F493134
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1338 | 327 | 2676 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10808210|Ga0105247_108082102 |
| Length | 149 |
| Sequence | VVTPASGRPRQQQEDDMRAYILGALVAVGLVLAAGTVRAHHSFAAEYDANKPIKISGTVTKMEWMNPHARFYVDVKETDGKVTNWNFELGAIPVLLKQGWKKDSLKQGDQVTVEGSLAKDGSKTANARSVVLSDGRKVFAGSSGGNGPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 200 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 241 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 242 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 243 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 244 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 245 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.86 |
| Metatranscriptomes | 3.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 1.05 |
| Rhizosphere | 97.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105247_10808210 | 3300009101 | Bacteria | 716 |
| 2 | Ga0058863_11384065 | 3300004799 | Unclassified | 1213 |
| 3 | Ga0058863_11860520 | 3300004799 | Unclassified | 564 |
| 4 | Ga0058861_11360516 | 3300004800 | Bacteria | 580 |
| 5 | Ga0058861_11653710 | 3300004800 | Unclassified | 1913 |
| 6 | Ga0058861_11906043 | 3300004800 | Bacteria | 621 |
| 7 | Ga0058860_10572999 | 3300004801 | Unclassified | 594 |
| 8 | Ga0058862_10882323 | 3300004803 | Bacteria | 1096 |
| 9 | Ga0058862_12292071 | 3300004803 | Unclassified | 1490 |
| 10 | Ga0058862_12848695 | 3300004803 | Bacteria | 1527 |
| 11 | Ga0058862_12883805 | 3300004803 | Bacteria | 729 |
| 12 | Ga0065704_10227521 | 3300005289 | Bacteria | 1054 |
| 13 | Ga0065707_10215388 | 3300005295 | Bacteria | 1247 |
| 14 | Ga0070658_10309734 | 3300005327 | Unclassified | 1347 |
| 15 | Ga0070676_10188458 | 3300005328 | Unclassified | 1345 |
| 16 | Ga0070676_10414428 | 3300005328 | Unclassified | 940 |
| 17 | Ga0070676_11582046 | 3300005328 | Bacteria | 506 |
| 18 | Ga0070683_100002345 | 3300005329 | Bacteria | 15024 |
| 19 | Ga0070683_100007027 | 3300005329 | Bacteria | 9475 |
| 20 | Ga0070683_100007330 | 3300005329 | Bacteria | 9314 |
| 21 | Ga0070683_100026483 | 3300005329 | Bacteria | 5222 |
| 22 | Ga0070683_100031320 | 3300005329 | Bacteria | 4835 |
| 23 | Ga0070683_100034975 | 3300005329 | Unclassified | 4592 |
| 24 | Ga0070683_100050632 | 3300005329 | Bacteria | 3846 |
| 25 | Ga0070683_100056252 | 3300005329 | Unclassified | 3653 |
| 26 | Ga0070683_100062857 | 3300005329 | Unclassified | 3452 |
| 27 | Ga0070683_100069695 | 3300005329 | Bacteria | 3279 |
| 28 | Ga0070683_100069785 | 3300005329 | Bacteria | 3277 |
| 29 | Ga0070683_100079969 | 3300005329 | Bacteria | 3059 |
| 30 | Ga0070683_100243025 | 3300005329 | Unclassified | 1712 |
| 31 | Ga0070683_100324622 | 3300005329 | Unclassified | 1465 |
| 32 | Ga0070683_100596853 | 3300005329 | Bacteria | 1057 |
| 33 | Ga0070683_100828048 | 3300005329 | Bacteria | 887 |
| 34 | Ga0070683_101015345 | 3300005329 | Unclassified | 796 |
| 35 | Ga0070683_101034575 | 3300005329 | Unclassified | 788 |
| 36 | Ga0070683_101204223 | 3300005329 | Unclassified | 728 |
| 37 | Ga0070690_100050211 | 3300005330 | Bacteria | 2661 |
| 38 | Ga0070690_100317884 | 3300005330 | Bacteria | 1121 |
| 39 | Ga0070690_100786286 | 3300005330 | Unclassified | 737 |
| 40 | Ga0070670_100005882 | 3300005331 | Bacteria | 10365 |
| 41 | Ga0070670_100320100 | 3300005331 | Unclassified | 1359 |
| 42 | Ga0068869_100078093 | 3300005334 | Unclassified | 2465 |
| 43 | Ga0068869_100193464 | 3300005334 | Bacteria | 1601 |
| 44 | Ga0068869_100588296 | 3300005334 | Bacteria | 939 |
| 45 | Ga0068869_100977678 | 3300005334 | Unclassified | 736 |
| 46 | Ga0068869_101370855 | 3300005334 | Unclassified | 625 |
| 47 | Ga0068869_101734854 | 3300005334 | Unclassified | 558 |
| 48 | Ga0070666_10024073 | 3300005335 | Bacteria | 3964 |
| 49 | Ga0070666_10215985 | 3300005335 | Bacteria | 1352 |
| 50 | Ga0070666_10405754 | 3300005335 | Bacteria | 980 |
| 51 | Ga0070666_10422344 | 3300005335 | Unclassified | 960 |
| 52 | Ga0070666_10559303 | 3300005335 | Unclassified | 832 |
| 53 | Ga0070680_100013477 | 3300005336 | Bacteria | 6368 |
| 54 | Ga0070680_100029837 | 3300005336 | Bacteria | 4378 |
| 55 | Ga0070680_100151391 | 3300005336 | Bacteria | 1948 |
| 56 | Ga0070680_100229327 | 3300005336 | Unclassified | 1568 |
| 57 | Ga0070680_101308905 | 3300005336 | Unclassified | 627 |
| 58 | Ga0070682_100457078 | 3300005337 | Bacteria | 979 |
| 59 | Ga0070682_101110468 | 3300005337 | Unclassified | 662 |
| 60 | Ga0070682_101298510 | 3300005337 | Unclassified | 618 |
| 61 | Ga0068868_100023014 | 3300005338 | Bacteria | 4711 |
| 62 | Ga0068868_100137746 | 3300005338 | Unclassified | 2002 |
| 63 | Ga0068868_101293173 | 3300005338 | Unclassified | 677 |
| 64 | Ga0070660_100038870 | 3300005339 | Bacteria | 3614 |
| 65 | Ga0070660_100046368 | 3300005339 | Unclassified | 3331 |
| 66 | Ga0070660_100074978 | 3300005339 | Unclassified | 2648 |
| 67 | Ga0070660_100112143 | 3300005339 | Bacteria | 2171 |
| 68 | Ga0070660_100217900 | 3300005339 | Bacteria | 1551 |
| 69 | Ga0070689_100114995 | 3300005340 | Bacteria | 2144 |
| 70 | Ga0070689_100206846 | 3300005340 | Bacteria | 1605 |
| 71 | Ga0070689_100472252 | 3300005340 | Bacteria | 1070 |
| 72 | Ga0070691_10012040 | 3300005341 | Unclassified | 3961 |
| 73 | Ga0070691_10018047 | 3300005341 | Unclassified | 3249 |
| 74 | Ga0070691_10134706 | 3300005341 | Bacteria | 1254 |
| 75 | Ga0070691_10333633 | 3300005341 | Bacteria | 838 |
| 76 | Ga0070691_10456970 | 3300005341 | Unclassified | 730 |
| 77 | Ga0070687_100952647 | 3300005343 | Unclassified | 619 |
| 78 | Ga0070661_100060635 | 3300005344 | Bacteria | 2776 |
| 79 | Ga0070661_100264588 | 3300005344 | Bacteria | 1330 |
| 80 | Ga0070661_100337359 | 3300005344 | Bacteria | 1180 |
| 81 | Ga0070661_100349870 | 3300005344 | Unclassified | 1159 |
| 82 | Ga0070692_10109473 | 3300005345 | Bacteria | 1526 |
| 83 | Ga0070692_10191505 | 3300005345 | Bacteria | 1192 |
| 84 | Ga0070668_100337956 | 3300005347 | Bacteria | 1272 |
| 85 | Ga0070669_100428240 | 3300005353 | Bacteria | 1087 |
| 86 | Ga0070669_101022808 | 3300005353 | Bacteria | 709 |
| 87 | Ga0070675_100149917 | 3300005354 | Bacteria | 1999 |
| 88 | Ga0070675_100194911 | 3300005354 | Bacteria | 1757 |
| 89 | Ga0070675_100214200 | 3300005354 | Bacteria | 1675 |
| 90 | Ga0070671_100040252 | 3300005355 | Bacteria | 3881 |
| 91 | Ga0070671_100157345 | 3300005355 | Bacteria | 1920 |
| 92 | Ga0070671_100917285 | 3300005355 | Unclassified | 766 |
| 93 | Ga0070674_100335792 | 3300005356 | Bacteria | 1216 |
| 94 | Ga0070674_100513238 | 3300005356 | Bacteria | 1000 |
| 95 | Ga0070674_100542029 | 3300005356 | Unclassified | 975 |
| 96 | Ga0070674_100996114 | 3300005356 | Bacteria | 735 |
| 97 | Ga0070673_100005787 | 3300005364 | Bacteria | 7962 |
| 98 | Ga0070673_100106619 | 3300005364 | Bacteria | 2317 |
| 99 | Ga0070673_100124756 | 3300005364 | Bacteria | 2153 |
| 100 | Ga0070673_100169976 | 3300005364 | Bacteria | 1860 |
| 101 | Ga0070673_100182409 | 3300005364 | Bacteria | 1798 |
| 102 | Ga0070673_100256744 | 3300005364 | Unclassified | 1525 |
| 103 | Ga0070673_100424792 | 3300005364 | Bacteria | 1192 |
| 104 | Ga0070673_100896624 | 3300005364 | Unclassified | 822 |
| 105 | Ga0070688_100074661 | 3300005365 | Bacteria | 2178 |
| 106 | Ga0070688_101739814 | 3300005365 | Bacteria | 511 |
| 107 | Ga0070659_100047286 | 3300005366 | Bacteria | 3374 |
| 108 | Ga0070659_100075163 | 3300005366 | Unclassified | 2692 |
| 109 | Ga0070667_100001720 | 3300005367 | Bacteria | 19568 |
| 110 | Ga0070667_100147324 | 3300005367 | Bacteria | 2066 |
| 111 | Ga0070667_100974453 | 3300005367 | Bacteria | 791 |
| 112 | Ga0070667_101886084 | 3300005367 | Unclassified | 563 |
| 113 | Ga0070703_10232305 | 3300005406 | Bacteria | 740 |
| 114 | Ga0070709_10028638 | 3300005434 | Unclassified | 3324 |
| 115 | Ga0070709_10064165 | 3300005434 | Bacteria | 2348 |
| 116 | Ga0070709_10222275 | 3300005434 | Unclassified | 1347 |
| 117 | Ga0070709_10415598 | 3300005434 | Bacteria | 1007 |
| 118 | Ga0070714_100044338 | 3300005435 | Bacteria | 3765 |
| 119 | Ga0070714_100368355 | 3300005435 | Unclassified | 1352 |
| 120 | Ga0070714_100455186 | 3300005435 | Bacteria | 1216 |
| 121 | Ga0070713_100016997 | 3300005436 | Bacteria | 5486 |
| 122 | Ga0070713_100028621 | 3300005436 | Unclassified | 4401 |
| 123 | Ga0070713_100030488 | 3300005436 | Bacteria | 4283 |
| 124 | Ga0070713_100054358 | 3300005436 | Bacteria | 3322 |
| 125 | Ga0070713_100107017 | 3300005436 | Bacteria | 2432 |
| 126 | Ga0070713_100175678 | 3300005436 | Bacteria | 1922 |
| 127 | Ga0070713_100636098 | 3300005436 | Bacteria | 1015 |
| 128 | Ga0070713_100690245 | 3300005436 | Unclassified | 974 |
| 129 | Ga0070713_100817213 | 3300005436 | Unclassified | 894 |
| 130 | Ga0070710_10395325 | 3300005437 | Unclassified | 925 |
| 131 | Ga0070710_10457965 | 3300005437 | Unclassified | 866 |
| 132 | Ga0070710_10506795 | 3300005437 | Unclassified | 827 |
| 133 | Ga0070701_10004374 | 3300005438 | Bacteria | 5712 |
| 134 | Ga0070701_10018944 | 3300005438 | Bacteria | 3243 |
| 135 | Ga0070701_10038134 | 3300005438 | Bacteria | 2430 |
| 136 | Ga0070711_100046631 | 3300005439 | Bacteria | 2954 |
| 137 | Ga0070711_100075032 | 3300005439 | Bacteria | 2393 |
| 138 | Ga0070711_100092618 | 3300005439 | Bacteria | 2181 |
| 139 | Ga0070711_100104359 | 3300005439 | Bacteria | 2068 |
| 140 | Ga0070711_100152967 | 3300005439 | Unclassified | 1741 |
| 141 | Ga0070711_100162332 | 3300005439 | Unclassified | 1695 |
| 142 | Ga0070711_100434143 | 3300005439 | Bacteria | 1072 |
| 143 | Ga0070711_102007357 | 3300005439 | Unclassified | 509 |
| 144 | Ga0070705_100001435 | 3300005440 | Bacteria | 12605 |
| 145 | Ga0070705_100002500 | 3300005440 | Bacteria | 9242 |
| 146 | Ga0070705_100133950 | 3300005440 | Unclassified | 1620 |
| 147 | Ga0070705_100200815 | 3300005440 | Bacteria | 1367 |
| 148 | Ga0070705_100792466 | 3300005440 | Bacteria | 753 |
| 149 | Ga0070705_100943505 | 3300005440 | Unclassified | 697 |
| 150 | Ga0070705_101458352 | 3300005440 | Bacteria | 572 |
| 151 | Ga0070700_100032779 | 3300005441 | Bacteria | 3125 |
| 152 | Ga0070700_100071387 | 3300005441 | Bacteria | 2216 |
| 153 | Ga0070700_100095694 | 3300005441 | Bacteria | 1947 |
| 154 | Ga0070700_100214486 | 3300005441 | Bacteria | 1360 |
| 155 | Ga0070694_100003150 | 3300005444 | Bacteria | 9827 |
| 156 | Ga0070694_100108601 | 3300005444 | Bacteria | 1973 |
| 157 | Ga0070694_100279690 | 3300005444 | Bacteria | 1272 |
| 158 | Ga0070694_100305915 | 3300005444 | Unclassified | 1219 |
| 159 | Ga0070694_100355481 | 3300005444 | Bacteria | 1136 |
| 160 | Ga0070694_100417269 | 3300005444 | Bacteria | 1054 |
| 161 | Ga0070694_100548720 | 3300005444 | Bacteria | 925 |
| 162 | Ga0070694_100641547 | 3300005444 | Bacteria | 859 |
| 163 | Ga0070663_100834405 | 3300005455 | Unclassified | 792 |
| 164 | Ga0070678_100470508 | 3300005456 | Unclassified | 1104 |
| 165 | Ga0070662_100004942 | 3300005457 | Bacteria | 8469 |
| 166 | Ga0070662_100181864 | 3300005457 | Bacteria | 1658 |
| 167 | Ga0070662_100311062 | 3300005457 | Unclassified | 1282 |
| 168 | Ga0070681_10002128 | 3300005458 | Bacteria | 17991 |
| 169 | Ga0070681_10004375 | 3300005458 | Bacteria | 13442 |
| 170 | Ga0070681_10059269 | 3300005458 | Bacteria | 3808 |
| 171 | Ga0070681_10241004 | 3300005458 | Bacteria | 1722 |
| 172 | Ga0068867_100100292 | 3300005459 | Unclassified | 2211 |
| 173 | Ga0068867_100149478 | 3300005459 | Bacteria | 1833 |
| 174 | Ga0068867_100359435 | 3300005459 | Unclassified | 1217 |
| 175 | Ga0068867_100732239 | 3300005459 | Unclassified | 875 |
| 176 | Ga0068867_101183253 | 3300005459 | Bacteria | 701 |
| 177 | Ga0070685_10277332 | 3300005466 | Bacteria | 1121 |
| 178 | Ga0070706_100387980 | 3300005467 | Bacteria | 1300 |
| 179 | Ga0070698_100009281 | 3300005471 | Bacteria | 10554 |
| 180 | Ga0070698_100198166 | 3300005471 | Bacteria | 1944 |
| 181 | Ga0070698_100932935 | 3300005471 | Bacteria | 814 |
| 182 | Ga0070698_100960636 | 3300005471 | Bacteria | 801 |
| 183 | Ga0070699_100009166 | 3300005518 | Bacteria | 8578 |
| 184 | Ga0070699_100069062 | 3300005518 | Bacteria | 3070 |
| 185 | Ga0070699_101650130 | 3300005518 | Bacteria | 587 |
| 186 | Ga0070679_100000317 | 3300005530 | Bacteria | 40891 |
| 187 | Ga0070679_100000639 | 3300005530 | Bacteria | 29746 |
| 188 | Ga0070679_100042258 | 3300005530 | Bacteria | 4539 |
| 189 | Ga0070679_100607365 | 3300005530 | Bacteria | 1037 |
| 190 | Ga0070679_101033822 | 3300005530 | Unclassified | 766 |
| 191 | Ga0070679_101042627 | 3300005530 | Unclassified | 762 |
| 192 | Ga0070684_100001053 | 3300005535 | Bacteria | 19708 |
| 193 | Ga0070684_100009305 | 3300005535 | Bacteria | 7734 |
| 194 | Ga0070684_100009843 | 3300005535 | Bacteria | 7551 |
| 195 | Ga0070684_100023219 | 3300005535 | Bacteria | 5183 |
| 196 | Ga0070684_100053538 | 3300005535 | Unclassified | 3514 |
| 197 | Ga0070684_100066215 | 3300005535 | Bacteria | 3172 |
| 198 | Ga0070684_100083416 | 3300005535 | Bacteria | 2832 |
| 199 | Ga0070684_100084648 | 3300005535 | Bacteria | 2811 |
| 200 | Ga0070684_100128939 | 3300005535 | Bacteria | 2281 |
| 201 | Ga0070684_100248814 | 3300005535 | Bacteria | 1624 |
| 202 | Ga0070684_100373886 | 3300005535 | Bacteria | 1312 |
| 203 | Ga0070684_101167988 | 3300005535 | Unclassified | 724 |
| 204 | Ga0070697_100271570 | 3300005536 | Bacteria | 1453 |
| 205 | Ga0070697_100620213 | 3300005536 | Unclassified | 951 |
| 206 | Ga0070697_100807347 | 3300005536 | Unclassified | 830 |
| 207 | Ga0070697_101959118 | 3300005536 | Unclassified | 524 |
| 208 | Ga0068853_100038010 | 3300005539 | Unclassified | 4099 |
| 209 | Ga0068853_100053906 | 3300005539 | Bacteria | 3464 |
| 210 | Ga0068853_100110004 | 3300005539 | Unclassified | 2447 |
| 211 | Ga0068853_100112737 | 3300005539 | Bacteria | 2417 |
| 212 | Ga0068853_100180352 | 3300005539 | Unclassified | 1915 |
| 213 | Ga0068853_100773026 | 3300005539 | Unclassified | 919 |
| 214 | Ga0068853_101847532 | 3300005539 | Unclassified | 586 |
| 215 | Ga0070672_100102173 | 3300005543 | Bacteria | 2327 |
| 216 | Ga0070672_100639645 | 3300005543 | Unclassified | 929 |
| 217 | Ga0070672_101656389 | 3300005543 | Unclassified | 574 |
| 218 | Ga0070686_100141638 | 3300005544 | Unclassified | 1674 |
| 219 | Ga0070686_100181556 | 3300005544 | Bacteria | 1495 |
| 220 | Ga0070686_100303310 | 3300005544 | Bacteria | 1185 |
| 221 | Ga0070686_100463144 | 3300005544 | Unclassified | 977 |
| 222 | Ga0070686_100806880 | 3300005544 | Bacteria | 757 |
| 223 | Ga0070695_100000407 | 3300005545 | Bacteria | 22225 |
| 224 | Ga0070695_100025631 | 3300005545 | Unclassified | 3642 |
| 225 | Ga0070695_100152647 | 3300005545 | Unclassified | 1613 |
| 226 | Ga0070695_100161808 | 3300005545 | Bacteria | 1572 |
| 227 | Ga0070695_100270632 | 3300005545 | Unclassified | 1244 |
| 228 | Ga0070695_100401465 | 3300005545 | Bacteria | 1039 |
| 229 | Ga0070696_100000265 | 3300005546 | Bacteria | 31638 |
| 230 | Ga0070696_100012427 | 3300005546 | Bacteria | 5711 |
| 231 | Ga0070696_100348614 | 3300005546 | Bacteria | 1146 |
| 232 | Ga0070696_100515654 | 3300005546 | Bacteria | 953 |
| 233 | Ga0070696_100763280 | 3300005546 | Unclassified | 793 |
| 234 | Ga0070696_100881679 | 3300005546 | Bacteria | 741 |
| 235 | Ga0070696_101528324 | 3300005546 | Bacteria | 572 |
| 236 | Ga0070696_101627935 | 3300005546 | Unclassified | 555 |
| 237 | Ga0070693_100015589 | 3300005547 | Bacteria | 3916 |
| 238 | Ga0070693_100027826 | 3300005547 | Bacteria | 3068 |
| 239 | Ga0070693_100079038 | 3300005547 | Viruses | 1956 |
| 240 | Ga0070693_100094819 | 3300005547 | Bacteria | 1806 |
| 241 | Ga0070693_100157229 | 3300005547 | Bacteria | 1445 |
| 242 | Ga0070693_100524306 | 3300005547 | Bacteria | 844 |
| 243 | Ga0070693_100834722 | 3300005547 | Bacteria | 686 |
| 244 | Ga0070693_101197686 | 3300005547 | Unclassified | 583 |
| 245 | Ga0070665_100029385 | 3300005548 | Bacteria | 5532 |
| 246 | Ga0070665_100471424 | 3300005548 | Unclassified | 1266 |
| 247 | Ga0070704_100001131 | 3300005549 | Bacteria | 13916 |
| 248 | Ga0070704_100004525 | 3300005549 | Bacteria | 8029 |
| 249 | Ga0070704_100006854 | 3300005549 | Bacteria | 6748 |
| 250 | Ga0070704_100098296 | 3300005549 | Bacteria | 2199 |
| 251 | Ga0070704_100145312 | 3300005549 | Bacteria | 1857 |
