| 154 | iso_pu_bacteria | 2802428862 | 2802743891 | 433 |
| 155 | iso_pu_bacteria | 2802428863 | 2802752891 | 433 |
| 156 | iso_pu_bacteria | 2802429268 | 2804751012 | 433 |
| 157 | iso_pu_bacteria | 2838074704 | 2838075462 | 433 |
| 158 | iso_pu_bacteria | 2841734538 | 2841740915 | 433 |
| 159 | iso_pu_bacteria | 2842922631 | 2842923443 | 433 |
| 160 | iso_pu_bacteria | 2844002411 | 2844005959 | 433 |
| 161 | iso_pu_bacteria | 2844009547 | 2844015225 | 433 |
| 162 | iso_pu_bacteria | 2847417321 | 2847417776 | 433 |
| 163 | iso_pu_bacteria | 2847670302 | 2847671185 | 433 |
| 164 | iso_pu_bacteria | 2847686936 | 2847687330 | 433 |
| 165 | iso_pu_bacteria | 2848992105 | 2848992622 | 433 |
| 166 | iso_pu_bacteria | 2850079185 | 2850080132 | 433 |
| 167 | iso_pu_bacteria | 2855825444 | 2855831877 | 433 |
| 168 | iso_pu_bacteria | 2855839649 | 2855840164 | 433 |
| 169 | iso_pu_bacteria | 2855872281 | 2855873176 | 433 |
| 170 | iso_pu_bacteria | 2856314179 | 2856316699 | 433 |
| 171 | iso_pu_bacteria | 2856320880 | 2856324576 | 433 |
| 172 | iso_pu_bacteria | 2856328259 | 2856333211 | 433 |
| 173 | iso_pu_bacteria | 2856334872 | 2856338680 | 433 |
| 174 | iso_pu_bacteria | 2856342000 | 2856344581 | 433 |
| 175 | iso_pu_bacteria | 2856349417 | 2856349666 | 433 |
| 176 | iso_pu_bacteria | 2856364286 | 2856370948 | 433 |
| 177 | iso_pu_bacteria | 2857349434 | 2857355245 | 433 |
| 178 | iso_pu_bacteria | 2857367948 | 2857370572 | 433 |
| 179 | iso_pu_bacteria | 2858800743 | 2858804069 | 433 |
| 180 | iso_pu_bacteria | 2869169390 | 2869176773 | 433 |
| 181 | iso_pu_bacteria | 2869234852 | 2869240941 | 433 |
| 182 | iso_pu_bacteria | 2869242130 | 2869245692 | 433 |
| 183 | iso_pu_bacteria | 2869249662 | 2869251440 | 433 |
| 184 | iso_pu_bacteria | 2869256925 | 2869260921 | 433 |
| 185 | iso_pu_bacteria | 2869264136 | 2869269825 | 433 |
| 186 | iso_pu_bacteria | 2869278585 | 2869281426 | 433 |
| 187 | iso_pu_bacteria | 2869285874 | 2869292159 | 433 |
| 188 | iso_pu_bacteria | 2871429161 | 2871435366 | 433 |
| 189 | iso_pu_bacteria | 2871435913 | 2871441389 | 433 |
| 190 | iso_pu_bacteria | 2871444079 | 2871449961 | 433 |
| 191 | iso_pu_bacteria | 2871451962 | 2871458996 | 433 |
| 192 | iso_pu_bacteria | 2871459585 | 2871465448 | 433 |
| 193 | iso_pu_bacteria | 2871474448 | 2871474956 | 433 |
| 194 | iso_pu_bacteria | 2871488783 | 2871489260 | 433 |
| 195 | iso_pu_bacteria | 2871495908 | 2871495958 | 433 |
| 196 | iso_pu_bacteria | 2874102143 | 2874107125 | 433 |
| 197 | iso_pu_bacteria | 2874109183 | 2874110495 | 433 |
| 198 | iso_pu_bacteria | 2874116593 | 2874118757 | 433 |
| 199 | iso_pu_bacteria | 2874123672 | 2874131164 | 433 |
| 200 | iso_pu_bacteria | 2874131515 | 2874138469 | 433 |
| 201 | iso_pu_bacteria | 2874139085 | 2874140908 | 433 |
| 202 | iso_pu_bacteria | 2874146452 | 2874155067 | 433 |
| 203 | iso_pu_bacteria | 2874155637 | 2874161386 | 433 |
| 204 | iso_pu_bacteria | 2874162495 | 2874164599 | 433 |
| 205 | iso_pu_bacteria | 2874168670 | 2874170442 | 433 |
| 206 | iso_pu_bacteria | 2876363079 | 2876366345 | 433 |
| 207 | iso_pu_bacteria | 2876369609 | 2876376869 | 433 |
| 208 | iso_pu_bacteria | 2876377896 | 2876383541 | 433 |
| 209 | iso_pu_bacteria | 2876386047 | 2876387886 | 433 |
| 210 | iso_pu_bacteria | 2876392853 | 2876395542 | 433 |
| 211 | iso_pu_bacteria | 2876399893 | 2876404008 | 433 |
| 212 | iso_pu_bacteria | 2876406927 | 2876412674 | 433 |
| 213 | iso_pu_bacteria | 2876413966 | 2876420523 | 433 |
| 214 | iso_pu_bacteria | 2876420981 | 2876427038 | 433 |
| 215 | iso_pu_bacteria | 2878035449 | 2878036909 | 433 |
| 216 | iso_pu_bacteria | 2878738818 | 2878742686 | 433 |
| 217 | iso_pu_bacteria | 2878745973 | 2878752501 | 433 |
| 218 | iso_pu_bacteria | 2878753008 | 2878753796 | 433 |
| 219 | iso_pu_bacteria | 2878760144 | 2878760191 | 433 |
| 220 | iso_pu_bacteria | 2878767105 | 2878767151 | 433 |
| 221 | iso_pu_bacteria | 2878774303 | 2878776733 | 433 |
| 222 | iso_pu_bacteria | 2881147464 | 2881152268 | 433 |
| 223 | iso_pu_bacteria | 2881155292 | 2881156720 | 433 |
| 224 | iso_pu_bacteria | 2881161766 | 2881162135 | 433 |
| 225 | iso_pu_bacteria | 2881845957 | 2881852407 | 433 |
| 226 | iso_pu_bacteria | 2881853255 | 2881856748 | 433 |
| 227 | iso_pu_bacteria | 2881861095 | 2881865080 | 433 |
| 228 | iso_pu_bacteria | 2882632389 | 2882633457 | 433 |
| 229 | iso_pu_bacteria | 2885305155 | 2885310975 | 433 |
| 230 | iso_pu_bacteria | 2885312484 | 2885316569 | 433 |
| 231 | iso_pu_bacteria | 2885318864 | 2885321377 | 433 |
| 232 | iso_pu_bacteria | 2885326080 | 2885329832 | 433 |
| 233 | iso_pu_bacteria | 2885342637 | 2885347743 | 433 |
| 234 | iso_pu_bacteria | 2885350715 | 2885354050 | 433 |
| 235 | iso_pu_bacteria | 2888337043 | 2888341138 | 433 |
| 236 | iso_pu_bacteria | 2888343758 | 2888348317 | 433 |
| 237 | iso_pu_bacteria | 2888350351 | 2888357321 | 433 |
| 238 | iso_pu_bacteria | 2889010040 | 2889012275 | 433 |
| 239 | iso_pu_bacteria | 2889016732 | 2889022833 | 433 |
| 240 | iso_pu_bacteria | 2891373044 | 2891376260 | 433 |
| 241 | iso_pu_bacteria | 2896384573 | 2896385433 | 433 |
| 242 | iso_pu_bacteria | 2903448605 | 2903452605 | 433 |
| 243 | iso_pu_bacteria | 2903492973 | 2903497140 | 433 |
| 244 | iso_pu_bacteria | 2903492973 | 2903505326 | 433 |
| 245 | iso_pu_bacteria | 2903521522 | 2903524213 | 433 |
| 246 | iso_pu_bacteria | 2903528002 | 2903533604 | 433 |
| 247 | iso_pu_bacteria | 2903540706 | 2903540753 | 433 |
| 248 | iso_pu_bacteria | 2904659560 | 2904662173 | 433 |
| 249 | iso_pu_bacteria | 2906308376 | 2906314895 | 433 |
| 250 | iso_pu_bacteria | 2906321335 | 2906328067 | 433 |
| 251 | iso_pu_bacteria | 2906328253 | 2906332663 | 433 |
| 252 | iso_pu_bacteria | 2906363423 | 2906366780 | 433 |
| 253 | iso_pu_bacteria | 2906386501 | 2906391646 | 433 |
| 254 | iso_pu_bacteria | 2906401398 | 2906404248 | 433 |
| 255 | iso_pu_bacteria | 2906408224 | 2906413484 | 433 |
| 256 | iso_pu_bacteria | 2906414383 | 2906416836 | 433 |
| 257 | iso_pu_bacteria | 2913295892 | 2913297884 | 433 |
| 258 | iso_pu_bacteria | 2915980308 | 2915982325 | 433 |
| 259 | iso_pu_bacteria | 2915986958 | 2915989371 | 433 |
| 260 | iso_pu_bacteria | 2915993759 | 2915999528 | 433 |
| 261 | iso_pu_bacteria | 2916000859 | 2916001497 | 433 |
| 262 | iso_pu_bacteria | 2916007675 | 2916010952 | 433 |
| 263 | iso_pu_bacteria | 2916014648 | 2916015280 | 433 |
| 264 | iso_pu_bacteria | 2916021584 | 2916022179 | 433 |
| 265 | iso_pu_bacteria | 2916028427 | 2916032698 | 433 |
| 266 | iso_pu_bacteria | 2916035215 | 2916041475 | 433 |
| 267 | iso_pu_bacteria | 2916041962 | 2916045895 | 433 |
| 268 | iso_pu_bacteria | 2916048683 | 2916051641 | 433 |
| 269 | iso_pu_bacteria | 2916055098 | 2916059412 | 433 |
| 270 | iso_pu_bacteria | 2916061851 | 2916062662 | 433 |
| 271 | iso_pu_bacteria | 2916068649 | 2916069521 | 433 |
| 272 | iso_pu_bacteria | 2916076590 | 2916082726 | 433 |
| 273 | iso_pu_bacteria | 2919166419 | 2919166954 | 433 |
| 274 | iso_pu_bacteria | 2920760137 | 2920763224 | 433 |
| 275 | iso_pu_bacteria | 2920822456 | 2920823476 | 433 |
| 276 | iso_pu_bacteria | 2921201388 | 2921205684 | 433 |
| 277 | iso_pu_bacteria | 2921208531 | 2921210795 | 433 |
| 278 | iso_pu_bacteria | 2921237296 | 2921237729 | 433 |
| 279 | iso_pu_bacteria | 2921244191 | 2921250562 | 433 |
| 280 | iso_pu_bacteria | 2921250672 | 2921250677 | 433 |
| 281 | iso_pu_bacteria | 2921257292 | 2921257998 | 433 |
| 282 | iso_pu_bacteria | 2921263974 | 2921268394 | 433 |
| 283 | iso_pu_bacteria | 2921282425 | 2921284163 | 433 |
| 284 | iso_pu_bacteria | 2921289301 | 2921295745 | 433 |
| 285 | iso_pu_bacteria | 2921296804 | 2921303644 | 433 |
| 286 | iso_pu_bacteria | 2922130491 | 2922137183 | 433 |
| 287 | iso_pu_bacteria | 2922151315 | 2922155239 | 433 |
| 288 | iso_pu_bacteria | 2922172374 | 2922177709 | 433 |
| 289 | iso_pu_bacteria | 2922178524 | 2922178892 | 433 |
| 290 | iso_pu_bacteria | 2922185730 | 2922194045 | 433 |
| 291 | iso_pu_bacteria | 2924144063 | 2924150525 | 433 |
| 292 | iso_pu_bacteria | 2924150972 | 2924155742 | 433 |
| 293 | iso_pu_bacteria | 2924158325 | 2924161356 | 433 |
| 294 | iso_pu_bacteria | 2924165586 | 2924169551 | 433 |
| 295 | iso_pu_bacteria | 2924172951 | 2924177075 | 433 |
| 296 | iso_pu_bacteria | 2924179722 | 2924180394 | 433 |
| 297 | iso_pu_bacteria | 2924186466 | 2924190523 | 433 |
| 298 | iso_pu_bacteria | 2924193448 | 2924199774 | 433 |
| 299 | iso_pu_bacteria | 2924200457 | 2924206730 | 433 |
| 300 | iso_pu_bacteria | 2924207177 | 2924213667 | 433 |
| 301 | iso_pu_bacteria | 2924214083 | 2924216741 | 433 |
| 302 | iso_pu_bacteria | 2924221636 | 2924225521 | 433 |
| 303 | iso_pu_bacteria | 2924228884 | 2924229517 | 433 |
| 304 | iso_pu_bacteria | 2924718760 | 2924721737 | 433 |
| 305 | iso_pu_bacteria | 2924726620 | 2924727972 | 433 |
| 306 | iso_pu_bacteria | 2924733363 | 2924735207 | 433 |
| 307 | iso_pu_bacteria | 2924748358 | 2924753625 | 433 |
| 308 | iso_pu_bacteria | 2924762789 | 2924765754 | 433 |
| 309 | iso_pu_bacteria | 2924776078 | 2924780486 | 433 |
| 310 | iso_pu_bacteria | 2924784321 | 2924791957 | 433 |
| 311 | iso_pu_bacteria | 2936996657 | 2936999287 | 433 |
| 312 | iso_pu_bacteria | 2937002841 | 2937009403 | 433 |
| 313 | iso_pu_bacteria | 2937009748 | 2937016024 | 433 |
| 314 | iso_pu_bacteria | 2937016420 | 2937022465 | 433 |
| 315 | iso_pu_bacteria | 2937023124 | 2937026805 | 433 |
| 316 | iso_pu_bacteria | 2937029754 | 2937030146 | 433 |
| 317 | iso_pu_bacteria | 2937036028 | 2937037862 | 433 |
| 318 | iso_pu_bacteria | 2937042894 | 2937043580 | 433 |
| 319 | iso_pu_bacteria | 2937049772 | 2937053805 | 433 |
| 320 | iso_pu_bacteria | 2937056579 | 2937060901 | 433 |
| 321 | iso_pu_bacteria | 2937063883 | 2937070678 | 433 |
| 322 | iso_pu_bacteria | 2937071275 | 2937078350 | 433 |
| 323 | iso_pu_bacteria | 2937078374 | 2937080221 | 433 |
| 324 | iso_pu_bacteria | 2937084907 | 2937087194 | 433 |
| 325 | iso_pu_bacteria | 2937091812 | 2937094634 | 433 |
| 326 | iso_pu_bacteria | 2937098957 | 2937102041 | 433 |
| 327 | iso_pu_bacteria | 2937106411 | 2937109645 | 433 |