| 252 | Ga0070704_101572347 | 3300005549 | Bacteria | 606 |
| 253 | Ga0068855_100001577 | 3300005563 | Bacteria | 28635 |
| 254 | Ga0068855_100004380 | 3300005563 | Bacteria | 17252 |
| 255 | Ga0068855_100004802 | 3300005563 | Bacteria | 16499 |
| 256 | Ga0068855_100079247 | 3300005563 | Bacteria | 3810 |
| 257 | Ga0068855_100085923 | 3300005563 | Bacteria | 3639 |
| 258 | Ga0068855_100263485 | 3300005563 | Unclassified | 1919 |
| 259 | Ga0068855_100350783 | 3300005563 | Bacteria | 1625 |
| 260 | Ga0068855_100374191 | 3300005563 | Unclassified | 1565 |
| 261 | Ga0068855_100442408 | 3300005563 | Bacteria | 1419 |
| 262 | Ga0068855_100546995 | 3300005563 | Bacteria | 1253 |
| 263 | Ga0068855_101284731 | 3300005563 | Unclassified | 758 |
| 264 | Ga0070664_100009191 | 3300005564 | Bacteria | 8024 |
| 265 | Ga0070664_100033980 | 3300005564 | Bacteria | 4276 |
| 266 | Ga0070664_100461521 | 3300005564 | Bacteria | 1167 |
| 267 | Ga0070664_101156707 | 3300005564 | Unclassified | 729 |
| 268 | Ga0070664_101769445 | 3300005564 | Unclassified | 586 |
| 269 | Ga0068857_100000258 | 3300005577 | Bacteria | 35751 |
| 270 | Ga0068857_100004932 | 3300005577 | Bacteria | 11327 |
| 271 | Ga0068857_100005540 | 3300005577 | Bacteria | 10772 |
| 272 | Ga0068857_100027212 | 3300005577 | Bacteria | 5043 |
| 273 | Ga0068857_100035682 | 3300005577 | Bacteria | 4404 |
| 274 | Ga0068857_100170260 | 3300005577 | Unclassified | 1979 |
| 275 | Ga0068857_101192127 | 3300005577 | Unclassified | 737 |
| 276 | Ga0068854_100085439 | 3300005578 | Bacteria | 2337 |
| 277 | Ga0068854_100921715 | 3300005578 | Bacteria | 769 |
| 278 | Ga0068854_101701363 | 3300005578 | Unclassified | 577 |
| 279 | Ga0068856_100003558 | 3300005614 | Bacteria | 15693 |
| 280 | Ga0068856_100010203 | 3300005614 | Bacteria | 9131 |
| 281 | Ga0068856_100030989 | 3300005614 | Bacteria | 5231 |
| 282 | Ga0068856_100034694 | 3300005614 | Bacteria | 4941 |
| 283 | Ga0068856_100048690 | 3300005614 | Bacteria | 4178 |
| 284 | Ga0068856_100062628 | 3300005614 | Bacteria | 3674 |
| 285 | Ga0068856_100075098 | 3300005614 | Viruses | 3348 |
| 286 | Ga0068856_100113605 | 3300005614 | Bacteria | 2706 |
| 287 | Ga0068856_100169115 | 3300005614 | Bacteria | 2198 |
| 288 | Ga0068856_100194880 | 3300005614 | Bacteria | 2040 |
| 289 | Ga0068856_100403588 | 3300005614 | Unclassified | 1386 |
| 290 | Ga0068856_100425021 | 3300005614 | Unclassified | 1349 |
| 291 | Ga0068856_100755802 | 3300005614 | Unclassified | 992 |
| 292 | Ga0070702_100209624 | 3300005615 | Bacteria | 1296 |
| 293 | Ga0068852_100009583 | 3300005616 | Bacteria | 7196 |
| 294 | Ga0068852_100017258 | 3300005616 | Bacteria | 5660 |
| 295 | Ga0068852_100268314 | 3300005616 | Unclassified | 1641 |
| 296 | Ga0068852_101113263 | 3300005616 | Unclassified | 810 |
| 297 | Ga0068852_101178096 | 3300005616 | Bacteria | 787 |
| 298 | Ga0068852_102023223 | 3300005616 | Bacteria | 598 |
| 299 | Ga0068852_102423238 | 3300005616 | Unclassified | 545 |
| 300 | Ga0068859_100008801 | 3300005617 | Bacteria | 10192 |
| 301 | Ga0068859_100012958 | 3300005617 | Bacteria | 8376 |
| 302 | Ga0068859_100026501 | 3300005617 | Bacteria | 5814 |
| 303 | Ga0068859_100059021 | 3300005617 | Bacteria | 3865 |
| 304 | Ga0068859_100211503 | 3300005617 | Bacteria | 2026 |
| 305 | Ga0068859_100494008 | 3300005617 | Unclassified | 1319 |
| 306 | Ga0068859_100525913 | 3300005617 | Bacteria | 1278 |
| 307 | Ga0068859_101088092 | 3300005617 | Bacteria | 879 |
| 308 | Ga0068864_100006937 | 3300005618 | Bacteria | 9293 |
| 309 | Ga0068864_100077999 | 3300005618 | Bacteria | 2898 |
| 310 | Ga0068864_100235391 | 3300005618 | Bacteria | 1695 |
| 311 | Ga0068864_100348485 | 3300005618 | Unclassified | 1397 |
| 312 | Ga0068866_10182525 | 3300005718 | Bacteria | 1241 |
| 313 | Ga0068866_10205960 | 3300005718 | Bacteria | 1178 |
| 314 | Ga0068866_10497184 | 3300005718 | Unclassified | 806 |
| 315 | Ga0068866_10892475 | 3300005718 | Unclassified | 625 |
| 316 | Ga0068861_100005313 | 3300005719 | Bacteria | 8694 |
| 317 | Ga0068861_100006410 | 3300005719 | Bacteria | 8017 |
| 318 | Ga0068861_100026627 | 3300005719 | Bacteria | 4206 |
| 319 | Ga0068861_100167407 | 3300005719 | Bacteria | 1818 |
| 320 | Ga0068861_100835351 | 3300005719 | Unclassified | 867 |
| 321 | Ga0068861_101032376 | 3300005719 | Bacteria | 786 |
| 322 | Ga0068851_10078327 | 3300005834 | Unclassified | 1722 |
| 323 | Ga0068851_10715605 | 3300005834 | Unclassified | 617 |
| 324 | Ga0068870_11154938 | 3300005840 | Unclassified | 559 |
| 325 | Ga0068863_100015411 | 3300005841 | Bacteria | 7349 |
| 326 | Ga0068863_100117366 | 3300005841 | Bacteria | 2536 |
| 327 | Ga0068863_100303809 | 3300005841 | Unclassified | 1548 |
| 328 | Ga0068863_100467116 | 3300005841 | Unclassified | 1240 |
| 329 | Ga0068863_100478709 | 3300005841 | Bacteria | 1224 |
| 330 | Ga0068863_101005994 | 3300005841 | Unclassified | 836 |
| 331 | Ga0068858_100017530 | 3300005842 | Bacteria | 6716 |
| 332 | Ga0068858_100048367 | 3300005842 | Bacteria | 3942 |
| 333 | Ga0068858_100055499 | 3300005842 | Unclassified | 3662 |
| 334 | Ga0068858_100094353 | 3300005842 | Bacteria | 2787 |
| 335 | Ga0068858_100099888 | 3300005842 | Bacteria | 2706 |
| 336 | Ga0068858_100115429 | 3300005842 | Bacteria | 2509 |
| 337 | Ga0068858_100167608 | 3300005842 | Bacteria | 2070 |
| 338 | Ga0068858_100457005 | 3300005842 | Unclassified | 1231 |
| 339 | Ga0068858_100529589 | 3300005842 | Unclassified | 1140 |
| 340 | Ga0068858_100985601 | 3300005842 | Unclassified | 826 |
| 341 | Ga0068858_101013366 | 3300005842 | Unclassified | 814 |
| 342 | Ga0068858_101287710 | 3300005842 | Bacteria | 719 |
| 343 | Ga0068858_101544909 | 3300005842 | Bacteria | 655 |
| 344 | Ga0068860_100042646 | 3300005843 | Bacteria | 4332 |
| 345 | Ga0068860_100045862 | 3300005843 | Unclassified | 4168 |
| 346 | Ga0068860_100248656 | 3300005843 | Bacteria | 1731 |
| 347 | Ga0068860_100266306 | 3300005843 | Bacteria | 1671 |
| 348 | Ga0068860_100407982 | 3300005843 | Bacteria | 1345 |
| 349 | Ga0068860_100778569 | 3300005843 | Bacteria | 969 |
| 350 | Ga0068860_101658591 | 3300005843 | Unclassified | 661 |
| 351 | Ga0068862_100108121 | 3300005844 | Bacteria | 2439 |
| 352 | Ga0068862_100123311 | 3300005844 | Bacteria | 2286 |
| 353 | Ga0068862_100226343 | 3300005844 | Bacteria | 1695 |
| 354 | Ga0068862_100724522 | 3300005844 | Unclassified | 965 |
| 355 | Ga0070717_10638574 | 3300006028 | Bacteria | 966 |
| 356 | Ga0075432_10123011 | 3300006058 | Bacteria | 976 |
| 357 | Ga0070715_10993176 | 3300006163 | Unclassified | 522 |
| 358 | Ga0070712_100939191 | 3300006175 | Bacteria | 747 |
| 359 | Ga0097621_100001713 | 3300006237 | Bacteria | 14989 |
| 360 | Ga0097621_100044563 | 3300006237 | Unclassified | 3579 |
| 361 | Ga0097621_100074616 | 3300006237 | Bacteria | 2809 |
| 362 | Ga0097621_100098703 | 3300006237 | Unclassified | 2454 |
| 363 | Ga0097621_100159274 | 3300006237 | Unclassified | 1940 |
| 364 | Ga0097621_100257700 | 3300006237 | Bacteria | 1529 |
| 365 | Ga0097621_100273876 | 3300006237 | Bacteria | 1484 |
| 366 | Ga0097621_100360336 | 3300006237 | Bacteria | 1295 |
| 367 | Ga0097621_101257981 | 3300006237 | Unclassified | 698 |
| 368 | Ga0068871_100004335 | 3300006358 | Bacteria | 9855 |
| 369 | Ga0068871_100005439 | 3300006358 | Bacteria | 8929 |
| 370 | Ga0068871_100035400 | 3300006358 | Bacteria | 3967 |
| 371 | Ga0068871_100037842 | 3300006358 | Unclassified | 3850 |
| 372 | Ga0068871_100119170 | 3300006358 | Bacteria | 2228 |
| 373 | Ga0068871_100119280 | 3300006358 | Bacteria | 2226 |
| 374 | Ga0068871_100135605 | 3300006358 | Bacteria | 2090 |
| 375 | Ga0068871_100598174 | 3300006358 | Bacteria | 1003 |
| 376 | Ga0068871_100778149 | 3300006358 | Unclassified | 881 |
| 377 | Ga0068871_100800608 | 3300006358 | Unclassified | 869 |
| 378 | Ga0068871_100941247 | 3300006358 | Unclassified | 802 |
| 379 | Ga0075428_100007745 | 3300006844 | Bacteria | 11902 |
| 380 | Ga0075428_100017987 | 3300006844 | Bacteria | 7810 |
| 381 | Ga0075428_100247730 | 3300006844 | Bacteria | 1921 |
| 382 | Ga0075430_100005720 | 3300006846 | Bacteria | 10487 |
| 383 | Ga0075430_100072688 | 3300006846 | Bacteria | 2884 |
| 384 | Ga0075430_100228350 | 3300006846 | Unclassified | 1544 |
| 385 | Ga0075430_100842287 | 3300006846 | Bacteria | 756 |
| 386 | Ga0075430_101137886 | 3300006846 | Bacteria | 643 |
| 387 | Ga0075431_100064718 | 3300006847 | Bacteria | 3775 |
| 388 | Ga0075431_100152444 | 3300006847 | Bacteria | 2379 |
| 389 | Ga0075431_101944344 | 3300006847 | Bacteria | 544 |
| 390 | Ga0075433_10447888 | 3300006852 | Bacteria | 1138 |
| 391 | Ga0075433_10567027 | 3300006852 | Bacteria | 997 |
| 392 | Ga0075434_100128556 | 3300006871 | Bacteria | 2551 |
| 393 | Ga0075434_100654962 | 3300006871 | Unclassified | 1068 |
| 394 | Ga0075434_100722181 | 3300006871 | Bacteria | 1013 |
| 395 | Ga0075434_101667684 | 3300006871 | Unclassified | 645 |
| 396 | Ga0075429_100045776 | 3300006880 | Bacteria | 3806 |
| 397 | Ga0075429_100067494 | 3300006880 | Bacteria | 3112 |
| 398 | Ga0075429_100085822 | 3300006880 | Bacteria | 2743 |
| 399 | Ga0075429_100151178 | 3300006880 | Bacteria | 2033 |
| 400 | Ga0068865_100031670 | 3300006881 | Bacteria | 3527 |
| 401 | Ga0068865_100031693 | 3300006881 | Unclassified | 3526 |
| 402 | Ga0068865_100098943 | 3300006881 | Bacteria | 2132 |
| 403 | Ga0068865_100487359 | 3300006881 | Unclassified | 1026 |
| 404 | Ga0068865_100956431 | 3300006881 | Bacteria | 748 |
| 405 | Ga0068865_101606170 | 3300006881 | Unclassified | 584 |
| 406 | Ga0075436_100290454 | 3300006914 | Unclassified | 1170 |
| 407 | Ga0075436_100349979 | 3300006914 | Unclassified | 1065 |
| 408 | Ga0075436_100367120 | 3300006914 | Unclassified | 1039 |
| 409 | Ga0075436_100376584 | 3300006914 | Bacteria | 1026 |
| 410 | Ga0075436_101125609 | 3300006914 | Bacteria | 591 |
| 411 | Ga0097620_100008801 | 3300006931 | Bacteria | 10192 |
| 412 | Ga0097620_100012958 | 3300006931 | Bacteria | 8376 |
| 413 | Ga0097620_100026501 | 3300006931 | Bacteria | 5814 |
| 414 | Ga0097620_100059022 | 3300006931 | Bacteria | 3865 |
| 415 | Ga0097620_100211504 | 3300006931 | Bacteria | 2026 |
| 416 | Ga0097620_100494032 | 3300006931 | Unclassified | 1319 |
| 417 | Ga0097620_100525853 | 3300006931 | Bacteria | 1278 |
| 418 | Ga0097620_101087907 | 3300006931 | Bacteria | 879 |
| 419 | Ga0075435_100089398 | 3300007076 | Bacteria | 2539 |
| 420 | Ga0075435_100127083 | 3300007076 | Bacteria | 2131 |
| 421 | Ga0075435_100375399 | 3300007076 | Bacteria | 1221 |
| 422 | Ga0105240_10003712 | 3300009093 | Bacteria | 23598 |
| 423 | Ga0105240_10009712 | 3300009093 | Bacteria | 13584 |
| 424 | Ga0105240_10009808 | 3300009093 | Bacteria | 13517 |
| 425 | Ga0105240_10023985 | 3300009093 | Bacteria | 8059 |
| 426 | Ga0105240_10034115 | 3300009093 | Bacteria | 6567 |
| 427 | Ga0105240_10035184 | 3300009093 | Bacteria | 6456 |
| 428 | Ga0105240_10041342 | 3300009093 | Bacteria | 5884 |
| 429 | Ga0105240_10205588 | 3300009093 | Bacteria | 2305 |
| 430 | Ga0105240_10219055 | 3300009093 | Unclassified | 2219 |
| 431 | Ga0105240_10267218 | 3300009093 | Viruses | 1971 |
| 432 | Ga0105240_11047394 | 3300009093 | Bacteria | 870 |
| 433 | Ga0105240_11276118 | 3300009093 | Unclassified | 775 |
| 434 | Ga0105240_11679224 | 3300009093 | Bacteria | 663 |
| 435 | Ga0111539_10000958 | 3300009094 | Bacteria | 37856 |
| 436 | Ga0111539_10003608 | 3300009094 | Bacteria | 20398 |
| 437 | Ga0111539_10019744 | 3300009094 | Bacteria | 8311 |
| 438 | Ga0111539_10027853 | 3300009094 | Bacteria | 6900 |
| 439 | Ga0111539_10068616 | 3300009094 | Bacteria | 4186 |
| 440 | Ga0111539_10249338 | 3300009094 | Bacteria | 2067 |
| 441 | Ga0111539_10481335 | 3300009094 | Unclassified | 1446 |
| 442 | Ga0111539_11371072 | 3300009094 | Unclassified | 820 |
| 443 | Ga0105245_10000754 | 3300009098 | Bacteria | 29261 |
| 444 | Ga0105245_10002867 | 3300009098 | Bacteria | 15490 |
| 445 | Ga0105245_10003919 | 3300009098 | Bacteria | 13227 |
| 446 | Ga0105245_10005756 | 3300009098 | Bacteria | 10880 |
| 447 | Ga0105245_10113908 | 3300009098 | Bacteria | 2519 |
| 448 | Ga0105245_10129763 | 3300009098 | Unclassified | 2363 |
| 449 | Ga0105245_10276027 | 3300009098 | Bacteria | 1641 |
| 450 | Ga0105245_10279186 | 3300009098 | Bacteria | 1632 |
| 451 | Ga0105245_10375500 | 3300009098 | Bacteria | 1415 |
| 452 | Ga0105245_10502835 | 3300009098 | Bacteria | 1228 |
| 453 | Ga0105245_10568068 | 3300009098 | Unclassified | 1158 |
| 454 | Ga0105245_10768019 | 3300009098 | Unclassified | 1000 |
| 455 | Ga0105245_11188548 | 3300009098 | Bacteria | 810 |
| 456 | Ga0105245_11201318 | 3300009098 | Unclassified | 806 |
| 457 | Ga0105245_11366157 | 3300009098 | Bacteria | 758 |
| 458 | Ga0105245_11902657 | 3300009098 | Unclassified | 648 |
| 459 | Ga0105245_11928547 | 3300009098 | Unclassified | 644 |
| 460 | Ga0105245_12533262 | 3300009098 | Unclassified | 566 |
| 461 | Ga0105247_10006758 | 3300009101 | Bacteria | 7080 |
| 462 | Ga0105247_10085628 | 3300009101 | Bacteria | 1993 |
| 463 | Ga0105247_10762319 | 3300009101 | Unclassified | 735 |
| 464 | Ga0114129_10033252 | 3300009147 | Bacteria | 7288 |
| 465 | Ga0114129_10043256 | 3300009147 | Bacteria | 6337 |
| 466 | Ga0114129_10089655 | 3300009147 | Bacteria | 4263 |
| 467 | Ga0114129_10257597 | 3300009147 | Bacteria | 2340 |
| 468 | Ga0114129_11155077 | 3300009147 | Bacteria | 967 |
| 469 | Ga0105243_10031200 | 3300009148 | Bacteria | 4108 |
| 470 | Ga0105243_10098187 | 3300009148 | Unclassified | 2425 |
| 471 | Ga0105243_10169464 | 3300009148 | Unclassified | 1890 |
| 472 | Ga0105243_10198107 | 3300009148 | Unclassified | 1759 |
| 473 | Ga0105243_10428371 | 3300009148 | Unclassified | 1236 |
| 474 | Ga0105243_10594427 | 3300009148 | Bacteria | 1064 |
| 475 | Ga0105243_10597125 | 3300009148 | Bacteria | 1062 |
| 476 | Ga0105243_10777265 | 3300009148 | Bacteria | 941 |
| 477 | Ga0105243_10897446 | 3300009148 | Bacteria | 881 |
| 478 | Ga0105243_11263761 | 3300009148 | Bacteria | 754 |
| 479 | Ga0105241_10001981 | 3300009174 | Bacteria | 15507 |
| 480 | Ga0105241_10011630 | 3300009174 | Bacteria | 6456 |
| 481 | Ga0105241_10024030 | 3300009174 | Bacteria | 4525 |
| 482 | Ga0105241_10027465 | 3300009174 | Bacteria | 4239 |
| 483 | Ga0105241_10032106 | 3300009174 | Unclassified | 3934 |
| 484 | Ga0105241_10041476 | 3300009174 | Bacteria | 3477 |
| 485 | Ga0105241_10051576 | 3300009174 | Bacteria | 3138 |
| 486 | Ga0105241_10200353 | 3300009174 | Unclassified | 1667 |
| 487 | Ga0105241_10231934 | 3300009174 | Unclassified | 1556 |
| 488 | Ga0105241_10363931 | 3300009174 | Bacteria | 1259 |
| 489 | Ga0105241_10515037 | 3300009174 | Bacteria | 1069 |
| 490 | Ga0105241_10552410 | 3300009174 | Unclassified | 1034 |
| 491 | Ga0105241_11080366 | 3300009174 | Unclassified | 754 |
| 492 | Ga0105242_10007238 | 3300009176 | Bacteria | 8555 |
| 493 | Ga0105242_10042795 | 3300009176 | Unclassified | 3660 |
| 494 | Ga0105242_10077281 | 3300009176 | Bacteria | 2777 |
| 495 | Ga0105242_10170661 | 3300009176 | Bacteria | 1912 |
| 496 | Ga0105242_10301643 | 3300009176 | Bacteria | 1462 |
| 497 | Ga0105242_10451686 | 3300009176 | Bacteria | 1212 |
| 498 | Ga0105242_10466061 | 3300009176 | Bacteria | 1194 |
| 499 | Ga0105242_10495189 | 3300009176 | Unclassified | 1161 |
| 500 | Ga0105242_10560194 | 3300009176 | Bacteria | 1097 |
| 501 | Ga0105242_10855356 | 3300009176 | Unclassified | 905 |
| 502 | Ga0105242_11095123 | 3300009176 | Unclassified | 810 |
| 503 | Ga0105242_11233312 | 3300009176 | Unclassified | 768 |
| 504 | Ga0105242_11583147 | 3300009176 | Unclassified | 688 |
| 505 | Ga0105248_10011826 | 3300009177 | Bacteria | 9628 |
| 506 | Ga0105248_10013168 | 3300009177 | Bacteria | 9106 |
| 507 | Ga0105248_10014349 | 3300009177 | Bacteria | 8718 |
| 508 | Ga0105248_10018424 | 3300009177 | Bacteria | 7715 |
| 509 | Ga0105248_10086468 | 3300009177 | Bacteria | 3528 |
| 510 | Ga0105248_10299821 | 3300009177 | Bacteria | 1810 |
| 511 | Ga0105248_10539373 | 3300009177 | Bacteria | 1316 |
| 512 | Ga0105248_10623352 | 3300009177 | Unclassified | 1217 |
| 513 | Ga0105248_10811860 | 3300009177 | Bacteria | 1056 |
| 514 | Ga0105248_11139912 | 3300009177 | Bacteria | 881 |
| 515 | Ga0105248_11139966 | 3300009177 | Unclassified | 881 |
| 516 | Ga0105248_11317254 | 3300009177 | Unclassified | 817 |
| 517 | Ga0105237_10002229 | 3300009545 | Bacteria | 24232 |
| 518 | Ga0105237_10007164 | 3300009545 | Bacteria | 12250 |
| 519 | Ga0105237_10008691 | 3300009545 | Bacteria | 10972 |
| 520 | Ga0105237_10022516 | 3300009545 | Bacteria | 6465 |
| 521 | Ga0105237_10081337 | 3300009545 | Bacteria | 3230 |
| 522 | Ga0105237_10097535 | 3300009545 | Bacteria | 2929 |
| 523 | Ga0105237_10254467 | 3300009545 | Bacteria | 1758 |
| 524 | Ga0105237_10517210 | 3300009545 | Bacteria | 1200 |
| 525 | Ga0105237_10548644 | 3300009545 | Bacteria | 1162 |
| 526 | Ga0105237_10924609 | 3300009545 | Bacteria | 879 |
| 527 | Ga0105237_12684996 | 3300009545 | Bacteria | 509 |
| 528 | Ga0105238_10000501 | 3300009551 | Bacteria | 41211 |
| 529 | Ga0105238_10006331 | 3300009551 | Bacteria | 11769 |
| 530 | Ga0105238_10006587 | 3300009551 | Bacteria | 11571 |
| 531 | Ga0105238_10015716 | 3300009551 | Bacteria | 7662 |
| 532 | Ga0105238_10020664 | 3300009551 | Bacteria | 6707 |
| 533 | Ga0105238_10025280 | 3300009551 | Bacteria | 6052 |
| 534 | Ga0105238_10027385 | 3300009551 | Bacteria | 5807 |
| 535 | Ga0105238_10032749 | 3300009551 | Bacteria | 5290 |
| 536 | Ga0105238_10034653 | 3300009551 | Bacteria | 5136 |
| 537 | Ga0105238_10036307 | 3300009551 | Bacteria | 5009 |
| 538 | Ga0105238_10050586 | 3300009551 | Bacteria | 4182 |
| 539 | Ga0105238_10056869 | 3300009551 | Unclassified | 3924 |
| 540 | Ga0105238_10131851 | 3300009551 | Bacteria | 2477 |
| 541 | Ga0105238_10216919 | 3300009551 | Bacteria | 1889 |
| 542 | Ga0105238_10388061 | 3300009551 | Unclassified | 1388 |
| 543 | Ga0105238_10941832 | 3300009551 | Bacteria | 883 |
| 544 | Ga0105238_11140645 | 3300009551 | Unclassified | 803 |
| 545 | Ga0105249_10003722 | 3300009553 | Bacteria | 13155 |
| 546 | Ga0105249_10056752 | 3300009553 | Bacteria | 3586 |
| 547 | Ga0105249_10087873 | 3300009553 | Bacteria | 2902 |
| 548 | Ga0105249_10516197 | 3300009553 | Bacteria | 1242 |
| 549 | Ga0105249_10633142 | 3300009553 | Unclassified | 1126 |
| 550 | Ga0105249_10752844 | 3300009553 | Unclassified | 1036 |
| 551 | Ga0105249_11183634 | 3300009553 | Unclassified | 835 |
| 552 | Ga0105249_11556958 | 3300009553 | Unclassified | 733 |
| 553 | Ga0105249_12083674 | 3300009553 | Bacteria | 640 |
| 554 | Ga0105239_10006720 | 3300010375 | Bacteria | 13287 |
| 555 | Ga0105239_10008026 | 3300010375 | Bacteria | 12052 |
| 556 | Ga0105239_10014929 | 3300010375 | Bacteria | 8610 |
| 557 | Ga0105239_10016121 | 3300010375 | Bacteria | 8267 |
| 558 | Ga0105239_10018915 | 3300010375 | Bacteria | 7612 |
| 559 | Ga0105239_10019532 | 3300010375 | Bacteria | 7479 |
| 560 | Ga0105239_10074835 | 3300010375 | Bacteria | 3723 |
| 561 | Ga0105239_10138119 | 3300010375 | Bacteria | 2714 |
| 562 | Ga0105239_10140003 | 3300010375 | Bacteria | 2696 |
| 563 | Ga0105239_10190256 | 3300010375 | Unclassified | 2297 |
| 564 | Ga0105239_10212868 | 3300010375 | Bacteria | 2166 |
| 565 | Ga0105239_10410491 | 3300010375 | Unclassified | 1533 |
| 566 | Ga0105239_10445548 | 3300010375 | Bacteria | 1468 |
| 567 | Ga0105239_10449699 | 3300010375 | Bacteria | 1461 |
| 568 | Ga0105239_10484894 | 3300010375 | Bacteria | 1405 |
| 569 | Ga0105239_11902886 | 3300010375 | Unclassified | 690 |
| 570 | Ga0105239_12719388 | 3300010375 | Unclassified | 577 |
| 571 | Ga0105246_10001430 | 3300011119 | Bacteria | 14122 |
| 572 | Ga0105246_10002423 | 3300011119 | Bacteria | 11256 |
| 573 | Ga0105246_10006397 | 3300011119 | Bacteria | 7195 |
| 574 | Ga0105246_10023226 | 3300011119 | Bacteria | 4010 |
| 575 | Ga0105246_10152689 | 3300011119 | Bacteria | 1750 |
| 576 | Ga0105246_10265826 | 3300011119 | Bacteria | 1369 |
| 577 | Ga0105246_10787935 | 3300011119 | Unclassified | 842 |
| 578 | Ga0105246_10938555 | 3300011119 | Unclassified | 779 |
| 579 | Ga0105246_11809137 | 3300011119 | Unclassified | 584 |
| 580 | Ga0157371_10105868 | 3300013102 | Unclassified | 1996 |
| 581 | Ga0157371_10451920 | 3300013102 | Unclassified | 945 |
| 582 | Ga0157370_10000997 | 3300013104 | Bacteria | 35747 |
| 583 | Ga0157370_10002206 | 3300013104 | Bacteria | 23774 |
| 584 | Ga0157370_10006724 | 3300013104 | Bacteria | 12615 |
| 585 | Ga0157370_10014006 | 3300013104 | Bacteria | 8235 |
| 586 | Ga0157370_10016306 | 3300013104 | Bacteria | 7528 |
| 587 | Ga0157370_10043153 | 3300013104 | Bacteria | 4341 |
| 588 | Ga0157370_11043857 | 3300013104 | Bacteria | 739 |
| 589 | Ga0157369_10002687 | 3300013105 | Bacteria | 21222 |
| 590 | Ga0157369_10005354 | 3300013105 | Bacteria | 14951 |
| 591 | Ga0157369_10015762 | 3300013105 | Bacteria | 8516 |
| 592 | Ga0157369_10025785 | 3300013105 | Bacteria | 6521 |
| 593 | Ga0157369_10053765 | 3300013105 | Unclassified | 4350 |
| 594 | Ga0157369_10080526 | 3300013105 | Bacteria | 3487 |
| 595 | Ga0157369_10146031 | 3300013105 | Unclassified | 2501 |
| 596 | Ga0157369_10177368 | 3300013105 | Unclassified | 2243 |
| 597 | Ga0157369_10789969 | 3300013105 | Unclassified | 975 |
| 598 | Ga0157369_11219750 | 3300013105 | Unclassified | 768 |
| 599 | Ga0157369_11302290 | 3300013105 | Unclassified | 741 |
| 600 | Ga0157374_10015751 | 3300013296 | Bacteria | 6640 |
| 601 | Ga0157374_10032701 | 3300013296 | Bacteria | 4738 |
| 602 | Ga0157374_10114113 | 3300013296 | Bacteria | 2601 |
| 603 | Ga0157374_10129332 | 3300013296 | Bacteria | 2443 |
| 604 | Ga0157374_10160587 | 3300013296 | Unclassified | 2189 |
| 605 | Ga0157374_10418116 | 3300013296 | Bacteria | 1339 |
| 606 | Ga0157374_10525097 | 3300013296 | Bacteria | 1190 |
| 607 | Ga0157374_10798042 | 3300013296 | Bacteria | 960 |
| 608 | Ga0157374_10891249 | 3300013296 | Unclassified | 907 |
| 609 | Ga0157374_10924086 | 3300013296 | Bacteria | 890 |
| 610 | Ga0157374_11024379 | 3300013296 | Unclassified | 845 |
| 611 | Ga0157378_10002798 | 3300013297 | Bacteria | 15556 |
| 612 | Ga0157378_10004041 | 3300013297 | Bacteria | 12956 |
| 613 | Ga0157378_10465355 | 3300013297 | Bacteria | 1257 |
| 614 | Ga0157378_10866816 | 3300013297 | Bacteria | 932 |
| 615 | Ga0157378_11033114 | 3300013297 | Bacteria | 857 |
| 616 | Ga0157378_11617900 | 3300013297 | Unclassified | 694 |
| 617 | Ga0157378_12770649 | 3300013297 | Unclassified | 543 |
| 618 | Ga0157378_13277404 | 3300013297 | Unclassified | 503 |
| 619 | Ga0163162_10090963 | 3300013306 | Bacteria | 3134 |
| 620 | Ga0163162_10353274 | 3300013306 | Bacteria | 1602 |
| 621 | Ga0163162_10369517 | 3300013306 | Bacteria | 1567 |
| 622 | Ga0163162_10727026 | 3300013306 | Bacteria | 1113 |
| 623 | Ga0163162_11332136 | 3300013306 | Unclassified | 816 |
| 624 | Ga0163162_11416531 | 3300013306 | Unclassified | 791 |
| 625 | Ga0163162_12097785 | 3300013306 | Unclassified | 648 |
| 626 | Ga0163162_12975431 | 3300013306 | Bacteria | 545 |
| 627 | Ga0157372_10001007 | 3300013307 | Bacteria | 30798 |
| 628 | Ga0157372_10007331 | 3300013307 | Bacteria | 11741 |
| 629 | Ga0157372_10018708 | 3300013307 | Bacteria | 7452 |
| 630 | Ga0157372_10043736 | 3300013307 | Unclassified | 4961 |
| 631 | Ga0157372_10079946 | 3300013307 | Bacteria | 3698 |
| 632 | Ga0157372_10116247 | 3300013307 | Bacteria | 3067 |
| 633 | Ga0157372_10126745 | 3300013307 | Bacteria | 2936 |
| 634 | Ga0157372_10228683 | 3300013307 | Bacteria | 2156 |
| 635 | Ga0157372_10298647 | 3300013307 | Unclassified | 1873 |
| 636 | Ga0157372_10428805 | 3300013307 | Bacteria | 1541 |
| 637 | Ga0157372_10732126 | 3300013307 | Bacteria | 1150 |
| 638 | Ga0157372_11386798 | 3300013307 | Unclassified | 810 |
| 639 | Ga0157375_10005619 | 3300013308 | Bacteria | 10916 |
| 640 | Ga0157375_10006921 | 3300013308 | Bacteria | 9896 |
| 641 | Ga0157375_10296682 | 3300013308 | Bacteria | 1780 |
| 642 | Ga0157375_10344053 | 3300013308 | Unclassified | 1657 |
| 643 | Ga0157375_10542131 | 3300013308 | Unclassified | 1326 |
| 644 | Ga0157375_11055096 | 3300013308 | Bacteria | 950 |
| 645 | Ga0157375_11088474 | 3300013308 | Unclassified | 935 |
| 646 | Ga0157375_11508388 | 3300013308 | Unclassified | 794 |
| 647 | Ga0163163_10003209 | 3300014325 | Bacteria | 13853 |
| 648 | Ga0163163_10007001 | 3300014325 | Bacteria | 9906 |
| 649 | Ga0163163_10016291 | 3300014325 | Bacteria | 6902 |
| 650 | Ga0163163_10041340 | 3300014325 | Bacteria | 4508 |
| 651 | Ga0163163_10083126 | 3300014325 | Unclassified | 3206 |
| 652 | Ga0163163_10161842 | 3300014325 | Bacteria | 2284 |
| 653 | Ga0163163_10719115 | 3300014325 | Unclassified | 1062 |
| 654 | Ga0163163_10795672 | 3300014325 | Unclassified | 1009 |
| 655 | Ga0163163_11189163 | 3300014325 | Unclassified | 825 |
| 656 | Ga0163163_11212101 | 3300014325 | Unclassified | 817 |
| 657 | Ga0163163_11560441 | 3300014325 | Unclassified | 721 |
| 658 | Ga0163163_11654389 | 3300014325 | Unclassified | 701 |
| 659 | Ga0163163_12482759 | 3300014325 | Unclassified | 576 |
| 660 | Ga0157380_10234790 | 3300014326 | Unclassified | 1649 |
| 661 | Ga0157380_10321361 | 3300014326 | Bacteria | 1435 |
| 662 | Ga0157380_10491402 | 3300014326 | Bacteria | 1190 |
| 663 | Ga0157377_10112470 | 3300014745 | Bacteria | 1638 |
| 664 | Ga0157377_11650735 | 3300014745 | Unclassified | 515 |
| 665 | Ga0157379_10002290 | 3300014968 | Bacteria | 15957 |
| 666 | Ga0157379_10007941 | 3300014968 | Bacteria | 9202 |
| 667 | Ga0157379_10172978 | 3300014968 | Unclassified | 1949 |
| 668 | Ga0157379_10301958 | 3300014968 | Bacteria | 1459 |
| 669 | Ga0157379_10589147 | 3300014968 | Bacteria | 1037 |
| 670 | Ga0157379_11648638 | 3300014968 | Unclassified | 627 |
| 671 | Ga0157376_10001111 | 3300014969 | Bacteria | 17644 |
| 672 | Ga0157376_10053435 | 3300014969 | Bacteria | 3364 |
| 673 | Ga0157376_10086011 | 3300014969 | Bacteria | 2710 |
| 674 | Ga0157376_10155812 | 3300014969 | Unclassified | 2065 |
| 675 | Ga0157376_10177946 | 3300014969 | Bacteria | 1942 |
| 676 | Ga0157376_10302621 | 3300014969 | Bacteria | 1514 |
| 677 | Ga0157376_10532277 | 3300014969 | Unclassified | 1160 |
| 678 | Ga0197907_10345105 | 3300020069 | Unclassified | 1821 |
| 679 | Ga0197907_11169527 | 3300020069 | Unclassified | 629 |
| 680 | Ga0197907_11388186 | 3300020069 | Unclassified | 1390 |
| 681 | Ga0197907_11513640 | 3300020069 | Unclassified | 571 |
| 682 | Ga0206356_10260711 | 3300020070 | Unclassified | 635 |
| 683 | Ga0206356_10950623 | 3300020070 | Unclassified | 4271 |
| 684 | Ga0206356_11094542 | 3300020070 | Unclassified | 529 |
| 685 | Ga0206356_11795575 | 3300020070 | Bacteria | 565 |
| 686 | Ga0206349_1966464 | 3300020075 | Unclassified | 834 |
| 687 | Ga0206355_1240202 | 3300020076 | Unclassified | 579 |
| 688 | Ga0206355_1373007 | 3300020076 | Unclassified | 922 |
| 689 | Ga0206351_10018568 | 3300020077 | Unclassified | 594 |
| 690 | Ga0206352_10265365 | 3300020078 | Unclassified | 888 |
| 691 | Ga0206352_10467909 | 3300020078 | Unclassified | 590 |
| 692 | Ga0206352_10647886 | 3300020078 | Bacteria | 8005 |
| 693 | Ga0206352_10969492 | 3300020078 | Unclassified | 504 |
| 694 | Ga0206350_10410420 | 3300020080 | Bacteria | 1399 |
| 695 | Ga0206350_10936759 | 3300020080 | Unclassified | 616 |
| 696 | Ga0206350_11445424 | 3300020080 | Unclassified | 1205 |
| 697 | Ga0206353_10638504 | 3300020082 | Unclassified | 988 |
| 698 | Ga0206353_10965158 | 3300020082 | Unclassified | 607 |
| 699 | Ga0154015_1088118 | 3300020610 | Unclassified | 509 |
| 700 | Ga0154015_1316610 | 3300020610 | Unclassified | 922 |
| 701 | Ga0154015_1543362 | 3300020610 | Unclassified | 569 |
| 702 | Ga0213876_10042224 | 3300021384 | Bacteria | 2410 |
| 703 | Ga0213875_10120989 | 3300021388 | Unclassified | 1223 |
| 704 | Ga0213875_10196336 | 3300021388 | Bacteria | 949 |
| 705 | Ga0213875_10333362 | 3300021388 | Bacteria | 720 |
| 706 | Ga0213875_10372449 | 3300021388 | Unclassified | 679 |
| 707 | Ga0224712_10002814 | 3300022467 | Unclassified | 4385 |
| 708 | Ga0224712_10075851 | 3300022467 | Unclassified | 1376 |
| 709 | Ga0224712_10538292 | 3300022467 | Unclassified | 567 |
| 710 | Ga0207653_10129309 | 3300025885 | Unclassified | 915 |
| 711 | Ga0207692_10239797 | 3300025898 | Unclassified | 1082 |
| 712 | Ga0207692_10257194 | 3300025898 | Unclassified | 1048 |
| 713 | Ga0207642_10299173 | 3300025899 | Unclassified | 932 |
| 714 | Ga0207642_10524103 | 3300025899 | Bacteria | 728 |
| 715 | Ga0207710_10008409 | 3300025900 | Bacteria | 4351 |
| 716 | Ga0207710_10039475 | 3300025900 | Unclassified | 2089 |
| 717 | Ga0207710_10077349 | 3300025900 | Bacteria | 1537 |
| 718 | Ga0207688_10059826 | 3300025901 | Bacteria | 2145 |
| 719 | Ga0207680_10013380 | 3300025903 | Bacteria | 4213 |
| 720 | Ga0207680_10272733 | 3300025903 | Bacteria | 1174 |
| 721 | Ga0207685_10285361 | 3300025905 | Unclassified | 811 |
| 722 | Ga0207685_10789037 | 3300025905 | Unclassified | 522 |
| 723 | Ga0207699_10010851 | 3300025906 | Unclassified | 4587 |
| 724 | Ga0207699_10040041 | 3300025906 | Unclassified | 2698 |
| 725 | Ga0207699_10051436 | 3300025906 | Bacteria | 2434 |
| 726 | Ga0207699_10439831 | 3300025906 | Bacteria | 934 |
| 727 | Ga0207699_11326260 | 3300025906 | Unclassified | 532 |
| 728 | Ga0207645_10045868 | 3300025907 | Bacteria | 2792 |
| 729 | Ga0207645_10188582 | 3300025907 | Unclassified | 1354 |
| 730 | Ga0207705_10111014 | 3300025909 | Unclassified | 2026 |
| 731 | Ga0207705_10330822 | 3300025909 | Bacteria | 1172 |
| 732 | Ga0207654_10016430 | 3300025911 | Unclassified | 3854 |
| 733 | Ga0207654_10028865 | 3300025911 | Bacteria | 3029 |
| 734 | Ga0207654_10036838 | 3300025911 | Bacteria | 2736 |
| 735 | Ga0207654_10045743 | 3300025911 | Bacteria | 2493 |
| 736 | Ga0207654_10097603 | 3300025911 | Unclassified | 1804 |
| 737 | Ga0207654_10101058 | 3300025911 | Unclassified | 1777 |
| 738 | Ga0207654_10113388 | 3300025911 | Unclassified | 1690 |
| 739 | Ga0207654_10261512 | 3300025911 | Bacteria | 1164 |
| 740 | Ga0207654_10378544 | 3300025911 | Unclassified | 980 |
| 741 | Ga0207654_11300093 | 3300025911 | Unclassified | 530 |
| 742 | Ga0207707_10000239 | 3300025912 | Bacteria | 59651 |
| 743 | Ga0207707_10005887 | 3300025912 | Bacteria | 10719 |
| 744 | Ga0207707_10017387 | 3300025912 | Bacteria | 6269 |
| 745 | Ga0207707_10044979 | 3300025912 | Unclassified | 3848 |
| 746 | Ga0207707_10277788 | 3300025912 | Bacteria | 1451 |
| 747 | Ga0207707_11191863 | 3300025912 | Bacteria | 617 |
| 748 | Ga0207695_10000688 | 3300025913 | Bacteria | 66300 |
| 749 | Ga0207695_10005342 | 3300025913 | Bacteria | 17091 |
| 750 | Ga0207695_10011291 | 3300025913 | Bacteria | 10828 |
| 751 | Ga0207695_10023442 | 3300025913 | Bacteria | 6973 |
| 752 | Ga0207695_10040357 | 3300025913 | Bacteria | 5007 |
| 753 | Ga0207695_10106740 | 3300025913 | Bacteria | 2786 |
| 754 | Ga0207695_10132059 | 3300025913 | Bacteria | 2454 |
| 755 | Ga0207695_10249922 | 3300025913 | Unclassified | 1673 |
| 756 | Ga0207695_11045500 | 3300025913 | Unclassified | 696 |
| 757 | Ga0207671_10007282 | 3300025914 | Bacteria | 9625 |
| 758 | Ga0207671_10009145 | 3300025914 | Bacteria | 8315 |
| 759 | Ga0207671_10015198 | 3300025914 | Bacteria | 6043 |
| 760 | Ga0207671_10045192 | 3300025914 | Bacteria | 3256 |
| 761 | Ga0207671_10238237 | 3300025914 | Bacteria | 1429 |
| 762 | Ga0207671_10724871 | 3300025914 | Bacteria | 790 |
| 763 | Ga0207663_10135976 | 3300025916 | Bacteria | 1706 |
| 764 | Ga0207663_10221892 | 3300025916 | Unclassified | 1376 |
| 765 | Ga0207663_10768809 | 3300025916 | Unclassified | 766 |
| 766 | Ga0207663_11205911 | 3300025916 | Unclassified | 609 |
| 767 | Ga0207663_11497263 | 3300025916 | Bacteria | 543 |
| 768 | Ga0207660_10014708 | 3300025917 | Bacteria | 5154 |
| 769 | Ga0207660_10027061 | 3300025917 | Unclassified | 3909 |
| 770 | Ga0207660_10205912 | 3300025917 | Bacteria | 1538 |
| 771 | Ga0207660_10421633 | 3300025917 | Bacteria | 1076 |
| 772 | Ga0207660_10496146 | 3300025917 | Bacteria | 990 |
| 773 | Ga0207660_10578862 | 3300025917 | Unclassified | 914 |
| 774 | Ga0207662_10194867 | 3300025918 | Bacteria | 1309 |
| 775 | Ga0207662_10596903 | 3300025918 | Unclassified | 768 |
| 776 | Ga0207657_10049976 | 3300025919 | Bacteria | 3641 |
| 777 | Ga0207657_10094357 | 3300025919 | Unclassified | 2492 |
| 778 | Ga0207657_10151274 | 3300025919 | Bacteria | 1890 |
| 779 | Ga0207657_10499321 | 3300025919 | Unclassified | 953 |
| 780 | Ga0207649_10346133 | 3300025920 | Bacteria | 1099 |
| 781 | Ga0207649_10467036 | 3300025920 | Unclassified | 955 |