| 328 | iso_pu_bacteria | 2937113482 | 2937117017 | 433 |
| 329 | iso_pu_bacteria | 2937119839 | 2937125653 | 433 |
| 330 | iso_pu_bacteria | 2937126314 | 2937132363 | 433 |
| 331 | iso_pu_bacteria | 2937813078 | 2937821293 | 433 |
| 332 | iso_pu_bacteria | 2937822353 | 2937823200 | 433 |
| 333 | iso_pu_bacteria | 2937836603 | 2937839482 | 433 |
| 334 | iso_pu_bacteria | 2937848649 | 2937855278 | 433 |
| 335 | iso_pu_bacteria | 2937861824 | 2937866072 | 433 |
| 336 | iso_pu_bacteria | 2937877337 | 2937883013 | 433 |
| 337 | iso_pu_bacteria | 2937891427 | 2937895972 | 433 |
| 338 | iso_pu_bacteria | 2937972304 | 2937973765 | 433 |
| 339 | iso_pu_bacteria | 2937980651 | 2937983527 | 433 |
| 340 | iso_pu_bacteria | 2937994558 | 2937994608 | 433 |
| 341 | iso_pu_bacteria | 2941499720 | 2941500617 | 433 |
| 342 | iso_pu_bacteria | 2957375807 | 2957377482 | 433 |
| 343 | iso_pu_bacteria | 2957382221 | 2957388130 | 433 |
| 344 | iso_pu_bacteria | 2957388812 | 2957392614 | 433 |
| 345 | iso_pu_bacteria | 2957395598 | 2957398496 | 433 |
| 346 | iso_pu_bacteria | 2957402308 | 2957408186 | 433 |
| 347 | iso_pu_bacteria | 2957408893 | 2957414617 | 433 |
| 348 | iso_pu_bacteria | 2957415311 | 2957415670 | 433 |
| 349 | iso_pu_bacteria | 2957422303 | 2957428362 | 433 |
| 350 | iso_pu_bacteria | 2957430029 | 2957433808 | 433 |
| 351 | iso_pu_bacteria | 2957437181 | 2957443602 | 433 |
| 352 | iso_pu_bacteria | 2957443900 | 2957446394 | 433 |
| 353 | iso_pu_bacteria | 2957450854 | 2957457277 | 433 |
| 354 | iso_pu_bacteria | 2957457609 | 2957458185 | 433 |
| 355 | iso_pu_bacteria | 2957464669 | 2957470720 | 433 |
| 356 | iso_pu_bacteria | 2957471148 | 2957474784 | 433 |
| 357 | iso_pu_bacteria | 2957478035 | 2957484404 | 433 |
| 358 | iso_pu_bacteria | 2957484790 | 2957488389 | 433 |
| 359 | iso_pu_bacteria | 2957491536 | 2957495457 | 433 |
| 360 | iso_pu_bacteria | 2957498199 | 2957502243 | 433 |
| 361 | iso_pu_bacteria | 2957505466 | 2957509332 | 433 |
| 362 | iso_pu_bacteria | 2958034702 | 2958037388 | 433 |
| 363 | iso_pu_bacteria | 2958041894 | 2958047100 | 433 |
| 364 | iso_pu_bacteria | 2958064165 | 2958069633 | 433 |
| 365 | iso_pu_bacteria | 2958071322 | 2958076645 | 433 |
| 366 | iso_pu_bacteria | 2958084443 | 2958090139 | 433 |
| 367 | iso_pu_bacteria | 2958092219 | 2958098886 | 433 |
| 368 | iso_pu_bacteria | 2958100919 | 2958105673 | 433 |
| 369 | iso_pu_bacteria | 2958108152 | 2958112630 | 433 |
| 370 | iso_pu_bacteria | 2958115193 | 2958117690 | 433 |
| 371 | iso_pu_bacteria | 2958122699 | 2958122886 | 433 |
| 372 | iso_pu_bacteria | 2958130278 | 2958136559 | 433 |
| 373 | iso_pu_bacteria | 2958158011 | 2958162240 | 433 |
| 374 | iso_pu_bacteria | 2958165035 | 2958165086 | 433 |
| 375 | iso_pu_bacteria | 2958172287 | 2958174899 | 433 |
| 376 | iso_pu_bacteria | 2958179912 | 2958186053 | 433 |
| 377 | iso_pu_bacteria | 2960584000 | 2960586284 | 433 |
| 378 | iso_pu_bacteria | 2960591022 | 2960593690 | 433 |
| 379 | iso_pu_bacteria | 2960597568 | 2960603167 | 433 |
| 380 | iso_pu_bacteria | 2960603979 | 2960604443 | 433 |
| 381 | iso_pu_bacteria | 2960610863 | 2960614870 | 433 |
| 382 | iso_pu_bacteria | 2960617483 | 2960621105 | 433 |
| 383 | iso_pu_bacteria | 2960624210 | 2960628496 | 433 |
| 384 | iso_pu_bacteria | 2960631154 | 2960632999 | 433 |
| 385 | iso_pu_bacteria | 2960637947 | 2960638273 | 433 |
| 386 | iso_pu_bacteria | 2960645483 | 2960650348 | 433 |
| 387 | iso_pu_bacteria | 2960652885 | 2960653644 | 433 |
| 388 | iso_pu_bacteria | 2960660292 | 2960664720 | 433 |
| 389 | iso_pu_bacteria | 2960667422 | 2960668324 | 433 |
| 390 | iso_pu_bacteria | 2960674078 | 2960675901 | 433 |
| 391 | iso_pu_bacteria | 2960680706 | 2960685563 | 433 |
| 392 | iso_pu_bacteria | 2960687367 | 2960691617 | 433 |
| 393 | iso_pu_bacteria | 2960693952 | 2960695576 | 433 |
| 394 | iso_pu_bacteria | 2961077736 | 2961084534 | 433 |
| 395 | iso_pu_bacteria | 2961114664 | 2961117327 | 433 |
| 396 | iso_pu_bacteria | 2961127735 | 2961129874 | 433 |
| 397 | iso_pu_bacteria | 2961163497 | 2961163546 | 433 |
| 398 | iso_pu_bacteria | 2961170736 | 2961171598 | 433 |
| 399 | iso_pu_bacteria | 2961183825 | 2961186691 | 433 |
| 400 | iso_pu_bacteria | 2963644680 | 2963649141 | 433 |
| 401 | iso_pu_bacteria | 2964607997 | 2964615243 | 433 |
| 402 | iso_pu_bacteria | 2964615318 | 2964619568 | 433 |
| 403 | iso_pu_bacteria | 2964621998 | 2964622642 | 433 |
| 404 | iso_pu_bacteria | 2964628898 | 2964633612 | 433 |
| 405 | iso_pu_bacteria | 2964636051 | 2964638511 | 433 |
| 406 | iso_pu_bacteria | 2964643177 | 2964649565 | 433 |
| 407 | iso_pu_bacteria | 2964649959 | 2964653546 | 433 |
| 408 | iso_pu_bacteria | 2964656573 | 2964661822 | 433 |
| 409 | iso_pu_bacteria | 2964663802 | 2964670439 | 433 |
| 410 | iso_pu_bacteria | 2964670856 | 2964677982 | 433 |
| 411 | iso_pu_bacteria | 2964678106 | 2964681361 | 433 |
| 412 | iso_pu_bacteria | 2964685014 | 2964685493 | 433 |
| 413 | iso_pu_bacteria | 2964691889 | 2964692247 | 433 |
| 414 | iso_pu_bacteria | 2964698721 | 2964700646 | 433 |
| 415 | iso_pu_bacteria | 2964705432 | 2964712584 | 433 |
| 416 | iso_pu_bacteria | 2964712639 | 2964715720 | 433 |
| 417 | iso_pu_bacteria | 2964719344 | 2964725156 | 433 |
| 418 | iso_pu_bacteria | 2965018300 | 2965018349 | 433 |
| 419 | iso_pu_bacteria | 2965025482 | 2965030483 | 433 |
| 420 | iso_pu_bacteria | 2965032056 | 2965038853 | 433 |
| 421 | iso_pu_bacteria | 2965040258 | 2965044579 | 433 |
| 422 | iso_pu_bacteria | 2965047637 | 2965053080 | 433 |
| 423 | iso_pu_bacteria | 2965062239 | 2965065888 | 433 |
| 424 | iso_pu_bacteria | 2967664464 | 2967666149 | 433 |
| 425 | iso_pu_bacteria | 2967671571 | 2967672063 | 433 |
| 426 | iso_pu_bacteria | 2967678726 | 2967683309 | 433 |
| 427 | iso_pu_bacteria | 2967686174 | 2967691841 | 433 |
| 428 | iso_pu_bacteria | 2967693043 | 2967696622 | 433 |
| 429 | iso_pu_bacteria | 2967699805 | 2967702385 | 433 |
| 430 | iso_pu_bacteria | 2967706974 | 2967711770 | 433 |
| 431 | iso_pu_bacteria | 2967714385 | 2967718186 | 433 |
| 432 | iso_pu_bacteria | 2967721400 | 2967725988 | 433 |
| 433 | iso_pu_bacteria | 2967728569 | 2967729893 | 433 |
| 434 | iso_pu_bacteria | 2967735183 | 2967738218 | 433 |
| 435 | iso_pu_bacteria | 2967742019 | 2967744781 | 433 |
| 436 | iso_pu_bacteria | 2967748971 | 2967755106 | 433 |
| 437 | iso_pu_bacteria | 2967755722 | 2967756685 | 433 |
| 438 | iso_pu_bacteria | 2967762386 | 2967767078 | 433 |
| 439 | iso_pu_bacteria | 2967769361 | 2967775337 | 433 |
| 440 | iso_pu_bacteria | 2967775926 | 2967777399 | 433 |
| 441 | iso_pu_bacteria | 2967996073 | 2967996325 | 433 |
| 442 | iso_pu_bacteria | 2968003550 | 2968004558 | 433 |
| 443 | iso_pu_bacteria | 2968016561 | 2968019772 | 433 |
| 444 | iso_pu_bacteria | 2968083720 | 2968084386 | 433 |
| 445 | iso_pu_bacteria | 2968091066 | 2968096704 | 433 |
| 446 | iso_pu_bacteria | 2968097103 | 2968099906 | 433 |
| 447 | iso_pu_bacteria | 2968110612 | 2968113235 | 433 |
| 448 | iso_pu_bacteria | 2968117919 | 2968123594 | 433 |
| 449 | iso_pu_bacteria | 2968128360 | 2968132871 | 433 |
| 450 | iso_pu_bacteria | 2968171901 | 2968171949 | 433 |
| 451 | iso_pu_bacteria | 2970019648 | 2970024809 | 433 |
| 452 | iso_pu_bacteria | 2970026789 | 2970032500 | 433 |
| 453 | iso_pu_bacteria | 2970033650 | 2970037609 | 433 |
| 454 | iso_pu_bacteria | 2970040964 | 2970045277 | 433 |
| 455 | iso_pu_bacteria | 2970047711 | 2970054087 | 433 |
| 456 | iso_pu_bacteria | 2970054988 | 2970058781 | 433 |
| 457 | iso_pu_bacteria | 2970061556 | 2970063758 | 433 |
| 458 | iso_pu_bacteria | 2970068827 | 2970072795 | 433 |
| 459 | iso_pu_bacteria | 2970076120 | 2970081531 | 433 |
| 460 | iso_pu_bacteria | 2970082768 | 2970086240 | 433 |
| 461 | iso_pu_bacteria | 2970088815 | 2970095356 | 433 |
| 462 | iso_pu_bacteria | 2970095765 | 2970096222 | 433 |
| 463 | iso_pu_bacteria | 2970102677 | 2970106380 | 433 |
| 464 | iso_pu_bacteria | 2970109326 | 2970113575 | 433 |
| 465 | iso_pu_bacteria | 2970116247 | 2970120309 | 433 |
| 466 | iso_pu_bacteria | 2970122695 | 2970123806 | 433 |
| 467 | iso_pu_bacteria | 2970129317 | 2970132900 | 433 |
| 468 | iso_pu_bacteria | 2970136068 | 2970139864 | 433 |
| 469 | iso_pu_bacteria | 2970143518 | 2970145585 | 433 |
| 470 | iso_pu_bacteria | 2970149975 | 2970153700 | 433 |
| 471 | iso_pu_bacteria | 2970156795 | 2970161651 | 433 |
| 472 | iso_pu_bacteria | 2970164137 | 2970170275 | 433 |
| 473 | iso_pu_bacteria | 2970170962 | 2970177496 | 433 |
| 474 | iso_pu_bacteria | 2970177841 | 2970181446 | 433 |
| 475 | iso_pu_bacteria | 2970184632 | 2970190944 | 433 |
| 476 | iso_pu_bacteria | 2970191845 | 2970195849 | 433 |
| 477 | iso_pu_bacteria | 2970469710 | 2970473093 | 433 |
| 478 | iso_pu_bacteria | 2970489779 | 2970495241 | 433 |
| 479 | iso_pu_bacteria | 2970503327 | 2970504025 | 433 |
| 480 | iso_pu_bacteria | 2970510686 | 2970515703 | 433 |
| 481 | iso_pu_bacteria | 2970524798 | 2970531330 | 433 |
| 482 | iso_pu_bacteria | 2970540015 | 2970541644 | 433 |
| 483 | iso_pu_bacteria | 2970547951 | 2970553536 | 433 |
| 484 | iso_pu_bacteria | 2970554993 | 2970555042 | 433 |
| 485 | iso_pu_bacteria | 2970593180 | 2970596030 | 433 |
| 486 | iso_pu_bacteria | 2970619444 | 2970626277 | 433 |
| 487 | iso_pu_bacteria | 2970627176 | 2970631630 | 433 |
| 488 | iso_pu_bacteria | 2977516862 | 2977520654 | 433 |
| 489 | iso_pu_bacteria | 2977523885 | 2977530397 | 433 |
| 490 | iso_pu_bacteria | 2977530762 | 2977537631 | 433 |
| 491 | iso_pu_bacteria | 2977537788 | 2977544014 | 433 |
| 492 | iso_pu_bacteria | 2977544691 | 2977549875 | 433 |
| 493 | iso_pu_bacteria | 2977551784 | 2977555720 | 433 |
| 494 | iso_pu_bacteria | 2977558990 | 2977559516 | 433 |
| 495 | iso_pu_bacteria | 2977565890 | 2977572285 | 433 |
| 496 | iso_pu_bacteria | 2977572785 | 2977577604 | 433 |
| 497 | iso_pu_bacteria | 2977579622 | 2977583972 | 433 |
| 498 | iso_pu_bacteria | 2977821940 | 2977823014 | 433 |
| 499 | iso_pu_bacteria | 2977843712 | 2977849506 | 433 |
| 500 | iso_pu_bacteria | 2977851361 | 2977857893 | 433 |
| 501 | iso_pu_bacteria | 2977858184 | 2977864589 | 433 |
| 502 | iso_pu_bacteria | 2977864932 | 2977866426 | 433 |
| 503 | iso_pu_bacteria | 2977872689 | 2977875902 | 433 |
| 504 | iso_pu_bacteria | 2977907340 | 2977912357 | 433 |
| 505 | iso_pu_bacteria | 2977915119 | 2977920731 | 433 |
| 506 | iso_pu_bacteria | 2977922695 | 2977926959 | 433 |
| 507 | iso_pu_bacteria | 2977935797 | 2977939382 | 433 |
| 508 | iso_pu_bacteria | 2977942078 | 2977948789 | 433 |
| 509 | iso_pu_bacteria | 2977957713 | 2977961711 | 433 |
| 510 | iso_pu_bacteria | 2977971508 | 2977971692 | 433 |
| 511 | iso_pu_bacteria | 2977986579 | 2977987389 | 433 |
| 512 | iso_pu_bacteria | 2978969890 | 2978973373 | 433 |
| 513 | iso_pu_bacteria | 2979710463 | 2979713542 | 433 |
| 514 | iso_pu_bacteria | 2979742915 | 2979744911 | 433 |
| 515 | iso_pu_bacteria | 2979764755 | 2979768944 | 433 |
| 516 | iso_pu_bacteria | 2979772303 | 2979774018 | 433 |
| 517 | iso_pu_bacteria | 2979808191 | 2979808660 | 433 |
| 518 | iso_pu_bacteria | 2984587000 | 2984591655 | 433 |
| 519 | iso_pu_bacteria | 2987636660 | 2987640378 | 433 |
| 520 | iso_pu_bacteria | 2987645492 | 2987647356 | 433 |
| 521 | iso_pu_bacteria | 2987652177 | 2987659141 | 433 |
| 522 | iso_pu_bacteria | 2987659509 | 2987659554 | 433 |
| 523 | iso_pu_bacteria | 2987666974 | 2987673079 | 433 |
| 524 | iso_pu_bacteria | 2987673487 | 2987679046 | 433 |
| 525 | iso_pu_bacteria | 2989349275 | 2989355414 | 433 |
| 526 | iso_pu_bacteria | 2996310559 | 2996316675 | 433 |
| 527 | iso_pu_bacteria | 2996341866 | 2996347245 | 433 |
| 528 | iso_pu_bacteria | 2996348954 | 2996351783 | 433 |
| 529 | iso_pu_bacteria | 2996386984 | 2996390615 | 433 |
| 530 | iso_pu_bacteria | 3000135777 | 3000139054 | 433 |
| 531 | iso_pu_bacteria | 3003930520 | 3003932192 | 433 |
| 532 | iso_pu_bacteria | 3004167301 | 3004170710 | 433 |
| 533 | iso_pu_bacteria | 3004188549 | 3004188597 | 433 |
| 534 | iso_pu_bacteria | 3004203850 | 3004208576 | 433 |
| 535 | iso_pu_bacteria | 3004211236 | 3004214830 | 433 |
| 536 | iso_pu_bacteria | 3004218560 | 3004222579 | 433 |
| 537 | iso_pu_bacteria | 3004232784 | 3004237610 | 433 |
| 538 | iso_pu_bacteria | 3004248173 | 3004251729 | 433 |
| 539 | iso_pu_bacteria | 3004268573 | 3004271699 | 433 |
| 540 | iso_pu_bacteria | 3004275668 | 3004278482 | 433 |
| 541 | iso_pu_bacteria | 3004334049 | 3004339626 | 433 |
| 542 | iso_pu_bacteria | 637000159 | 637079873 | 433 |
| 543 | iso_pu_bacteria | 643692032 | 643824633 | 433 |
| 544 | iso_pu_bacteria | 648276728 | 648741465 | 433 |
| 545 | iso_pu_bacteria | 649633066 | 649874437 | 433 |
| 546 | iso_pu_bacteria | 8002285264 | 8002287685 | 433 |
| 547 | iso_pu_bacteria | 8003992118 | 8003992577 | 433 |
| 548 | iso_pu_bacteria | 8003999396 | 8003999899 | 433 |
| 549 | iso_pu_bacteria | 8004300914 | 8004303404 | 433 |
| 550 | iso_pu_bacteria | 8004312739 | 8004315443 | 433 |
| 551 | iso_pu_bacteria | 8004361976 | 8004367223 | 433 |
| 552 | iso_pu_bacteria | 8004374579 | 8004375370 | 433 |
| 553 | iso_pu_bacteria | 8004387939 | 8004394861 | 433 |
| 554 | iso_pu_bacteria | 8004395343 | 8004401869 | 433 |
| 555 | iso_pu_bacteria | 8004445564 | 8004451202 | 433 |
| 556 | iso_pu_bacteria | 8004633249 | 8004635367 | 433 |
| 557 | iso_pu_bacteria | 8004640170 | 8004642805 | 433 |
| 558 | iso_pu_bacteria | 8004703790 | 8004711573 | 433 |
| 559 | iso_pu_bacteria | 8004714634 | 8004721156 | 433 |
| 560 | iso_pu_bacteria | 8004727605 | 8004731153 | 433 |
| 561 | iso_pu_bacteria | 8054460903 | 8054461375 | 433 |
| 562 | iso_pu_bacteria | 8054558443 | 8054563089 | 433 |
| 563 | iso_pu_bacteria | 8055617313 | 8055622510 | 433 |
| 564 | 3300013105 | Ga0157369_10098581 | Ga0157369_100985812 | 434 |
| 565 | 3300046492 | Ga0495585_0012209 | Ga0495585_0012209_1472_2776 | 434 |
| 566 | 3300046515 | Ga0495620_0018738 | Ga0495620_0018738_1418_2722 | 434 |
| 567 | 3300049570 | Ga0501033_0000171 | Ga0501033_0000171_11958_13262 | 434 |
| 568 | 3300049822 | Ga0501035_0002971 | Ga0501035_0002971_7793_9097 | 434 |
| 569 | 3300053125 | Ga0500618_000360 | Ga0500618_000360_23696_25003 | 434 |
| 570 | iso_pu_bacteria | 2510917026 | 2511170151 | 434 |
| 571 | iso_pu_bacteria | 2511231027 | 2511390775 | 434 |
| 572 | iso_pu_bacteria | 2558860983 | 2561467335 | 434 |
| 573 | iso_pu_bacteria | 2582581304 | 2585257101 | 434 |
| 574 | iso_pu_bacteria | 2643221634 | 2644190699 | 434 |
| 575 | iso_pu_bacteria | 2738541317 | 2738945686 | 434 |
| 576 | iso_pu_bacteria | 2765235802 | 2765464394 | 434 |
| 577 | iso_pu_bacteria | 2767802442 | 2770194751 | 434 |
| 578 | iso_pu_bacteria | 2775506902 | 2776272460 | 434 |
| 579 | iso_pu_bacteria | 2775506904 | 2776284400 | 434 |
| 580 | iso_pu_bacteria | 2791355253 | 2793281952 | 434 |
| 581 | iso_pu_bacteria | 2839993093 | 2839994305 | 434 |
| 582 | iso_pu_bacteria | 2840764183 | 2840769283 | 434 |
| 583 | iso_pu_bacteria | 2842871566 | 2842873522 | 434 |
| 584 | iso_pu_bacteria | 2852387548 | 2852388593 | 434 |
| 585 | iso_pu_bacteria | 2854896431 | 2854898383 | 434 |
| 586 | iso_pu_bacteria | 2854916844 | 2854919097 | 434 |
| 587 | iso_pu_bacteria | 2894652903 | 2894655318 | 434 |
| 588 | iso_pu_bacteria | 2904578770 | 2904579019 | 434 |
| 589 | iso_pu_bacteria | 2919119836 | 2919122154 | 434 |
| 590 | iso_pu_bacteria | 2919171160 | 2919171967 | 434 |
| 591 | iso_pu_bacteria | 2928521798 | 2928521909 | 434 |
| 592 | iso_pu_bacteria | 2929138655 | 2929139049 | 434 |
| 593 | iso_pu_bacteria | 2954011201 | 2954014734 | 434 |
| 594 | iso_pu_bacteria | 3002141150 | 3002142710 | 434 |
| 595 | iso_pu_bacteria | 8005658619 | 8005660429 | 434 |
| 596 | iso_pu_bacteria | 8055431914 | 8055433378 | 434 |
| 597 | iso_pu_bacteria | 8056875544 | 8056879232 | 434 |
| 598 | 3300005548 | Ga0070665_100080233 | Ga0070665_1000802334 | 435 |
| 599 | 3300009177 | Ga0105248_10084414 | Ga0105248_100844144 | 435 |
| 600 | 3300009765 | Ga0123341_1009192 | Ga0123341_10091922 | 435 |
| 601 | 3300009766 | Ga0123342_1010831 | Ga0123342_10108319 | 435 |
| 602 | 3300041492 | Ga0451835_0651872 | Ga0451835_0651872_232_1539 | 435 |
| 603 | 3300046492 | Ga0495585_0017543 | Ga0495585_0017543_2058_3365 | 435 |
| 604 | 3300046501 | Ga0495607_0045498 | Ga0495607_0045498_604_1911 | 435 |
| 605 | 3300046507 | Ga0495606_0081419 | Ga0495606_0081419_570_1877 | 435 |
| 606 | 3300046512 | Ga0495610_0000975 | Ga0495610_0000975_3322_4629 | 435 |
| 607 | 3300046515 | Ga0495620_0006890 | Ga0495620_0006890_2050_3357 | 435 |
| 608 | 3300046515 | Ga0495620_0009193 | Ga0495620_0009193_1180_2487 | 435 |
| 609 | 3300046515 | Ga0495620_0055028 | Ga0495620_0055028_181_1488 | 435 |
| 610 | 3300046519 | Ga0495632_0003225 | Ga0495632_0003225_4675_5982 | 435 |
| 611 | 3300046558 | Ga0495633_0010509 | Ga0495633_0010509_3418_4725 | 435 |
| 612 | 3300046660 | Ga0495625_0066799 | Ga0495625_0066799_805_2112 | 435 |
| 613 | 3300047443 | Ga0495687_026666 | Ga0495687_026666_740_2047 | 435 |
| 614 | 3300047472 | Ga0495686_0003176 | Ga0495686_0003176_3034_4341 | 435 |
| 615 | 3300047472 | Ga0495686_0052452 | Ga0495686_0052452_508_1815 | 435 |
| 616 | 3300048929 | Ga0496126_0063940 | Ga0496126_0063940_1219_2526 | 435 |
| 617 | 3300049459 | Ga0495678_009868 | Ga0495678_009868_1494_2801 | 435 |
| 618 | 3300050489 | nmdc:mga03683_18138_c1 | nmdc:mga03683_18138_c1_1193_2500 | 435 |
| 619 | 3300050492 | nmdc:mga0yw44_6030_c1 | nmdc:mga0yw44_6030_c1_2773_4080 | 435 |
| 620 | 3300050496 | nmdc:mga07m45_136486_c1 | nmdc:mga07m45_136486_c1_44_1351 | 435 |
| 621 | 3300050516 | nmdc:mga0sz30_14203_c1 | nmdc:mga0sz30_14203_c1_1017_2324 | 435 |
| 622 | 3300053134 | Ga0500658_0005556 | Ga0500658_0005556_322_1629 | 435 |
| 623 | 3300053153 | Ga0500616_0029737 | Ga0500616_0029737_144_1451 | 435 |
| 624 | 3300053160 | Ga0500633_0034441 | Ga0500633_0034441_251_1558 | 435 |
| 625 | iso_pu_bacteria | 2509276021 | 2509388312 | 435 |
| 626 | iso_pu_bacteria | 2509276033 | 2509443879 | 435 |
| 627 | iso_pu_bacteria | 2510065019 | 2510131588 | 435 |
| 628 | iso_pu_bacteria | 2510461076 | 2510897882 | 435 |
| 629 | iso_pu_bacteria | 2510917022 | 2511136180 | 435 |
| 630 | iso_pu_bacteria | 2510917028 | 2511185591 | 435 |
| 631 | iso_pu_bacteria | 2513237084 | 2513571167 | 435 |
| 632 | iso_pu_bacteria | 2513237085 | 2513579289 | 435 |
| 633 | iso_pu_bacteria | 2513237088 | 2513598549 | 435 |
| 634 | iso_pu_bacteria | 2513237093 | 2513632262 | 435 |
| 635 | iso_pu_bacteria | 2513237103 | 2513713254 | 435 |
| 636 | iso_pu_bacteria | 2513237138 | 2513866372 | 435 |
| 637 | iso_pu_bacteria | 2513237144 | 2513907990 | 435 |
| 638 | iso_pu_bacteria | 2513237146 | 2513927646 | 435 |
| 639 | iso_pu_bacteria | 2513237162 | 2514020912 | 435 |
| 640 | iso_pu_bacteria | 2515075009 | 2515110511 | 435 |
| 641 | iso_pu_bacteria | 2515154113 | 2515636889 | 435 |
| 642 | iso_pu_bacteria | 2515154114 | 2515646808 | 435 |
| 643 | iso_pu_bacteria | 2515154116 | 2515659506 | 435 |
| 644 | iso_pu_bacteria | 2515154134 | 2515742979 | 435 |
| 645 | iso_pu_bacteria | 2516653077 | 2517039213 | 435 |
| 646 | iso_pu_bacteria | 2516653085 | 2517079456 | 435 |
| 647 | iso_pu_bacteria | 2517093000 | 2517093401 | 435 |
| 648 | iso_pu_bacteria | 2517287029 | 2517405098 | 435 |
| 649 | iso_pu_bacteria | 2524023209 | 2524457613 | 435 |
| 650 | iso_pu_bacteria | 2529292951 | 2530647695 | 435 |
| 651 | iso_pu_bacteria | 2534681796 | 2535515197 | 435 |
| 652 | iso_pu_bacteria | 2537561587 | 2537874352 | 435 |
| 653 | iso_pu_bacteria | 2554235003 | 2554246725 | 435 |
| 654 | iso_pu_bacteria | 2558860242 | 2559293952 | 435 |
| 655 | iso_pu_bacteria | 2582581294 | 2585203775 | 435 |
| 656 | iso_pu_bacteria | 2582581299 | 2585229085 | 435 |
| 657 | iso_pu_bacteria | 2582581307 | 2585275346 | 435 |
| 658 | iso_pu_bacteria | 2582581308 | 2585283473 | 435 |
| 659 | iso_pu_bacteria | 2582581315 | 2585325882 | 435 |
| 660 | iso_pu_bacteria | 2582581316 | 2585330054 | 435 |
| 661 | iso_pu_bacteria | 2582581867 | 2585398451 | 435 |
| 662 | iso_pu_bacteria | 2585427526 | 2585528413 | 435 |
| 663 | iso_pu_bacteria | 2585427527 | 2585536413 | 435 |
| 664 | iso_pu_bacteria | 2585427528 | 2585539806 | 435 |
| 665 | iso_pu_bacteria | 2585427530 | 2585556916 | 435 |