| 782 | Ga0207649_10474559 | 3300025920 | Unclassified | 948 |
| 783 | Ga0207649_10545018 | 3300025920 | Unclassified | 887 |
| 784 | Ga0207649_10573183 | 3300025920 | Bacteria | 866 |
| 785 | Ga0207649_10684279 | 3300025920 | Unclassified | 795 |
| 786 | Ga0207652_10000872 | 3300025921 | Bacteria | 28576 |
| 787 | Ga0207652_10012468 | 3300025921 | Bacteria | 6869 |
| 788 | Ga0207652_10168082 | 3300025921 | Bacteria | 1967 |
| 789 | Ga0207652_10365969 | 3300025921 | Unclassified | 1301 |
| 790 | Ga0207681_10424427 | 3300025923 | Bacteria | 1078 |
| 791 | Ga0207681_11407598 | 3300025923 | Bacteria | 585 |
| 792 | Ga0207694_10003106 | 3300025924 | Bacteria | 13286 |
| 793 | Ga0207694_10003534 | 3300025924 | Bacteria | 12412 |
| 794 | Ga0207694_10005943 | 3300025924 | Bacteria | 9357 |
| 795 | Ga0207694_10008251 | 3300025924 | Bacteria | 7873 |
| 796 | Ga0207694_10012985 | 3300025924 | Bacteria | 6271 |
| 797 | Ga0207694_10026656 | 3300025924 | Unclassified | 4398 |
| 798 | Ga0207694_10040522 | 3300025924 | Bacteria | 3586 |
| 799 | Ga0207694_10044764 | 3300025924 | Unclassified | 3417 |
| 800 | Ga0207694_10060786 | 3300025924 | Bacteria | 2941 |
| 801 | Ga0207694_10079545 | 3300025924 | Unclassified | 2571 |
| 802 | Ga0207694_10104193 | 3300025924 | Unclassified | 2251 |
| 803 | Ga0207694_10222267 | 3300025924 | Bacteria | 1541 |
| 804 | Ga0207694_10360924 | 3300025924 | Unclassified | 1204 |
| 805 | Ga0207694_10380640 | 3300025924 | Bacteria | 1171 |
| 806 | Ga0207694_10845343 | 3300025924 | Bacteria | 773 |
| 807 | Ga0207694_10856305 | 3300025924 | Unclassified | 768 |
| 808 | Ga0207650_10263270 | 3300025925 | Bacteria | 1399 |
| 809 | Ga0207650_10265981 | 3300025925 | Bacteria | 1392 |
| 810 | Ga0207650_10486603 | 3300025925 | Bacteria | 1030 |
| 811 | Ga0207659_10041379 | 3300025926 | Bacteria | 3227 |
| 812 | Ga0207659_10079002 | 3300025926 | Bacteria | 2426 |
| 813 | Ga0207659_10431108 | 3300025926 | Unclassified | 1107 |
| 814 | Ga0207687_10000339 | 3300025927 | Bacteria | 31327 |
| 815 | Ga0207687_10000965 | 3300025927 | Bacteria | 19524 |
| 816 | Ga0207687_10001193 | 3300025927 | Bacteria | 17754 |
| 817 | Ga0207687_10001331 | 3300025927 | Bacteria | 16892 |
| 818 | Ga0207687_10006593 | 3300025927 | Bacteria | 7656 |
| 819 | Ga0207687_10150546 | 3300025927 | Bacteria | 1775 |
| 820 | Ga0207687_10194132 | 3300025927 | Bacteria | 1582 |
| 821 | Ga0207687_10229603 | 3300025927 | Bacteria | 1465 |
| 822 | Ga0207687_10303138 | 3300025927 | Bacteria | 1287 |
| 823 | Ga0207687_10343124 | 3300025927 | Bacteria | 1215 |
| 824 | Ga0207687_10470260 | 3300025927 | Bacteria | 1045 |
| 825 | Ga0207687_10487811 | 3300025927 | Bacteria | 1027 |
| 826 | Ga0207687_10997971 | 3300025927 | Bacteria | 718 |
| 827 | Ga0207700_10023058 | 3300025928 | Unclassified | 4283 |
| 828 | Ga0207700_10051165 | 3300025928 | Bacteria | 3081 |
| 829 | Ga0207700_10119581 | 3300025928 | Bacteria | 2134 |
| 830 | Ga0207700_10150242 | 3300025928 | Bacteria | 1924 |
| 831 | Ga0207700_10176176 | 3300025928 | Bacteria | 1787 |
| 832 | Ga0207700_10782845 | 3300025928 | Unclassified | 853 |
| 833 | Ga0207700_10885628 | 3300025928 | Bacteria | 799 |
| 834 | Ga0207700_11200041 | 3300025928 | Unclassified | 677 |
| 835 | Ga0207664_10081362 | 3300025929 | Unclassified | 2635 |
| 836 | Ga0207644_10121378 | 3300025931 | Bacteria | 1990 |
| 837 | Ga0207690_10203052 | 3300025932 | Unclassified | 1506 |
| 838 | Ga0207690_10999151 | 3300025932 | Bacteria | 696 |
| 839 | Ga0207706_10051290 | 3300025933 | Bacteria | 3643 |
| 840 | Ga0207706_10207083 | 3300025933 | Bacteria | 1720 |
| 841 | Ga0207706_10258272 | 3300025933 | Bacteria | 1521 |
| 842 | Ga0207706_10502552 | 3300025933 | Unclassified | 1046 |
| 843 | Ga0207706_10515764 | 3300025933 | Bacteria | 1031 |
| 844 | Ga0207686_10009052 | 3300025934 | Bacteria | 5391 |
| 845 | Ga0207686_10017571 | 3300025934 | Unclassified | 4033 |
| 846 | Ga0207686_10049240 | 3300025934 | Bacteria | 2615 |
| 847 | Ga0207686_10107567 | 3300025934 | Unclassified | 1874 |
| 848 | Ga0207686_10428083 | 3300025934 | Unclassified | 1014 |
| 849 | Ga0207686_10491542 | 3300025934 | Unclassified | 951 |
| 850 | Ga0207686_10607029 | 3300025934 | Unclassified | 862 |
| 851 | Ga0207686_11131628 | 3300025934 | Bacteria | 639 |
| 852 | Ga0207686_11290022 | 3300025934 | Unclassified | 599 |
| 853 | Ga0207686_11660720 | 3300025934 | Unclassified | 528 |
| 854 | Ga0207709_10043392 | 3300025935 | Bacteria | 2710 |
| 855 | Ga0207709_10057515 | 3300025935 | Bacteria | 2412 |
| 856 | Ga0207709_10126861 | 3300025935 | Bacteria | 1732 |
| 857 | Ga0207709_10508940 | 3300025935 | Unclassified | 941 |
| 858 | Ga0207670_10071092 | 3300025936 | Bacteria | 2405 |
| 859 | Ga0207670_10127861 | 3300025936 | Bacteria | 1857 |
| 860 | Ga0207670_10261722 | 3300025936 | Bacteria | 1341 |
| 861 | Ga0207670_10380015 | 3300025936 | Bacteria | 1125 |
| 862 | Ga0207670_11787615 | 3300025936 | Bacteria | 523 |
| 863 | Ga0207669_10052709 | 3300025937 | Bacteria | 2446 |
| 864 | Ga0207669_10584870 | 3300025937 | Unclassified | 905 |
| 865 | Ga0207669_11303487 | 3300025937 | Unclassified | 617 |
| 866 | Ga0207669_11590500 | 3300025937 | Unclassified | 558 |
| 867 | Ga0207704_10006166 | 3300025938 | Bacteria | 5566 |
| 868 | Ga0207704_10172484 | 3300025938 | Bacteria | 1553 |
| 869 | Ga0207704_10609215 | 3300025938 | Bacteria | 895 |
| 870 | Ga0207704_10707724 | 3300025938 | Unclassified | 834 |
| 871 | Ga0207704_10708902 | 3300025938 | Unclassified | 834 |
| 872 | Ga0207665_11510228 | 3300025939 | Unclassified | 534 |
| 873 | Ga0207691_10161552 | 3300025940 | Bacteria | 1965 |
| 874 | Ga0207691_10559953 | 3300025940 | Unclassified | 969 |
| 875 | Ga0207711_10003057 | 3300025941 | Bacteria | 14623 |
| 876 | Ga0207711_10009081 | 3300025941 | Bacteria | 8301 |
| 877 | Ga0207711_10009217 | 3300025941 | Bacteria | 8242 |
| 878 | Ga0207711_10025923 | 3300025941 | Bacteria | 4917 |
| 879 | Ga0207711_10106048 | 3300025941 | Bacteria | 2493 |
| 880 | Ga0207711_10168821 | 3300025941 | Unclassified | 1984 |
| 881 | Ga0207711_10295208 | 3300025941 | Bacteria | 1494 |
| 882 | Ga0207711_10388113 | 3300025941 | Unclassified | 1296 |
| 883 | Ga0207711_11936479 | 3300025941 | Bacteria | 532 |
| 884 | Ga0207689_10044198 | 3300025942 | Unclassified | 3682 |
| 885 | Ga0207689_10101050 | 3300025942 | Bacteria | 2369 |
| 886 | Ga0207689_10141989 | 3300025942 | Bacteria | 1978 |
| 887 | Ga0207689_10188640 | 3300025942 | Unclassified | 1701 |
| 888 | Ga0207689_10208270 | 3300025942 | Bacteria | 1615 |
| 889 | Ga0207689_10247856 | 3300025942 | Unclassified | 1473 |
| 890 | Ga0207689_10324615 | 3300025942 | Bacteria | 1278 |
| 891 | Ga0207689_11140102 | 3300025942 | Unclassified | 657 |
| 892 | Ga0207661_10006879 | 3300025944 | Bacteria | 8064 |
| 893 | Ga0207661_10014859 | 3300025944 | Bacteria | 5711 |
| 894 | Ga0207661_10017326 | 3300025944 | Bacteria | 5327 |
| 895 | Ga0207661_10018049 | 3300025944 | Bacteria | 5237 |
| 896 | Ga0207661_10023596 | 3300025944 | Unclassified | 4650 |
| 897 | Ga0207661_10040570 | 3300025944 | Bacteria | 3660 |
| 898 | Ga0207661_10084621 | 3300025944 | Bacteria | 2627 |
| 899 | Ga0207661_10111463 | 3300025944 | Bacteria | 2315 |
| 900 | Ga0207661_10167483 | 3300025944 | Unclassified | 1910 |
| 901 | Ga0207661_10268692 | 3300025944 | Bacteria | 1521 |
| 902 | Ga0207661_10323547 | 3300025944 | Bacteria | 1387 |
| 903 | Ga0207661_10693614 | 3300025944 | Unclassified | 936 |
| 904 | Ga0207661_10832789 | 3300025944 | Unclassified | 849 |
| 905 | Ga0207679_10012055 | 3300025945 | Bacteria | 5622 |
| 906 | Ga0207679_10192303 | 3300025945 | Unclassified | 1698 |
| 907 | Ga0207679_10343407 | 3300025945 | Unclassified | 1299 |
| 908 | Ga0207679_10604995 | 3300025945 | Unclassified | 988 |
| 909 | Ga0207679_11078694 | 3300025945 | Bacteria | 737 |
| 910 | Ga0207667_10001263 | 3300025949 | Bacteria | 31737 |
| 911 | Ga0207667_10002815 | 3300025949 | Bacteria | 21563 |
| 912 | Ga0207667_10005334 | 3300025949 | Bacteria | 15669 |
| 913 | Ga0207667_10007297 | 3300025949 | Bacteria | 13321 |
| 914 | Ga0207667_10088424 | 3300025949 | Bacteria | 3204 |
| 915 | Ga0207667_10165941 | 3300025949 | Bacteria | 2270 |
| 916 | Ga0207667_10268213 | 3300025949 | Bacteria | 1745 |
| 917 | Ga0207667_10281715 | 3300025949 | Unclassified | 1699 |
| 918 | Ga0207667_10686012 | 3300025949 | Unclassified | 1028 |
| 919 | Ga0207667_11222369 | 3300025949 | Unclassified | 730 |
| 920 | Ga0207651_10009187 | 3300025960 | Bacteria | 5390 |
| 921 | Ga0207651_10136303 | 3300025960 | Unclassified | 1889 |
| 922 | Ga0207651_10149867 | 3300025960 | Bacteria | 1814 |
| 923 | Ga0207651_10181780 | 3300025960 | Bacteria | 1669 |
| 924 | Ga0207651_10519810 | 3300025960 | Bacteria | 1031 |
| 925 | Ga0207651_10552892 | 3300025960 | Bacteria | 1001 |
| 926 | Ga0207651_11317669 | 3300025960 | Bacteria | 649 |
| 927 | Ga0207712_10003128 | 3300025961 | Bacteria | 10552 |
| 928 | Ga0207712_10062799 | 3300025961 | Unclassified | 2642 |
| 929 | Ga0207712_10430534 | 3300025961 | Bacteria | 1115 |
| 930 | Ga0207712_10953371 | 3300025961 | Unclassified | 760 |
| 931 | Ga0207712_11313131 | 3300025961 | Unclassified | 647 |
| 932 | Ga0207640_10074983 | 3300025981 | Bacteria | 2291 |
| 933 | Ga0207640_10362052 | 3300025981 | Unclassified | 1169 |
| 934 | Ga0207640_11272339 | 3300025981 | Unclassified | 656 |
| 935 | Ga0207658_10116648 | 3300025986 | Bacteria | 2121 |
| 936 | Ga0207658_10299571 | 3300025986 | Bacteria | 1385 |
| 937 | Ga0207658_10529431 | 3300025986 | Bacteria | 1052 |
| 938 | Ga0207677_10212446 | 3300026023 | Bacteria | 1546 |
| 939 | Ga0207677_10348024 | 3300026023 | Unclassified | 1241 |
| 940 | Ga0207677_11595559 | 3300026023 | Unclassified | 604 |
| 941 | Ga0207703_10023347 | 3300026035 | Bacteria | 4857 |
| 942 | Ga0207703_10107236 | 3300026035 | Bacteria | 2378 |
| 943 | Ga0207703_10141720 | 3300026035 | Bacteria | 2087 |
| 944 | Ga0207703_10142120 | 3300026035 | Unclassified | 2084 |
| 945 | Ga0207703_10271524 | 3300026035 | Bacteria | 1536 |
| 946 | Ga0207703_10514303 | 3300026035 | Bacteria | 1125 |
| 947 | Ga0207703_10524284 | 3300026035 | Bacteria | 1115 |
| 948 | Ga0207703_10972720 | 3300026035 | Bacteria | 814 |
| 949 | Ga0207639_10013820 | 3300026041 | Bacteria | 5660 |
| 950 | Ga0207639_10046941 | 3300026041 | Unclassified | 3261 |
| 951 | Ga0207639_10126997 | 3300026041 | Bacteria | 2105 |
| 952 | Ga0207639_10152759 | 3300026041 | Unclassified | 1936 |
| 953 | Ga0207639_10181498 | 3300026041 | Bacteria | 1791 |
| 954 | Ga0207639_10369719 | 3300026041 | Unclassified | 1285 |
| 955 | Ga0207639_10465400 | 3300026041 | Unclassified | 1150 |
| 956 | Ga0207639_10820883 | 3300026041 | Bacteria | 867 |
| 957 | Ga0207639_11397884 | 3300026041 | Bacteria | 657 |
| 958 | Ga0207708_10021309 | 3300026075 | Bacteria | 4887 |
| 959 | Ga0207708_10037499 | 3300026075 | Bacteria | 3693 |
| 960 | Ga0207708_10188531 | 3300026075 | Bacteria | 1640 |
| 961 | Ga0207708_10255058 | 3300026075 | Bacteria | 1414 |
| 962 | Ga0207708_10352205 | 3300026075 | Unclassified | 1208 |
| 963 | Ga0207708_10387930 | 3300026075 | Bacteria | 1153 |
| 964 | Ga0207708_10458182 | 3300026075 | Bacteria | 1063 |
| 965 | Ga0207708_11677962 | 3300026075 | Unclassified | 558 |
| 966 | Ga0207702_10004066 | 3300026078 | Bacteria | 13128 |
| 967 | Ga0207702_10005778 | 3300026078 | Bacteria | 10757 |
| 968 | Ga0207702_10015083 | 3300026078 | Bacteria | 6407 |
| 969 | Ga0207702_10045055 | 3300026078 | Bacteria | 3711 |
| 970 | Ga0207702_10045696 | 3300026078 | Unclassified | 3684 |
| 971 | Ga0207702_10068818 | 3300026078 | Viruses | 3042 |
| 972 | Ga0207702_10075030 | 3300026078 | Bacteria | 2921 |
| 973 | Ga0207702_10102176 | 3300026078 | Bacteria | 2533 |
| 974 | Ga0207702_10178422 | 3300026078 | Bacteria | 1954 |
| 975 | Ga0207702_10324567 | 3300026078 | Bacteria | 1467 |
| 976 | Ga0207702_10697891 | 3300026078 | Unclassified | 1000 |
| 977 | Ga0207702_11634441 | 3300026078 | Unclassified | 637 |
| 978 | Ga0207641_10348450 | 3300026088 | Unclassified | 1411 |
| 979 | Ga0207641_10531534 | 3300026088 | Bacteria | 1145 |
| 980 | Ga0207641_10550241 | 3300026088 | Bacteria | 1125 |
| 981 | Ga0207641_10638522 | 3300026088 | Unclassified | 1045 |
| 982 | Ga0207648_10074848 | 3300026089 | Unclassified | 2952 |
| 983 | Ga0207648_10128417 | 3300026089 | Bacteria | 2230 |
| 984 | Ga0207648_10366375 | 3300026089 | Bacteria | 1301 |
| 985 | Ga0207648_10859981 | 3300026089 | Unclassified | 846 |
| 986 | Ga0207648_10976101 | 3300026089 | Unclassified | 793 |
| 987 | Ga0207648_11979044 | 3300026089 | Bacteria | 544 |
| 988 | Ga0207676_10035645 | 3300026095 | Bacteria | 3778 |
| 989 | Ga0207676_10055179 | 3300026095 | Bacteria | 3118 |
| 990 | Ga0207676_10808843 | 3300026095 | Unclassified | 915 |
| 991 | Ga0207676_11832673 | 3300026095 | Unclassified | 605 |
| 992 | Ga0207674_10000035 | 3300026116 | Bacteria | 136262 |
| 993 | Ga0207674_10000101 | 3300026116 | Bacteria | 97551 |
| 994 | Ga0207674_10000187 | 3300026116 | Bacteria | 75592 |
| 995 | Ga0207674_10001119 | 3300026116 | Bacteria | 34786 |
| 996 | Ga0207674_10001346 | 3300026116 | Bacteria | 31774 |
| 997 | Ga0207674_10009238 | 3300026116 | Bacteria | 11300 |
| 998 | Ga0207674_11172262 | 3300026116 | Unclassified | 738 |
| 999 | Ga0207674_12217091 | 3300026116 | Unclassified | 512 |
| 1000 | Ga0207675_100002274 | 3300026118 | Bacteria | 19086 |
| 1001 | Ga0207675_100003771 | 3300026118 | Bacteria | 14760 |
| 1002 | Ga0207675_100003855 | 3300026118 | Bacteria | 14579 |
| 1003 | Ga0207675_100220347 | 3300026118 | Bacteria | 1828 |
| 1004 | Ga0207675_100232559 | 3300026118 | Bacteria | 1779 |
| 1005 | Ga0207675_100899962 | 3300026118 | Unclassified | 901 |
| 1006 | Ga0207683_10336593 | 3300026121 | Unclassified | 1384 |
| 1007 | Ga0207698_10030025 | 3300026142 | Bacteria | 3903 |
| 1008 | Ga0207698_10058127 | 3300026142 | Unclassified | 2995 |
| 1009 | Ga0207698_10461732 | 3300026142 | Unclassified | 1228 |
| 1010 | Ga0207698_10759933 | 3300026142 | Unclassified | 969 |
| 1011 | Ga0207698_11281958 | 3300026142 | Bacteria | 747 |
| 1012 | Ga0207698_11358409 | 3300026142 | Unclassified | 725 |
| 1013 | Ga0207698_11665798 | 3300026142 | Bacteria | 653 |
| 1014 | Ga0207698_11676101 | 3300026142 | Unclassified | 651 |
| 1015 | Ga0209983_1040851 | 3300027665 | Bacteria | 1003 |
| 1016 | Ga0209974_10342199 | 3300027876 | Unclassified | 579 |
| 1017 | Ga0207428_10023817 | 3300027907 | Bacteria | 5142 |
| 1018 | Ga0207428_10034926 | 3300027907 | Bacteria | 4114 |
| 1019 | Ga0207428_10047517 | 3300027907 | Unclassified | 3446 |
| 1020 | Ga0207428_10060800 | 3300027907 | Bacteria | 2992 |
| 1021 | Ga0207428_10157922 | 3300027907 | Bacteria | 1723 |
| 1022 | Ga0207428_10258530 | 3300027907 | Bacteria | 1297 |
| 1023 | Ga0207428_10339716 | 3300027907 | Unclassified | 1106 |
| 1024 | Ga0268266_10138074 | 3300028379 | Bacteria | 2185 |
| 1025 | Ga0268265_10032524 | 3300028380 | Bacteria | 3782 |
| 1026 | Ga0268265_10079514 | 3300028380 | Bacteria | 2582 |
| 1027 | Ga0268265_11548456 | 3300028380 | Unclassified | 667 |
| 1028 | Ga0268264_10078776 | 3300028381 | Bacteria | 2810 |
| 1029 | Ga0268264_10134491 | 3300028381 | Unclassified | 2196 |
| 1030 | Ga0268264_10216239 | 3300028381 | Bacteria | 1762 |
| 1031 | Ga0268264_10634138 | 3300028381 | Unclassified | 1056 |
| 1032 | Ga0268264_10836333 | 3300028381 | Unclassified | 921 |
| 1033 | Ga0268264_11060286 | 3300028381 | Bacteria | 818 |
| 1034 | Ga0268264_11447146 | 3300028381 | Bacteria | 698 |
| 1035 | Ga0268264_11618224 | 3300028381 | Unclassified | 658 |
| 1036 | Ga0268264_12135007 | 3300028381 | Unclassified | 568 |
| 1037 | Ga0265338_10265855 | 3300028800 | Bacteria | 1259 |
| 1038 | Ga0265338_10783562 | 3300028800 | Unclassified | 654 |
| 1039 | Ga0316178_1065459 | 3300030735 | Unclassified | 543 |
| 1040 | Ga0265766_1012762 | 3300030863 | Unclassified | 624 |
| 1041 | Ga0265761_107455 | 3300030889 | Unclassified | 598 |
| 1042 | Ga0265760_10108614 | 3300031090 | Unclassified | 882 |
| 1043 | Ga0265760_10298254 | 3300031090 | Unclassified | 570 |
| 1044 | Ga0265340_10060438 | 3300031247 | Bacteria | 1815 |
| 1045 | Ga0265313_10003726 | 3300031595 | Bacteria | 12129 |
| 1046 | Ga0265313_10037651 | 3300031595 | Unclassified | 2415 |
| 1047 | Ga0265314_10000216 | 3300031711 | Bacteria | 85672 |