| 666 | iso_pu_bacteria | 2585427531 | 2585560211 | 435 |
| 667 | iso_pu_bacteria | 2585427590 | 2585819402 | 435 |
| 668 | iso_pu_bacteria | 2585427593 | 2585837787 | 435 |
| 669 | iso_pu_bacteria | 2585427594 | 2585844545 | 435 |
| 670 | iso_pu_bacteria | 2585427608 | 2585901522 | 435 |
| 671 | iso_pu_bacteria | 2585427609 | 2585905607 | 435 |
| 672 | iso_pu_bacteria | 2585428125 | 2587979277 | 435 |
| 673 | iso_pu_bacteria | 2599185170 | 2599419077 | 435 |
| 674 | iso_pu_bacteria | 2599185210 | 2599605505 | 435 |
| 675 | iso_pu_bacteria | 2600255279 | 2601609074 | 435 |
| 676 | iso_pu_bacteria | 2600255308 | 2601745849 | 435 |
| 677 | iso_pu_bacteria | 2615840624 | 2616295774 | 435 |
| 678 | iso_pu_bacteria | 2615840626 | 2616306226 | 435 |
| 679 | iso_pu_bacteria | 2615840698 | 2616553513 | 435 |
| 680 | iso_pu_bacteria | 2617270742 | 2617382569 | 435 |
| 681 | iso_pu_bacteria | 2643221582 | 2643921060 | 435 |
| 682 | iso_pu_bacteria | 2643221599 | 2644007447 | 435 |
| 683 | iso_pu_bacteria | 2643221643 | 2644241447 | 435 |
| 684 | iso_pu_bacteria | 2643221693 | 2644519133 | 435 |
| 685 | iso_pu_bacteria | 2667528174 | 2671112465 | 435 |
| 686 | iso_pu_bacteria | 2718217882 | 2719179674 | 435 |
| 687 | iso_pu_bacteria | 2718217927 | 2719384286 | 435 |
| 688 | iso_pu_bacteria | 2718217997 | 2719664020 | 435 |
| 689 | iso_pu_bacteria | 2718218009 | 2719730344 | 435 |
| 690 | iso_pu_bacteria | 2718218199 | 2720490439 | 435 |
| 691 | iso_pu_bacteria | 2718218232 | 2720611821 | 435 |
| 692 | iso_pu_bacteria | 2718218233 | 2720618676 | 435 |
| 693 | iso_pu_bacteria | 2718218235 | 2720630075 | 435 |
| 694 | iso_pu_bacteria | 2718218269 | 2720773770 | 435 |
| 695 | iso_pu_bacteria | 2718218363 | 2721145767 | 435 |
| 696 | iso_pu_bacteria | 2718218365 | 2721157299 | 435 |
| 697 | iso_pu_bacteria | 2718218366 | 2721162646 | 435 |
| 698 | iso_pu_bacteria | 2718218423 | 2721398000 | 435 |
| 699 | iso_pu_bacteria | 2721755514 | 2722838816 | 435 |
| 700 | iso_pu_bacteria | 2721755556 | 2723025440 | 435 |
| 701 | iso_pu_bacteria | 2721755684 | 2723559023 | 435 |
| 702 | iso_pu_bacteria | 2721755685 | 2723565630 | 435 |
| 703 | iso_pu_bacteria | 2721755809 | 2724036810 | 435 |
| 704 | iso_pu_bacteria | 2721755810 | 2724043100 | 435 |
| 705 | iso_pu_bacteria | 2721755819 | 2724088377 | 435 |
| 706 | iso_pu_bacteria | 2721755822 | 2724102895 | 435 |
| 707 | iso_pu_bacteria | 2721755823 | 2724108760 | 435 |
| 708 | iso_pu_bacteria | 2724679232 | 2725950136 | 435 |
| 709 | iso_pu_bacteria | 2728369352 | 2730106376 | 435 |
| 710 | iso_pu_bacteria | 2728369365 | 2730162911 | 435 |
| 711 | iso_pu_bacteria | 2728369397 | 2730296931 | 435 |
| 712 | iso_pu_bacteria | 2738541293 | 2738803728 | 435 |
| 713 | iso_pu_bacteria | 2738541333 | 2739034663 | 435 |
| 714 | iso_pu_bacteria | 2765235942 | 2766065589 | 435 |
| 715 | iso_pu_bacteria | 2775507266 | 2778174267 | 435 |
| 716 | iso_pu_bacteria | 2791355256 | 2793295109 | 435 |
| 717 | iso_pu_bacteria | 2791355259 | 2793315321 | 435 |
| 718 | iso_pu_bacteria | 2791355260 | 2793320176 | 435 |
| 719 | iso_pu_bacteria | 2791355261 | 2793326044 | 435 |
| 720 | iso_pu_bacteria | 2791355262 | 2793332537 | 435 |
| 721 | iso_pu_bacteria | 2791355263 | 2793343224 | 435 |
| 722 | iso_pu_bacteria | 2791355264 | 2793351019 | 435 |
| 723 | iso_pu_bacteria | 2791355265 | 2793353276 | 435 |
| 724 | iso_pu_bacteria | 2791355266 | 2793362657 | 435 |
| 725 | iso_pu_bacteria | 2791355267 | 2793364786 | 435 |
| 726 | iso_pu_bacteria | 2802429605 | 2805927479 | 435 |
| 727 | iso_pu_bacteria | 2802429606 | 2805932263 | 435 |
| 728 | iso_pu_bacteria | 2802429633 | 2806043962 | 435 |
| 729 | iso_pu_bacteria | 2802429634 | 2806052220 | 435 |
| 730 | iso_pu_bacteria | 2802429635 | 2806058521 | 435 |
| 731 | iso_pu_bacteria | 2802429636 | 2806067019 | 435 |
| 732 | iso_pu_bacteria | 2802429637 | 2806074762 | 435 |
| 733 | iso_pu_bacteria | 2808606387 | 2808986271 | 435 |
| 734 | iso_pu_bacteria | 2818991439 | 2819556403 | 435 |
| 735 | iso_pu_bacteria | 2818991448 | 2819608308 | 435 |
| 736 | iso_pu_bacteria | 2818991453 | 2819643427 | 435 |
| 737 | iso_pu_bacteria | 2838016132 | 2838022127 | 435 |
| 738 | iso_pu_bacteria | 2838022645 | 2838024539 | 435 |
| 739 | iso_pu_bacteria | 2838029111 | 2838029198 | 435 |
| 740 | iso_pu_bacteria | 2838035591 | 2838037236 | 435 |
| 741 | iso_pu_bacteria | 2838061910 | 2838066685 | 435 |
| 742 | iso_pu_bacteria | 2838068647 | 2838073740 | 435 |
| 743 | iso_pu_bacteria | 2838661181 | 2838663576 | 435 |
| 744 | iso_pu_bacteria | 2838668709 | 2838673169 | 435 |
| 745 | iso_pu_bacteria | 2838675328 | 2838677132 | 435 |
| 746 | iso_pu_bacteria | 2838686498 | 2838692640 | 435 |
| 747 | iso_pu_bacteria | 2838701080 | 2838703971 | 435 |
| 748 | iso_pu_bacteria | 2838714209 | 2838716019 | 435 |
| 749 | iso_pu_bacteria | 2838719591 | 2838720180 | 435 |
| 750 | iso_pu_bacteria | 2838724970 | 2838726772 | 435 |
| 751 | iso_pu_bacteria | 2838729681 | 2838732712 | 435 |
| 752 | iso_pu_bacteria | 2838742623 | 2838745607 | 435 |
| 753 | iso_pu_bacteria | 2841846520 | 2841847114 | 435 |
| 754 | iso_pu_bacteria | 2841851746 | 2841855251 | 435 |
| 755 | iso_pu_bacteria | 2841859092 | 2841860353 | 435 |
| 756 | iso_pu_bacteria | 2842110456 | 2842112319 | 435 |
| 757 | iso_pu_bacteria | 2842124991 | 2842126857 | 435 |
| 758 | iso_pu_bacteria | 2842130223 | 2842132025 | 435 |
| 759 | iso_pu_bacteria | 2842146304 | 2842148237 | 435 |
| 760 | iso_pu_bacteria | 2842152218 | 2842152806 | 435 |
| 761 | iso_pu_bacteria | 2842156927 | 2842161719 | 435 |
| 762 | iso_pu_bacteria | 2842163707 | 2842170122 | 435 |
| 763 | iso_pu_bacteria | 2842170452 | 2842172265 | 435 |
| 764 | iso_pu_bacteria | 2842175837 | 2842176425 | 435 |
| 765 | iso_pu_bacteria | 2842180545 | 2842185336 | 435 |
| 766 | iso_pu_bacteria | 2842187318 | 2842189127 | 435 |
| 767 | iso_pu_bacteria | 2842192696 | 2842193010 | 435 |
| 768 | iso_pu_bacteria | 2842198810 | 2842200356 | 435 |
| 769 | iso_pu_bacteria | 2842205361 | 2842206824 | 435 |
| 770 | iso_pu_bacteria | 2842211629 | 2842213441 | 435 |
| 771 | iso_pu_bacteria | 2842217011 | 2842218683 | 435 |
| 772 | iso_pu_bacteria | 2842224351 | 2842224941 | 435 |
| 773 | iso_pu_bacteria | 2842229732 | 2842233274 | 435 |
| 774 | iso_pu_bacteria | 2842243621 | 2842248722 | 435 |
| 775 | iso_pu_bacteria | 2842250916 | 2842253303 | 435 |
| 776 | iso_pu_bacteria | 2842257432 | 2842261865 | 435 |
| 777 | iso_pu_bacteria | 2842264693 | 2842267336 | 435 |
| 778 | iso_pu_bacteria | 2842271015 | 2842277071 | 435 |
| 779 | iso_pu_bacteria | 2842278818 | 2842280483 | 435 |
| 780 | iso_pu_bacteria | 2842285085 | 2842289433 | 435 |
| 781 | iso_pu_bacteria | 2842298080 | 2842300773 | 435 |
| 782 | iso_pu_bacteria | 2842304105 | 2842306372 | 435 |
| 783 | iso_pu_bacteria | 2842311132 | 2842312518 | 435 |
| 784 | iso_pu_bacteria | 2842317721 | 2842322549 | 435 |
| 785 | iso_pu_bacteria | 2842357229 | 2842358108 | 435 |
| 786 | iso_pu_bacteria | 2842395702 | 2842401278 | 435 |
| 787 | iso_pu_bacteria | 2842402390 | 2842406781 | 435 |
| 788 | iso_pu_bacteria | 2842409023 | 2842413722 | 435 |
| 789 | iso_pu_bacteria | 2842415677 | 2842420315 | 435 |
| 790 | iso_pu_bacteria | 2842422224 | 2842427188 | 435 |
| 791 | iso_pu_bacteria | 2842428310 | 2842431412 | 435 |
| 792 | iso_pu_bacteria | 2842434925 | 2842437747 | 435 |
| 793 | iso_pu_bacteria | 2842441272 | 2842444562 | 435 |
| 794 | iso_pu_bacteria | 2842447887 | 2842450310 | 435 |
| 795 | iso_pu_bacteria | 2842462802 | 2842465610 | 435 |
| 796 | iso_pu_bacteria | 2842469257 | 2842472420 | 435 |
| 797 | iso_pu_bacteria | 2842475841 | 2842476372 | 435 |
| 798 | iso_pu_bacteria | 2842482326 | 2842482446 | 435 |
| 799 | iso_pu_bacteria | 2842489311 | 2842492352 | 435 |
| 800 | iso_pu_bacteria | 2842495871 | 2842500917 | 435 |
| 801 | iso_pu_bacteria | 2842502639 | 2842502726 | 435 |
| 802 | iso_pu_bacteria | 2842509118 | 2842509302 | 435 |
| 803 | iso_pu_bacteria | 2842515876 | 2842517138 | 435 |
| 804 | iso_pu_bacteria | 2844454524 | 2844455866 | 435 |
| 805 | iso_pu_bacteria | 2857516855 | 2857522201 | 435 |
| 806 | iso_pu_bacteria | 2889790730 | 2889794935 | 435 |
| 807 | iso_pu_bacteria | 2889914905 | 2889918300 | 435 |
| 808 | iso_pu_bacteria | 2899792073 | 2899792420 | 435 |
| 809 | iso_pu_bacteria | 2899845264 | 2899846689 | 435 |
| 810 | iso_pu_bacteria | 2919114240 | 2919116223 | 435 |
| 811 | iso_pu_bacteria | 2919408235 | 2919408898 | 435 |
| 812 | iso_pu_bacteria | 2923556063 | 2923557294 | 435 |
| 813 | iso_pu_bacteria | 2926754445 | 2926757177 | 435 |
| 814 | iso_pu_bacteria | 2926760298 | 2926761394 | 435 |
| 815 | iso_pu_bacteria | 2933006813 | 2933007451 | 435 |
| 816 | iso_pu_bacteria | 2933011516 | 2933012219 | 435 |
| 817 | iso_pu_bacteria | 2933016740 | 2933022374 | 435 |
| 818 | iso_pu_bacteria | 2933570622 | 2933573441 | 435 |
| 819 | iso_pu_bacteria | 2933586486 | 2933587648 | 435 |
| 820 | iso_pu_bacteria | 2933594066 | 2933594662 | 435 |
| 821 | iso_pu_bacteria | 2933599457 | 2933604168 | 435 |
| 822 | iso_pu_bacteria | 2935894831 | 2935895786 | 435 |
| 823 | iso_pu_bacteria | 2935901341 | 2935907761 | 435 |
| 824 | iso_pu_bacteria | 2936367885 | 2936368808 | 435 |
| 825 | iso_pu_bacteria | 2936375103 | 2936377114 | 435 |
| 826 | iso_pu_bacteria | 2936381700 | 2936387351 | 435 |
| 827 | iso_pu_bacteria | 2979089926 | 2979093322 | 435 |
| 828 | iso_pu_bacteria | 2979095461 | 2979099294 | 435 |
| 829 | iso_pu_bacteria | 2979100975 | 2979105292 | 435 |
| 830 | iso_pu_bacteria | 2984509177 | 2984512852 | 435 |
| 831 | iso_pu_bacteria | 2984518228 | 2984520784 | 435 |
| 832 | iso_pu_bacteria | 2984537506 | 2984540079 | 435 |
| 833 | iso_pu_bacteria | 2984601300 | 2984602270 | 435 |
| 834 | iso_pu_bacteria | 2996887358 | 2996892084 | 435 |
| 835 | iso_pu_bacteria | 2996893221 | 2996893562 | 435 |
| 836 | iso_pu_bacteria | 3005416602 | 3005422714 | 435 |
| 837 | iso_pu_bacteria | 3005452660 | 3005452939 | 435 |
| 838 | iso_pu_bacteria | 639633055 | 639646784 | 435 |
| 839 | iso_pu_bacteria | 650716007 | 650739143 | 435 |
| 840 | iso_pu_bacteria | 8003570095 | 8003570149 | 435 |
| 841 | iso_pu_bacteria | 8005258706 | 8005263590 | 435 |
| 842 | iso_pu_bacteria | 8005275841 | 8005279001 | 435 |
| 843 | iso_pu_bacteria | 8005282627 | 8005283688 | 435 |
| 844 | iso_pu_bacteria | 8005289223 | 8005291817 | 435 |
| 845 | iso_pu_bacteria | 8005301065 | 8005303956 | 435 |
| 846 | iso_pu_bacteria | 8005307578 | 8005308774 | 435 |
| 847 | iso_pu_bacteria | 8005314921 | 8005321750 | 435 |
| 848 | iso_pu_bacteria | 8005321885 | 8005326611 | 435 |
| 849 | iso_pu_bacteria | 8005376324 | 8005377313 | 435 |
| 850 | iso_pu_bacteria | 8005382845 | 8005387183 | 435 |
| 851 | iso_pu_bacteria | 8005395548 | 8005401942 | 435 |
| 852 | iso_pu_bacteria | 8005430974 | 8005433038 | 435 |
| 853 | iso_pu_bacteria | 8005460587 | 8005461151 | 435 |
| 854 | iso_pu_bacteria | 8005484373 | 8005486044 | 435 |
| 855 | iso_pu_bacteria | 8005497431 | 8005498764 | 435 |
| 856 | iso_pu_bacteria | 8005542996 | 8005543875 | 435 |
| 857 | iso_pu_bacteria | 8005556819 | 8005560752 | 435 |
| 858 | iso_pu_bacteria | 8005563573 | 8005569734 | 435 |
| 859 | iso_pu_bacteria | 8005570704 | 8005577039 | 435 |
| 860 | iso_pu_bacteria | 8005619151 | 8005619958 | 435 |
| 861 | iso_pu_bacteria | 8005626139 | 8005628557 | 435 |
| 862 | iso_pu_bacteria | 8005645114 | 8005646571 | 435 |
| 863 | iso_pu_bacteria | 8005668836 | 8005670175 | 435 |
| 864 | iso_pu_bacteria | 8005682033 | 8005685017 | 435 |
| 865 | iso_pu_bacteria | 8005688590 | 8005690382 | 435 |
| 866 | iso_pu_bacteria | 8005695170 | 8005700264 | 435 |
| 867 | iso_pu_bacteria | 8018127388 | 8018133236 | 435 |
| 868 | iso_pu_bacteria | 8018150411 | 8018151738 | 435 |
| 869 | iso_pu_bacteria | 8018163183 | 8018167777 | 435 |
| 870 | iso_pu_bacteria | 8018176218 | 8018180203 | 435 |
| 871 | iso_pu_bacteria | 8023680758 | 8023684102 | 435 |
| 872 | iso_pu_bacteria | 8024479707 | 8024480407 | 435 |
| 873 | iso_pu_bacteria | 8024486573 | 8024489362 | 435 |
| 874 | iso_pu_bacteria | 8024501048 | 8024503570 | 435 |
| 875 | iso_pu_bacteria | 8046767195 | 8046771070 | 435 |
| 876 | iso_pu_bacteria | 8056375014 | 8056375743 | 435 |
| 877 | iso_pu_bacteria | 8056382006 | 8056386061 | 435 |
| 878 | iso_pu_bacteria | 8057575449 | 8057579836 | 435 |
| 879 | iso_pu_bacteria | 8057874678 | 8057881037 | 435 |
| 880 | 3300041404 | Ga0439436_0005742 | Ga0439436_0005742_1917_3227 | 436 |
| 881 | 3300042146 | Ga0450907_008680 | Ga0450907_008680_287_1597 | 436 |
| 882 | 3300042531 | Ga0450918_004827 | Ga0450918_004827_262_1572 | 436 |
| 883 | iso_pu_bacteria | 2510461069 | 2510839863 | 436 |
| 884 | iso_pu_bacteria | 2643221653 | 2644297462 | 436 |
| 885 | iso_pu_bacteria | 2643221719 | 2644655715 | 436 |
| 886 | iso_pu_bacteria | 2775507049 | 2776912249 | 436 |
| 887 | iso_pu_bacteria | 2818991461 | 2819684607 | 436 |
| 888 | iso_pu_bacteria | 2989776772 | 2989777616 | 436 |
| 889 | iso_pu_bacteria | 8005246636 | 8005247215 | 436 |
| 890 | 3300001989 | JGI24739J22299_10032207 | JGI24739J22299_100322073 | 437 |
| 891 | 3300002705 | JGI25156J39149_1004645 | JGI25156J39149_10046452 | 437 |
| 892 | 3300002741 | JGI25157J39369_1002670 | JGI25157J39369_10026702 | 437 |
| 893 | 3300002987 | JGI25159J45721_1000021 | JGI25159J45721_100002191 | 437 |
| 894 | 3300003214 | JGI25165J46597_1000070 | JGI25165J46597_100007094 | 437 |
| 895 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_1000002384 | 437 |
| 896 | 3300003374 | JGI25161J50226_1001568 | JGI25161J50226_10015686 | 437 |
| 897 | 3300003762 | Ga0055542_1000344 | Ga0055542_100034413 | 437 |
| 898 | 3300003763 | Ga0055529_1007055 | Ga0055529_10070551 | 437 |
| 899 | 3300003775 | Ga0055524_1001940 | Ga0055524_10019405 | 437 |
| 900 | 3300003781 | Ga0055536_1003131 | Ga0055536_10031317 | 437 |
| 901 | 3300003781 | Ga0055536_1007911 | Ga0055536_10079114 | 437 |
| 902 | 3300003794 | Ga0055531_10013431 | Ga0055531_100134314 | 437 |
| 903 | 3300004625 | Ga0055543_1000306 | Ga0055543_10003064 | 437 |
| 904 | 3300005262 | Ga0065165_1000058 | Ga0065165_100005810 | 437 |
| 905 | 3300005539 | Ga0068853_100007135 | Ga0068853_1000071356 | 437 |
| 906 | 3300005548 | Ga0070665_100038883 | Ga0070665_1000388835 | 437 |
| 907 | 3300005563 | Ga0068855_100245902 | Ga0068855_1002459022 | 437 |
| 908 | 3300005577 | Ga0068857_100106827 | Ga0068857_1001068273 | 437 |
| 909 | 3300006038 | Ga0075365_10003722 | Ga0075365_100037222 | 437 |
| 910 | 3300006038 | Ga0075365_10017983 | Ga0075365_100179834 | 437 |
| 911 | 3300006038 | Ga0075365_10050727 | Ga0075365_100507272 | 437 |
| 912 | 3300006038 | Ga0075365_10125496 | Ga0075365_101254962 | 437 |
| 913 | 3300006051 | Ga0075364_10000416 | Ga0075364_1000041616 | 437 |
| 914 | 3300006178 | Ga0075367_10045013 | Ga0075367_100450133 | 437 |
| 915 | 3300006178 | Ga0075367_10054584 | Ga0075367_100545842 | 437 |
| 916 | 3300006186 | Ga0075369_10007943 | Ga0075369_100079435 | 437 |
| 917 | 3300009148 | Ga0105243_10049161 | Ga0105243_100491612 | 437 |
| 918 | 3300009545 | Ga0105237_10014009 | Ga0105237_100140097 | 437 |
| 919 | 3300009551 | Ga0105238_10006570 | Ga0105238_100065705 | 437 |
| 920 | 3300013102 | Ga0157371_10008296 | Ga0157371_100082962 | 437 |
| 921 | 3300013104 | Ga0157370_10163277 | Ga0157370_101632772 | 437 |
| 922 | 3300013105 | Ga0157369_10280081 | Ga0157369_102800811 | 437 |
| 923 | 3300013249 | Ga0171463_1001 | Ga0171463_1001597 | 437 |
| 924 | 3300014497 | Ga0182008_10072680 | Ga0182008_100726802 | 437 |
| 925 | 3300015262 | Ga0182007_10022213 | Ga0182007_100222132 | 437 |
| 926 | 3300015690 | Ga0183363_1186 | Ga0183363_11867 | 437 |
| 927 | 3300021320 | Ga0214544_1000008 | Ga0214544_1000008263 | 437 |
| 928 | 3300021321 | Ga0214542_1000010 | Ga0214542_1000010220 | 437 |
| 929 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003128 | 437 |
| 930 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004242 | 437 |
| 931 | 3300022739 | Ga0228711_1000137 | Ga0228711_100013747 | 437 |
| 932 | 3300022740 | Ga0228710_1000031 | Ga0228710_100003116 | 437 |
| 933 | 3300025208 | Ga0209436_100128 | Ga0209436_1001285 | 437 |
| 934 | 3300025250 | Ga0209026_1000002 | Ga0209026_10000021047 | 437 |
| 935 | 3300025254 | Ga0209148_1000123 | Ga0209148_1000123150 | 437 |
| 936 | 3300025256 | Ga0209759_1000381 | Ga0209759_100038136 | 437 |
| 937 | 3300025261 | Ga0209233_1000131 | Ga0209233_1000131108 | 437 |
| 938 | 3300025272 | Ga0209455_1000129 | Ga0209455_1000129119 | 437 |
| 939 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008160 | 437 |
| 940 | 3300025292 | Ga0209676_1008200 | Ga0209676_10082003 | 437 |
| 941 | 3300025294 | Ga0209025_1000118 | Ga0209025_100011819 | 437 |
| 942 | 3300025294 | Ga0209025_1000956 | Ga0209025_100095615 | 437 |
| 943 | 3300025295 | Ga0209564_1000091 | Ga0209564_100009172 | 437 |
| 944 | 3300025297 | Ga0209758_1007462 | Ga0209758_10074627 | 437 |
| 945 | 3300025299 | Ga0209256_1000169 | Ga0209256_1000169106 | 437 |
| 946 | 3300025299 | Ga0209256_1002377 | Ga0209256_10023779 | 437 |
| 947 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016401 | 437 |
| 948 | 3300025303 | Ga0209051_1010007 | Ga0209051_10100073 | 437 |
| 949 | 3300025304 | Ga0209257_1004315 | Ga0209257_10043156 | 437 |
| 950 | 3300025904 | Ga0207647_10005582 | Ga0207647_100055822 | 437 |
| 951 | 3300025904 | Ga0207647_10033555 | Ga0207647_100335553 | 437 |
| 952 | 3300025913 | Ga0207695_10078835 | Ga0207695_100788352 | 437 |
| 953 | 3300025914 | Ga0207671_10006724 | Ga0207671_100067243 | 437 |
| 954 | 3300025924 | Ga0207694_10008378 | Ga0207694_100083785 | 437 |
| 955 | 3300025949 | Ga0207667_10133513 | Ga0207667_101335132 | 437 |
| 956 | 3300026041 | Ga0207639_10003928 | Ga0207639_100039283 | 437 |
| 957 | 3300026078 | Ga0207702_10073938 | Ga0207702_100739383 | 437 |
| 958 | 3300026116 | Ga0207674_10060733 | Ga0207674_100607334 | 437 |
| 959 | 3300026116 | Ga0207674_10087471 | Ga0207674_100874714 | 437 |
| 960 | 3300026142 | Ga0207698_10075067 | Ga0207698_100750672 | 437 |
| 961 | 3300027111 | Ga0209281_1000155 | Ga0209281_100015517 | 437 |
| 962 | 3300027111 | Ga0209281_1001059 | Ga0209281_100105918 | 437 |
| 963 | 3300027666 | Ga0209282_1000025 | Ga0209282_1000025147 | 437 |
| 964 | 3300028379 | Ga0268266_10089010 | Ga0268266_100890104 | 437 |
| 965 | 3300028379 | Ga0268266_10111561 | Ga0268266_101115611 | 437 |
| 966 | 3300028379 | Ga0268266_10193345 | Ga0268266_101933452 | 437 |
| 967 | 3300028794 | Ga0307515_10000154 | Ga0307515_1000015475 | 437 |
| 968 | 3300028794 | Ga0307515_10043638 | Ga0307515_100436385 | 437 |
| 969 | 3300031456 | Ga0307513_10001054 | Ga0307513_1000105417 | 437 |
| 970 | 3300031911 | Ga0307412_10049598 | Ga0307412_100495982 | 437 |
| 971 | 3300031967 | Ga0315914_1000620 | Ga0315914_100062027 | 437 |
| 972 | 3300031995 | Ga0307409_100031636 | Ga0307409_1000316364 | 437 |
| 973 | 3300033430 | Ga0315913_1000150 | Ga0315913_100015017 | 437 |
| 974 | 3300033464 | Ga0315915_1000015 | Ga0315915_100001516 | 437 |
| 975 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_143899_145215 | 437 |
| 976 | 3300037312 | Ga0395899_0055606 | Ga0395899_0055606_234_1550 | 437 |
| 977 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_248469_249785 | 437 |
| 978 | 3300037418 | Ga0395900_0027451 | Ga0395900_0027451_2895_4211 | 437 |
| 979 | 3300037418 | Ga0395900_0173782 | Ga0395900_0173782_161_1477 | 437 |
| 980 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_93529_94845 | 437 |
| 981 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_36148_37464 | 437 |
| 982 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_36173_37489 | 437 |
| 983 | 3300038443 | Ga0395901_0014679 | Ga0395901_0014679_3177_4493 | 437 |
| 984 | 3300038443 | Ga0395901_0034079 | Ga0395901_0034079_3293_4609 | 437 |
| 985 | 3300042007 | Ga0439449_0029318 | Ga0439449_0029318_276_1589 | 437 |
| 986 | 3300046515 | Ga0495620_0045964 | Ga0495620_0045964_259_1575 | 437 |
| 987 | 3300047443 | Ga0495687_041534 | Ga0495687_041534_266_1582 | 437 |
| 988 | 3300048915 | Ga0496112_0004721 | Ga0496112_0004721_7257_8573 | 437 |
| 989 | 3300048919 | Ga0496116_0000080 | Ga0496116_0000080_83121_84437 | 437 |