| 1048 | Ga0265314_10215465 | 3300031711 | Unclassified | 1124 |
| 1049 | Ga0307405_12090089 | 3300031731 | Unclassified | 508 |
| 1050 | Ga0307413_10552266 | 3300031824 | Bacteria | 934 |
| 1051 | Ga0307413_11115968 | 3300031824 | Unclassified | 682 |
| 1052 | Ga0307410_11025746 | 3300031852 | Unclassified | 712 |
| 1053 | Ga0307406_10792529 | 3300031901 | Unclassified | 799 |
| 1054 | Ga0307416_100940942 | 3300032002 | Unclassified | 966 |
| 1055 | Ga0307416_102527223 | 3300032002 | Unclassified | 612 |
| 1056 | Ga0307411_10084496 | 3300032005 | Bacteria | 2196 |
| 1057 | Ga0373934_0008713 | 3300035086 | Bacteria | 3786 |
| 1058 | Ga0373934_0011047 | 3300035086 | Unclassified | 3397 |
| 1059 | Ga0373934_0025370 | 3300035086 | Unclassified | 2295 |
| 1060 | Ga0373934_0192680 | 3300035086 | Unclassified | 839 |
| 1061 | Ga0373934_0477963 | 3300035086 | Bacteria | 523 |
| 1062 | Ga0373949_0310785 | 3300035090 | Bacteria | 502 |
| 1063 | Ga0373952_0190577 | 3300035092 | Unclassified | 596 |
| 1064 | Ga0373923_0001630 | 3300035111 | Bacteria | 6545 |
| 1065 | Ga0373923_0032759 | 3300035111 | Unclassified | 2101 |
| 1066 | Ga0373923_0276864 | 3300035111 | Bacteria | 790 |
| 1067 | Ga0373923_0633190 | 3300035111 | Unclassified | 528 |
| 1068 | Ga0373923_0651865 | 3300035111 | Unclassified | 521 |
| 1069 | Ga0373932_0215559 | 3300035112 | Unclassified | 688 |
| 1070 | Ga0373936_0085361 | 3300035113 | Bacteria | 1318 |
| 1071 | Ga0373936_0151066 | 3300035113 | Bacteria | 1007 |
| 1072 | Ga0373945_0436833 | 3300035116 | Unclassified | 577 |
| 1073 | Ga0373953_0016546 | 3300035117 | Bacteria | 2694 |
| 1074 | Ga0373953_0323307 | 3300035117 | Bacteria | 674 |
| 1075 | Ga0373954_0009618 | 3300035118 | Unclassified | 4255 |
| 1076 | Ga0373954_0025706 | 3300035118 | Unclassified | 2695 |
| 1077 | Ga0373954_0031641 | 3300035118 | Bacteria | 2443 |
| 1078 | Ga0373954_0051598 | 3300035118 | Unclassified | 1932 |
| 1079 | Ga0373954_0057398 | 3300035118 | Unclassified | 1833 |
| 1080 | Ga0373954_0094897 | 3300035118 | Bacteria | 1436 |
| 1081 | Ga0373954_0219683 | 3300035118 | Bacteria | 935 |
| 1082 | Ga0373954_0579479 | 3300035118 | Unclassified | 556 |
| 1083 | Ga0373956_0051017 | 3300035119 | Unclassified | 1859 |
| 1084 | Ga0373956_0092851 | 3300035119 | Bacteria | 1394 |
| 1085 | Ga0373957_0011268 | 3300035120 | Unclassified | 2980 |
| 1086 | Ga0373957_0084898 | 3300035120 | Bacteria | 1253 |
| 1087 | Ga0373957_0086224 | 3300035120 | Bacteria | 1244 |
| 1088 | Ga0373957_0210694 | 3300035120 | Unclassified | 812 |
| 1089 | Ga0373957_0273425 | 3300035120 | Unclassified | 713 |
| 1090 | Ga0373943_0309150 | 3300035170 | Bacteria | 899 |
| 1091 | Ga0373943_0701557 | 3300035170 | Bacteria | 600 |
| 1092 | Ga0373946_0424304 | 3300035171 | Bacteria | 674 |
| 1093 | Ga0373955_0011914 | 3300035172 | Unclassified | 4165 |
| 1094 | Ga0373955_0020013 | 3300035172 | Unclassified | 3357 |
| 1095 | Ga0373955_0069483 | 3300035172 | Bacteria | 1965 |
| 1096 | Ga0373955_0129042 | 3300035172 | Bacteria | 1475 |
| 1097 | Ga0373955_0255000 | 3300035172 | Bacteria | 1052 |
| 1098 | Ga0373955_0620131 | 3300035172 | Unclassified | 663 |
| 1099 | Ga0373955_0629694 | 3300035172 | Bacteria | 657 |
| 1100 | Ga0373962_0103317 | 3300035242 | Bacteria | 891 |
| 1101 | Ga0373924_0056918 | 3300035410 | Unclassified | 1630 |
| 1102 | Ga0373924_0151665 | 3300035410 | Bacteria | 1014 |
| 1103 | Ga0373931_0163170 | 3300035691 | Bacteria | 1308 |
| 1104 | Ga0373935_0221628 | 3300035692 | Unclassified | 1314 |
| 1105 | Ga0373935_1061923 | 3300035692 | Bacteria | 602 |
| 1106 | Ga0373935_1172377 | 3300035692 | Bacteria | 572 |
| 1107 | Ga0373927_0031610 | 3300035695 | Bacteria | 3449 |
| 1108 | Ga0373927_0033707 | 3300035695 | Unclassified | 3333 |
| 1109 | Ga0373927_0093199 | 3300035695 | Bacteria | 1957 |
| 1110 | Ga0373933_0006501 | 3300035724 | Bacteria | 6364 |
| 1111 | Ga0373933_0011568 | 3300035724 | Unclassified | 4869 |
| 1112 | Ga0373933_0078309 | 3300035724 | Bacteria | 2022 |
| 1113 | Ga0373933_0110163 | 3300035724 | Bacteria | 1717 |
| 1114 | Ga0373933_0156543 | 3300035724 | Unclassified | 1445 |
| 1115 | Ga0373933_0223485 | 3300035724 | Bacteria | 1208 |
| 1116 | Ga0373947_0179077 | 3300035725 | Bacteria | 1379 |
| 1117 | Ga0373947_0195393 | 3300035725 | Bacteria | 1322 |
| 1118 | Ga0373937_0007916 | 3300036401 | Bacteria | 9210 |
| 1119 | Ga0373937_0016065 | 3300036401 | Bacteria | 6640 |
| 1120 | Ga0373937_0033347 | 3300036401 | Bacteria | 4675 |
| 1121 | Ga0373937_0051686 | 3300036401 | Bacteria | 3767 |
| 1122 | Ga0373937_0071823 | 3300036401 | Unclassified | 3192 |
| 1123 | Ga0373937_0102790 | 3300036401 | Bacteria | 2653 |
| 1124 | Ga0373937_0152835 | 3300036401 | Bacteria | 2162 |
| 1125 | Ga0373937_0159609 | 3300036401 | Bacteria | 2114 |
| 1126 | Ga0373937_0184876 | 3300036401 | Unclassified | 1957 |
| 1127 | Ga0373937_0289994 | 3300036401 | Bacteria | 1546 |
| 1128 | Ga0373937_0318383 | 3300036401 | Bacteria | 1472 |
| 1129 | Ga0373937_0554995 | 3300036401 | Bacteria | 1091 |
| 1130 | Ga0373937_0603185 | 3300036401 | Unclassified | 1042 |
| 1131 | Ga0373937_1328886 | 3300036401 | Unclassified | 667 |
| 1132 | Ga0373937_1729560 | 3300036401 | Unclassified | 572 |
| 1133 | Ga0265778_025300 | 3300036457 | Unclassified | 749 |
| 1134 | Ga0373925_0022844 | 3300037068 | Bacteria | 4564 |
| 1135 | Ga0373925_0030612 | 3300037068 | Unclassified | 3951 |
| 1136 | Ga0373925_0069136 | 3300037068 | Bacteria | 2667 |
| 1137 | Ga0373925_0075906 | 3300037068 | Bacteria | 2548 |
| 1138 | Ga0373925_0171978 | 3300037068 | Unclassified | 1711 |
| 1139 | Ga0373925_0418951 | 3300037068 | Unclassified | 1094 |
| 1140 | Ga0373925_0741198 | 3300037068 | Bacteria | 810 |
| 1141 | Ga0373925_1569217 | 3300037068 | Bacteria | 538 |
| 1142 | Ga0436364_0322271 | 3300037853 | Bacteria | 1224 |
| 1143 | Ga0436364_0408987 | 3300037853 | Unclassified | 736 |
| 1144 | Ga0436364_0502698 | 3300037853 | Bacteria | 6112 |
| 1145 | Ga0436364_1160244 | 3300037853 | Unclassified | 2656 |
| 1146 | Ga0436364_1532637 | 3300037853 | Bacteria | 11509 |
| 1147 | Ga0436365_0148535 | 3300039437 | Unclassified | 2863 |
| 1148 | Ga0436363_0251377 | 3300039450 | Unclassified | 1339 |
| 1149 | Ga0436363_0583931 | 3300039450 | Unclassified | 1497 |
| 1150 | Ga0436362_0326765 | 3300039453 | Unclassified | 563 |
| 1151 | Ga0436362_0653106 | 3300039453 | Unclassified | 2143 |
| 1152 | Ga0439439_0227515 | 3300041406 | Bacteria | 548 |
| 1153 | Ga0439453_0002949 | 3300041408 | Unclassified | 2402 |
| 1154 | Ga0439448_0055837 | 3300042005 | Unclassified | 1299 |
| 1155 | Ga0450910_102440 | 3300042147 | Bacteria | 515 |
| 1156 | Ga0439435_0001943 | 3300042436 | Bacteria | 3973 |
| 1157 | Ga0450916_058727 | 3300042530 | Bacteria | 621 |
| 1158 | Ga0495592_0133697 | 3300046454 | Bacteria | 1732 |
| 1159 | Ga0495592_0289042 | 3300046454 | Unclassified | 1069 |
| 1160 | Ga0495651_0024889 | 3300046462 | Unclassified | 4657 |
| 1161 | Ga0495580_0008386 | 3300046472 | Bacteria | 8220 |
| 1162 | Ga0495580_0012657 | 3300046472 | Bacteria | 6469 |
| 1163 | Ga0495580_0018987 | 3300046472 | Bacteria | 5113 |
| 1164 | Ga0495580_0032844 | 3300046472 | Unclassified | 3741 |
| 1165 | Ga0495580_0072887 | 3300046472 | Bacteria | 2398 |
| 1166 | Ga0495580_0176328 | 3300046472 | Bacteria | 1476 |
| 1167 | Ga0495580_0217229 | 3300046472 | Unclassified | 1314 |
| 1168 | Ga0495580_0646951 | 3300046472 | Unclassified | 695 |
| 1169 | Ga0495580_0798583 | 3300046472 | Unclassified | 612 |
| 1170 | Ga0495582_0188291 | 3300046473 | Bacteria | 1177 |
| 1171 | Ga0495639_0248034 | 3300046475 | Unclassified | 880 |
| 1172 | Ga0495639_0359164 | 3300046475 | Unclassified | 732 |
| 1173 | Ga0495639_0759167 | 3300046475 | Unclassified | 502 |
| 1174 | Ga0495664_0515565 | 3300046477 | Unclassified | 714 |
| 1175 | Ga0495664_0578955 | 3300046477 | Unclassified | 668 |
| 1176 | Ga0495584_0035393 | 3300046491 | Unclassified | 2524 |
| 1177 | Ga0495594_0128079 | 3300046499 | Archaea | 1437 |
| 1178 | Ga0495608_0062113 | 3300046511 | Bacteria | 2455 |
| 1179 | Ga0495608_0067259 | 3300046511 | Unclassified | 2344 |
| 1180 | Ga0495618_0535614 | 3300046514 | Unclassified | 703 |
| 1181 | Ga0495618_0595623 | 3300046514 | Unclassified | 658 |
| 1182 | Ga0495628_0426329 | 3300046516 | Bacteria | 966 |
| 1183 | Ga0495630_0617809 | 3300046517 | Bacteria | 831 |
| 1184 | Ga0495663_0020425 | 3300046525 | Unclassified | 1901 |
| 1185 | Ga0495663_0150397 | 3300046525 | Bacteria | 794 |
| 1186 | Ga0495642_0027494 | 3300046528 | Bacteria | 2264 |
| 1187 | Ga0495642_0226901 | 3300046528 | Bacteria | 816 |
| 1188 | Ga0495652_0069906 | 3300046529 | Bacteria | 2937 |
| 1189 | Ga0495652_0183777 | 3300046529 | Unclassified | 1602 |
| 1190 | Ga0495652_0506020 | 3300046529 | Unclassified | 837 |
| 1191 | Ga0495652_0683770 | 3300046529 | Unclassified | 692 |
| 1192 | Ga0495652_0957639 | 3300046529 | Bacteria | 562 |
| 1193 | Ga0495652_1095066 | 3300046529 | Unclassified | 517 |
| 1194 | Ga0495586_0040857 | 3300046535 | Bacteria | 2497 |
| 1195 | Ga0495586_0076146 | 3300046535 | Bacteria | 1838 |
| 1196 | Ga0495586_0108233 | 3300046535 | Bacteria | 1546 |
| 1197 | Ga0495587_0001148 | 3300046536 | Bacteria | 17383 |
| 1198 | Ga0495587_0011486 | 3300046536 | Bacteria | 5609 |
| 1199 | Ga0495587_0013274 | 3300046536 | Bacteria | 5179 |
| 1200 | Ga0495587_0141376 | 3300046536 | Unclassified | 1374 |
| 1201 | Ga0495587_0222737 | 3300046536 | Unclassified | 1064 |
| 1202 | Ga0495598_0027162 | 3300046537 | Bacteria | 1576 |
| 1203 | Ga0495609_0015778 | 3300046538 | Bacteria | 3531 |
| 1204 | Ga0495621_0372411 | 3300046539 | Bacteria | 602 |
| 1205 | Ga0495645_0159263 | 3300046543 | Unclassified | 1562 |
| 1206 | Ga0495645_0216685 | 3300046543 | Unclassified | 1290 |
| 1207 | Ga0495645_0518724 | 3300046543 | Bacteria | 743 |
| 1208 | Ga0495667_0058295 | 3300046559 | Bacteria | 2537 |
| 1209 | Ga0495667_0124185 | 3300046559 | Unclassified | 1666 |
| 1210 | Ga0495667_0610827 | 3300046559 | Unclassified | 679 |
| 1211 | Ga0495656_0011957 | 3300046615 | Bacteria | 3194 |
| 1212 | Ga0495635_0488039 | 3300046663 | Bacteria | 812 |
| 1213 | Ga0495635_0590106 | 3300046663 | Bacteria | 726 |
| 1214 | Ga0495659_0075681 | 3300046664 | Bacteria | 1268 |
| 1215 | Ga0495659_0116345 | 3300046664 | Unclassified | 1048 |
| 1216 | Ga0495657_0545635 | 3300046675 | Unclassified | 674 |
| 1217 | Ga0495657_0893905 | 3300046675 | Bacteria | 505 |
| 1218 | Ga0495599_0002747 | 3300046678 | Bacteria | 10267 |
| 1219 | Ga0495599_0005840 | 3300046678 | Bacteria | 7393 |
| 1220 | Ga0495599_0089696 | 3300046678 | Bacteria | 1919 |
| 1221 | Ga0495599_0123211 | 3300046678 | Unclassified | 1611 |
| 1222 | Ga0495599_0402358 | 3300046678 | Bacteria | 815 |
| 1223 | Ga0495599_0479268 | 3300046678 | Unclassified | 734 |
| 1224 | Ga0495599_0654289 | 3300046678 | Unclassified | 608 |
| 1225 | Ga0495623_0055150 | 3300046679 | Bacteria | 2506 |
| 1226 | Ga0495647_0070439 | 3300046681 | Bacteria | 1399 |
| 1227 | Ga0495669_0170874 | 3300046684 | Bacteria | 1034 |
| 1228 | Ga0495613_0032157 | 3300046689 | Unclassified | 3897 |
| 1229 | Ga0495613_0033856 | 3300046689 | Bacteria | 3795 |
| 1230 | Ga0495613_0402817 | 3300046689 | Bacteria | 933 |
| 1231 | Ga0495600_0096251 | 3300046809 | Bacteria | 1930 |
| 1232 | Ga0495600_0113205 | 3300046809 | Unclassified | 1767 |
| 1233 | Ga0495581_0134208 | 3300047315 | Bacteria | 1443 |
| 1234 | Ga0495604_0425390 | 3300047317 | Bacteria | 871 |
| 1235 | Ga0495636_0017244 | 3300047318 | Unclassified | 2889 |
| 1236 | Ga0495636_0114688 | 3300047318 | Bacteria | 1188 |
| 1237 | Ga0495636_0468121 | 3300047318 | Unclassified | 607 |
| 1238 | Ga0495674_0073136 | 3300047319 | Bacteria | 2956 |
| 1239 | Ga0495674_0162803 | 3300047319 | Unclassified | 1866 |
| 1240 | Ga0495680_0531040 | 3300047322 | Bacteria | 795 |
| 1241 | Ga0495680_0583449 | 3300047322 | Bacteria | 750 |
| 1242 | Ga0495675_0054515 | 3300047444 | Unclassified | 2537 |
| 1243 | Ga0495675_0280381 | 3300047444 | Bacteria | 994 |
| 1244 | Ga0495675_0554746 | 3300047444 | Bacteria | 655 |
| 1245 | Ga0495677_0025708 | 3300047445 | Unclassified | 2136 |
| 1246 | Ga0495677_0327133 | 3300047445 | Unclassified | 604 |
| 1247 | Ga0495684_0005160 | 3300047471 | Bacteria | 10178 |
| 1248 | Ga0495684_0008399 | 3300047471 | Bacteria | 7997 |
| 1249 | Ga0495684_0491259 | 3300047471 | Unclassified | 846 |
| 1250 | Ga0495602_0004288 | 3300048088 | Bacteria | 14849 |
| 1251 | Ga0495602_0027992 | 3300048088 | Bacteria | 5405 |
| 1252 | Ga0495602_1028660 | 3300048088 | Unclassified | 542 |
| 1253 | Ga0496101_1223163 | 3300048904 | Unclassified | 588 |
| 1254 | Ga0496104_0114079 | 3300048907 | Plasmid | 2591 |
| 1255 | Ga0496104_0159263 | 3300048907 | Bacteria | 2166 |
| 1256 | Ga0496105_0339015 | 3300048908 | Bacteria | 1202 |
| 1257 | Ga0496107_1227927 | 3300048910 | Unclassified | 538 |
| 1258 | Ga0496108_0280509 | 3300048911 | Bacteria | 1451 |
| 1259 | Ga0496109_0310786 | 3300048912 | Bacteria | 1487 |
| 1260 | Ga0496109_1183307 | 3300048912 | Unclassified | 701 |
| 1261 | Ga0496112_0068296 | 3300048915 | Bacteria | 3509 |
| 1262 | Ga0496112_1233309 | 3300048915 | Unclassified | 664 |
| 1263 | Ga0496113_0089071 | 3300048916 | Bacteria | 2375 |
| 1264 | Ga0496114_0000515 | 3300048917 | Bacteria | 28421 |
| 1265 | Ga0496115_0203300 | 3300048918 | Unclassified | 1636 |
| 1266 | Ga0496115_0631447 | 3300048918 | Unclassified | 849 |
| 1267 | Ga0501031_1004704 | 3300049568 | Unclassified | 533 |
| 1268 | Ga0501036_0827086 | 3300049572 | Unclassified | 762 |
| 1269 | Ga0501036_1210707 | 3300049572 | Unclassified | 615 |
| 1270 | Ga0501039_0543551 | 3300049575 | Bacteria | 912 |
| 1271 | Ga0501040_0615093 | 3300049576 | Bacteria | 785 |
| 1272 | Ga0501041_0089304 | 3300049577 | Bacteria | 1903 |
| 1273 | Ga0501042_0314539 | 3300049578 | Bacteria | 1131 |
| 1274 | Ga0501042_1088986 | 3300049578 | Unclassified | 582 |
| 1275 | Ga0501043_0864408 | 3300049579 | Bacteria | 651 |
| 1276 | Ga0501048_0457116 | 3300049582 | Bacteria | 915 |
| 1277 | Ga0501048_0614575 | 3300049582 | Bacteria | 780 |
| 1278 | Ga0501048_1058334 | 3300049582 | Bacteria | 584 |
| 1279 | Ga0501068_0600910 | 3300049584 | Unclassified | 717 |
| 1280 | Ga0501071_0071166 | 3300049587 | Bacteria | 2535 |
| 1281 | Ga0501071_0081775 | 3300049587 | Unclassified | 2364 |
| 1282 | Ga0501071_0907566 | 3300049587 | Bacteria | 680 |
| 1283 | Ga0501071_1081316 | 3300049587 | Unclassified | 620 |
| 1284 | Ga0501072_0032837 | 3300049588 | Bacteria | 4066 |
| 1285 | Ga0501072_0103475 | 3300049588 | Unclassified | 2263 |
| 1286 | Ga0501074_0355926 | 3300049590 | Unclassified | 1039 |
| 1287 | Ga0501075_0072953 | 3300049591 | Bacteria | 2595 |
| 1288 | Ga0501075_0400545 | 3300049591 | Unclassified | 1046 |
| 1289 | Ga0501075_0818820 | 3300049591 | Bacteria | 708 |
| 1290 | Ga0501076_0525307 | 3300049592 | Bacteria | 976 |
| 1291 | Ga0501076_0734288 | 3300049592 | Unclassified | 815 |
| 1292 | Ga0501076_0950862 | 3300049592 | Bacteria | 708 |
| 1293 | Ga0501079_0659506 | 3300049741 | Bacteria | 824 |
| 1294 | Ga0501081_1051522 | 3300049743 | Bacteria | 616 |
| 1295 | nmdc:mga05p37_1255215_c1 | 3300050507 | Unclassified | 760 |
| 1296 | nmdc:mga05p37_1267785_c1 | 3300050507 | Unclassified | 754 |
| 1297 | nmdc:mga05p37_41774_c1 | 3300050507 | Bacteria | 5631 |
| 1298 | nmdc:mga05p37_9001_c1 | 3300050507 | Bacteria | 8870 |
| 1299 | nmdc:mga09592_20174_c1 | 3300050508 | Bacteria | 5477 |
| 1300 | nmdc:mga09592_563462_c1 | 3300050508 | Unclassified | 978 |
| 1301 | nmdc:mga09592_6242_c1 | 3300050508 | Bacteria | 9705 |
| 1302 | nmdc:mga09592_6838_c1 | 3300050508 | Bacteria | 9283 |
| 1303 | nmdc:mga0qj67_14222_c1 | 3300050509 | Bacteria | 6015 |
| 1304 | nmdc:mga0qj67_18992_c1 | 3300050509 | Bacteria | 5246 |
| 1305 | nmdc:mga0qj67_243841_c1 | 3300050509 | Bacteria | 1458 |
| 1306 | nmdc:mga0qj67_320250_c1 | 3300050509 | Bacteria | 1255 |
| 1307 | nmdc:mga0qj67_74584_c1 | 3300050509 | Bacteria | 2711 |
| 1308 | nmdc:mga06r32_47913_c1 | 3300050510 | Bacteria | 4084 |
| 1309 | nmdc:mga08y16_146855_c1 | 3300050511 | Bacteria | 2452 |
| 1310 | nmdc:mga08y16_159457_c1 | 3300050511 | Bacteria | 2344 |
| 1311 | nmdc:mga08y16_21290_c1 | 3300050511 | Bacteria | 6846 |
| 1312 | nmdc:mga08y16_28325_c1 | 3300050511 | Bacteria | 5905 |
| 1313 | nmdc:mga08y16_38725_c1 | 3300050511 | Bacteria | 5004 |
| 1314 | nmdc:mga08y16_534348_c1 | 3300050511 | Bacteria | 1188 |
| 1315 | nmdc:mga08y16_715_c1 | 3300050511 | Bacteria | 31535 |
| 1316 | nmdc:mga0n895_131017_c1 | 3300050512 | Bacteria | 2533 |
| 1317 | nmdc:mga0n895_1467169_c1 | 3300050512 | Bacteria | 649 |
| 1318 | nmdc:mga0n895_370138_c1 | 3300050512 | Bacteria | 1451 |
| 1319 | nmdc:mga0n895_584126_c1 | 3300050512 | Bacteria | 1121 |
| 1320 | nmdc:mga0rr50_1182568_c1 | 3300050513 | Unclassified | 650 |
| 1321 | nmdc:mga0rr50_130167_c1 | 3300050513 | Bacteria | 2014 |
| 1322 | nmdc:mga0rr50_277036_c1 | 3300050513 | Bacteria | 1399 |
| 1323 | nmdc:mga0rr50_613594_c1 | 3300050513 | Bacteria | 928 |
| 1324 | nmdc:mga08x19_325325_c1 | 3300050514 | Unclassified | 1070 |
| 1325 | nmdc:mga08x19_432811_c1 | 3300050514 | Unclassified | 925 |
| 1326 | nmdc:mga08x19_650892_c1 | 3300050514 | Bacteria | 747 |
| 1327 | nmdc:mga08x19_720487_c1 | 3300050514 | Unclassified | 708 |
| 1328 | nmdc:mga0a205_129296_c2 | 3300050515 | Bacteria | 807 |
| 1329 | nmdc:mga0a205_177397_c1 | 3300050515 | Bacteria | 2026 |
| 1330 | Ga0495601_0163507 | 3300053077 | Bacteria | 1455 |
| 1331 | Ga0495601_0392563 | 3300053077 | Unclassified | 900 |
| 1332 | Ga0495595_0443513 | 3300053084 | Bacteria | 660 |
| 1333 | Ga0495619_0132605 | 3300053085 | Unclassified | 1713 |
| 1334 | Ga0495619_0569993 | 3300053085 | Unclassified | 776 |
| 1335 | Ga0495619_0822349 | 3300053085 | Bacteria | 628 |
| 1336 | Ga0500641_0147194 | 3300053096 | Bacteria | 1017 |
| 1337 | Ga0500568_0000723 | 3300053139 | Bacteria | 23653 |
| 1338 | Ga0590074_068829 | 3300059423 | Unclassified | 665 |
| 1339 | Ga0105247_10808210 | |||
| 1340 | Ga0058863_11384065 | |||
| 1341 | Ga0058863_11860520 | |||
| 1342 | Ga0058861_11360516 | |||
| 1343 | Ga0058861_11653710 | |||
| 1344 | Ga0058861_11906043 | |||
| 1345 | Ga0058860_10572999 | |||
| 1346 | Ga0058862_10882323 | |||
| 1347 | Ga0058862_12292071 | |||
| 1348 | Ga0058862_12848695 | |||
| 1349 | Ga0058862_12883805 | |||
| 1350 | Ga0065704_10227521 | |||
| 1351 | Ga0065707_10215388 | |||
| 1352 | Ga0070658_10309734 | |||
| 1353 | Ga0070676_10188458 | |||
| 1354 | Ga0070676_10414428 | |||
| 1355 | Ga0070676_11582046 | |||
| 1356 | Ga0070683_100002345 | |||
| 1357 | Ga0070683_100007027 | |||
| 1358 | Ga0070683_100007330 | |||
| 1359 | Ga0070683_100026483 | |||
| 1360 | Ga0070683_100031320 | |||
| 1361 | Ga0070683_100034975 | |||
| 1362 | Ga0070683_100050632 | |||
| 1363 | Ga0070683_100056252 | |||
| 1364 | Ga0070683_100062857 | |||
| 1365 | Ga0070683_100069695 | |||
| 1366 | Ga0070683_100069785 | |||
| 1367 | Ga0070683_100079969 | |||
| 1368 | Ga0070683_100243025 | |||
| 1369 | Ga0070683_100324622 | |||
| 1370 | Ga0070683_100596853 | |||
| 1371 | Ga0070683_100828048 | |||
| 1372 | Ga0070683_101015345 | |||
| 1373 | Ga0070683_101034575 | |||
| 1374 | Ga0070683_101204223 | |||
| 1375 | Ga0070690_100050211 | |||
| 1376 | Ga0070690_100317884 | |||
| 1377 | Ga0070690_100786286 | |||
| 1378 | Ga0070670_100005882 | |||
| 1379 | Ga0070670_100320100 | |||
| 1380 | Ga0068869_100078093 | |||
| 1381 | Ga0068869_100193464 | |||
| 1382 | Ga0068869_100588296 | |||
| 1383 | Ga0068869_100977678 | |||
| 1384 | Ga0068869_101370855 | |||
| 1385 | Ga0068869_101734854 | |||
| 1386 | Ga0070666_10024073 | |||
| 1387 | Ga0070666_10215985 | |||
| 1388 | Ga0070666_10405754 | |||
| 1389 | Ga0070666_10422344 | |||
| 1390 | Ga0070666_10559303 | |||
| 1391 | Ga0070680_100013477 | |||
| 1392 | Ga0070680_100029837 | |||
| 1393 | Ga0070680_100151391 | |||
| 1394 | Ga0070680_100229327 | |||
| 1395 | Ga0070680_101308905 | |||
| 1396 | Ga0070682_100457078 | |||
| 1397 | Ga0070682_101110468 | |||
| 1398 | Ga0070682_101298510 | |||
| 1399 | Ga0068868_100023014 | |||
| 1400 | Ga0068868_100137746 | |||
| 1401 | Ga0068868_101293173 | |||
| 1402 | Ga0070660_100038870 | |||
| 1403 | Ga0070660_100046368 | |||
| 1404 | Ga0070660_100074978 | |||
| 1405 | Ga0070660_100112143 | |||
| 1406 | Ga0070660_100217900 | |||
| 1407 | Ga0070689_100114995 | |||
| 1408 | Ga0070689_100206846 | |||
| 1409 | Ga0070689_100472252 | |||
| 1410 | Ga0070691_10012040 | |||
| 1411 | Ga0070691_10018047 | |||
| 1412 | Ga0070691_10134706 | |||
| 1413 | Ga0070691_10333633 | |||
| 1414 | Ga0070691_10456970 | |||
| 1415 | Ga0070687_100952647 | |||
| 1416 | Ga0070661_100060635 | |||
| 1417 | Ga0070661_100264588 | |||
| 1418 | Ga0070661_100337359 | |||
| 1419 | Ga0070661_100349870 | |||
| 1420 | Ga0070692_10109473 | |||
| 1421 | Ga0070692_10191505 | |||
| 1422 | Ga0070668_100337956 | |||
| 1423 | Ga0070669_100428240 | |||
| 1424 | Ga0070669_101022808 | |||
| 1425 | Ga0070675_100149917 | |||
| 1426 | Ga0070675_100194911 | |||
| 1427 | Ga0070675_100214200 | |||
| 1428 | Ga0070671_100040252 | |||
| 1429 | Ga0070671_100157345 | |||
| 1430 | Ga0070671_100917285 | |||
| 1431 | Ga0070674_100335792 | |||
| 1432 | Ga0070674_100513238 | |||
| 1433 | Ga0070674_100542029 | |||
| 1434 | Ga0070674_100996114 | |||
| 1435 | Ga0070673_100005787 | |||
| 1436 | Ga0070673_100106619 | |||
| 1437 | Ga0070673_100124756 | |||
| 1438 | Ga0070673_100169976 | |||
| 1439 | Ga0070673_100182409 | |||
| 1440 | Ga0070673_100256744 | |||
| 1441 | Ga0070673_100424792 | |||
| 1442 | Ga0070673_100896624 | |||
| 1443 | Ga0070688_100074661 | |||
| 1444 | Ga0070688_101739814 | |||
| 1445 | Ga0070659_100047286 | |||
| 1446 | Ga0070659_100075163 | |||
| 1447 | Ga0070667_100001720 | |||
| 1448 | Ga0070667_100147324 | |||
| 1449 | Ga0070667_100974453 | |||
| 1450 | Ga0070667_101886084 | |||
| 1451 | Ga0070703_10232305 | |||
| 1452 | Ga0070709_10028638 | |||
| 1453 | Ga0070709_10064165 | |||
| 1454 | Ga0070709_10222275 | |||
| 1455 | Ga0070709_10415598 | |||
| 1456 | Ga0070714_100044338 | |||
| 1457 | Ga0070714_100368355 | |||
| 1458 | Ga0070714_100455186 | |||
| 1459 | Ga0070713_100016997 | |||
| 1460 | Ga0070713_100028621 | |||
| 1461 | Ga0070713_100030488 | |||
| 1462 | Ga0070713_100054358 | |||
| 1463 | Ga0070713_100107017 | |||
| 1464 | Ga0070713_100175678 | |||
| 1465 | Ga0070713_100636098 | |||
| 1466 | Ga0070713_100690245 | |||
| 1467 | Ga0070713_100817213 | |||
| 1468 | Ga0070710_10395325 | |||
| 1469 | Ga0070710_10457965 | |||
| 1470 | Ga0070710_10506795 | |||
| 1471 | Ga0070701_10004374 | |||
| 1472 | Ga0070701_10018944 | |||
| 1473 | Ga0070701_10038134 | |||
| 1474 | Ga0070711_100046631 | |||
| 1475 | Ga0070711_100075032 | |||
| 1476 | Ga0070711_100092618 | |||
| 1477 | Ga0070711_100104359 | |||
| 1478 | Ga0070711_100152967 | |||
| 1479 | Ga0070711_100162332 | |||
| 1480 | Ga0070711_100434143 | |||
| 1481 | Ga0070711_102007357 | |||
| 1482 | Ga0070705_100001435 | |||
| 1483 | Ga0070705_100002500 | |||
| 1484 | Ga0070705_100133950 | |||
| 1485 | Ga0070705_100200815 | |||
| 1486 | Ga0070705_100792466 | |||
| 1487 | Ga0070705_100943505 | |||
| 1488 | Ga0070705_101458352 | |||
| 1489 | Ga0070700_100032779 | |||
| 1490 | Ga0070700_100071387 | |||
| 1491 | Ga0070700_100095694 | |||
| 1492 | Ga0070700_100214486 | |||
| 1493 | Ga0070694_100003150 | |||
| 1494 | Ga0070694_100108601 | |||
| 1495 | Ga0070694_100279690 | |||
| 1496 | Ga0070694_100305915 | |||
| 1497 | Ga0070694_100355481 | |||
| 1498 | Ga0070694_100417269 | |||
| 1499 | Ga0070694_100548720 | |||
| 1500 | Ga0070694_100641547 | |||
| 1501 | Ga0070663_100834405 | |||
| 1502 | Ga0070678_100470508 | |||
| 1503 | Ga0070662_100004942 | |||
| 1504 | Ga0070662_100181864 | |||
| 1505 | Ga0070662_100311062 | |||
| 1506 | Ga0070681_10002128 | |||
| 1507 | Ga0070681_10004375 | |||
| 1508 | Ga0070681_10059269 | |||
| 1509 | Ga0070681_10241004 | |||
| 1510 | Ga0068867_100100292 | |||
| 1511 | Ga0068867_100149478 | |||
| 1512 | Ga0068867_100359435 | |||
| 1513 | Ga0068867_100732239 | |||
| 1514 | Ga0068867_101183253 | |||
| 1515 | Ga0070685_10277332 | |||
| 1516 | Ga0070706_100387980 | |||
| 1517 | Ga0070698_100009281 | |||
| 1518 | Ga0070698_100198166 | |||
| 1519 | Ga0070698_100932935 | |||
| 1520 | Ga0070698_100960636 | |||
| 1521 | Ga0070699_100009166 | |||
| 1522 | Ga0070699_100069062 | |||
| 1523 | Ga0070699_101650130 | |||
| 1524 | Ga0070679_100000317 | |||
| 1525 | Ga0070679_100000639 | |||
| 1526 | Ga0070679_100042258 | |||
| 1527 | Ga0070679_100607365 | |||
| 1528 | Ga0070679_101033822 | |||
| 1529 | Ga0070679_101042627 | |||
| 1530 | Ga0070684_100001053 | |||
| 1531 | Ga0070684_100009305 | |||
| 1532 | Ga0070684_100009843 | |||
| 1533 | Ga0070684_100023219 | |||
| 1534 | Ga0070684_100053538 | |||
| 1535 | Ga0070684_100066215 | |||
| 1536 | Ga0070684_100083416 | |||
| 1537 | Ga0070684_100084648 | |||
| 1538 | Ga0070684_100128939 | |||
| 1539 | Ga0070684_100248814 | |||
| 1540 | Ga0070684_100373886 | |||
| 1541 | Ga0070684_101167988 | |||
| 1542 | Ga0070697_100271570 | |||
| 1543 | Ga0070697_100620213 | |||
| 1544 | Ga0070697_100807347 | |||
| 1545 | Ga0070697_101959118 | |||
| 1546 | Ga0068853_100038010 | |||
| 1547 | Ga0068853_100053906 | |||
| 1548 | Ga0068853_100110004 | |||
| 1549 | Ga0068853_100112737 | |||
| 1550 | Ga0068853_100180352 | |||
| 1551 | Ga0068853_100773026 | |||
| 1552 | Ga0068853_101847532 | |||
| 1553 | Ga0070672_100102173 | |||
| 1554 | Ga0070672_100639645 | |||
| 1555 | Ga0070672_101656389 | |||
| 1556 | Ga0070686_100141638 | |||
| 1557 | Ga0070686_100181556 | |||
| 1558 | Ga0070686_100303310 | |||
| 1559 | Ga0070686_100463144 | |||
| 1560 | Ga0070686_100806880 | |||
| 1561 | Ga0070695_100000407 | |||
| 1562 | Ga0070695_100025631 | |||
| 1563 | Ga0070695_100152647 | |||
| 1564 | Ga0070695_100161808 | |||
| 1565 | Ga0070695_100270632 | |||
| 1566 | Ga0070695_100401465 | |||
| 1567 | Ga0070696_100000265 | |||
| 1568 | Ga0070696_100012427 | |||
| 1569 | Ga0070696_100348614 | |||
| 1570 | Ga0070696_100515654 | |||
| 1571 | Ga0070696_100763280 | |||
| 1572 | Ga0070696_100881679 | |||
| 1573 | Ga0070696_101528324 | |||
| 1574 | Ga0070696_101627935 | |||
| 1575 | Ga0070693_100015589 | |||
| 1576 | Ga0070693_100027826 | |||
| 1577 | Ga0070693_100079038 | |||
| 1578 | Ga0070693_100094819 | |||
| 1579 | Ga0070693_100157229 | |||
| 1580 | Ga0070693_100524306 | |||
| 1581 | Ga0070693_100834722 | |||
| 1582 | Ga0070693_101197686 | |||
| 1583 | Ga0070665_100029385 | |||
| 1584 | Ga0070665_100471424 | |||
| 1585 | Ga0070704_100001131 | |||
| 1586 | Ga0070704_100004525 | |||
| 1587 | Ga0070704_100006854 | |||
| 1588 | Ga0070704_100098296 | |||
| 1589 | Ga0070704_100145312 | |||
| 1590 | Ga0070704_101572347 | |||
| 1591 | Ga0068855_100001577 | |||
| 1592 | Ga0068855_100004380 | |||
| 1593 | Ga0068855_100004802 | |||
| 1594 | Ga0068855_100079247 | |||
| 1595 | Ga0068855_100085923 | |||
| 1596 | Ga0068855_100263485 | |||
| 1597 | Ga0068855_100350783 | |||
| 1598 | Ga0068855_100374191 | |||
| 1599 | Ga0068855_100442408 | |||
| 1600 | Ga0068855_100546995 | |||
| 1601 | Ga0068855_101284731 | |||
| 1602 | Ga0070664_100009191 | |||
| 1603 | Ga0070664_100033980 | |||
| 1604 | Ga0070664_100461521 | |||
| 1605 | Ga0070664_101156707 | |||
| 1606 | Ga0070664_101769445 | |||
| 1607 | Ga0068857_100000258 | |||
| 1608 | Ga0068857_100004932 | |||
| 1609 | Ga0068857_100005540 | |||
| 1610 | Ga0068857_100027212 | |||
| 1611 | Ga0068857_100035682 | |||
| 1612 | Ga0068857_100170260 | |||
| 1613 | Ga0068857_101192127 | |||
| 1614 | Ga0068854_100085439 | |||
| 1615 | Ga0068854_100921715 | |||
| 1616 | Ga0068854_101701363 | |||
| 1617 | Ga0068856_100003558 | |||
| 1618 | Ga0068856_100010203 | |||
| 1619 | Ga0068856_100030989 | |||
| 1620 | Ga0068856_100034694 | |||
| 1621 | Ga0068856_100048690 | |||
| 1622 | Ga0068856_100062628 | |||
| 1623 | Ga0068856_100075098 | |||
| 1624 | Ga0068856_100113605 | |||
| 1625 | Ga0068856_100169115 | |||
| 1626 | Ga0068856_100194880 | |||
| 1627 | Ga0068856_100403588 | |||
| 1628 | Ga0068856_100425021 | |||
| 1629 | Ga0068856_100755802 | |||
| 1630 | Ga0070702_100209624 | |||
| 1631 | Ga0068852_100009583 | |||
| 1632 | Ga0068852_100017258 | |||
| 1633 | Ga0068852_100268314 | |||
| 1634 | Ga0068852_101113263 | |||
| 1635 | Ga0068852_101178096 | |||
| 1636 | Ga0068852_102023223 | |||
| 1637 | Ga0068852_102423238 | |||
| 1638 | Ga0068859_100008801 | |||
| 1639 | Ga0068859_100012958 | |||
| 1640 | Ga0068859_100026501 | |||
| 1641 | Ga0068859_100059021 | |||
| 1642 | Ga0068859_100211503 | |||
| 1643 | Ga0068859_100494008 | |||
| 1644 | Ga0068859_100525913 | |||
| 1645 | Ga0068859_101088092 | |||
| 1646 | Ga0068864_100006937 | |||
| 1647 | Ga0068864_100077999 | |||
| 1648 | Ga0068864_100235391 | |||
| 1649 | Ga0068864_100348485 | |||
| 1650 | Ga0068866_10182525 | |||
| 1651 | Ga0068866_10205960 | |||
| 1652 | Ga0068866_10497184 | |||
| 1653 | Ga0068866_10892475 | |||
| 1654 | Ga0068861_100005313 | |||
| 1655 | Ga0068861_100006410 | |||
| 1656 | Ga0068861_100026627 | |||
| 1657 | Ga0068861_100167407 | |||
| 1658 | Ga0068861_100835351 | |||
| 1659 | Ga0068861_101032376 | |||
| 1660 | Ga0068851_10078327 | |||
| 1661 | Ga0068851_10715605 | |||
| 1662 | Ga0068870_11154938 | |||
| 1663 | Ga0068863_100015411 | |||
| 1664 | Ga0068863_100117366 | |||
| 1665 | Ga0068863_100303809 | |||
| 1666 | Ga0068863_100467116 | |||
| 1667 | Ga0068863_100478709 | |||
| 1668 | Ga0068863_101005994 | |||
| 1669 | Ga0068858_100017530 | |||
| 1670 | Ga0068858_100048367 | |||
| 1671 | Ga0068858_100055499 | |||
| 1672 | Ga0068858_100094353 | |||
| 1673 | Ga0068858_100099888 | |||
| 1674 | Ga0068858_100115429 | |||
| 1675 | Ga0068858_100167608 | |||
| 1676 | Ga0068858_100457005 | |||
| 1677 | Ga0068858_100529589 | |||
| 1678 | Ga0068858_100985601 | |||
| 1679 | Ga0068858_101013366 | |||
| 1680 | Ga0068858_101287710 | |||
| 1681 | Ga0068858_101544909 | |||
| 1682 | Ga0068860_100042646 | |||
| 1683 | Ga0068860_100045862 | |||
| 1684 | Ga0068860_100248656 | |||
| 1685 | Ga0068860_100266306 | |||
| 1686 | Ga0068860_100407982 | |||
| 1687 | Ga0068860_100778569 | |||
| 1688 | Ga0068860_101658591 | |||
| 1689 | Ga0068862_100108121 | |||
| 1690 | Ga0068862_100123311 | |||
| 1691 | Ga0068862_100226343 | |||
| 1692 | Ga0068862_100724522 | |||
| 1693 | Ga0070717_10638574 | |||
| 1694 | Ga0075432_10123011 | |||
| 1695 | Ga0070715_10993176 | |||
| 1696 | Ga0070712_100939191 | |||
| 1697 | Ga0097621_100001713 | |||
| 1698 | Ga0097621_100044563 | |||
| 1699 | Ga0097621_100074616 | |||
| 1700 | Ga0097621_100098703 | |||
| 1701 | Ga0097621_100159274 | |||
| 1702 | Ga0097621_100257700 | |||
| 1703 | Ga0097621_100273876 | |||
| 1704 | Ga0097621_100360336 | |||
| 1705 | Ga0097621_101257981 | |||
| 1706 | Ga0068871_100004335 | |||
| 1707 | Ga0068871_100005439 | |||
| 1708 | Ga0068871_100035400 | |||
| 1709 | Ga0068871_100037842 | |||
| 1710 | Ga0068871_100119170 | |||
| 1711 | Ga0068871_100119280 | |||
| 1712 | Ga0068871_100135605 | |||
| 1713 | Ga0068871_100598174 | |||
| 1714 | Ga0068871_100778149 | |||
| 1715 | Ga0068871_100800608 | |||
| 1716 | Ga0068871_100941247 | |||
| 1717 | Ga0075428_100007745 | |||
| 1718 | Ga0075428_100017987 | |||
| 1719 | Ga0075428_100247730 | |||
| 1720 | Ga0075430_100005720 | |||
| 1721 | Ga0075430_100072688 | |||
| 1722 | Ga0075430_100228350 | |||
| 1723 | Ga0075430_100842287 | |||
| 1724 | Ga0075430_101137886 | |||
| 1725 | Ga0075431_100064718 | |||
| 1726 | Ga0075431_100152444 | |||
| 1727 | Ga0075431_101944344 | |||
| 1728 | Ga0075433_10447888 | |||
| 1729 | Ga0075433_10567027 | |||
| 1730 | Ga0075434_100128556 | |||
| 1731 | Ga0075434_100654962 | |||
| 1732 | Ga0075434_100722181 | |||
| 1733 | Ga0075434_101667684 | |||
| 1734 | Ga0075429_100045776 | |||
| 1735 | Ga0075429_100067494 | |||
| 1736 | Ga0075429_100085822 | |||
| 1737 | Ga0075429_100151178 | |||
| 1738 | Ga0068865_100031670 | |||
| 1739 | Ga0068865_100031693 | |||
| 1740 | Ga0068865_100098943 | |||
| 1741 | Ga0068865_100487359 | |||
| 1742 | Ga0068865_100956431 | |||
| 1743 | Ga0068865_101606170 | |||
| 1744 | Ga0075436_100290454 | |||
| 1745 | Ga0075436_100349979 | |||
| 1746 | Ga0075436_100367120 | |||
| 1747 | Ga0075436_100376584 | |||
| 1748 | Ga0075436_101125609 | |||
| 1749 | Ga0097620_100008801 | |||
| 1750 | Ga0097620_100012958 | |||
| 1751 | Ga0097620_100026501 | |||
| 1752 | Ga0097620_100059022 | |||
| 1753 | Ga0097620_100211504 | |||
| 1754 | Ga0097620_100494032 | |||
| 1755 | Ga0097620_100525853 | |||
| 1756 | Ga0097620_101087907 | |||
| 1757 | Ga0075435_100089398 | |||
| 1758 | Ga0075435_100127083 | |||
| 1759 | Ga0075435_100375399 | |||
| 1760 | Ga0105240_10003712 | |||
| 1761 | Ga0105240_10009712 | |||
| 1762 | Ga0105240_10009808 | |||
| 1763 | Ga0105240_10023985 | |||
| 1764 | Ga0105240_10034115 | |||
| 1765 | Ga0105240_10035184 | |||
| 1766 | Ga0105240_10041342 | |||
| 1767 | Ga0105240_10205588 | |||
| 1768 | Ga0105240_10219055 | |||
| 1769 | Ga0105240_10267218 | |||
| 1770 | Ga0105240_11047394 | |||
| 1771 | Ga0105240_11276118 | |||
| 1772 | Ga0105240_11679224 | |||
| 1773 | Ga0111539_10000958 | |||
| 1774 | Ga0111539_10003608 | |||
| 1775 | Ga0111539_10019744 | |||
| 1776 | Ga0111539_10027853 | |||
| 1777 | Ga0111539_10068616 | |||
| 1778 | Ga0111539_10249338 | |||
| 1779 | Ga0111539_10481335 | |||
| 1780 | Ga0111539_11371072 | |||
| 1781 | Ga0105245_10000754 | |||
| 1782 | Ga0105245_10002867 | |||
| 1783 | Ga0105245_10003919 | |||
| 1784 | Ga0105245_10005756 | |||
| 1785 | Ga0105245_10113908 | |||
| 1786 | Ga0105245_10129763 | |||
| 1787 | Ga0105245_10276027 | |||
| 1788 | Ga0105245_10279186 | |||
| 1789 | Ga0105245_10375500 | |||
| 1790 | Ga0105245_10502835 | |||
| 1791 | Ga0105245_10568068 | |||
| 1792 | Ga0105245_10768019 | |||
| 1793 | Ga0105245_11188548 | |||
| 1794 | Ga0105245_11201318 | |||
| 1795 | Ga0105245_11366157 | |||
| 1796 | Ga0105245_11902657 | |||
| 1797 | Ga0105245_11928547 | |||
| 1798 | Ga0105245_12533262 | |||
| 1799 | Ga0105247_10006758 | |||
| 1800 | Ga0105247_10085628 | |||
| 1801 | Ga0105247_10762319 | |||
| 1802 | Ga0114129_10033252 | |||
| 1803 | Ga0114129_10043256 | |||
| 1804 | Ga0114129_10089655 | |||
| 1805 | Ga0114129_10257597 | |||
| 1806 | Ga0114129_11155077 | |||
| 1807 | Ga0105243_10031200 | |||
| 1808 | Ga0105243_10098187 | |||
| 1809 | Ga0105243_10169464 | |||
| 1810 | Ga0105243_10198107 | |||
| 1811 | Ga0105243_10428371 | |||
| 1812 | Ga0105243_10594427 | |||
| 1813 | Ga0105243_10597125 | |||
| 1814 | Ga0105243_10777265 | |||
| 1815 | Ga0105243_10897446 | |||
| 1816 | Ga0105243_11263761 | |||
| 1817 | Ga0105241_10001981 | |||
| 1818 | Ga0105241_10011630 | |||
| 1819 | Ga0105241_10024030 | |||
| 1820 | Ga0105241_10027465 | |||
| 1821 | Ga0105241_10032106 | |||
| 1822 | Ga0105241_10041476 | |||
| 1823 | Ga0105241_10051576 | |||
| 1824 | Ga0105241_10200353 | |||
| 1825 | Ga0105241_10231934 | |||
| 1826 | Ga0105241_10363931 | |||
| 1827 | Ga0105241_10515037 | |||
| 1828 | Ga0105241_10552410 | |||
| 1829 | Ga0105241_11080366 | |||
| 1830 | Ga0105242_10007238 | |||
| 1831 | Ga0105242_10042795 | |||
| 1832 | Ga0105242_10077281 | |||
| 1833 | Ga0105242_10170661 | |||
| 1834 | Ga0105242_10301643 | |||
| 1835 | Ga0105242_10451686 | |||
| 1836 | Ga0105242_10466061 | |||
| 1837 | Ga0105242_10495189 | |||
| 1838 | Ga0105242_10560194 | |||
| 1839 | Ga0105242_10855356 | |||
| 1840 | Ga0105242_11095123 | |||
| 1841 | Ga0105242_11233312 | |||
| 1842 | Ga0105242_11583147 | |||
| 1843 | Ga0105248_10011826 | |||
| 1844 | Ga0105248_10013168 | |||
| 1845 | Ga0105248_10014349 | |||
| 1846 | Ga0105248_10018424 | |||
| 1847 | Ga0105248_10086468 | |||
| 1848 | Ga0105248_10299821 | |||
| 1849 | Ga0105248_10539373 | |||
| 1850 | Ga0105248_10623352 | |||
| 1851 | Ga0105248_10811860 | |||
| 1852 | Ga0105248_11139912 | |||
| 1853 | Ga0105248_11139966 | |||
| 1854 | Ga0105248_11317254 | |||
| 1855 | Ga0105237_10002229 | |||
| 1856 | Ga0105237_10007164 | |||
| 1857 | Ga0105237_10008691 | |||
| 1858 | Ga0105237_10022516 | |||
| 1859 | Ga0105237_10081337 | |||
| 1860 | Ga0105237_10097535 | |||
| 1861 | Ga0105237_10254467 | |||
| 1862 | Ga0105237_10517210 | |||
| 1863 | Ga0105237_10548644 | |||
| 1864 | Ga0105237_10924609 | |||
| 1865 | Ga0105237_12684996 | |||
| 1866 | Ga0105238_10000501 | |||
| 1867 | Ga0105238_10006331 | |||
| 1868 | Ga0105238_10006587 | |||
| 1869 | Ga0105238_10015716 | |||
| 1870 | Ga0105238_10020664 | |||
| 1871 | Ga0105238_10025280 | |||
| 1872 | Ga0105238_10027385 | |||
| 1873 | Ga0105238_10032749 | |||
| 1874 | Ga0105238_10034653 | |||
| 1875 | Ga0105238_10036307 | |||
| 1876 | Ga0105238_10050586 | |||
| 1877 | Ga0105238_10056869 | |||
| 1878 | Ga0105238_10131851 | |||
| 1879 | Ga0105238_10216919 | |||
| 1880 | Ga0105238_10388061 | |||
| 1881 | Ga0105238_10941832 | |||
| 1882 | Ga0105238_11140645 | |||
| 1883 | Ga0105249_10003722 | |||
| 1884 | Ga0105249_10056752 | |||
| 1885 | Ga0105249_10087873 | |||
| 1886 | Ga0105249_10516197 | |||
| 1887 | Ga0105249_10633142 | |||
| 1888 | Ga0105249_10752844 | |||
| 1889 | Ga0105249_11183634 | |||
| 1890 | Ga0105249_11556958 | |||
| 1891 | Ga0105249_12083674 | |||
| 1892 | Ga0105239_10006720 | |||
| 1893 | Ga0105239_10008026 | |||
| 1894 | Ga0105239_10014929 | |||
| 1895 | Ga0105239_10016121 | |||
| 1896 | Ga0105239_10018915 | |||
| 1897 | Ga0105239_10019532 | |||
| 1898 | Ga0105239_10074835 | |||
| 1899 | Ga0105239_10138119 | |||
| 1900 | Ga0105239_10140003 | |||
| 1901 | Ga0105239_10190256 | |||
| 1902 | Ga0105239_10212868 | |||
| 1903 | Ga0105239_10410491 | |||
| 1904 | Ga0105239_10445548 | |||
| 1905 | Ga0105239_10449699 | |||
| 1906 | Ga0105239_10484894 | |||
| 1907 | Ga0105239_11902886 | |||
| 1908 | Ga0105239_12719388 | |||
| 1909 | Ga0105246_10001430 | |||
| 1910 | Ga0105246_10002423 | |||
| 1911 | Ga0105246_10006397 | |||
| 1912 | Ga0105246_10023226 | |||
| 1913 | Ga0105246_10152689 | |||
| 1914 | Ga0105246_10265826 | |||
| 1915 | Ga0105246_10787935 | |||
| 1916 | Ga0105246_10938555 | |||
| 1917 | Ga0105246_11809137 | |||
| 1918 | Ga0157371_10105868 | |||
| 1919 | Ga0157371_10451920 | |||
| 1920 | Ga0157370_10000997 | |||
| 1921 | Ga0157370_10002206 | |||
| 1922 | Ga0157370_10006724 | |||
| 1923 | Ga0157370_10014006 | |||
| 1924 | Ga0157370_10016306 | |||
| 1925 | Ga0157370_10043153 | |||
| 1926 | Ga0157370_11043857 | |||
| 1927 | Ga0157369_10002687 | |||
| 1928 | Ga0157369_10005354 | |||
| 1929 | Ga0157369_10015762 | |||
| 1930 | Ga0157369_10025785 | |||
| 1931 | Ga0157369_10053765 | |||
| 1932 | Ga0157369_10080526 | |||
| 1933 | Ga0157369_10146031 | |||
| 1934 | Ga0157369_10177368 | |||
| 1935 | Ga0157369_10789969 | |||
| 1936 | Ga0157369_11219750 | |||
| 1937 | Ga0157369_11302290 | |||
| 1938 | Ga0157374_10015751 | |||
| 1939 | Ga0157374_10032701 | |||
| 1940 | Ga0157374_10114113 | |||
| 1941 | Ga0157374_10129332 | |||
| 1942 | Ga0157374_10160587 | |||
| 1943 | Ga0157374_10418116 | |||
| 1944 | Ga0157374_10525097 | |||
| 1945 | Ga0157374_10798042 | |||
| 1946 | Ga0157374_10891249 | |||
| 1947 | Ga0157374_10924086 | |||
| 1948 | Ga0157374_11024379 | |||
| 1949 | Ga0157378_10002798 | |||
| 1950 | Ga0157378_10004041 | |||
| 1951 | Ga0157378_10465355 | |||
| 1952 | Ga0157378_10866816 | |||
| 1953 | Ga0157378_11033114 | |||
| 1954 | Ga0157378_11617900 | |||
| 1955 | Ga0157378_12770649 | |||
| 1956 | Ga0157378_13277404 | |||
| 1957 | Ga0163162_10090963 | |||
| 1958 | Ga0163162_10353274 | |||
| 1959 | Ga0163162_10369517 | |||
| 1960 | Ga0163162_10727026 | |||
| 1961 | Ga0163162_11332136 | |||
| 1962 | Ga0163162_11416531 | |||
| 1963 | Ga0163162_12097785 | |||
| 1964 | Ga0163162_12975431 | |||
| 1965 | Ga0157372_10001007 | |||
| 1966 | Ga0157372_10007331 | |||
| 1967 | Ga0157372_10018708 | |||
| 1968 | Ga0157372_10043736 | |||
| 1969 | Ga0157372_10079946 | |||
| 1970 | Ga0157372_10116247 | |||
| 1971 | Ga0157372_10126745 | |||
| 1972 | Ga0157372_10228683 | |||
| 1973 | Ga0157372_10298647 | |||
| 1974 | Ga0157372_10428805 | |||
| 1975 | Ga0157372_10732126 | |||
| 1976 | Ga0157372_11386798 | |||
| 1977 | Ga0157375_10005619 | |||
| 1978 | Ga0157375_10006921 | |||
| 1979 | Ga0157375_10296682 | |||
| 1980 | Ga0157375_10344053 | |||
| 1981 | Ga0157375_10542131 | |||
| 1982 | Ga0157375_11055096 | |||
| 1983 | Ga0157375_11088474 | |||
| 1984 | Ga0157375_11508388 | |||
| 1985 | Ga0163163_10003209 | |||
| 1986 | Ga0163163_10007001 | |||
| 1987 | Ga0163163_10016291 | |||
| 1988 | Ga0163163_10041340 | |||
| 1989 | Ga0163163_10083126 | |||
| 1990 | Ga0163163_10161842 | |||
| 1991 | Ga0163163_10719115 | |||
| 1992 | Ga0163163_10795672 | |||
| 1993 | Ga0163163_11189163 | |||
| 1994 | Ga0163163_11212101 | |||
| 1995 | Ga0163163_11560441 | |||
| 1996 | Ga0163163_11654389 | |||
| 1997 | Ga0163163_12482759 | |||
| 1998 | Ga0157380_10234790 | |||
| 1999 | Ga0157380_10321361 | |||
| 2000 | Ga0157380_10491402 | |||
| 2001 | Ga0157377_10112470 | |||
| 2002 | Ga0157377_11650735 | |||
| 2003 | Ga0157379_10002290 | |||
| 2004 | Ga0157379_10007941 | |||
| 2005 | Ga0157379_10172978 | |||
| 2006 | Ga0157379_10301958 | |||
| 2007 | Ga0157379_10589147 | |||
| 2008 | Ga0157379_11648638 | |||
| 2009 | Ga0157376_10001111 | |||
| 2010 | Ga0157376_10053435 | |||
| 2011 | Ga0157376_10086011 | |||
| 2012 | Ga0157376_10155812 | |||
| 2013 | Ga0157376_10177946 | |||
| 2014 | Ga0157376_10302621 | |||
| 2015 | Ga0157376_10532277 | |||
| 2016 | Ga0197907_10345105 | |||
| 2017 | Ga0197907_11169527 | |||
| 2018 | Ga0197907_11388186 | |||
| 2019 | Ga0197907_11513640 | |||
| 2020 | Ga0206356_10260711 | |||
| 2021 | Ga0206356_10950623 | |||
| 2022 | Ga0206356_11094542 | |||
| 2023 | Ga0206356_11795575 | |||
| 2024 | Ga0206349_1966464 | |||
| 2025 | Ga0206355_1240202 | |||
| 2026 | Ga0206355_1373007 | |||
| 2027 | Ga0206351_10018568 | |||
| 2028 | Ga0206352_10265365 | |||
| 2029 | Ga0206352_10467909 | |||
| 2030 | Ga0206352_10647886 | |||
| 2031 | Ga0206352_10969492 | |||
| 2032 | Ga0206350_10410420 | |||
| 2033 | Ga0206350_10936759 | |||
| 2034 | Ga0206350_11445424 | |||
| 2035 | Ga0206353_10638504 | |||
| 2036 | Ga0206353_10965158 | |||
| 2037 | Ga0154015_1088118 | |||
| 2038 | Ga0154015_1316610 | |||
| 2039 | Ga0154015_1543362 | |||
| 2040 | Ga0213876_10042224 | |||
| 2041 | Ga0213875_10120989 | |||
| 2042 | Ga0213875_10196336 | |||
| 2043 | Ga0213875_10333362 | |||
| 2044 | Ga0213875_10372449 | |||
| 2045 | Ga0224712_10002814 | |||
| 2046 | Ga0224712_10075851 | |||
| 2047 | Ga0224712_10538292 | |||
| 2048 | Ga0207653_10129309 | |||
| 2049 | Ga0207692_10239797 | |||
| 2050 | Ga0207692_10257194 | |||
| 2051 | Ga0207642_10299173 | |||
| 2052 | Ga0207642_10524103 | |||
| 2053 | Ga0207710_10008409 | |||
| 2054 | Ga0207710_10039475 | |||
| 2055 | Ga0207710_10077349 | |||
| 2056 | Ga0207688_10059826 | |||
| 2057 | Ga0207680_10013380 | |||
| 2058 | Ga0207680_10272733 | |||
| 2059 | Ga0207685_10285361 | |||
| 2060 | Ga0207685_10789037 | |||
| 2061 | Ga0207699_10010851 | |||
| 2062 | Ga0207699_10040041 | |||
| 2063 | Ga0207699_10051436 | |||
| 2064 | Ga0207699_10439831 | |||
| 2065 | Ga0207699_11326260 | |||
| 2066 | Ga0207645_10045868 | |||
| 2067 | Ga0207645_10188582 | |||
| 2068 | Ga0207705_10111014 | |||
| 2069 | Ga0207705_10330822 | |||
| 2070 | Ga0207654_10016430 | |||
| 2071 | Ga0207654_10028865 | |||
| 2072 | Ga0207654_10036838 | |||
| 2073 | Ga0207654_10045743 | |||
| 2074 | Ga0207654_10097603 | |||
| 2075 | Ga0207654_10101058 | |||
| 2076 | Ga0207654_10113388 | |||
| 2077 | Ga0207654_10261512 | |||
| 2078 | Ga0207654_10378544 | |||
| 2079 | Ga0207654_11300093 | |||
| 2080 | Ga0207707_10000239 | |||
| 2081 | Ga0207707_10005887 | |||
| 2082 | Ga0207707_10017387 | |||
| 2083 | Ga0207707_10044979 | |||
| 2084 | Ga0207707_10277788 | |||
| 2085 | Ga0207707_11191863 | |||
| 2086 | Ga0207695_10000688 | |||
| 2087 | Ga0207695_10005342 | |||
| 2088 | Ga0207695_10011291 | |||
| 2089 | Ga0207695_10023442 | |||
| 2090 | Ga0207695_10040357 | |||
| 2091 | Ga0207695_10106740 | |||
| 2092 | Ga0207695_10132059 | |||
| 2093 | Ga0207695_10249922 | |||
| 2094 | Ga0207695_11045500 | |||
| 2095 | Ga0207671_10007282 | |||
| 2096 | Ga0207671_10009145 | |||
| 2097 | Ga0207671_10015198 | |||
| 2098 | Ga0207671_10045192 | |||
| 2099 | Ga0207671_10238237 | |||
| 2100 | Ga0207671_10724871 | |||
| 2101 | Ga0207663_10135976 | |||
| 2102 | Ga0207663_10221892 | |||
| 2103 | Ga0207663_10768809 | |||
| 2104 | Ga0207663_11205911 | |||
| 2105 | Ga0207663_11497263 | |||
| 2106 | Ga0207660_10014708 | |||
| 2107 | Ga0207660_10027061 | |||
| 2108 | Ga0207660_10205912 | |||
| 2109 | Ga0207660_10421633 | |||
| 2110 | Ga0207660_10496146 | |||
| 2111 | Ga0207660_10578862 | |||
| 2112 | Ga0207662_10194867 | |||
| 2113 | Ga0207662_10596903 | |||
| 2114 | Ga0207657_10049976 | |||
| 2115 | Ga0207657_10094357 | |||
| 2116 | Ga0207657_10151274 | |||
| 2117 | Ga0207657_10499321 | |||
| 2118 | Ga0207649_10346133 | |||
| 2119 | Ga0207649_10467036 | |||
| 2120 | Ga0207649_10474559 | |||
| 2121 | Ga0207649_10545018 | |||
| 2122 | Ga0207649_10573183 | |||
| 2123 | Ga0207649_10684279 | |||
| 2124 | Ga0207652_10000872 | |||
| 2125 | Ga0207652_10012468 | |||
| 2126 | Ga0207652_10168082 | |||
| 2127 | Ga0207652_10365969 | |||
| 2128 | Ga0207681_10424427 | |||
| 2129 | Ga0207681_11407598 | |||
| 2130 | Ga0207694_10003106 | |||
| 2131 | Ga0207694_10003534 | |||
| 2132 | Ga0207694_10005943 | |||
| 2133 | Ga0207694_10008251 | |||
| 2134 | Ga0207694_10012985 | |||
| 2135 | Ga0207694_10026656 | |||
| 2136 | Ga0207694_10040522 | |||
| 2137 | Ga0207694_10044764 | |||
| 2138 | Ga0207694_10060786 | |||
| 2139 | Ga0207694_10079545 | |||
| 2140 | Ga0207694_10104193 | |||
| 2141 | Ga0207694_10222267 | |||
| 2142 | Ga0207694_10360924 | |||
| 2143 | Ga0207694_10380640 | |||
| 2144 | Ga0207694_10845343 | |||
| 2145 | Ga0207694_10856305 | |||
| 2146 | Ga0207650_10263270 | |||
| 2147 | Ga0207650_10265981 | |||
| 2148 | Ga0207650_10486603 | |||
| 2149 | Ga0207659_10041379 | |||
| 2150 | Ga0207659_10079002 | |||
| 2151 | Ga0207659_10431108 | |||
| 2152 | Ga0207687_10000339 | |||
| 2153 | Ga0207687_10000965 | |||
| 2154 | Ga0207687_10001193 | |||
| 2155 | Ga0207687_10001331 | |||
| 2156 | Ga0207687_10006593 | |||
| 2157 | Ga0207687_10150546 | |||
| 2158 | Ga0207687_10194132 | |||
| 2159 | Ga0207687_10229603 | |||
| 2160 | Ga0207687_10303138 | |||
| 2161 | Ga0207687_10343124 | |||
| 2162 | Ga0207687_10470260 | |||
| 2163 | Ga0207687_10487811 | |||
| 2164 | Ga0207687_10997971 | |||
| 2165 | Ga0207700_10023058 | |||
| 2166 | Ga0207700_10051165 | |||
| 2167 | Ga0207700_10119581 | |||
| 2168 | Ga0207700_10150242 | |||
| 2169 | Ga0207700_10176176 | |||
| 2170 | Ga0207700_10782845 | |||
| 2171 | Ga0207700_10885628 | |||
| 2172 | Ga0207700_11200041 | |||
| 2173 | Ga0207664_10081362 | |||
| 2174 | Ga0207644_10121378 | |||
| 2175 | Ga0207690_10203052 | |||
| 2176 | Ga0207690_10999151 | |||
| 2177 | Ga0207706_10051290 | |||
| 2178 | Ga0207706_10207083 | |||
| 2179 | Ga0207706_10258272 | |||
| 2180 | Ga0207706_10502552 | |||
| 2181 | Ga0207706_10515764 | |||
| 2182 | Ga0207686_10009052 | |||
| 2183 | Ga0207686_10017571 | |||
| 2184 | Ga0207686_10049240 | |||
| 2185 | Ga0207686_10107567 | |||
| 2186 | Ga0207686_10428083 | |||
| 2187 | Ga0207686_10491542 | |||
| 2188 | Ga0207686_10607029 | |||
| 2189 | Ga0207686_11131628 | |||
| 2190 | Ga0207686_11290022 | |||
| 2191 | Ga0207686_11660720 | |||
| 2192 | Ga0207709_10043392 | |||
| 2193 | Ga0207709_10057515 | |||
| 2194 | Ga0207709_10126861 | |||
| 2195 | Ga0207709_10508940 | |||
| 2196 | Ga0207670_10071092 | |||
| 2197 | Ga0207670_10127861 | |||
| 2198 | Ga0207670_10261722 | |||
| 2199 | Ga0207670_10380015 | |||
| 2200 | Ga0207670_11787615 | |||
| 2201 | Ga0207669_10052709 | |||
| 2202 | Ga0207669_10584870 | |||
| 2203 | Ga0207669_11303487 | |||
| 2204 | Ga0207669_11590500 | |||
| 2205 | Ga0207704_10006166 | |||
| 2206 | Ga0207704_10172484 | |||
| 2207 | Ga0207704_10609215 | |||
| 2208 | Ga0207704_10707724 | |||
| 2209 | Ga0207704_10708902 | |||
| 2210 | Ga0207665_11510228 | |||
| 2211 | Ga0207691_10161552 | |||
| 2212 | Ga0207691_10559953 | |||
| 2213 | Ga0207711_10003057 | |||
| 2214 | Ga0207711_10009081 | |||
| 2215 | Ga0207711_10009217 | |||
| 2216 | Ga0207711_10025923 | |||
| 2217 | Ga0207711_10106048 | |||
| 2218 | Ga0207711_10168821 | |||
| 2219 | Ga0207711_10295208 | |||
| 2220 | Ga0207711_10388113 | |||
| 2221 | Ga0207711_11936479 | |||
| 2222 | Ga0207689_10044198 | |||
| 2223 | Ga0207689_10101050 | |||
| 2224 | Ga0207689_10141989 | |||
| 2225 | Ga0207689_10188640 | |||
| 2226 | Ga0207689_10208270 | |||
| 2227 | Ga0207689_10247856 | |||
| 2228 | Ga0207689_10324615 | |||
| 2229 | Ga0207689_11140102 | |||
| 2230 | Ga0207661_10006879 | |||
| 2231 | Ga0207661_10014859 | |||
| 2232 | Ga0207661_10017326 | |||
| 2233 | Ga0207661_10018049 | |||
| 2234 | Ga0207661_10023596 | |||
| 2235 | Ga0207661_10040570 | |||
| 2236 | Ga0207661_10084621 | |||
| 2237 | Ga0207661_10111463 | |||
| 2238 | Ga0207661_10167483 | |||
| 2239 | Ga0207661_10268692 | |||
| 2240 | Ga0207661_10323547 | |||
| 2241 | Ga0207661_10693614 | |||
| 2242 | Ga0207661_10832789 | |||
| 2243 | Ga0207679_10012055 | |||
| 2244 | Ga0207679_10192303 | |||
| 2245 | Ga0207679_10343407 | |||
| 2246 | Ga0207679_10604995 | |||
| 2247 | Ga0207679_11078694 | |||
| 2248 | Ga0207667_10001263 | |||
| 2249 | Ga0207667_10002815 | |||
| 2250 | Ga0207667_10005334 | |||
| 2251 | Ga0207667_10007297 | |||
| 2252 | Ga0207667_10088424 | |||
| 2253 | Ga0207667_10165941 | |||
| 2254 | Ga0207667_10268213 | |||
| 2255 | Ga0207667_10281715 | |||
| 2256 | Ga0207667_10686012 | |||
| 2257 | Ga0207667_11222369 | |||
| 2258 | Ga0207651_10009187 | |||
| 2259 | Ga0207651_10136303 | |||
| 2260 | Ga0207651_10149867 | |||
| 2261 | Ga0207651_10181780 | |||
| 2262 | Ga0207651_10519810 | |||
| 2263 | Ga0207651_10552892 | |||
| 2264 | Ga0207651_11317669 | |||
| 2265 | Ga0207712_10003128 | |||
| 2266 | Ga0207712_10062799 | |||
| 2267 | Ga0207712_10430534 | |||
| 2268 | Ga0207712_10953371 | |||
| 2269 | Ga0207712_11313131 | |||
| 2270 | Ga0207640_10074983 | |||
| 2271 | Ga0207640_10362052 | |||
| 2272 | Ga0207640_11272339 | |||
| 2273 | Ga0207658_10116648 | |||
| 2274 | Ga0207658_10299571 | |||
| 2275 | Ga0207658_10529431 | |||
| 2276 | Ga0207677_10212446 | |||
| 2277 | Ga0207677_10348024 | |||
| 2278 | Ga0207677_11595559 | |||
| 2279 | Ga0207703_10023347 | |||
| 2280 | Ga0207703_10107236 | |||
| 2281 | Ga0207703_10141720 | |||
| 2282 | Ga0207703_10142120 | |||
| 2283 | Ga0207703_10271524 | |||
| 2284 | Ga0207703_10514303 | |||
| 2285 | Ga0207703_10524284 | |||
| 2286 | Ga0207703_10972720 | |||
| 2287 | Ga0207639_10013820 | |||
| 2288 | Ga0207639_10046941 | |||
| 2289 | Ga0207639_10126997 | |||
| 2290 | Ga0207639_10152759 | |||
| 2291 | Ga0207639_10181498 | |||
| 2292 | Ga0207639_10369719 | |||
| 2293 | Ga0207639_10465400 | |||
| 2294 | Ga0207639_10820883 | |||
| 2295 | Ga0207639_11397884 | |||
| 2296 | Ga0207708_10021309 | |||
| 2297 | Ga0207708_10037499 | |||
| 2298 | Ga0207708_10188531 | |||
| 2299 | Ga0207708_10255058 | |||
| 2300 | Ga0207708_10352205 | |||
| 2301 | Ga0207708_10387930 | |||
| 2302 | Ga0207708_10458182 | |||
| 2303 | Ga0207708_11677962 | |||
| 2304 | Ga0207702_10004066 | |||
| 2305 | Ga0207702_10005778 | |||
| 2306 | Ga0207702_10015083 | |||
| 2307 | Ga0207702_10045055 | |||
| 2308 | Ga0207702_10045696 | |||
| 2309 | Ga0207702_10068818 | |||
| 2310 | Ga0207702_10075030 | |||
| 2311 | Ga0207702_10102176 | |||
| 2312 | Ga0207702_10178422 | |||
| 2313 | Ga0207702_10324567 | |||
| 2314 | Ga0207702_10697891 | |||
| 2315 | Ga0207702_11634441 | |||
| 2316 | Ga0207641_10348450 | |||
| 2317 | Ga0207641_10531534 | |||
| 2318 | Ga0207641_10550241 | |||
| 2319 | Ga0207641_10638522 | |||
| 2320 | Ga0207648_10074848 | |||
| 2321 | Ga0207648_10128417 | |||
| 2322 | Ga0207648_10366375 | |||
| 2323 | Ga0207648_10859981 | |||
| 2324 | Ga0207648_10976101 | |||
| 2325 | Ga0207648_11979044 | |||
| 2326 | Ga0207676_10035645 | |||
| 2327 | Ga0207676_10055179 | |||
| 2328 | Ga0207676_10808843 | |||
| 2329 | Ga0207676_11832673 | |||
| 2330 | Ga0207674_10000035 | |||
| 2331 | Ga0207674_10000101 | |||
| 2332 | Ga0207674_10000187 | |||
| 2333 | Ga0207674_10001119 | |||
| 2334 | Ga0207674_10001346 | |||
| 2335 | Ga0207674_10009238 | |||
| 2336 | Ga0207674_11172262 | |||
| 2337 | Ga0207674_12217091 | |||
| 2338 | Ga0207675_100002274 | |||
| 2339 | Ga0207675_100003771 | |||
| 2340 | Ga0207675_100003855 | |||
| 2341 | Ga0207675_100220347 | |||
| 2342 | Ga0207675_100232559 | |||
| 2343 | Ga0207675_100899962 | |||
| 2344 | Ga0207683_10336593 | |||
| 2345 | Ga0207698_10030025 | |||
| 2346 | Ga0207698_10058127 | |||
| 2347 | Ga0207698_10461732 | |||
| 2348 | Ga0207698_10759933 | |||
| 2349 | Ga0207698_11281958 | |||
| 2350 | Ga0207698_11358409 | |||
| 2351 | Ga0207698_11665798 | |||
| 2352 | Ga0207698_11676101 | |||
| 2353 | Ga0209983_1040851 | |||
| 2354 | Ga0209974_10342199 | |||
| 2355 | Ga0207428_10023817 | |||
| 2356 | Ga0207428_10034926 | |||
| 2357 | Ga0207428_10047517 | |||
| 2358 | Ga0207428_10060800 | |||
| 2359 | Ga0207428_10157922 | |||
| 2360 | Ga0207428_10258530 | |||
| 2361 | Ga0207428_10339716 | |||
| 2362 | Ga0268266_10138074 | |||
| 2363 | Ga0268265_10032524 | |||
| 2364 | Ga0268265_10079514 | |||
| 2365 | Ga0268265_11548456 | |||
| 2366 | Ga0268264_10078776 | |||
| 2367 | Ga0268264_10134491 | |||
| 2368 | Ga0268264_10216239 | |||
| 2369 | Ga0268264_10634138 | |||
| 2370 | Ga0268264_10836333 | |||
| 2371 | Ga0268264_11060286 | |||
| 2372 | Ga0268264_11447146 | |||
| 2373 | Ga0268264_11618224 | |||
| 2374 | Ga0268264_12135007 | |||
| 2375 | Ga0265338_10265855 | |||
| 2376 | Ga0265338_10783562 | |||
| 2377 | Ga0316178_1065459 | |||
| 2378 | Ga0265766_1012762 | |||
| 2379 | Ga0265761_107455 | |||
| 2380 | Ga0265760_10108614 | |||
| 2381 | Ga0265760_10298254 | |||
| 2382 | Ga0265340_10060438 | |||
| 2383 | Ga0265313_10003726 | |||
| 2384 | Ga0265313_10037651 | |||
| 2385 | Ga0265314_10000216 | |||
| 2386 | Ga0265314_10215465 | |||
| 2387 | Ga0307405_12090089 | |||
| 2388 | Ga0307413_10552266 | |||
| 2389 | Ga0307413_11115968 | |||
| 2390 | Ga0307410_11025746 | |||
| 2391 | Ga0307406_10792529 | |||
| 2392 | Ga0307416_100940942 | |||
| 2393 | Ga0307416_102527223 | |||
| 2394 | Ga0307411_10084496 | |||
| 2395 | Ga0373934_0008713 | |||
| 2396 | Ga0373934_0011047 | |||
| 2397 | Ga0373934_0025370 | |||
| 2398 | Ga0373934_0192680 | |||
| 2399 | Ga0373934_0477963 | |||
| 2400 | Ga0373949_0310785 | |||
| 2401 | Ga0373952_0190577 | |||
| 2402 | Ga0373923_0001630 | |||
| 2403 | Ga0373923_0032759 | |||
| 2404 | Ga0373923_0276864 | |||
| 2405 | Ga0373923_0633190 | |||
| 2406 | Ga0373923_0651865 | |||
| 2407 | Ga0373932_0215559 | |||
| 2408 | Ga0373936_0085361 | |||
| 2409 | Ga0373936_0151066 | |||
| 2410 | Ga0373945_0436833 | |||
| 2411 | Ga0373953_0016546 | |||
| 2412 | Ga0373953_0323307 | |||
| 2413 | Ga0373954_0009618 | |||
| 2414 | Ga0373954_0025706 | |||
| 2415 | Ga0373954_0031641 | |||
| 2416 | Ga0373954_0051598 | |||
| 2417 | Ga0373954_0057398 | |||
| 2418 | Ga0373954_0094897 | |||
| 2419 | Ga0373954_0219683 | |||
| 2420 | Ga0373954_0579479 | |||
| 2421 | Ga0373956_0051017 | |||
| 2422 | Ga0373956_0092851 | |||
| 2423 | Ga0373957_0011268 | |||
| 2424 | Ga0373957_0084898 | |||
| 2425 | Ga0373957_0086224 | |||
| 2426 | Ga0373957_0210694 | |||
| 2427 | Ga0373957_0273425 | |||
| 2428 | Ga0373943_0309150 | |||
| 2429 | Ga0373943_0701557 | |||
| 2430 | Ga0373946_0424304 | |||
| 2431 | Ga0373955_0011914 | |||
| 2432 | Ga0373955_0020013 | |||
| 2433 | Ga0373955_0069483 | |||
| 2434 | Ga0373955_0129042 | |||
| 2435 | Ga0373955_0255000 | |||
| 2436 | Ga0373955_0620131 | |||
| 2437 | Ga0373955_0629694 | |||
| 2438 | Ga0373962_0103317 | |||
| 2439 | Ga0373924_0056918 | |||
| 2440 | Ga0373924_0151665 | |||
| 2441 | Ga0373931_0163170 | |||
| 2442 | Ga0373935_0221628 | |||
| 2443 | Ga0373935_1061923 | |||
| 2444 | Ga0373935_1172377 | |||
| 2445 | Ga0373927_0031610 | |||
| 2446 | Ga0373927_0033707 | |||
| 2447 | Ga0373927_0093199 | |||
| 2448 | Ga0373933_0006501 | |||
| 2449 | Ga0373933_0011568 | |||
| 2450 | Ga0373933_0078309 | |||
| 2451 | Ga0373933_0110163 | |||
| 2452 | Ga0373933_0156543 | |||
| 2453 | Ga0373933_0223485 | |||
| 2454 | Ga0373947_0179077 | |||
| 2455 | Ga0373947_0195393 | |||
| 2456 | Ga0373937_0007916 | |||
| 2457 | Ga0373937_0016065 | |||
| 2458 | Ga0373937_0033347 | |||
| 2459 | Ga0373937_0051686 | |||
| 2460 | Ga0373937_0071823 | |||
| 2461 | Ga0373937_0102790 | |||
| 2462 | Ga0373937_0152835 | |||
| 2463 | Ga0373937_0159609 | |||
| 2464 | Ga0373937_0184876 | |||
| 2465 | Ga0373937_0289994 | |||
| 2466 | Ga0373937_0318383 | |||
| 2467 | Ga0373937_0554995 | |||
| 2468 | Ga0373937_0603185 | |||
| 2469 | Ga0373937_1328886 | |||
| 2470 | Ga0373937_1729560 | |||
| 2471 | Ga0265778_025300 | |||
| 2472 | Ga0373925_0022844 | |||
| 2473 | Ga0373925_0030612 | |||
| 2474 | Ga0373925_0069136 | |||
| 2475 | Ga0373925_0075906 | |||
| 2476 | Ga0373925_0171978 | |||
| 2477 | Ga0373925_0418951 | |||
| 2478 | Ga0373925_0741198 | |||
| 2479 | Ga0373925_1569217 | |||
| 2480 | Ga0436364_0322271 | |||
| 2481 | Ga0436364_0408987 | |||
| 2482 | Ga0436364_0502698 | |||
| 2483 | Ga0436364_1160244 | |||
| 2484 | Ga0436364_1532637 | |||
| 2485 | Ga0436365_0148535 | |||
| 2486 | Ga0436363_0251377 | |||
| 2487 | Ga0436363_0583931 | |||
| 2488 | Ga0436362_0326765 | |||
| 2489 | Ga0436362_0653106 | |||
| 2490 | Ga0439439_0227515 | |||
| 2491 | Ga0439453_0002949 | |||
| 2492 | Ga0439448_0055837 | |||
| 2493 | Ga0450910_102440 | |||
| 2494 | Ga0439435_0001943 | |||
| 2495 | Ga0450916_058727 | |||
| 2496 | Ga0495592_0133697 | |||
| 2497 | Ga0495592_0289042 | |||
| 2498 | Ga0495651_0024889 | |||
| 2499 | Ga0495580_0008386 | |||
| 2500 | Ga0495580_0012657 | |||
| 2501 | Ga0495580_0018987 | |||
| 2502 | Ga0495580_0032844 | |||
| 2503 | Ga0495580_0072887 | |||
| 2504 | Ga0495580_0176328 | |||
| 2505 | Ga0495580_0217229 | |||
| 2506 | Ga0495580_0646951 | |||
| 2507 | Ga0495580_0798583 | |||
| 2508 | Ga0495582_0188291 | |||
| 2509 | Ga0495639_0248034 | |||
| 2510 | Ga0495639_0359164 | |||
| 2511 | Ga0495639_0759167 | |||
| 2512 | Ga0495664_0515565 | |||
| 2513 | Ga0495664_0578955 | |||
| 2514 | Ga0495584_0035393 | |||
| 2515 | Ga0495594_0128079 | |||
| 2516 | Ga0495608_0062113 | |||
| 2517 | Ga0495608_0067259 | |||
| 2518 | Ga0495618_0535614 | |||
| 2519 | Ga0495618_0595623 | |||
| 2520 | Ga0495628_0426329 | |||
| 2521 | Ga0495630_0617809 | |||
| 2522 | Ga0495663_0020425 | |||
| 2523 | Ga0495663_0150397 | |||
| 2524 | Ga0495642_0027494 | |||
| 2525 | Ga0495642_0226901 | |||
| 2526 | Ga0495652_0069906 | |||
| 2527 | Ga0495652_0183777 | |||
| 2528 | Ga0495652_0506020 | |||
| 2529 | Ga0495652_0683770 | |||
| 2530 | Ga0495652_0957639 | |||
| 2531 | Ga0495652_1095066 | |||
| 2532 | Ga0495586_0040857 | |||
| 2533 | Ga0495586_0076146 | |||
| 2534 | Ga0495586_0108233 | |||
| 2535 | Ga0495587_0001148 | |||
| 2536 | Ga0495587_0011486 | |||
| 2537 | Ga0495587_0013274 | |||
| 2538 | Ga0495587_0141376 | |||
| 2539 | Ga0495587_0222737 | |||
| 2540 | Ga0495598_0027162 | |||
| 2541 | Ga0495609_0015778 | |||
| 2542 | Ga0495621_0372411 | |||
| 2543 | Ga0495645_0159263 | |||
| 2544 | Ga0495645_0216685 | |||
| 2545 | Ga0495645_0518724 | |||
| 2546 | Ga0495667_0058295 | |||
| 2547 | Ga0495667_0124185 | |||
| 2548 | Ga0495667_0610827 | |||
| 2549 | Ga0495656_0011957 | |||
| 2550 | Ga0495635_0488039 | |||
| 2551 | Ga0495635_0590106 | |||
| 2552 | Ga0495659_0075681 | |||
| 2553 | Ga0495659_0116345 | |||
| 2554 | Ga0495657_0545635 | |||
| 2555 | Ga0495657_0893905 | |||
| 2556 | Ga0495599_0002747 | |||
| 2557 | Ga0495599_0005840 | |||
| 2558 | Ga0495599_0089696 | |||
| 2559 | Ga0495599_0123211 | |||
| 2560 | Ga0495599_0402358 | |||
| 2561 | Ga0495599_0479268 | |||
| 2562 | Ga0495599_0654289 | |||
| 2563 | Ga0495623_0055150 | |||
| 2564 | Ga0495647_0070439 | |||
| 2565 | Ga0495669_0170874 | |||
| 2566 | Ga0495613_0032157 | |||
| 2567 | Ga0495613_0033856 | |||
| 2568 | Ga0495613_0402817 | |||
| 2569 | Ga0495600_0096251 | |||
| 2570 | Ga0495600_0113205 | |||
| 2571 | Ga0495581_0134208 | |||
| 2572 | Ga0495604_0425390 | |||
| 2573 | Ga0495636_0017244 | |||
| 2574 | Ga0495636_0114688 | |||
| 2575 | Ga0495636_0468121 | |||
| 2576 | Ga0495674_0073136 | |||
| 2577 | Ga0495674_0162803 | |||
| 2578 | Ga0495680_0531040 | |||
| 2579 | Ga0495680_0583449 | |||
| 2580 | Ga0495675_0054515 | |||
| 2581 | Ga0495675_0280381 | |||
| 2582 | Ga0495675_0554746 | |||
| 2583 | Ga0495677_0025708 | |||
| 2584 | Ga0495677_0327133 | |||
| 2585 | Ga0495684_0005160 | |||
| 2586 | Ga0495684_0008399 | |||
| 2587 | Ga0495684_0491259 | |||
| 2588 | Ga0495602_0004288 | |||
| 2589 | Ga0495602_0027992 | |||
| 2590 | Ga0495602_1028660 | |||
| 2591 | Ga0496101_1223163 | |||
| 2592 | Ga0496104_0114079 | |||
| 2593 | Ga0496104_0159263 | |||
| 2594 | Ga0496105_0339015 | |||
| 2595 | Ga0496107_1227927 | |||
| 2596 | Ga0496108_0280509 | |||
| 2597 | Ga0496109_0310786 | |||
| 2598 | Ga0496109_1183307 | |||
| 2599 | Ga0496112_0068296 | |||
| 2600 | Ga0496112_1233309 | |||
| 2601 | Ga0496113_0089071 | |||
| 2602 | Ga0496114_0000515 | |||
| 2603 | Ga0496115_0203300 | |||
| 2604 | Ga0496115_0631447 | |||
| 2605 | Ga0501031_1004704 | |||
| 2606 | Ga0501036_0827086 | |||
| 2607 | Ga0501036_1210707 | |||
| 2608 | Ga0501039_0543551 | |||
| 2609 | Ga0501040_0615093 | |||
| 2610 | Ga0501041_0089304 | |||
| 2611 | Ga0501042_0314539 | |||
| 2612 | Ga0501042_1088986 | |||
| 2613 | Ga0501043_0864408 | |||
| 2614 | Ga0501048_0457116 | |||
| 2615 | Ga0501048_0614575 | |||
| 2616 | Ga0501048_1058334 | |||
| 2617 | Ga0501068_0600910 | |||
| 2618 | Ga0501071_0071166 | |||
| 2619 | Ga0501071_0081775 | |||
| 2620 | Ga0501071_0907566 | |||
| 2621 | Ga0501071_1081316 | |||
| 2622 | Ga0501072_0032837 | |||
| 2623 | Ga0501072_0103475 | |||
| 2624 | Ga0501074_0355926 | |||
| 2625 | Ga0501075_0072953 | |||
| 2626 | Ga0501075_0400545 | |||
| 2627 | Ga0501075_0818820 | |||
| 2628 | Ga0501076_0525307 | |||
| 2629 | Ga0501076_0734288 | |||
| 2630 | Ga0501076_0950862 | |||
| 2631 | Ga0501079_0659506 | |||
| 2632 | Ga0501081_1051522 | |||
| 2633 | nmdc:mga05p37_1255215_c1 | |||
| 2634 | nmdc:mga05p37_1267785_c1 | |||
| 2635 | nmdc:mga05p37_41774_c1 | |||
| 2636 | nmdc:mga05p37_9001_c1 | |||
| 2637 | nmdc:mga09592_20174_c1 | |||
| 2638 | nmdc:mga09592_563462_c1 | |||
| 2639 | nmdc:mga09592_6242_c1 | |||
| 2640 | nmdc:mga09592_6838_c1 | |||
| 2641 | nmdc:mga0qj67_14222_c1 | |||
| 2642 | nmdc:mga0qj67_18992_c1 | |||
| 2643 | nmdc:mga0qj67_243841_c1 | |||
| 2644 | nmdc:mga0qj67_320250_c1 | |||
| 2645 | nmdc:mga0qj67_74584_c1 | |||
| 2646 | nmdc:mga06r32_47913_c1 | |||
| 2647 | nmdc:mga08y16_146855_c1 | |||
| 2648 | nmdc:mga08y16_159457_c1 | |||
| 2649 | nmdc:mga08y16_21290_c1 | |||
| 2650 | nmdc:mga08y16_28325_c1 | |||
| 2651 | nmdc:mga08y16_38725_c1 | |||
| 2652 | nmdc:mga08y16_534348_c1 | |||
| 2653 | nmdc:mga08y16_715_c1 | |||
| 2654 | nmdc:mga0n895_131017_c1 | |||
| 2655 | nmdc:mga0n895_1467169_c1 | |||
| 2656 | nmdc:mga0n895_370138_c1 | |||
| 2657 | nmdc:mga0n895_584126_c1 | |||
| 2658 | nmdc:mga0rr50_1182568_c1 | |||
| 2659 | nmdc:mga0rr50_130167_c1 | |||
| 2660 | nmdc:mga0rr50_277036_c1 | |||
| 2661 | nmdc:mga0rr50_613594_c1 | |||
| 2662 | nmdc:mga08x19_325325_c1 | |||
| 2663 | nmdc:mga08x19_432811_c1 | |||
| 2664 | nmdc:mga08x19_650892_c1 | |||
| 2665 | nmdc:mga08x19_720487_c1 | |||
| 2666 | nmdc:mga0a205_129296_c2 | |||
| 2667 | nmdc:mga0a205_177397_c1 | |||
| 2668 | Ga0495601_0163507 | |||
| 2669 | Ga0495601_0392563 | |||
| 2670 | Ga0495595_0443513 | |||
| 2671 | Ga0495619_0132605 | |||
| 2672 | Ga0495619_0569993 | |||
| 2673 | Ga0495619_0822349 | |||
| 2674 | Ga0500641_0147194 | |||
| 2675 | Ga0500568_0000723 | |||
| 2676 | Ga0590074_068829 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8056 | 38 | 96 |
| 5g3q-assembly2.cif.gz_B | crystal structure of a hypothetical domain in wnk1 | 0.8008 | 35 | 72 |
| 8d0k-assembly1.cif.gz_F | human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic | 0.7916 | 38 | 72 |
| 1sru-assembly1.cif.gz_C | crystal structure of full length e. coli ssb protein | 0.7894 | 35 | 101 |
| 2jjd-assembly4.cif.gz_D | protein tyrosine phosphatase, receptor type, e isoform | 0.7765 | 43 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B2RYE5_272_368_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8975 | 43 | 72 | 2.30.29.30 |
| af_Q9VKY7_200_296_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8726 | 43 | 70 | 2.30.29.30 |
| 2awoD03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8489 | 37 | 96 | 2.40.50.140 |
| af_Q9TZG4_240_302_2.60.40.1180 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.8212 | 39 | 72 | 2.60.40.1180 |
| af_Q3E8Y7_122_291_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8029 | 42 | 70 | 2.120.10.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9CMA3-F1-model_v4 | Uncharacterized protein | 0.9701 | 41 | 124 |
|
| AF-A0A661GE79-F1-model_v4 | DNA-binding protein | 0.9641 | 24 | 124 |
|
| AF-A0A524HRQ9-F1-model_v4 | Uncharacterized protein | 0.963 | 31 | 123 |
|
| AF-A0A2V8I9N4-F1-model_v4 | DUF5666 domain-containing protein | 0.9617 | 39 | 124 |
|
| AF-A0A7C2J476-F1-model_v4 | DUF5666 domain-containing protein | 0.9604 | 31 | 121 |
|