| 990 | 3300048920 | Ga0496117_0002938 | Ga0496117_0002938_11064_12380 | 437 |
| 991 | 3300048920 | Ga0496117_0065162 | Ga0496117_0065162_294_1610 | 437 |
| 992 | 3300048921 | Ga0496118_0036260 | Ga0496118_0036260_998_2314 | 437 |
| 993 | 3300048922 | Ga0496119_0053279 | Ga0496119_0053279_532_1848 | 437 |
| 994 | 3300048922 | Ga0496119_0074573 | Ga0496119_0074573_575_1891 | 437 |
| 995 | 3300048923 | Ga0496120_0001808 | Ga0496120_0001808_19729_21045 | 437 |
| 996 | 3300048924 | Ga0496121_0000459 | Ga0496121_0000459_20073_21389 | 437 |
| 997 | 3300048924 | Ga0496121_0063677 | Ga0496121_0063677_642_1958 | 437 |
| 998 | 3300048925 | Ga0496122_0000247 | Ga0496122_0000247_66824_68140 | 437 |
| 999 | 3300048925 | Ga0496122_0002082 | Ga0496122_0002082_16053_17369 | 437 |
| 1000 | 3300048926 | Ga0496123_0000222 | Ga0496123_0000222_66485_67801 | 437 |
| 1001 | 3300048927 | Ga0496124_0000063 | Ga0496124_0000063_29474_30790 | 437 |
| 1002 | 3300048927 | Ga0496124_0000592 | Ga0496124_0000592_47496_48812 | 437 |
| 1003 | 3300048928 | Ga0496125_0000557 | Ga0496125_0000557_47379_48695 | 437 |
| 1004 | 3300048928 | Ga0496125_0057046 | Ga0496125_0057046_1837_3153 | 437 |
| 1005 | 3300048928 | Ga0496125_0085081 | Ga0496125_0085081_289_1605 | 437 |
| 1006 | 3300048928 | Ga0496125_0157560 | Ga0496125_0157560_78_1394 | 437 |
| 1007 | 3300048929 | Ga0496126_0000438 | Ga0496126_0000438_69542_70858 | 437 |
| 1008 | 3300048929 | Ga0496126_0001405 | Ga0496126_0001405_7097_8413 | 437 |
| 1009 | 3300049569 | Ga0501032_0051622 | Ga0501032_0051622_779_2095 | 437 |
| 1010 | 3300049570 | Ga0501033_0008539 | Ga0501033_0008539_6345_7661 | 437 |
| 1011 | 3300049571 | Ga0501034_0006126 | Ga0501034_0006126_5231_6547 | 437 |
| 1012 | 3300049573 | Ga0501037_0029877 | Ga0501037_0029877_150_1466 | 437 |
| 1013 | 3300049578 | Ga0501042_0031541 | Ga0501042_0031541_1850_3166 | 437 |
| 1014 | 3300049580 | Ga0501046_0007521 | Ga0501046_0007521_6992_8308 | 437 |
| 1015 | 3300049581 | Ga0501047_0164809 | Ga0501047_0164809_377_1693 | 437 |
| 1016 | 3300049586 | Ga0501070_0057259 | Ga0501070_0057259_1593_2909 | 437 |
| 1017 | 3300049586 | Ga0501070_0087750 | Ga0501070_0087750_310_1626 | 437 |
| 1018 | 3300049587 | Ga0501071_0041718 | Ga0501071_0041718_37_1353 | 437 |
| 1019 | 3300049590 | Ga0501074_0017250 | Ga0501074_0017250_2693_4009 | 437 |
| 1020 | 3300049822 | Ga0501035_0076851 | Ga0501035_0076851_779_2095 | 437 |
| 1021 | 3300049823 | Ga0501044_0030478 | Ga0501044_0030478_2309_3625 | 437 |
| 1022 | 3300050491 | nmdc:mga00v17_690_c1 | nmdc:mga00v17_690_c1_5657_6973 | 437 |
| 1023 | 3300050492 | nmdc:mga0yw44_79671_c1 | nmdc:mga0yw44_79671_c1_150_1466 | 437 |
| 1024 | 3300050494 | nmdc:mga06z11_69452_c1 | nmdc:mga06z11_69452_c1_325_1641 | 437 |
| 1025 | 3300050516 | nmdc:mga0sz30_11731_c1 | nmdc:mga0sz30_11731_c1_93_1409 | 437 |
| 1026 | 3300053083 | Ga0495655_0004667 | Ga0495655_0004667_529_1845 | 437 |
| 1027 | 3300053087 | Ga0500643_018034 | Ga0500643_018034_590_1906 | 437 |
| 1028 | 3300053139 | Ga0500568_0000048 | Ga0500568_0000048_67108_68424 | 437 |
| 1029 | 3300053155 | Ga0500620_000553 | Ga0500620_000553_515_1831 | 437 |
| 1030 | 3300053158 | Ga0500627_0061574 | Ga0500627_0061574_69_1385 | 437 |
| 1031 | 3300053161 | Ga0500634_0000129 | Ga0500634_0000129_22143_23459 | 437 |
| 1032 | 3300053177 | Ga0500636_0000010 | Ga0500636_0000010_31617_32933 | 437 |
| 1033 | iso_pu_bacteria | 2599185236 | 2599719459 | 437 |
| 1034 | iso_pu_bacteria | 2791355082 | 2792583846 | 437 |
| 1035 | iso_pu_bacteria | 2821123053 | 2821123738 | 437 |
| 1036 | iso_pu_bacteria | 2838736955 | 2838739232 | 437 |
| 1037 | iso_pu_bacteria | 2841840854 | 2841843130 | 437 |
| 1038 | iso_pu_bacteria | 2842140634 | 2842142912 | 437 |
| 1039 | iso_pu_bacteria | 2857531043 | 2857531300 | 437 |
| 1040 | iso_pu_bacteria | 2968138860 | 2968145495 | 437 |
| 1041 | iso_pu_bacteria | 8004695233 | 8004702987 | 437 |
| 1042 | iso_pu_bacteria | 8049293176 | 8049293589 | 437 |
| 1043 | 3300002773 | JGI25152J39213_1001977 | JGI25152J39213_10019771 | 438 |
| 1044 | 3300003792 | Ga0055540_1004730 | Ga0055540_10047305 | 438 |
| 1045 | 3300003794 | Ga0055531_10001859 | Ga0055531_100018593 | 438 |
| 1046 | 3300005262 | Ga0065165_1004713 | Ga0065165_10047137 | 438 |
| 1047 | 3300005262 | Ga0065165_1010993 | Ga0065165_10109932 | 438 |
| 1048 | 3300005539 | Ga0068853_100154814 | Ga0068853_1001548141 | 438 |
| 1049 | 3300005983 | Ga0081540_1012530 | Ga0081540_10125304 | 438 |
| 1050 | 3300006038 | Ga0075365_10059189 | Ga0075365_100591894 | 438 |
| 1051 | 3300006051 | Ga0075364_10033396 | Ga0075364_100333963 | 438 |
| 1052 | 3300025258 | Ga0209129_1000407 | Ga0209129_100040723 | 438 |
| 1053 | 3300025273 | Ga0209673_1000015 | Ga0209673_1000015258 | 438 |
| 1054 | 3300025294 | Ga0209025_1005096 | Ga0209025_10050962 | 438 |
| 1055 | 3300025295 | Ga0209564_1012297 | Ga0209564_10122972 | 438 |
| 1056 | 3300025299 | Ga0209256_1001975 | Ga0209256_10019754 | 438 |
| 1057 | 3300025303 | Ga0209051_1041554 | Ga0209051_10415541 | 438 |
| 1058 | 3300025925 | Ga0207650_10002037 | Ga0207650_1000203711 | 438 |
| 1059 | 3300046507 | Ga0495606_0021406 | Ga0495606_0021406_940_2304 | 438 |
| 1060 | 3300047472 | Ga0495686_0001812 | Ga0495686_0001812_9936_11252 | 438 |
| 1061 | 3300047472 | Ga0495686_0049030 | Ga0495686_0049030_212_1528 | 438 |
| 1062 | 3300048917 | Ga0496114_0038222 | Ga0496114_0038222_1628_2992 | 438 |
| 1063 | 3300048920 | Ga0496117_0052801 | Ga0496117_0052801_933_2252 | 438 |
| 1064 | 3300048921 | Ga0496118_0045335 | Ga0496118_0045335_389_1708 | 438 |
| 1065 | 3300048923 | Ga0496120_0051187 | Ga0496120_0051187_748_2067 | 438 |
| 1066 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_504715_506034 | 438 |
| 1067 | 3300048925 | Ga0496122_0000009 | Ga0496122_0000009_421702_423039 | 438 |
| 1068 | 3300048926 | Ga0496123_0000020 | Ga0496123_0000020_226154_227491 | 438 |
| 1069 | 3300048927 | Ga0496124_0039327 | Ga0496124_0039327_163_1500 | 438 |
| 1070 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_616797_618116 | 438 |
| 1071 | 3300049568 | Ga0501031_0015024 | Ga0501031_0015024_756_2075 | 438 |
| 1072 | 3300049569 | Ga0501032_0000116 | Ga0501032_0000116_11182_12501 | 438 |
| 1073 | 3300049570 | Ga0501033_0001994 | Ga0501033_0001994_3256_4575 | 438 |
| 1074 | 3300049571 | Ga0501034_0003453 | Ga0501034_0003453_2307_3626 | 438 |
| 1075 | 3300049571 | Ga0501034_0004432 | Ga0501034_0004432_11054_12373 | 438 |
| 1076 | 3300049571 | Ga0501034_0025197 | Ga0501034_0025197_1650_2969 | 438 |
| 1077 | 3300049572 | Ga0501036_0000117 | Ga0501036_0000117_1132_2451 | 438 |
| 1078 | 3300049573 | Ga0501037_0000108 | Ga0501037_0000108_26096_27415 | 438 |
| 1079 | 3300049574 | Ga0501038_0000126 | Ga0501038_0000126_11054_12373 | 438 |
| 1080 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_177176_178495 | 438 |
| 1081 | 3300049575 | Ga0501039_0056119 | Ga0501039_0056119_449_1768 | 438 |
| 1082 | 3300049577 | Ga0501041_0020926 | Ga0501041_0020926_1895_3214 | 438 |
| 1083 | 3300049579 | Ga0501043_0000140 | Ga0501043_0000140_61668_62987 | 438 |
| 1084 | 3300049581 | Ga0501047_0100696 | Ga0501047_0100696_769_2088 | 438 |
| 1085 | 3300049776 | Ga0501280_002482 | Ga0501280_002482_740_2065 | 438 |
| 1086 | 3300049822 | Ga0501035_0001153 | Ga0501035_0001153_3384_4703 | 438 |
| 1087 | 3300049823 | Ga0501044_0040211 | Ga0501044_0040211_499_1818 | 438 |
| 1088 | 3300050491 | nmdc:mga00v17_40101_c1 | nmdc:mga00v17_40101_c1_370_1689 | 438 |
| 1089 | 3300053140 | Ga0500573_0000746 | Ga0500573_0000746_12159_13478 | 438 |
| 1090 | iso_pu_bacteria | 2585427633 | 2585994576 | 438 |
| 1091 | iso_pu_bacteria | 2585427634 | 2585999064 | 438 |
| 1092 | iso_pu_bacteria | 2937843397 | 2937844251 | 438 |
| 1093 | 3300002704 | JGI25155J39150_1000006 | JGI25155J39150_1000006228 | 439 |
| 1094 | 3300002705 | JGI25156J39149_1000019 | JGI25156J39149_100001919 | 439 |
| 1095 | 3300002737 | JGI25162J39368_1000177 | JGI25162J39368_100017761 | 439 |
| 1096 | 3300002737 | JGI25162J39368_1000381 | JGI25162J39368_100038115 | 439 |
| 1097 | 3300002738 | JGI25154J39366_1000177 | JGI25154J39366_100017719 | 439 |
| 1098 | 3300002741 | JGI25157J39369_1000024 | JGI25157J39369_1000024145 | 439 |
| 1099 | 3300002773 | JGI25152J39213_1000299 | JGI25152J39213_100029927 | 439 |
| 1100 | 3300002773 | JGI25152J39213_1002166 | JGI25152J39213_10021665 | 439 |
| 1101 | 3300002774 | JGI25150J39212_1000042 | JGI25150J39212_100004257 | 439 |
| 1102 | 3300002987 | JGI25159J45721_1001496 | JGI25159J45721_10014968 | 439 |
| 1103 | 3300003187 | JGI25151J46595_10000099 | JGI25151J46595_1000009922 | 439 |
| 1104 | 3300003187 | JGI25151J46595_10000707 | JGI25151J46595_100007075 | 439 |
| 1105 | 3300003187 | JGI25151J46595_10009360 | JGI25151J46595_100093604 | 439 |
| 1106 | 3300003203 | JGI25406J46586_10010757 | JGI25406J46586_100107575 | 439 |
| 1107 | 3300003214 | JGI25165J46597_1000480 | JGI25165J46597_100048018 | 439 |
| 1108 | 3300003214 | JGI25165J46597_1001692 | JGI25165J46597_10016922 | 439 |
| 1109 | 3300003215 | JGI25153J46596_10007987 | JGI25153J46596_100079873 | 439 |
| 1110 | 3300003215 | JGI25153J46596_10009490 | JGI25153J46596_100094902 | 439 |
| 1111 | 3300003320 | rootH2_10081828 | rootH2_100818283 | 439 |
| 1112 | 3300003322 | rootL2_10006203 | rootL2_100062034 | 439 |
| 1113 | 3300003323 | rootH1_10006221 | rootH1_100062214 | 439 |
| 1114 | 3300003323 | rootH1_10080966 | rootH1_100809663 | 439 |
| 1115 | 3300003354 | JGI25160J50197_1000046 | JGI25160J50197_10000467 | 439 |
| 1116 | 3300003354 | JGI25160J50197_1008028 | JGI25160J50197_10080284 | 439 |
| 1117 | 3300003374 | JGI25161J50226_1000031 | JGI25161J50226_10000317 | 439 |
| 1118 | 3300003771 | Ga0055526_1003166 | Ga0055526_10031664 | 439 |
| 1119 | 3300003775 | Ga0055524_1004569 | Ga0055524_10045694 | 439 |
| 1120 | 3300003790 | Ga0055528_1002755 | Ga0055528_10027554 | 439 |
| 1121 | 3300003790 | Ga0055528_1019902 | Ga0055528_10199022 | 439 |
| 1122 | 3300003792 | Ga0055540_1000269 | Ga0055540_100026911 | 439 |
| 1123 | 3300003792 | Ga0055540_1007822 | Ga0055540_10078222 | 439 |
| 1124 | 3300003856 | Ga0058692_1002755 | Ga0058692_10027553 | 439 |
| 1125 | 3300003856 | Ga0058692_1010264 | Ga0058692_10102641 | 439 |
| 1126 | 3300004625 | Ga0055543_1000278 | Ga0055543_100027828 | 439 |
| 1127 | 3300004625 | Ga0055543_1004016 | Ga0055543_10040163 | 439 |
| 1128 | 3300005262 | Ga0065165_1000693 | Ga0065165_10006938 | 439 |
| 1129 | 3300005262 | Ga0065165_1013516 | Ga0065165_10135163 | 439 |
| 1130 | 3300005347 | Ga0070668_100042434 | Ga0070668_1000424342 | 439 |
| 1131 | 3300005355 | Ga0070671_100043211 | Ga0070671_1000432113 | 439 |
| 1132 | 3300005455 | Ga0070663_100011297 | Ga0070663_1000112972 | 439 |
| 1133 | 3300005455 | Ga0070663_100133810 | Ga0070663_1001338101 | 439 |
| 1134 | 3300005548 | Ga0070665_100040022 | Ga0070665_1000400225 | 439 |
| 1135 | 3300005548 | Ga0070665_100059703 | Ga0070665_1000597033 | 439 |
| 1136 | 3300005548 | Ga0070665_100151867 | Ga0070665_1001518672 | 439 |
| 1137 | 3300005563 | Ga0068855_100109516 | Ga0068855_1001095164 | 439 |
| 1138 | 3300005985 | Ga0081539_10003940 | Ga0081539_100039405 | 439 |
| 1139 | 3300006038 | Ga0075365_10007235 | Ga0075365_100072355 | 439 |
| 1140 | 3300006038 | Ga0075365_10052489 | Ga0075365_100524893 | 439 |
| 1141 | 3300006042 | Ga0075368_10001844 | Ga0075368_100018445 | 439 |
| 1142 | 3300006048 | Ga0075363_100041351 | Ga0075363_1000413512 | 439 |
| 1143 | 3300006048 | Ga0075363_100122317 | Ga0075363_1001223171 | 439 |
| 1144 | 3300006177 | Ga0075362_10017477 | Ga0075362_100174771 | 439 |
| 1145 | 3300006177 | Ga0075362_10022993 | Ga0075362_100229932 | 439 |
| 1146 | 3300006178 | Ga0075367_10012811 | Ga0075367_100128114 | 439 |
| 1147 | 3300006186 | Ga0075369_10000599 | Ga0075369_100005998 | 439 |
| 1148 | 3300006186 | Ga0075369_10012428 | Ga0075369_100124283 | 439 |
| 1149 | 3300006353 | Ga0075370_10007858 | Ga0075370_100078584 | 439 |
| 1150 | 3300006948 | Ga0099826_10000327 | Ga0099826_1000032716 | 439 |
| 1151 | 3300006948 | Ga0099826_10029864 | Ga0099826_100298644 | 439 |
| 1152 | 3300009092 | Ga0105250_10008165 | Ga0105250_100081655 | 439 |
| 1153 | 3300009093 | Ga0105240_10003684 | Ga0105240_100036843 | 439 |
| 1154 | 3300009148 | Ga0105243_10018026 | Ga0105243_100180264 | 439 |
| 1155 | 3300009545 | Ga0105237_10002476 | Ga0105237_100024765 | 439 |
| 1156 | 3300010375 | Ga0105239_10003906 | Ga0105239_1000390614 | 439 |
| 1157 | 3300013100 | Ga0157373_10020610 | Ga0157373_100206104 | 439 |
| 1158 | 3300013102 | Ga0157371_10000058 | Ga0157371_1000005898 | 439 |
| 1159 | 3300013104 | Ga0157370_10000030 | Ga0157370_10000030121 | 439 |
| 1160 | 3300013104 | Ga0157370_10003932 | Ga0157370_1000393212 | 439 |
| 1161 | 3300014497 | Ga0182008_10008080 | Ga0182008_100080804 | 439 |
| 1162 | 3300015262 | Ga0182007_10000598 | Ga0182007_1000059811 | 439 |
| 1163 | 3300015265 | Ga0182005_1006003 | Ga0182005_10060034 | 439 |
| 1164 | 3300025206 | Ga0209435_100011 | Ga0209435_100011225 | 439 |
| 1165 | 3300025233 | Ga0209437_100036 | Ga0209437_100036126 | 439 |
| 1166 | 3300025233 | Ga0209437_100086 | Ga0209437_100086124 | 439 |
| 1167 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012442 | 439 |
| 1168 | 3300025245 | Ga0207425_1003062 | Ga0207425_10030625 | 439 |
| 1169 | 3300025246 | Ga0209646_1000024 | Ga0209646_1000024186 | 439 |
| 1170 | 3300025250 | Ga0209026_1000030 | Ga0209026_1000030186 | 439 |
| 1171 | 3300025253 | Ga0209677_100862 | Ga0209677_1008622 | 439 |
| 1172 | 3300025256 | Ga0209759_1000011 | Ga0209759_1000011225 | 439 |
| 1173 | 3300025258 | Ga0209129_1000086 | Ga0209129_1000086100 | 439 |
| 1174 | 3300025258 | Ga0209129_1000606 | Ga0209129_100060622 | 439 |
| 1175 | 3300025258 | Ga0209129_1007997 | Ga0209129_10079973 | 439 |
| 1176 | 3300025261 | Ga0209233_1000110 | Ga0209233_1000110123 | 439 |
| 1177 | 3300025261 | Ga0209233_1000166 | Ga0209233_1000166126 | 439 |
| 1178 | 3300025261 | Ga0209233_1000390 | Ga0209233_100039012 | 439 |
| 1179 | 3300025273 | Ga0209673_1000091 | Ga0209673_1000091134 | 439 |
| 1180 | 3300025273 | Ga0209673_1003094 | Ga0209673_10030945 | 439 |
| 1181 | 3300025273 | Ga0209673_1004627 | Ga0209673_10046274 | 439 |
| 1182 | 3300025273 | Ga0209673_1015431 | Ga0209673_10154312 | 439 |
| 1183 | 3300025284 | Ga0209130_1000312 | Ga0209130_10003128 | 439 |
| 1184 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024442 | 439 |
| 1185 | 3300025294 | Ga0209025_1000549 | Ga0209025_100054956 | 439 |
| 1186 | 3300025294 | Ga0209025_1000980 | Ga0209025_100098032 | 439 |
| 1187 | 3300025294 | Ga0209025_1009494 | Ga0209025_10094946 | 439 |
| 1188 | 3300025294 | Ga0209025_1017886 | Ga0209025_10178862 | 439 |
| 1189 | 3300025295 | Ga0209564_1000742 | Ga0209564_100074218 | 439 |
| 1190 | 3300025295 | Ga0209564_1003340 | Ga0209564_10033403 | 439 |
| 1191 | 3300025295 | Ga0209564_1008708 | Ga0209564_10087083 | 439 |
| 1192 | 3300025297 | Ga0209758_1000046 | Ga0209758_1000046100 | 439 |
| 1193 | 3300025297 | Ga0209758_1000325 | Ga0209758_100032568 | 439 |
| 1194 | 3300025297 | Ga0209758_1008441 | Ga0209758_10084416 | 439 |
| 1195 | 3300025299 | Ga0209256_1000858 | Ga0209256_100085826 | 439 |
| 1196 | 3300025299 | Ga0209256_1005090 | Ga0209256_10050904 | 439 |
| 1197 | 3300025299 | Ga0209256_1005247 | Ga0209256_10052476 | 439 |
| 1198 | 3300025302 | Ga0207426_1000012 | Ga0207426_10000128 | 439 |
| 1199 | 3300025302 | Ga0207426_1000063 | Ga0207426_1000063105 | 439 |
| 1200 | 3300025302 | Ga0207426_1000457 | Ga0207426_100045727 | 439 |
| 1201 | 3300025303 | Ga0209051_1000084 | Ga0209051_100008425 | 439 |
| 1202 | 3300025303 | Ga0209051_1004764 | Ga0209051_10047645 | 439 |
| 1203 | 3300025303 | Ga0209051_1014165 | Ga0209051_10141654 | 439 |
| 1204 | 3300025304 | Ga0209257_1005237 | Ga0209257_10052373 | 439 |
| 1205 | 3300025913 | Ga0207695_10003123 | Ga0207695_1000312319 | 439 |
| 1206 | 3300025914 | Ga0207671_10000176 | Ga0207671_1000017640 | 439 |
| 1207 | 3300025932 | Ga0207690_10077815 | Ga0207690_100778152 | 439 |
| 1208 | 3300026067 | Ga0207678_10009958 | Ga0207678_100099584 | 439 |
| 1209 | 3300026067 | Ga0207678_10059370 | Ga0207678_100593702 | 439 |
| 1210 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009344 | 439 |
| 1211 | 3300027312 | Ga0209371_1001145 | Ga0209371_100114515 | 439 |
| 1212 | 3300027312 | Ga0209371_1002735 | Ga0209371_10027356 | 439 |
| 1213 | 3300027666 | Ga0209282_1000908 | Ga0209282_10009086 | 439 |
| 1214 | 3300027666 | Ga0209282_1022896 | Ga0209282_10228962 | 439 |
| 1215 | 3300028379 | Ga0268266_10028826 | Ga0268266_100288263 | 439 |
| 1216 | 3300028379 | Ga0268266_10090430 | Ga0268266_100904303 | 439 |
| 1217 | 3300028794 | Ga0307515_10006246 | Ga0307515_1000624622 | 439 |
| 1218 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010343 | 439 |
| 1219 | 3300030500 | Ga0268256_1003517 | Ga0268256_10035175 | 439 |
| 1220 | 3300030500 | Ga0268256_1015207 | Ga0268256_10152071 | 439 |
| 1221 | 3300031548 | Ga0307408_100089591 | Ga0307408_1000895911 | 439 |
| 1222 | 3300031901 | Ga0307406_10083835 | Ga0307406_100838352 | 439 |
| 1223 | 3300031911 | Ga0307412_10007356 | Ga0307412_100073562 | 439 |
| 1224 | 3300041413 | Ga0439465_0002164 | Ga0439465_0002164_3751_5070 | 439 |
| 1225 | 3300044694 | Ga0466963_0002783 | Ga0466963_0002783_1853_3172 | 439 |
| 1226 | 3300045836 | Ga0466958_0007058 | Ga0466958_0007058_1042_2361 | 439 |
| 1227 | 3300046459 | Ga0495629_0014910 | Ga0495629_0014910_2776_4098 | 439 |
| 1228 | 3300046460 | Ga0495638_0001215 | Ga0495638_0001215_18569_19888 | 439 |
| 1229 | 3300046474 | Ga0495605_0001185 | Ga0495605_0001185_15704_17023 | 439 |
| 1230 | 3300046476 | Ga0495662_0015369 | Ga0495662_0015369_1818_3140 | 439 |
| 1231 | 3300046492 | Ga0495585_0001367 | Ga0495585_0001367_11178_12497 | 439 |
| 1232 | 3300046506 | Ga0495583_0001517 | Ga0495583_0001517_4081_5400 | 439 |
| 1233 | 3300046506 | Ga0495583_0013986 | Ga0495583_0013986_2456_3775 | 439 |
| 1234 | 3300046515 | Ga0495620_0041739 | Ga0495620_0041739_357_1676 | 439 |
| 1235 | 3300046518 | Ga0495631_0000622 | Ga0495631_0000622_20913_22232 | 439 |
| 1236 | 3300046519 | Ga0495632_0025761 | Ga0495632_0025761_1414_2733 | 439 |
| 1237 | 3300046538 | Ga0495609_0027309 | Ga0495609_0027309_915_2234 | 439 |
| 1238 | 3300046557 | Ga0495622_0004894 | Ga0495622_0004894_2516_3838 | 439 |
| 1239 | 3300046616 | Ga0495668_0001429 | Ga0495668_0001429_7838_9157 | 439 |
| 1240 | 3300046642 | Ga0495634_0113523 | Ga0495634_0113523_286_1608 | 439 |
| 1241 | 3300046660 | Ga0495625_0001674 | Ga0495625_0001674_14802_16121 | 439 |
| 1242 | 3300046663 | Ga0495635_0009879 | Ga0495635_0009879_2963_4285 | 439 |
| 1243 | 3300046674 | Ga0495588_0001635 | Ga0495588_0001635_5704_7026 | 439 |
| 1244 | 3300046674 | Ga0495588_0009713 | Ga0495588_0009713_1337_2659 | 439 |
| 1245 | 3300046674 | Ga0495588_0026724 | Ga0495588_0026724_251_1570 | 439 |
| 1246 | 3300046675 | Ga0495657_0011072 | Ga0495657_0011072_1957_3279 | 439 |
| 1247 | 3300046692 | Ga0495671_0025493 | Ga0495671_0025493_858_2180 | 439 |
| 1248 | 3300047320 | Ga0495672_0003865 | Ga0495672_0003865_9287_10606 | 439 |
| 1249 | 3300047470 | Ga0495681_0005896 | Ga0495681_0005896_4783_6105 | 439 |
| 1250 | 3300048907 | Ga0496104_0321642 | Ga0496104_0321642_49_1371 | 439 |
| 1251 | 3300048916 | Ga0496113_0130227 | Ga0496113_0130227_42_1364 | 439 |
| 1252 | 3300048919 | Ga0496116_0002774 | Ga0496116_0002774_1269_2588 | 439 |
| 1253 | 3300048919 | Ga0496116_0004619 | Ga0496116_0004619_29_1348 | 439 |
| 1254 | 3300048919 | Ga0496116_0004929 | Ga0496116_0004929_10135_11454 | 439 |
| 1255 | 3300048919 | Ga0496116_0006070 | Ga0496116_0006070_2767_4086 | 439 |
| 1256 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1863917_1865239 | 439 |
| 1257 | 3300048920 | Ga0496117_0003435 | Ga0496117_0003435_5837_7156 | 439 |
| 1258 | 3300048920 | Ga0496117_0004016 | Ga0496117_0004016_13302_14621 | 439 |
| 1259 | 3300048920 | Ga0496117_0028812 | Ga0496117_0028812_125_1444 | 439 |
| 1260 | 3300048920 | Ga0496117_0072659 | Ga0496117_0072659_851_2173 | 439 |
| 1261 | 3300048921 | Ga0496118_0001656 | Ga0496118_0001656_17282_18604 | 439 |
| 1262 | 3300048921 | Ga0496118_0002528 | Ga0496118_0002528_15003_16322 | 439 |
| 1263 | 3300048921 | Ga0496118_0004982 | Ga0496118_0004982_1969_3288 | 439 |
| 1264 | 3300048921 | Ga0496118_0015790 | Ga0496118_0015790_5479_6798 | 439 |
| 1265 | 3300048922 | Ga0496119_0003135 | Ga0496119_0003135_3184_4503 | 439 |
| 1266 | 3300048922 | Ga0496119_0012020 | Ga0496119_0012020_1284_2606 | 439 |
| 1267 | 3300048922 | Ga0496119_0053616 | Ga0496119_0053616_491_1810 | 439 |
| 1268 | 3300048923 | Ga0496120_0000021 | Ga0496120_0000021_201336_202658 | 439 |
| 1269 | 3300048923 | Ga0496120_0004424 | Ga0496120_0004424_938_2257 | 439 |
| 1270 | 3300048924 | Ga0496121_0001940 | Ga0496121_0001940_13560_14879 | 439 |
| 1271 | 3300048924 | Ga0496121_0016156 | Ga0496121_0016156_6370_7689 | 439 |
| 1272 | 3300048924 | Ga0496121_0022977 | Ga0496121_0022977_2659_3978 | 439 |
| 1273 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1234707_1236029 | 439 |
| 1274 | 3300048925 | Ga0496122_0006417 | Ga0496122_0006417_143_1462 | 439 |
| 1275 | 3300048925 | Ga0496122_0006956 | Ga0496122_0006956_10122_11489 | 439 |
| 1276 | 3300048925 | Ga0496122_0013353 | Ga0496122_0013353_143_1462 | 439 |
| 1277 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1238438_1239760 | 439 |
| 1278 | 3300048926 | Ga0496123_0011146 | Ga0496123_0011146_143_1462 | 439 |
| 1279 | 3300048926 | Ga0496123_0013913 | Ga0496123_0013913_3280_4599 | 439 |
| 1280 | 3300048926 | Ga0496123_0111412 | Ga0496123_0111412_143_1462 | 439 |
| 1281 | 3300048927 | Ga0496124_0002394 | Ga0496124_0002394_472_1791 | 439 |
| 1282 | 3300048927 | Ga0496124_0009274 | Ga0496124_0009274_69_1388 | 439 |
| 1283 | 3300048927 | Ga0496124_0010148 | Ga0496124_0010148_6386_7708 | 439 |
| 1284 | 3300048927 | Ga0496124_0038494 | Ga0496124_0038494_2127_3446 | 439 |
| 1285 | 3300048927 | Ga0496124_0055913 | Ga0496124_0055913_1945_3264 | 439 |
| 1286 | 3300048927 | Ga0496124_0098010 | Ga0496124_0098010_648_1967 | 439 |
| 1287 | 3300048928 | Ga0496125_0005358 | Ga0496125_0005358_12350_13669 | 439 |
| 1288 | 3300048928 | Ga0496125_0007390 | Ga0496125_0007390_9486_10808 | 439 |
| 1289 | 3300048929 | Ga0496126_0052716 | Ga0496126_0052716_729_2048 | 439 |
| 1290 | 3300049568 | Ga0501031_0000037 | Ga0501031_0000037_28377_29699 | 439 |
| 1291 | 3300049569 | Ga0501032_0000081 | Ga0501032_0000081_28621_29943 | 439 |
| 1292 | 3300049569 | Ga0501032_0159737 | Ga0501032_0159737_22_1344 | 439 |
| 1293 | 3300049570 | Ga0501033_0000097 | Ga0501033_0000097_62488_63810 | 439 |
| 1294 | 3300049570 | Ga0501033_0000501 | Ga0501033_0000501_8244_9566 | 439 |
| 1295 | 3300049570 | Ga0501033_0003939 | Ga0501033_0003939_9009_10331 | 439 |
| 1296 | 3300049570 | Ga0501033_0040448 | Ga0501033_0040448_1723_3045 | 439 |
| 1297 | 3300049570 | Ga0501033_0099030 | Ga0501033_0099030_737_2059 | 439 |
| 1298 | 3300049571 | Ga0501034_0000186 | Ga0501034_0000186_52689_54011 | 439 |
| 1299 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_229299_230621 | 439 |
| 1300 | 3300049573 | Ga0501037_0000095 | Ga0501037_0000095_28649_29971 | 439 |
| 1301 | 3300049573 | Ga0501037_0000451 | Ga0501037_0000451_9104_10426 | 439 |
| 1302 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_35848_37170 | 439 |
| 1303 | 3300049574 | Ga0501038_0031440 | Ga0501038_0031440_2827_4149 | 439 |
| 1304 | 3300049574 | Ga0501038_0098426 | Ga0501038_0098426_747_2069 | 439 |
| 1305 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_311343_312665 | 439 |
| 1306 | 3300049576 | Ga0501040_0004757 | Ga0501040_0004757_1149_2471 | 439 |
| 1307 | 3300049579 | Ga0501043_0000081 | Ga0501043_0000081_44422_45744 | 439 |
| 1308 | 3300049579 | Ga0501043_0000162 | Ga0501043_0000162_28177_29499 | 439 |
| 1309 | 3300049579 | Ga0501043_0046250 | Ga0501043_0046250_1684_3006 | 439 |
| 1310 | 3300049581 | Ga0501047_0001069 | Ga0501047_0001069_12777_14099 | 439 |
| 1311 | 3300049581 | Ga0501047_0020656 | Ga0501047_0020656_216_1538 | 439 |
| 1312 | 3300049581 | Ga0501047_0084377 | Ga0501047_0084377_312_1634 | 439 |
| 1313 | 3300049581 | Ga0501047_0150278 | Ga0501047_0150278_434_1756 | 439 |
| 1314 | 3300049581 | Ga0501047_0245424 | Ga0501047_0245424_197_1519 | 439 |
| 1315 | 3300049585 | Ga0501069_0000118 | Ga0501069_0000118_9995_11317 | 439 |
| 1316 | 3300049586 | Ga0501070_0000127 | Ga0501070_0000127_64043_65365 | 439 |
| 1317 | 3300049586 | Ga0501070_0002038 | Ga0501070_0002038_13230_14552 | 439 |
| 1318 | 3300049586 | Ga0501070_0010186 | Ga0501070_0010186_5993_7315 | 439 |
| 1319 | 3300049586 | Ga0501070_0044569 | Ga0501070_0044569_711_2033 | 439 |
| 1320 | 3300049586 | Ga0501070_0079084 | Ga0501070_0079084_744_2066 | 439 |
| 1321 | 3300049589 | Ga0501073_0031877 | Ga0501073_0031877_289_1611 | 439 |
| 1322 | 3300049590 | Ga0501074_0000062 | Ga0501074_0000062_21727_23049 | 439 |
| 1323 | 3300049742 | Ga0501080_0000254 | Ga0501080_0000254_31766_33088 | 439 |
| 1324 | 3300049744 | Ga0501083_0000453 | Ga0501083_0000453_23148_24470 | 439 |
| 1325 | 3300049744 | Ga0501083_0032262 | Ga0501083_0032262_1307_2629 | 439 |
| 1326 | 3300049822 | Ga0501035_0000017 | Ga0501035_0000017_225541_226863 | 439 |
| 1327 | 3300049822 | Ga0501035_0000100 | Ga0501035_0000100_43512_44834 | 439 |
| 1328 | 3300049822 | Ga0501035_0001764 | Ga0501035_0001764_13178_14500 | 439 |
| 1329 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_62488_63810 | 439 |
| 1330 | 3300049823 | Ga0501044_0000751 | Ga0501044_0000751_9122_10444 | 439 |
| 1331 | 3300049823 | Ga0501044_0044749 | Ga0501044_0044749_1921_3243 | 439 |
| 1332 | 3300049823 | Ga0501044_0056676 | Ga0501044_0056676_312_1634 | 439 |
| 1333 | 3300049823 | Ga0501044_0090220 | Ga0501044_0090220_1196_2518 | 439 |
| 1334 | 3300049823 | Ga0501044_0110800 | Ga0501044_0110800_1394_2716 | 439 |
| 1335 | 3300050491 | nmdc:mga00v17_90_c1 | nmdc:mga00v17_90_c1_5207_6529 | 439 |
| 1336 | 3300050492 | nmdc:mga0yw44_1586_c1 | nmdc:mga0yw44_1586_c1_5246_6568 | 439 |
| 1337 | 3300050494 | nmdc:mga06z11_34216_c1 | nmdc:mga06z11_34216_c1_1082_2404 | 439 |
| 1338 | 3300050516 | nmdc:mga0sz30_711_c2 | nmdc:mga0sz30_711_c2_3219_4541 | 439 |
| 1339 | 3300053086 | Ga0500578_0037488 | Ga0500578_0037488_1236_2555 | 439 |
| 1340 | 3300053107 | Ga0500560_012286 | Ga0500560_012286_480_1802 | 439 |
| 1341 | 3300053109 | Ga0500569_000527 | Ga0500569_000527_1595_2914 | 439 |
| 1342 | 3300053118 | Ga0500594_0001679 | Ga0500594_0001679_1210_2529 | 439 |
| 1343 | 3300053130 | Ga0500642_0076166 | Ga0500642_0076166_38_1357 | 439 |
| 1344 | 3300053137 | Ga0500561_0000208 | Ga0500561_0000208_8016_9338 | 439 |
| 1345 | 3300053139 | Ga0500568_0000533 | Ga0500568_0000533_20939_22258 | 439 |
| 1346 | 3300053148 | Ga0500590_002289 | Ga0500590_002289_2958_4280 | 439 |
| 1347 | 3300053153 | Ga0500616_0001527 | Ga0500616_0001527_4887_6206 | 439 |
| 1348 | 3300059643 | Ga0587072_003865 | Ga0587072_003865_463_1785 | 439 |
| 1349 | 3300060353 | Ga0501082_0034529 | Ga0501082_0034529_644_1966 | 439 |
| 1350 | iso_pu_bacteria | 2837651117 | 2837652160 | 439 |
| 1351 | 3300006038 | Ga0075365_10029225 | Ga0075365_100292252 | 440 |
| 1352 | 3300050492 | nmdc:mga0yw44_937_c1 | nmdc:mga0yw44_937_c1_4577_5902 | 440 |
| 1353 | 3300006946 | Ga0079104_1000069 | Ga0079104_1000069131 | 441 |
| 1354 | 3300027111 | Ga0209281_1000253 | Ga0209281_100025316 | 441 |
| 1355 | 3300046530 | Ga0495654_0000320 | Ga0495654_0000320_19123_20451 | 441 |
| 1356 | 3300050491 | nmdc:mga00v17_92752_c1 | nmdc:mga00v17_92752_c1_297_1625 | 441 |
| 1357 | 3300053125 | Ga0500618_000132 | Ga0500618_000132_11381_12709 | 441 |
| 1358 | iso_pu_bacteria | 2891048133 | 2891051165 | 449 |
| 1359 | iso_pu_bacteria | 2995392953 | 2995395485 | 449 |
| 1360 | iso_pu_bacteria | 2551306092 | 2551738467 | 451 |
| 1361 | iso_pu_bacteria | 2551306093 | 2551742083 | 451 |
| 1362 | 3300001979 | JGI24740J21852_10002672 | JGI24740J21852_100026722 | 467 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bfc-assembly1.cif.gz_A | crystal structure of the c-terminal cmp-kdo binding domain of waaa from acinetobacter baumannii | 0.9214 | 221 | 404 |
| 4bfc-assembly1.cif.gz_A | crystal structure of the c-terminal cmp-kdo binding domain of waaa from acinetobacter baumannii | 0.8759 | 221 | 404 |
| 1o6c-assembly1.cif.gz_A | crystal structure of udp-n-acetylglucosamine 2-epimerase | 0.6814 | 55 | 399 |
| 2gek-assembly1.cif.gz_A | crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp | 0.676 | 58 | 424 |
| 7vyy-assembly1.cif.gz_B | the crystal structure of non-hydrolyzing udpglcnac 2-epimerase | 0.6689 | 55 | 417 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AC75_216_403_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9595 | 222 | 404 | 3.40.50.2000 |
| af_A0A1D6N6V1_47_223_3.40.50.11720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;3-Deoxy-D-manno-octulosonic-acid transferase, N-terminal domain | 0.9586 | 45 | 212 | 3.40.50.11720 |
| af_P0AC75_41_209_3.40.50.11720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;3-Deoxy-D-manno-octulosonic-acid transferase, N-terminal domain | 0.9584 | 48 | 212 | 3.40.50.11720 |
| af_I1L969_232_416_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9513 | 225 | 403 | 3.40.50.2000 |
| af_A0A0P0VAM2_51_200_3.40.50.11720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;3-Deoxy-D-manno-octulosonic-acid transferase, N-terminal domain | 0.9494 | 47 | 188 | 3.40.50.11720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S3IGI5-F1-model_v4 | 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) | 0.9899 | 77 | 187 |
GO:0005886
GO:0009244 GO:0009245 GO:0043842 |
| AF-A0A352KRL0-F1-model_v4 | 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) | 0.9744 | 265 | 400 |
GO:0005886
GO:0009244 GO:0009245 GO:0043842 |
| AF-A0A3S3IGI5-F1-model_v4 | 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) | 0.9725 | 77 | 187 |
GO:0005886
GO:0009244 GO:0009245 GO:0043842 |
| AF-A0A3N5ML70-F1-model_v4 | 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) | 0.9714 | 107 | 421 |
GO:0005886
GO:0009244 GO:0009245 GO:0043842 |
| AF-A0A060BLA8-F1-model_v4 | 3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase) | 0.9681 | 232 | 357 |
GO:0005886
GO:0009244 GO:0009245 GO:0043842 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar