F493134

General Info

Members Datasets Scaffolds Average Seq Length
1338 327 2676 135

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10808210|Ga0105247_108082102
Length 149
Sequence VVTPASGRPRQQQEDDMRAYILGALVAVGLVLAAGTVRAHHSFAAEYDANKPIKISGTVTKMEWMNPHARFYVDVKETDGKVTNWNFELGAIPVLLKQGWKKDSLKQGDQVTVEGSLAKDGSKTANARSVVLSDGRKVFAGSSGGNGPQ

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
200 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 3.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.05
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10808210 3300009101 Bacteria 716
2 Ga0058863_11384065 3300004799 Unclassified 1213
3 Ga0058863_11860520 3300004799 Unclassified 564
4 Ga0058861_11360516 3300004800 Bacteria 580
5 Ga0058861_11653710 3300004800 Unclassified 1913
6 Ga0058861_11906043 3300004800 Bacteria 621
7 Ga0058860_10572999 3300004801 Unclassified 594
8 Ga0058862_10882323 3300004803 Bacteria 1096
9 Ga0058862_12292071 3300004803 Unclassified 1490
10 Ga0058862_12848695 3300004803 Bacteria 1527
11 Ga0058862_12883805 3300004803 Bacteria 729
12 Ga0065704_10227521 3300005289 Bacteria 1054
13 Ga0065707_10215388 3300005295 Bacteria 1247
14 Ga0070658_10309734 3300005327 Unclassified 1347
15 Ga0070676_10188458 3300005328 Unclassified 1345
16 Ga0070676_10414428 3300005328 Unclassified 940
17 Ga0070676_11582046 3300005328 Bacteria 506
18 Ga0070683_100002345 3300005329 Bacteria 15024
19 Ga0070683_100007027 3300005329 Bacteria 9475
20 Ga0070683_100007330 3300005329 Bacteria 9314
21 Ga0070683_100026483 3300005329 Bacteria 5222
22 Ga0070683_100031320 3300005329 Bacteria 4835
23 Ga0070683_100034975 3300005329 Unclassified 4592
24 Ga0070683_100050632 3300005329 Bacteria 3846
25 Ga0070683_100056252 3300005329 Unclassified 3653
26 Ga0070683_100062857 3300005329 Unclassified 3452
27 Ga0070683_100069695 3300005329 Bacteria 3279
28 Ga0070683_100069785 3300005329 Bacteria 3277
29 Ga0070683_100079969 3300005329 Bacteria 3059
30 Ga0070683_100243025 3300005329 Unclassified 1712
31 Ga0070683_100324622 3300005329 Unclassified 1465
32 Ga0070683_100596853 3300005329 Bacteria 1057
33 Ga0070683_100828048 3300005329 Bacteria 887
34 Ga0070683_101015345 3300005329 Unclassified 796
35 Ga0070683_101034575 3300005329 Unclassified 788
36 Ga0070683_101204223 3300005329 Unclassified 728
37 Ga0070690_100050211 3300005330 Bacteria 2661
38 Ga0070690_100317884 3300005330 Bacteria 1121
39 Ga0070690_100786286 3300005330 Unclassified 737
40 Ga0070670_100005882 3300005331 Bacteria 10365
41 Ga0070670_100320100 3300005331 Unclassified 1359
42 Ga0068869_100078093 3300005334 Unclassified 2465
43 Ga0068869_100193464 3300005334 Bacteria 1601
44 Ga0068869_100588296 3300005334 Bacteria 939
45 Ga0068869_100977678 3300005334 Unclassified 736
46 Ga0068869_101370855 3300005334 Unclassified 625
47 Ga0068869_101734854 3300005334 Unclassified 558
48 Ga0070666_10024073 3300005335 Bacteria 3964
49 Ga0070666_10215985 3300005335 Bacteria 1352
50 Ga0070666_10405754 3300005335 Bacteria 980
51 Ga0070666_10422344 3300005335 Unclassified 960
52 Ga0070666_10559303 3300005335 Unclassified 832
53 Ga0070680_100013477 3300005336 Bacteria 6368
54 Ga0070680_100029837 3300005336 Bacteria 4378
55 Ga0070680_100151391 3300005336 Bacteria 1948
56 Ga0070680_100229327 3300005336 Unclassified 1568
57 Ga0070680_101308905 3300005336 Unclassified 627
58 Ga0070682_100457078 3300005337 Bacteria 979
59 Ga0070682_101110468 3300005337 Unclassified 662
60 Ga0070682_101298510 3300005337 Unclassified 618
61 Ga0068868_100023014 3300005338 Bacteria 4711
62 Ga0068868_100137746 3300005338 Unclassified 2002
63 Ga0068868_101293173 3300005338 Unclassified 677
64 Ga0070660_100038870 3300005339 Bacteria 3614
65 Ga0070660_100046368 3300005339 Unclassified 3331
66 Ga0070660_100074978 3300005339 Unclassified 2648
67 Ga0070660_100112143 3300005339 Bacteria 2171
68 Ga0070660_100217900 3300005339 Bacteria 1551
69 Ga0070689_100114995 3300005340 Bacteria 2144
70 Ga0070689_100206846 3300005340 Bacteria 1605
71 Ga0070689_100472252 3300005340 Bacteria 1070
72 Ga0070691_10012040 3300005341 Unclassified 3961
73 Ga0070691_10018047 3300005341 Unclassified 3249
74 Ga0070691_10134706 3300005341 Bacteria 1254
75 Ga0070691_10333633 3300005341 Bacteria 838
76 Ga0070691_10456970 3300005341 Unclassified 730
77 Ga0070687_100952647 3300005343 Unclassified 619
78 Ga0070661_100060635 3300005344 Bacteria 2776
79 Ga0070661_100264588 3300005344 Bacteria 1330
80 Ga0070661_100337359 3300005344 Bacteria 1180
81 Ga0070661_100349870 3300005344 Unclassified 1159
82 Ga0070692_10109473 3300005345 Bacteria 1526
83 Ga0070692_10191505 3300005345 Bacteria 1192
84 Ga0070668_100337956 3300005347 Bacteria 1272
85 Ga0070669_100428240 3300005353 Bacteria 1087
86 Ga0070669_101022808 3300005353 Bacteria 709
87 Ga0070675_100149917 3300005354 Bacteria 1999
88 Ga0070675_100194911 3300005354 Bacteria 1757
89 Ga0070675_100214200 3300005354 Bacteria 1675
90 Ga0070671_100040252 3300005355 Bacteria 3881
91 Ga0070671_100157345 3300005355 Bacteria 1920
92 Ga0070671_100917285 3300005355 Unclassified 766
93 Ga0070674_100335792 3300005356 Bacteria 1216
94 Ga0070674_100513238 3300005356 Bacteria 1000
95 Ga0070674_100542029 3300005356 Unclassified 975
96 Ga0070674_100996114 3300005356 Bacteria 735
97 Ga0070673_100005787 3300005364 Bacteria 7962
98 Ga0070673_100106619 3300005364 Bacteria 2317
99 Ga0070673_100124756 3300005364 Bacteria 2153
100 Ga0070673_100169976 3300005364 Bacteria 1860
101 Ga0070673_100182409 3300005364 Bacteria 1798
102 Ga0070673_100256744 3300005364 Unclassified 1525
103 Ga0070673_100424792 3300005364 Bacteria 1192
104 Ga0070673_100896624 3300005364 Unclassified 822
105 Ga0070688_100074661 3300005365 Bacteria 2178
106 Ga0070688_101739814 3300005365 Bacteria 511
107 Ga0070659_100047286 3300005366 Bacteria 3374
108 Ga0070659_100075163 3300005366 Unclassified 2692
109 Ga0070667_100001720 3300005367 Bacteria 19568
110 Ga0070667_100147324 3300005367 Bacteria 2066
111 Ga0070667_100974453 3300005367 Bacteria 791
112 Ga0070667_101886084 3300005367 Unclassified 563
113 Ga0070703_10232305 3300005406 Bacteria 740
114 Ga0070709_10028638 3300005434 Unclassified 3324
115 Ga0070709_10064165 3300005434 Bacteria 2348
116 Ga0070709_10222275 3300005434 Unclassified 1347
117 Ga0070709_10415598 3300005434 Bacteria 1007
118 Ga0070714_100044338 3300005435 Bacteria 3765
119 Ga0070714_100368355 3300005435 Unclassified 1352
120 Ga0070714_100455186 3300005435 Bacteria 1216
121 Ga0070713_100016997 3300005436 Bacteria 5486
122 Ga0070713_100028621 3300005436 Unclassified 4401
123 Ga0070713_100030488 3300005436 Bacteria 4283
124 Ga0070713_100054358 3300005436 Bacteria 3322
125 Ga0070713_100107017 3300005436 Bacteria 2432
126 Ga0070713_100175678 3300005436 Bacteria 1922
127 Ga0070713_100636098 3300005436 Bacteria 1015
128 Ga0070713_100690245 3300005436 Unclassified 974
129 Ga0070713_100817213 3300005436 Unclassified 894
130 Ga0070710_10395325 3300005437 Unclassified 925
131 Ga0070710_10457965 3300005437 Unclassified 866
132 Ga0070710_10506795 3300005437 Unclassified 827
133 Ga0070701_10004374 3300005438 Bacteria 5712
134 Ga0070701_10018944 3300005438 Bacteria 3243
135 Ga0070701_10038134 3300005438 Bacteria 2430
136 Ga0070711_100046631 3300005439 Bacteria 2954
137 Ga0070711_100075032 3300005439 Bacteria 2393
138 Ga0070711_100092618 3300005439 Bacteria 2181
139 Ga0070711_100104359 3300005439 Bacteria 2068
140 Ga0070711_100152967 3300005439 Unclassified 1741
141 Ga0070711_100162332 3300005439 Unclassified 1695
142 Ga0070711_100434143 3300005439 Bacteria 1072
143 Ga0070711_102007357 3300005439 Unclassified 509
144 Ga0070705_100001435 3300005440 Bacteria 12605
145 Ga0070705_100002500 3300005440 Bacteria 9242
146 Ga0070705_100133950 3300005440 Unclassified 1620
147 Ga0070705_100200815 3300005440 Bacteria 1367
148 Ga0070705_100792466 3300005440 Bacteria 753
149 Ga0070705_100943505 3300005440 Unclassified 697
150 Ga0070705_101458352 3300005440 Bacteria 572
151 Ga0070700_100032779 3300005441 Bacteria 3125
152 Ga0070700_100071387 3300005441 Bacteria 2216
153 Ga0070700_100095694 3300005441 Bacteria 1947
154 Ga0070700_100214486 3300005441 Bacteria 1360
155 Ga0070694_100003150 3300005444 Bacteria 9827
156 Ga0070694_100108601 3300005444 Bacteria 1973
157 Ga0070694_100279690 3300005444 Bacteria 1272
158 Ga0070694_100305915 3300005444 Unclassified 1219
159 Ga0070694_100355481 3300005444 Bacteria 1136
160 Ga0070694_100417269 3300005444 Bacteria 1054
161 Ga0070694_100548720 3300005444 Bacteria 925
162 Ga0070694_100641547 3300005444 Bacteria 859
163 Ga0070663_100834405 3300005455 Unclassified 792
164 Ga0070678_100470508 3300005456 Unclassified 1104
165 Ga0070662_100004942 3300005457 Bacteria 8469
166 Ga0070662_100181864 3300005457 Bacteria 1658
167 Ga0070662_100311062 3300005457 Unclassified 1282
168 Ga0070681_10002128 3300005458 Bacteria 17991
169 Ga0070681_10004375 3300005458 Bacteria 13442
170 Ga0070681_10059269 3300005458 Bacteria 3808
171 Ga0070681_10241004 3300005458 Bacteria 1722
172 Ga0068867_100100292 3300005459 Unclassified 2211
173 Ga0068867_100149478 3300005459 Bacteria 1833
174 Ga0068867_100359435 3300005459 Unclassified 1217
175 Ga0068867_100732239 3300005459 Unclassified 875
176 Ga0068867_101183253 3300005459 Bacteria 701
177 Ga0070685_10277332 3300005466 Bacteria 1121
178 Ga0070706_100387980 3300005467 Bacteria 1300
179 Ga0070698_100009281 3300005471 Bacteria 10554
180 Ga0070698_100198166 3300005471 Bacteria 1944
181 Ga0070698_100932935 3300005471 Bacteria 814
182 Ga0070698_100960636 3300005471 Bacteria 801
183 Ga0070699_100009166 3300005518 Bacteria 8578
184 Ga0070699_100069062 3300005518 Bacteria 3070
185 Ga0070699_101650130 3300005518 Bacteria 587
186 Ga0070679_100000317 3300005530 Bacteria 40891
187 Ga0070679_100000639 3300005530 Bacteria 29746
188 Ga0070679_100042258 3300005530 Bacteria 4539
189 Ga0070679_100607365 3300005530 Bacteria 1037
190 Ga0070679_101033822 3300005530 Unclassified 766
191 Ga0070679_101042627 3300005530 Unclassified 762
192 Ga0070684_100001053 3300005535 Bacteria 19708
193 Ga0070684_100009305 3300005535 Bacteria 7734
194 Ga0070684_100009843 3300005535 Bacteria 7551
195 Ga0070684_100023219 3300005535 Bacteria 5183
196 Ga0070684_100053538 3300005535 Unclassified 3514
197 Ga0070684_100066215 3300005535 Bacteria 3172
198 Ga0070684_100083416 3300005535 Bacteria 2832
199 Ga0070684_100084648 3300005535 Bacteria 2811
200 Ga0070684_100128939 3300005535 Bacteria 2281
201 Ga0070684_100248814 3300005535 Bacteria 1624
202 Ga0070684_100373886 3300005535 Bacteria 1312
203 Ga0070684_101167988 3300005535 Unclassified 724
204 Ga0070697_100271570 3300005536 Bacteria 1453
205 Ga0070697_100620213 3300005536 Unclassified 951
206 Ga0070697_100807347 3300005536 Unclassified 830
207 Ga0070697_101959118 3300005536 Unclassified 524
208 Ga0068853_100038010 3300005539 Unclassified 4099
209 Ga0068853_100053906 3300005539 Bacteria 3464
210 Ga0068853_100110004 3300005539 Unclassified 2447
211 Ga0068853_100112737 3300005539 Bacteria 2417
212 Ga0068853_100180352 3300005539 Unclassified 1915
213 Ga0068853_100773026 3300005539 Unclassified 919
214 Ga0068853_101847532 3300005539 Unclassified 586
215 Ga0070672_100102173 3300005543 Bacteria 2327
216 Ga0070672_100639645 3300005543 Unclassified 929
217 Ga0070672_101656389 3300005543 Unclassified 574
218 Ga0070686_100141638 3300005544 Unclassified 1674
219 Ga0070686_100181556 3300005544 Bacteria 1495
220 Ga0070686_100303310 3300005544 Bacteria 1185
221 Ga0070686_100463144 3300005544 Unclassified 977
222 Ga0070686_100806880 3300005544 Bacteria 757
223 Ga0070695_100000407 3300005545 Bacteria 22225
224 Ga0070695_100025631 3300005545 Unclassified 3642
225 Ga0070695_100152647 3300005545 Unclassified 1613
226 Ga0070695_100161808 3300005545 Bacteria 1572
227 Ga0070695_100270632 3300005545 Unclassified 1244
228 Ga0070695_100401465 3300005545 Bacteria 1039
229 Ga0070696_100000265 3300005546 Bacteria 31638
230 Ga0070696_100012427 3300005546 Bacteria 5711
231 Ga0070696_100348614 3300005546 Bacteria 1146
232 Ga0070696_100515654 3300005546 Bacteria 953
233 Ga0070696_100763280 3300005546 Unclassified 793
234 Ga0070696_100881679 3300005546 Bacteria 741
235 Ga0070696_101528324 3300005546 Bacteria 572
236 Ga0070696_101627935 3300005546 Unclassified 555
237 Ga0070693_100015589 3300005547 Bacteria 3916
238 Ga0070693_100027826 3300005547 Bacteria 3068
239 Ga0070693_100079038 3300005547 Viruses 1956
240 Ga0070693_100094819 3300005547 Bacteria 1806
241 Ga0070693_100157229 3300005547 Bacteria 1445
242 Ga0070693_100524306 3300005547 Bacteria 844
243 Ga0070693_100834722 3300005547 Bacteria 686
244 Ga0070693_101197686 3300005547 Unclassified 583
245 Ga0070665_100029385 3300005548 Bacteria 5532
246 Ga0070665_100471424 3300005548 Unclassified 1266
247 Ga0070704_100001131 3300005549 Bacteria 13916
248 Ga0070704_100004525 3300005549 Bacteria 8029
249 Ga0070704_100006854 3300005549 Bacteria 6748
250 Ga0070704_100098296 3300005549 Bacteria 2199
251 Ga0070704_100145312 3300005549 Bacteria 1857
252 Ga0070704_101572347 3300005549 Bacteria 606
253 Ga0068855_100001577 3300005563 Bacteria 28635
254 Ga0068855_100004380 3300005563 Bacteria 17252
255 Ga0068855_100004802 3300005563 Bacteria 16499
256 Ga0068855_100079247 3300005563 Bacteria 3810
257 Ga0068855_100085923 3300005563 Bacteria 3639
258 Ga0068855_100263485 3300005563 Unclassified 1919
259 Ga0068855_100350783 3300005563 Bacteria 1625
260 Ga0068855_100374191 3300005563 Unclassified 1565
261 Ga0068855_100442408 3300005563 Bacteria 1419
262 Ga0068855_100546995 3300005563 Bacteria 1253
263 Ga0068855_101284731 3300005563 Unclassified 758
264 Ga0070664_100009191 3300005564 Bacteria 8024
265 Ga0070664_100033980 3300005564 Bacteria 4276
266 Ga0070664_100461521 3300005564 Bacteria 1167
267 Ga0070664_101156707 3300005564 Unclassified 729
268 Ga0070664_101769445 3300005564 Unclassified 586
269 Ga0068857_100000258 3300005577 Bacteria 35751
270 Ga0068857_100004932 3300005577 Bacteria 11327
271 Ga0068857_100005540 3300005577 Bacteria 10772
272 Ga0068857_100027212 3300005577 Bacteria 5043
273 Ga0068857_100035682 3300005577 Bacteria 4404
274 Ga0068857_100170260 3300005577 Unclassified 1979
275 Ga0068857_101192127 3300005577 Unclassified 737
276 Ga0068854_100085439 3300005578 Bacteria 2337
277 Ga0068854_100921715 3300005578 Bacteria 769
278 Ga0068854_101701363 3300005578 Unclassified 577
279 Ga0068856_100003558 3300005614 Bacteria 15693
280 Ga0068856_100010203 3300005614 Bacteria 9131
281 Ga0068856_100030989 3300005614 Bacteria 5231
282 Ga0068856_100034694 3300005614 Bacteria 4941
283 Ga0068856_100048690 3300005614 Bacteria 4178
284 Ga0068856_100062628 3300005614 Bacteria 3674
285 Ga0068856_100075098 3300005614 Viruses 3348
286 Ga0068856_100113605 3300005614 Bacteria 2706
287 Ga0068856_100169115 3300005614 Bacteria 2198
288 Ga0068856_100194880 3300005614 Bacteria 2040
289 Ga0068856_100403588 3300005614 Unclassified 1386
290 Ga0068856_100425021 3300005614 Unclassified 1349
291 Ga0068856_100755802 3300005614 Unclassified 992
292 Ga0070702_100209624 3300005615 Bacteria 1296
293 Ga0068852_100009583 3300005616 Bacteria 7196
294 Ga0068852_100017258 3300005616 Bacteria 5660
295 Ga0068852_100268314 3300005616 Unclassified 1641
296 Ga0068852_101113263 3300005616 Unclassified 810
297 Ga0068852_101178096 3300005616 Bacteria 787
298 Ga0068852_102023223 3300005616 Bacteria 598
299 Ga0068852_102423238 3300005616 Unclassified 545
300 Ga0068859_100008801 3300005617 Bacteria 10192
301 Ga0068859_100012958 3300005617 Bacteria 8376
302 Ga0068859_100026501 3300005617 Bacteria 5814
303 Ga0068859_100059021 3300005617 Bacteria 3865
304 Ga0068859_100211503 3300005617 Bacteria 2026
305 Ga0068859_100494008 3300005617 Unclassified 1319
306 Ga0068859_100525913 3300005617 Bacteria 1278
307 Ga0068859_101088092 3300005617 Bacteria 879
308 Ga0068864_100006937 3300005618 Bacteria 9293
309 Ga0068864_100077999 3300005618 Bacteria 2898
310 Ga0068864_100235391 3300005618 Bacteria 1695
311 Ga0068864_100348485 3300005618 Unclassified 1397
312 Ga0068866_10182525 3300005718 Bacteria 1241
313 Ga0068866_10205960 3300005718 Bacteria 1178
314 Ga0068866_10497184 3300005718 Unclassified 806
315 Ga0068866_10892475 3300005718 Unclassified 625
316 Ga0068861_100005313 3300005719 Bacteria 8694
317 Ga0068861_100006410 3300005719 Bacteria 8017
318 Ga0068861_100026627 3300005719 Bacteria 4206
319 Ga0068861_100167407 3300005719 Bacteria 1818
320 Ga0068861_100835351 3300005719 Unclassified 867
321 Ga0068861_101032376 3300005719 Bacteria 786
322 Ga0068851_10078327 3300005834 Unclassified 1722
323 Ga0068851_10715605 3300005834 Unclassified 617
324 Ga0068870_11154938 3300005840 Unclassified 559
325 Ga0068863_100015411 3300005841 Bacteria 7349
326 Ga0068863_100117366 3300005841 Bacteria 2536
327 Ga0068863_100303809 3300005841 Unclassified 1548
328 Ga0068863_100467116 3300005841 Unclassified 1240
329 Ga0068863_100478709 3300005841 Bacteria 1224
330 Ga0068863_101005994 3300005841 Unclassified 836
331 Ga0068858_100017530 3300005842 Bacteria 6716
332 Ga0068858_100048367 3300005842 Bacteria 3942
333 Ga0068858_100055499 3300005842 Unclassified 3662
334 Ga0068858_100094353 3300005842 Bacteria 2787
335 Ga0068858_100099888 3300005842 Bacteria 2706
336 Ga0068858_100115429 3300005842 Bacteria 2509
337 Ga0068858_100167608 3300005842 Bacteria 2070
338 Ga0068858_100457005 3300005842 Unclassified 1231
339 Ga0068858_100529589 3300005842 Unclassified 1140
340 Ga0068858_100985601 3300005842 Unclassified 826
341 Ga0068858_101013366 3300005842 Unclassified 814
342 Ga0068858_101287710 3300005842 Bacteria 719
343 Ga0068858_101544909 3300005842 Bacteria 655
344 Ga0068860_100042646 3300005843 Bacteria 4332
345 Ga0068860_100045862 3300005843 Unclassified 4168
346 Ga0068860_100248656 3300005843 Bacteria 1731
347 Ga0068860_100266306 3300005843 Bacteria 1671
348 Ga0068860_100407982 3300005843 Bacteria 1345
349 Ga0068860_100778569 3300005843 Bacteria 969
350 Ga0068860_101658591 3300005843 Unclassified 661
351 Ga0068862_100108121 3300005844 Bacteria 2439
352 Ga0068862_100123311 3300005844 Bacteria 2286
353 Ga0068862_100226343 3300005844 Bacteria 1695
354 Ga0068862_100724522 3300005844 Unclassified 965
355 Ga0070717_10638574 3300006028 Bacteria 966
356 Ga0075432_10123011 3300006058 Bacteria 976
357 Ga0070715_10993176 3300006163 Unclassified 522
358 Ga0070712_100939191 3300006175 Bacteria 747
359 Ga0097621_100001713 3300006237 Bacteria 14989
360 Ga0097621_100044563 3300006237 Unclassified 3579
361 Ga0097621_100074616 3300006237 Bacteria 2809
362 Ga0097621_100098703 3300006237 Unclassified 2454
363 Ga0097621_100159274 3300006237 Unclassified 1940
364 Ga0097621_100257700 3300006237 Bacteria 1529
365 Ga0097621_100273876 3300006237 Bacteria 1484
366 Ga0097621_100360336 3300006237 Bacteria 1295
367 Ga0097621_101257981 3300006237 Unclassified 698
368 Ga0068871_100004335 3300006358 Bacteria 9855
369 Ga0068871_100005439 3300006358 Bacteria 8929
370 Ga0068871_100035400 3300006358 Bacteria 3967
371 Ga0068871_100037842 3300006358 Unclassified 3850
372 Ga0068871_100119170 3300006358 Bacteria 2228
373 Ga0068871_100119280 3300006358 Bacteria 2226
374 Ga0068871_100135605 3300006358 Bacteria 2090
375 Ga0068871_100598174 3300006358 Bacteria 1003
376 Ga0068871_100778149 3300006358 Unclassified 881
377 Ga0068871_100800608 3300006358 Unclassified 869
378 Ga0068871_100941247 3300006358 Unclassified 802
379 Ga0075428_100007745 3300006844 Bacteria 11902
380 Ga0075428_100017987 3300006844 Bacteria 7810
381 Ga0075428_100247730 3300006844 Bacteria 1921
382 Ga0075430_100005720 3300006846 Bacteria 10487
383 Ga0075430_100072688 3300006846 Bacteria 2884
384 Ga0075430_100228350 3300006846 Unclassified 1544
385 Ga0075430_100842287 3300006846 Bacteria 756
386 Ga0075430_101137886 3300006846 Bacteria 643
387 Ga0075431_100064718 3300006847 Bacteria 3775
388 Ga0075431_100152444 3300006847 Bacteria 2379
389 Ga0075431_101944344 3300006847 Bacteria 544
390 Ga0075433_10447888 3300006852 Bacteria 1138
391 Ga0075433_10567027 3300006852 Bacteria 997
392 Ga0075434_100128556 3300006871 Bacteria 2551
393 Ga0075434_100654962 3300006871 Unclassified 1068
394 Ga0075434_100722181 3300006871 Bacteria 1013
395 Ga0075434_101667684 3300006871 Unclassified 645
396 Ga0075429_100045776 3300006880 Bacteria 3806
397 Ga0075429_100067494 3300006880 Bacteria 3112
398 Ga0075429_100085822 3300006880 Bacteria 2743
399 Ga0075429_100151178 3300006880 Bacteria 2033
400 Ga0068865_100031670 3300006881 Bacteria 3527
401 Ga0068865_100031693 3300006881 Unclassified 3526
402 Ga0068865_100098943 3300006881 Bacteria 2132
403 Ga0068865_100487359 3300006881 Unclassified 1026
404 Ga0068865_100956431 3300006881 Bacteria 748
405 Ga0068865_101606170 3300006881 Unclassified 584
406 Ga0075436_100290454 3300006914 Unclassified 1170
407 Ga0075436_100349979 3300006914 Unclassified 1065
408 Ga0075436_100367120 3300006914 Unclassified 1039
409 Ga0075436_100376584 3300006914 Bacteria 1026
410 Ga0075436_101125609 3300006914 Bacteria 591
411 Ga0097620_100008801 3300006931 Bacteria 10192
412 Ga0097620_100012958 3300006931 Bacteria 8376
413 Ga0097620_100026501 3300006931 Bacteria 5814
414 Ga0097620_100059022 3300006931 Bacteria 3865
415 Ga0097620_100211504 3300006931 Bacteria 2026
416 Ga0097620_100494032 3300006931 Unclassified 1319
417 Ga0097620_100525853 3300006931 Bacteria 1278
418 Ga0097620_101087907 3300006931 Bacteria 879
419 Ga0075435_100089398 3300007076 Bacteria 2539
420 Ga0075435_100127083 3300007076 Bacteria 2131
421 Ga0075435_100375399 3300007076 Bacteria 1221
422 Ga0105240_10003712 3300009093 Bacteria 23598
423 Ga0105240_10009712 3300009093 Bacteria 13584
424 Ga0105240_10009808 3300009093 Bacteria 13517
425 Ga0105240_10023985 3300009093 Bacteria 8059
426 Ga0105240_10034115 3300009093 Bacteria 6567
427 Ga0105240_10035184 3300009093 Bacteria 6456
428 Ga0105240_10041342 3300009093 Bacteria 5884
429 Ga0105240_10205588 3300009093 Bacteria 2305
430 Ga0105240_10219055 3300009093 Unclassified 2219
431 Ga0105240_10267218 3300009093 Viruses 1971
432 Ga0105240_11047394 3300009093 Bacteria 870
433 Ga0105240_11276118 3300009093 Unclassified 775
434 Ga0105240_11679224 3300009093 Bacteria 663
435 Ga0111539_10000958 3300009094 Bacteria 37856
436 Ga0111539_10003608 3300009094 Bacteria 20398
437 Ga0111539_10019744 3300009094 Bacteria 8311
438 Ga0111539_10027853 3300009094 Bacteria 6900
439 Ga0111539_10068616 3300009094 Bacteria 4186
440 Ga0111539_10249338 3300009094 Bacteria 2067
441 Ga0111539_10481335 3300009094 Unclassified 1446
442 Ga0111539_11371072 3300009094 Unclassified 820
443 Ga0105245_10000754 3300009098 Bacteria 29261
444 Ga0105245_10002867 3300009098 Bacteria 15490
445 Ga0105245_10003919 3300009098 Bacteria 13227
446 Ga0105245_10005756 3300009098 Bacteria 10880
447 Ga0105245_10113908 3300009098 Bacteria 2519
448 Ga0105245_10129763 3300009098 Unclassified 2363
449 Ga0105245_10276027 3300009098 Bacteria 1641
450 Ga0105245_10279186 3300009098 Bacteria 1632
451 Ga0105245_10375500 3300009098 Bacteria 1415
452 Ga0105245_10502835 3300009098 Bacteria 1228
453 Ga0105245_10568068 3300009098 Unclassified 1158
454 Ga0105245_10768019 3300009098 Unclassified 1000
455 Ga0105245_11188548 3300009098 Bacteria 810
456 Ga0105245_11201318 3300009098 Unclassified 806
457 Ga0105245_11366157 3300009098 Bacteria 758
458 Ga0105245_11902657 3300009098 Unclassified 648
459 Ga0105245_11928547 3300009098 Unclassified 644
460 Ga0105245_12533262 3300009098 Unclassified 566
461 Ga0105247_10006758 3300009101 Bacteria 7080
462 Ga0105247_10085628 3300009101 Bacteria 1993
463 Ga0105247_10762319 3300009101 Unclassified 735
464 Ga0114129_10033252 3300009147 Bacteria 7288
465 Ga0114129_10043256 3300009147 Bacteria 6337
466 Ga0114129_10089655 3300009147 Bacteria 4263
467 Ga0114129_10257597 3300009147 Bacteria 2340
468 Ga0114129_11155077 3300009147 Bacteria 967
469 Ga0105243_10031200 3300009148 Bacteria 4108
470 Ga0105243_10098187 3300009148 Unclassified 2425
471 Ga0105243_10169464 3300009148 Unclassified 1890
472 Ga0105243_10198107 3300009148 Unclassified 1759
473 Ga0105243_10428371 3300009148 Unclassified 1236
474 Ga0105243_10594427 3300009148 Bacteria 1064
475 Ga0105243_10597125 3300009148 Bacteria 1062
476 Ga0105243_10777265 3300009148 Bacteria 941
477 Ga0105243_10897446 3300009148 Bacteria 881
478 Ga0105243_11263761 3300009148 Bacteria 754
479 Ga0105241_10001981 3300009174 Bacteria 15507
480 Ga0105241_10011630 3300009174 Bacteria 6456
481 Ga0105241_10024030 3300009174 Bacteria 4525
482 Ga0105241_10027465 3300009174 Bacteria 4239
483 Ga0105241_10032106 3300009174 Unclassified 3934
484 Ga0105241_10041476 3300009174 Bacteria 3477
485 Ga0105241_10051576 3300009174 Bacteria 3138
486 Ga0105241_10200353 3300009174 Unclassified 1667
487 Ga0105241_10231934 3300009174 Unclassified 1556
488 Ga0105241_10363931 3300009174 Bacteria 1259
489 Ga0105241_10515037 3300009174 Bacteria 1069
490 Ga0105241_10552410 3300009174 Unclassified 1034
491 Ga0105241_11080366 3300009174 Unclassified 754
492 Ga0105242_10007238 3300009176 Bacteria 8555
493 Ga0105242_10042795 3300009176 Unclassified 3660
494 Ga0105242_10077281 3300009176 Bacteria 2777
495 Ga0105242_10170661 3300009176 Bacteria 1912
496 Ga0105242_10301643 3300009176 Bacteria 1462
497 Ga0105242_10451686 3300009176 Bacteria 1212
498 Ga0105242_10466061 3300009176 Bacteria 1194
499 Ga0105242_10495189 3300009176 Unclassified 1161
500 Ga0105242_10560194 3300009176 Bacteria 1097
501 Ga0105242_10855356 3300009176 Unclassified 905
502 Ga0105242_11095123 3300009176 Unclassified 810
503 Ga0105242_11233312 3300009176 Unclassified 768
504 Ga0105242_11583147 3300009176 Unclassified 688
505 Ga0105248_10011826 3300009177 Bacteria 9628
506 Ga0105248_10013168 3300009177 Bacteria 9106
507 Ga0105248_10014349 3300009177 Bacteria 8718
508 Ga0105248_10018424 3300009177 Bacteria 7715
509 Ga0105248_10086468 3300009177 Bacteria 3528
510 Ga0105248_10299821 3300009177 Bacteria 1810
511 Ga0105248_10539373 3300009177 Bacteria 1316
512 Ga0105248_10623352 3300009177 Unclassified 1217
513 Ga0105248_10811860 3300009177 Bacteria 1056
514 Ga0105248_11139912 3300009177 Bacteria 881
515 Ga0105248_11139966 3300009177 Unclassified 881
516 Ga0105248_11317254 3300009177 Unclassified 817
517 Ga0105237_10002229 3300009545 Bacteria 24232
518 Ga0105237_10007164 3300009545 Bacteria 12250
519 Ga0105237_10008691 3300009545 Bacteria 10972
520 Ga0105237_10022516 3300009545 Bacteria 6465
521 Ga0105237_10081337 3300009545 Bacteria 3230
522 Ga0105237_10097535 3300009545 Bacteria 2929
523 Ga0105237_10254467 3300009545 Bacteria 1758
524 Ga0105237_10517210 3300009545 Bacteria 1200
525 Ga0105237_10548644 3300009545 Bacteria 1162
526 Ga0105237_10924609 3300009545 Bacteria 879
527 Ga0105237_12684996 3300009545 Bacteria 509
528 Ga0105238_10000501 3300009551 Bacteria 41211
529 Ga0105238_10006331 3300009551 Bacteria 11769
530 Ga0105238_10006587 3300009551 Bacteria 11571
531 Ga0105238_10015716 3300009551 Bacteria 7662
532 Ga0105238_10020664 3300009551 Bacteria 6707
533 Ga0105238_10025280 3300009551 Bacteria 6052
534 Ga0105238_10027385 3300009551 Bacteria 5807
535 Ga0105238_10032749 3300009551 Bacteria 5290
536 Ga0105238_10034653 3300009551 Bacteria 5136
537 Ga0105238_10036307 3300009551 Bacteria 5009
538 Ga0105238_10050586 3300009551 Bacteria 4182
539 Ga0105238_10056869 3300009551 Unclassified 3924
540 Ga0105238_10131851 3300009551 Bacteria 2477
541 Ga0105238_10216919 3300009551 Bacteria 1889
542 Ga0105238_10388061 3300009551 Unclassified 1388
543 Ga0105238_10941832 3300009551 Bacteria 883
544 Ga0105238_11140645 3300009551 Unclassified 803
545 Ga0105249_10003722 3300009553 Bacteria 13155
546 Ga0105249_10056752 3300009553 Bacteria 3586
547 Ga0105249_10087873 3300009553 Bacteria 2902
548 Ga0105249_10516197 3300009553 Bacteria 1242
549 Ga0105249_10633142 3300009553 Unclassified 1126
550 Ga0105249_10752844 3300009553 Unclassified 1036
551 Ga0105249_11183634 3300009553 Unclassified 835
552 Ga0105249_11556958 3300009553 Unclassified 733
553 Ga0105249_12083674 3300009553 Bacteria 640
554 Ga0105239_10006720 3300010375 Bacteria 13287
555 Ga0105239_10008026 3300010375 Bacteria 12052
556 Ga0105239_10014929 3300010375 Bacteria 8610
557 Ga0105239_10016121 3300010375 Bacteria 8267
558 Ga0105239_10018915 3300010375 Bacteria 7612
559 Ga0105239_10019532 3300010375 Bacteria 7479
560 Ga0105239_10074835 3300010375 Bacteria 3723
561 Ga0105239_10138119 3300010375 Bacteria 2714
562 Ga0105239_10140003 3300010375 Bacteria 2696
563 Ga0105239_10190256 3300010375 Unclassified 2297
564 Ga0105239_10212868 3300010375 Bacteria 2166
565 Ga0105239_10410491 3300010375 Unclassified 1533
566 Ga0105239_10445548 3300010375 Bacteria 1468
567 Ga0105239_10449699 3300010375 Bacteria 1461
568 Ga0105239_10484894 3300010375 Bacteria 1405
569 Ga0105239_11902886 3300010375 Unclassified 690
570 Ga0105239_12719388 3300010375 Unclassified 577
571 Ga0105246_10001430 3300011119 Bacteria 14122
572 Ga0105246_10002423 3300011119 Bacteria 11256
573 Ga0105246_10006397 3300011119 Bacteria 7195
574 Ga0105246_10023226 3300011119 Bacteria 4010
575 Ga0105246_10152689 3300011119 Bacteria 1750
576 Ga0105246_10265826 3300011119 Bacteria 1369
577 Ga0105246_10787935 3300011119 Unclassified 842
578 Ga0105246_10938555 3300011119 Unclassified 779
579 Ga0105246_11809137 3300011119 Unclassified 584
580 Ga0157371_10105868 3300013102 Unclassified 1996
581 Ga0157371_10451920 3300013102 Unclassified 945
582 Ga0157370_10000997 3300013104 Bacteria 35747
583 Ga0157370_10002206 3300013104 Bacteria 23774
584 Ga0157370_10006724 3300013104 Bacteria 12615
585 Ga0157370_10014006 3300013104 Bacteria 8235
586 Ga0157370_10016306 3300013104 Bacteria 7528
587 Ga0157370_10043153 3300013104 Bacteria 4341
588 Ga0157370_11043857 3300013104 Bacteria 739
589 Ga0157369_10002687 3300013105 Bacteria 21222
590 Ga0157369_10005354 3300013105 Bacteria 14951
591 Ga0157369_10015762 3300013105 Bacteria 8516
592 Ga0157369_10025785 3300013105 Bacteria 6521
593 Ga0157369_10053765 3300013105 Unclassified 4350
594 Ga0157369_10080526 3300013105 Bacteria 3487
595 Ga0157369_10146031 3300013105 Unclassified 2501
596 Ga0157369_10177368 3300013105 Unclassified 2243
597 Ga0157369_10789969 3300013105 Unclassified 975
598 Ga0157369_11219750 3300013105 Unclassified 768
599 Ga0157369_11302290 3300013105 Unclassified 741
600 Ga0157374_10015751 3300013296 Bacteria 6640
601 Ga0157374_10032701 3300013296 Bacteria 4738
602 Ga0157374_10114113 3300013296 Bacteria 2601
603 Ga0157374_10129332 3300013296 Bacteria 2443
604 Ga0157374_10160587 3300013296 Unclassified 2189
605 Ga0157374_10418116 3300013296 Bacteria 1339
606 Ga0157374_10525097 3300013296 Bacteria 1190
607 Ga0157374_10798042 3300013296 Bacteria 960
608 Ga0157374_10891249 3300013296 Unclassified 907
609 Ga0157374_10924086 3300013296 Bacteria 890
610 Ga0157374_11024379 3300013296 Unclassified 845
611 Ga0157378_10002798 3300013297 Bacteria 15556
612 Ga0157378_10004041 3300013297 Bacteria 12956
613 Ga0157378_10465355 3300013297 Bacteria 1257
614 Ga0157378_10866816 3300013297 Bacteria 932
615 Ga0157378_11033114 3300013297 Bacteria 857
616 Ga0157378_11617900 3300013297 Unclassified 694
617 Ga0157378_12770649 3300013297 Unclassified 543
618 Ga0157378_13277404 3300013297 Unclassified 503
619 Ga0163162_10090963 3300013306 Bacteria 3134
620 Ga0163162_10353274 3300013306 Bacteria 1602
621 Ga0163162_10369517 3300013306 Bacteria 1567
622 Ga0163162_10727026 3300013306 Bacteria 1113
623 Ga0163162_11332136 3300013306 Unclassified 816
624 Ga0163162_11416531 3300013306 Unclassified 791
625 Ga0163162_12097785 3300013306 Unclassified 648
626 Ga0163162_12975431 3300013306 Bacteria 545
627 Ga0157372_10001007 3300013307 Bacteria 30798
628 Ga0157372_10007331 3300013307 Bacteria 11741
629 Ga0157372_10018708 3300013307 Bacteria 7452
630 Ga0157372_10043736 3300013307 Unclassified 4961
631 Ga0157372_10079946 3300013307 Bacteria 3698
632 Ga0157372_10116247 3300013307 Bacteria 3067
633 Ga0157372_10126745 3300013307 Bacteria 2936
634 Ga0157372_10228683 3300013307 Bacteria 2156
635 Ga0157372_10298647 3300013307 Unclassified 1873
636 Ga0157372_10428805 3300013307 Bacteria 1541
637 Ga0157372_10732126 3300013307 Bacteria 1150
638 Ga0157372_11386798 3300013307 Unclassified 810
639 Ga0157375_10005619 3300013308 Bacteria 10916
640 Ga0157375_10006921 3300013308 Bacteria 9896
641 Ga0157375_10296682 3300013308 Bacteria 1780
642 Ga0157375_10344053 3300013308 Unclassified 1657
643 Ga0157375_10542131 3300013308 Unclassified 1326
644 Ga0157375_11055096 3300013308 Bacteria 950
645 Ga0157375_11088474 3300013308 Unclassified 935
646 Ga0157375_11508388 3300013308 Unclassified 794
647 Ga0163163_10003209 3300014325 Bacteria 13853
648 Ga0163163_10007001 3300014325 Bacteria 9906
649 Ga0163163_10016291 3300014325 Bacteria 6902
650 Ga0163163_10041340 3300014325 Bacteria 4508
651 Ga0163163_10083126 3300014325 Unclassified 3206
652 Ga0163163_10161842 3300014325 Bacteria 2284
653 Ga0163163_10719115 3300014325 Unclassified 1062
654 Ga0163163_10795672 3300014325 Unclassified 1009
655 Ga0163163_11189163 3300014325 Unclassified 825
656 Ga0163163_11212101 3300014325 Unclassified 817
657 Ga0163163_11560441 3300014325 Unclassified 721
658 Ga0163163_11654389 3300014325 Unclassified 701
659 Ga0163163_12482759 3300014325 Unclassified 576
660 Ga0157380_10234790 3300014326 Unclassified 1649
661 Ga0157380_10321361 3300014326 Bacteria 1435
662 Ga0157380_10491402 3300014326 Bacteria 1190
663 Ga0157377_10112470 3300014745 Bacteria 1638
664 Ga0157377_11650735 3300014745 Unclassified 515
665 Ga0157379_10002290 3300014968 Bacteria 15957
666 Ga0157379_10007941 3300014968 Bacteria 9202
667 Ga0157379_10172978 3300014968 Unclassified 1949
668 Ga0157379_10301958 3300014968 Bacteria 1459
669 Ga0157379_10589147 3300014968 Bacteria 1037
670 Ga0157379_11648638 3300014968 Unclassified 627
671 Ga0157376_10001111 3300014969 Bacteria 17644
672 Ga0157376_10053435 3300014969 Bacteria 3364
673 Ga0157376_10086011 3300014969 Bacteria 2710
674 Ga0157376_10155812 3300014969 Unclassified 2065
675 Ga0157376_10177946 3300014969 Bacteria 1942
676 Ga0157376_10302621 3300014969 Bacteria 1514
677 Ga0157376_10532277 3300014969 Unclassified 1160
678 Ga0197907_10345105 3300020069 Unclassified 1821
679 Ga0197907_11169527 3300020069 Unclassified 629
680 Ga0197907_11388186 3300020069 Unclassified 1390
681 Ga0197907_11513640 3300020069 Unclassified 571
682 Ga0206356_10260711 3300020070 Unclassified 635
683 Ga0206356_10950623 3300020070 Unclassified 4271
684 Ga0206356_11094542 3300020070 Unclassified 529
685 Ga0206356_11795575 3300020070 Bacteria 565
686 Ga0206349_1966464 3300020075 Unclassified 834
687 Ga0206355_1240202 3300020076 Unclassified 579
688 Ga0206355_1373007 3300020076 Unclassified 922
689 Ga0206351_10018568 3300020077 Unclassified 594
690 Ga0206352_10265365 3300020078 Unclassified 888
691 Ga0206352_10467909 3300020078 Unclassified 590
692 Ga0206352_10647886 3300020078 Bacteria 8005
693 Ga0206352_10969492 3300020078 Unclassified 504
694 Ga0206350_10410420 3300020080 Bacteria 1399
695 Ga0206350_10936759 3300020080 Unclassified 616
696 Ga0206350_11445424 3300020080 Unclassified 1205
697 Ga0206353_10638504 3300020082 Unclassified 988
698 Ga0206353_10965158 3300020082 Unclassified 607
699 Ga0154015_1088118 3300020610 Unclassified 509
700 Ga0154015_1316610 3300020610 Unclassified 922
701 Ga0154015_1543362 3300020610 Unclassified 569
702 Ga0213876_10042224 3300021384 Bacteria 2410
703 Ga0213875_10120989 3300021388 Unclassified 1223
704 Ga0213875_10196336 3300021388 Bacteria 949
705 Ga0213875_10333362 3300021388 Bacteria 720
706 Ga0213875_10372449 3300021388 Unclassified 679
707 Ga0224712_10002814 3300022467 Unclassified 4385
708 Ga0224712_10075851 3300022467 Unclassified 1376
709 Ga0224712_10538292 3300022467 Unclassified 567
710 Ga0207653_10129309 3300025885 Unclassified 915
711 Ga0207692_10239797 3300025898 Unclassified 1082
712 Ga0207692_10257194 3300025898 Unclassified 1048
713 Ga0207642_10299173 3300025899 Unclassified 932
714 Ga0207642_10524103 3300025899 Bacteria 728
715 Ga0207710_10008409 3300025900 Bacteria 4351
716 Ga0207710_10039475 3300025900 Unclassified 2089
717 Ga0207710_10077349 3300025900 Bacteria 1537
718 Ga0207688_10059826 3300025901 Bacteria 2145
719 Ga0207680_10013380 3300025903 Bacteria 4213
720 Ga0207680_10272733 3300025903 Bacteria 1174
721 Ga0207685_10285361 3300025905 Unclassified 811
722 Ga0207685_10789037 3300025905 Unclassified 522
723 Ga0207699_10010851 3300025906 Unclassified 4587
724 Ga0207699_10040041 3300025906 Unclassified 2698
725 Ga0207699_10051436 3300025906 Bacteria 2434
726 Ga0207699_10439831 3300025906 Bacteria 934
727 Ga0207699_11326260 3300025906 Unclassified 532
728 Ga0207645_10045868 3300025907 Bacteria 2792
729 Ga0207645_10188582 3300025907 Unclassified 1354
730 Ga0207705_10111014 3300025909 Unclassified 2026
731 Ga0207705_10330822 3300025909 Bacteria 1172
732 Ga0207654_10016430 3300025911 Unclassified 3854
733 Ga0207654_10028865 3300025911 Bacteria 3029
734 Ga0207654_10036838 3300025911 Bacteria 2736
735 Ga0207654_10045743 3300025911 Bacteria 2493
736 Ga0207654_10097603 3300025911 Unclassified 1804
737 Ga0207654_10101058 3300025911 Unclassified 1777
738 Ga0207654_10113388 3300025911 Unclassified 1690
739 Ga0207654_10261512 3300025911 Bacteria 1164
740 Ga0207654_10378544 3300025911 Unclassified 980
741 Ga0207654_11300093 3300025911 Unclassified 530
742 Ga0207707_10000239 3300025912 Bacteria 59651
743 Ga0207707_10005887 3300025912 Bacteria 10719
744 Ga0207707_10017387 3300025912 Bacteria 6269
745 Ga0207707_10044979 3300025912 Unclassified 3848
746 Ga0207707_10277788 3300025912 Bacteria 1451
747 Ga0207707_11191863 3300025912 Bacteria 617
748 Ga0207695_10000688 3300025913 Bacteria 66300
749 Ga0207695_10005342 3300025913 Bacteria 17091
750 Ga0207695_10011291 3300025913 Bacteria 10828
751 Ga0207695_10023442 3300025913 Bacteria 6973
752 Ga0207695_10040357 3300025913 Bacteria 5007
753 Ga0207695_10106740 3300025913 Bacteria 2786
754 Ga0207695_10132059 3300025913 Bacteria 2454
755 Ga0207695_10249922 3300025913 Unclassified 1673
756 Ga0207695_11045500 3300025913 Unclassified 696
757 Ga0207671_10007282 3300025914 Bacteria 9625
758 Ga0207671_10009145 3300025914 Bacteria 8315
759 Ga0207671_10015198 3300025914 Bacteria 6043
760 Ga0207671_10045192 3300025914 Bacteria 3256
761 Ga0207671_10238237 3300025914 Bacteria 1429
762 Ga0207671_10724871 3300025914 Bacteria 790
763 Ga0207663_10135976 3300025916 Bacteria 1706
764 Ga0207663_10221892 3300025916 Unclassified 1376
765 Ga0207663_10768809 3300025916 Unclassified 766
766 Ga0207663_11205911 3300025916 Unclassified 609
767 Ga0207663_11497263 3300025916 Bacteria 543
768 Ga0207660_10014708 3300025917 Bacteria 5154
769 Ga0207660_10027061 3300025917 Unclassified 3909
770 Ga0207660_10205912 3300025917 Bacteria 1538
771 Ga0207660_10421633 3300025917 Bacteria 1076
772 Ga0207660_10496146 3300025917 Bacteria 990
773 Ga0207660_10578862 3300025917 Unclassified 914
774 Ga0207662_10194867 3300025918 Bacteria 1309
775 Ga0207662_10596903 3300025918 Unclassified 768
776 Ga0207657_10049976 3300025919 Bacteria 3641
777 Ga0207657_10094357 3300025919 Unclassified 2492
778 Ga0207657_10151274 3300025919 Bacteria 1890
779 Ga0207657_10499321 3300025919 Unclassified 953
780 Ga0207649_10346133 3300025920 Bacteria 1099
781 Ga0207649_10467036 3300025920 Unclassified 955
782 Ga0207649_10474559 3300025920 Unclassified 948
783 Ga0207649_10545018 3300025920 Unclassified 887
784 Ga0207649_10573183 3300025920 Bacteria 866
785 Ga0207649_10684279 3300025920 Unclassified 795
786 Ga0207652_10000872 3300025921 Bacteria 28576
787 Ga0207652_10012468 3300025921 Bacteria 6869
788 Ga0207652_10168082 3300025921 Bacteria 1967
789 Ga0207652_10365969 3300025921 Unclassified 1301
790 Ga0207681_10424427 3300025923 Bacteria 1078
791 Ga0207681_11407598 3300025923 Bacteria 585
792 Ga0207694_10003106 3300025924 Bacteria 13286
793 Ga0207694_10003534 3300025924 Bacteria 12412
794 Ga0207694_10005943 3300025924 Bacteria 9357
795 Ga0207694_10008251 3300025924 Bacteria 7873
796 Ga0207694_10012985 3300025924 Bacteria 6271
797 Ga0207694_10026656 3300025924 Unclassified 4398
798 Ga0207694_10040522 3300025924 Bacteria 3586
799 Ga0207694_10044764 3300025924 Unclassified 3417
800 Ga0207694_10060786 3300025924 Bacteria 2941
801 Ga0207694_10079545 3300025924 Unclassified 2571
802 Ga0207694_10104193 3300025924 Unclassified 2251
803 Ga0207694_10222267 3300025924 Bacteria 1541
804 Ga0207694_10360924 3300025924 Unclassified 1204
805 Ga0207694_10380640 3300025924 Bacteria 1171
806 Ga0207694_10845343 3300025924 Bacteria 773
807 Ga0207694_10856305 3300025924 Unclassified 768
808 Ga0207650_10263270 3300025925 Bacteria 1399
809 Ga0207650_10265981 3300025925 Bacteria 1392
810 Ga0207650_10486603 3300025925 Bacteria 1030
811 Ga0207659_10041379 3300025926 Bacteria 3227
812 Ga0207659_10079002 3300025926 Bacteria 2426
813 Ga0207659_10431108 3300025926 Unclassified 1107
814 Ga0207687_10000339 3300025927 Bacteria 31327
815 Ga0207687_10000965 3300025927 Bacteria 19524
816 Ga0207687_10001193 3300025927 Bacteria 17754
817 Ga0207687_10001331 3300025927 Bacteria 16892
818 Ga0207687_10006593 3300025927 Bacteria 7656
819 Ga0207687_10150546 3300025927 Bacteria 1775
820 Ga0207687_10194132 3300025927 Bacteria 1582
821 Ga0207687_10229603 3300025927 Bacteria 1465
822 Ga0207687_10303138 3300025927 Bacteria 1287
823 Ga0207687_10343124 3300025927 Bacteria 1215
824 Ga0207687_10470260 3300025927 Bacteria 1045
825 Ga0207687_10487811 3300025927 Bacteria 1027
826 Ga0207687_10997971 3300025927 Bacteria 718
827 Ga0207700_10023058 3300025928 Unclassified 4283
828 Ga0207700_10051165 3300025928 Bacteria 3081
829 Ga0207700_10119581 3300025928 Bacteria 2134
830 Ga0207700_10150242 3300025928 Bacteria 1924
831 Ga0207700_10176176 3300025928 Bacteria 1787
832 Ga0207700_10782845 3300025928 Unclassified 853
833 Ga0207700_10885628 3300025928 Bacteria 799
834 Ga0207700_11200041 3300025928 Unclassified 677
835 Ga0207664_10081362 3300025929 Unclassified 2635
836 Ga0207644_10121378 3300025931 Bacteria 1990
837 Ga0207690_10203052 3300025932 Unclassified 1506
838 Ga0207690_10999151 3300025932 Bacteria 696
839 Ga0207706_10051290 3300025933 Bacteria 3643
840 Ga0207706_10207083 3300025933 Bacteria 1720
841 Ga0207706_10258272 3300025933 Bacteria 1521
842 Ga0207706_10502552 3300025933 Unclassified 1046
843 Ga0207706_10515764 3300025933 Bacteria 1031
844 Ga0207686_10009052 3300025934 Bacteria 5391
845 Ga0207686_10017571 3300025934 Unclassified 4033
846 Ga0207686_10049240 3300025934 Bacteria 2615
847 Ga0207686_10107567 3300025934 Unclassified 1874
848 Ga0207686_10428083 3300025934 Unclassified 1014
849 Ga0207686_10491542 3300025934 Unclassified 951
850 Ga0207686_10607029 3300025934 Unclassified 862
851 Ga0207686_11131628 3300025934 Bacteria 639
852 Ga0207686_11290022 3300025934 Unclassified 599
853 Ga0207686_11660720 3300025934 Unclassified 528
854 Ga0207709_10043392 3300025935 Bacteria 2710
855 Ga0207709_10057515 3300025935 Bacteria 2412
856 Ga0207709_10126861 3300025935 Bacteria 1732
857 Ga0207709_10508940 3300025935 Unclassified 941
858 Ga0207670_10071092 3300025936 Bacteria 2405
859 Ga0207670_10127861 3300025936 Bacteria 1857
860 Ga0207670_10261722 3300025936 Bacteria 1341
861 Ga0207670_10380015 3300025936 Bacteria 1125
862 Ga0207670_11787615 3300025936 Bacteria 523
863 Ga0207669_10052709 3300025937 Bacteria 2446
864 Ga0207669_10584870 3300025937 Unclassified 905
865 Ga0207669_11303487 3300025937 Unclassified 617
866 Ga0207669_11590500 3300025937 Unclassified 558
867 Ga0207704_10006166 3300025938 Bacteria 5566
868 Ga0207704_10172484 3300025938 Bacteria 1553
869 Ga0207704_10609215 3300025938 Bacteria 895
870 Ga0207704_10707724 3300025938 Unclassified 834
871 Ga0207704_10708902 3300025938 Unclassified 834
872 Ga0207665_11510228 3300025939 Unclassified 534
873 Ga0207691_10161552 3300025940 Bacteria 1965
874 Ga0207691_10559953 3300025940 Unclassified 969
875 Ga0207711_10003057 3300025941 Bacteria 14623
876 Ga0207711_10009081 3300025941 Bacteria 8301
877 Ga0207711_10009217 3300025941 Bacteria 8242
878 Ga0207711_10025923 3300025941 Bacteria 4917
879 Ga0207711_10106048 3300025941 Bacteria 2493
880 Ga0207711_10168821 3300025941 Unclassified 1984
881 Ga0207711_10295208 3300025941 Bacteria 1494
882 Ga0207711_10388113 3300025941 Unclassified 1296
883 Ga0207711_11936479 3300025941 Bacteria 532
884 Ga0207689_10044198 3300025942 Unclassified 3682
885 Ga0207689_10101050 3300025942 Bacteria 2369
886 Ga0207689_10141989 3300025942 Bacteria 1978
887 Ga0207689_10188640 3300025942 Unclassified 1701
888 Ga0207689_10208270 3300025942 Bacteria 1615
889 Ga0207689_10247856 3300025942 Unclassified 1473
890 Ga0207689_10324615 3300025942 Bacteria 1278
891 Ga0207689_11140102 3300025942 Unclassified 657
892 Ga0207661_10006879 3300025944 Bacteria 8064
893 Ga0207661_10014859 3300025944 Bacteria 5711
894 Ga0207661_10017326 3300025944 Bacteria 5327
895 Ga0207661_10018049 3300025944 Bacteria 5237
896 Ga0207661_10023596 3300025944 Unclassified 4650
897 Ga0207661_10040570 3300025944 Bacteria 3660
898 Ga0207661_10084621 3300025944 Bacteria 2627
899 Ga0207661_10111463 3300025944 Bacteria 2315
900 Ga0207661_10167483 3300025944 Unclassified 1910
901 Ga0207661_10268692 3300025944 Bacteria 1521
902 Ga0207661_10323547 3300025944 Bacteria 1387
903 Ga0207661_10693614 3300025944 Unclassified 936
904 Ga0207661_10832789 3300025944 Unclassified 849
905 Ga0207679_10012055 3300025945 Bacteria 5622
906 Ga0207679_10192303 3300025945 Unclassified 1698
907 Ga0207679_10343407 3300025945 Unclassified 1299
908 Ga0207679_10604995 3300025945 Unclassified 988
909 Ga0207679_11078694 3300025945 Bacteria 737
910 Ga0207667_10001263 3300025949 Bacteria 31737
911 Ga0207667_10002815 3300025949 Bacteria 21563
912 Ga0207667_10005334 3300025949 Bacteria 15669
913 Ga0207667_10007297 3300025949 Bacteria 13321
914 Ga0207667_10088424 3300025949 Bacteria 3204
915 Ga0207667_10165941 3300025949 Bacteria 2270
916 Ga0207667_10268213 3300025949 Bacteria 1745
917 Ga0207667_10281715 3300025949 Unclassified 1699
918 Ga0207667_10686012 3300025949 Unclassified 1028
919 Ga0207667_11222369 3300025949 Unclassified 730
920 Ga0207651_10009187 3300025960 Bacteria 5390
921 Ga0207651_10136303 3300025960 Unclassified 1889
922 Ga0207651_10149867 3300025960 Bacteria 1814
923 Ga0207651_10181780 3300025960 Bacteria 1669
924 Ga0207651_10519810 3300025960 Bacteria 1031
925 Ga0207651_10552892 3300025960 Bacteria 1001
926 Ga0207651_11317669 3300025960 Bacteria 649
927 Ga0207712_10003128 3300025961 Bacteria 10552
928 Ga0207712_10062799 3300025961 Unclassified 2642
929 Ga0207712_10430534 3300025961 Bacteria 1115
930 Ga0207712_10953371 3300025961 Unclassified 760
931 Ga0207712_11313131 3300025961 Unclassified 647
932 Ga0207640_10074983 3300025981 Bacteria 2291
933 Ga0207640_10362052 3300025981 Unclassified 1169
934 Ga0207640_11272339 3300025981 Unclassified 656
935 Ga0207658_10116648 3300025986 Bacteria 2121
936 Ga0207658_10299571 3300025986 Bacteria 1385
937 Ga0207658_10529431 3300025986 Bacteria 1052
938 Ga0207677_10212446 3300026023 Bacteria 1546
939 Ga0207677_10348024 3300026023 Unclassified 1241
940 Ga0207677_11595559 3300026023 Unclassified 604
941 Ga0207703_10023347 3300026035 Bacteria 4857
942 Ga0207703_10107236 3300026035 Bacteria 2378
943 Ga0207703_10141720 3300026035 Bacteria 2087
944 Ga0207703_10142120 3300026035 Unclassified 2084
945 Ga0207703_10271524 3300026035 Bacteria 1536
946 Ga0207703_10514303 3300026035 Bacteria 1125
947 Ga0207703_10524284 3300026035 Bacteria 1115
948 Ga0207703_10972720 3300026035 Bacteria 814
949 Ga0207639_10013820 3300026041 Bacteria 5660
950 Ga0207639_10046941 3300026041 Unclassified 3261
951 Ga0207639_10126997 3300026041 Bacteria 2105
952 Ga0207639_10152759 3300026041 Unclassified 1936
953 Ga0207639_10181498 3300026041 Bacteria 1791
954 Ga0207639_10369719 3300026041 Unclassified 1285
955 Ga0207639_10465400 3300026041 Unclassified 1150
956 Ga0207639_10820883 3300026041 Bacteria 867
957 Ga0207639_11397884 3300026041 Bacteria 657
958 Ga0207708_10021309 3300026075 Bacteria 4887
959 Ga0207708_10037499 3300026075 Bacteria 3693
960 Ga0207708_10188531 3300026075 Bacteria 1640
961 Ga0207708_10255058 3300026075 Bacteria 1414
962 Ga0207708_10352205 3300026075 Unclassified 1208
963 Ga0207708_10387930 3300026075 Bacteria 1153
964 Ga0207708_10458182 3300026075 Bacteria 1063
965 Ga0207708_11677962 3300026075 Unclassified 558
966 Ga0207702_10004066 3300026078 Bacteria 13128
967 Ga0207702_10005778 3300026078 Bacteria 10757
968 Ga0207702_10015083 3300026078 Bacteria 6407
969 Ga0207702_10045055 3300026078 Bacteria 3711
970 Ga0207702_10045696 3300026078 Unclassified 3684
971 Ga0207702_10068818 3300026078 Viruses 3042
972 Ga0207702_10075030 3300026078 Bacteria 2921
973 Ga0207702_10102176 3300026078 Bacteria 2533
974 Ga0207702_10178422 3300026078 Bacteria 1954
975 Ga0207702_10324567 3300026078 Bacteria 1467
976 Ga0207702_10697891 3300026078 Unclassified 1000
977 Ga0207702_11634441 3300026078 Unclassified 637
978 Ga0207641_10348450 3300026088 Unclassified 1411
979 Ga0207641_10531534 3300026088 Bacteria 1145
980 Ga0207641_10550241 3300026088 Bacteria 1125
981 Ga0207641_10638522 3300026088 Unclassified 1045
982 Ga0207648_10074848 3300026089 Unclassified 2952
983 Ga0207648_10128417 3300026089 Bacteria 2230
984 Ga0207648_10366375 3300026089 Bacteria 1301
985 Ga0207648_10859981 3300026089 Unclassified 846
986 Ga0207648_10976101 3300026089 Unclassified 793
987 Ga0207648_11979044 3300026089 Bacteria 544
988 Ga0207676_10035645 3300026095 Bacteria 3778
989 Ga0207676_10055179 3300026095 Bacteria 3118
990 Ga0207676_10808843 3300026095 Unclassified 915
991 Ga0207676_11832673 3300026095 Unclassified 605
992 Ga0207674_10000035 3300026116 Bacteria 136262
993 Ga0207674_10000101 3300026116 Bacteria 97551
994 Ga0207674_10000187 3300026116 Bacteria 75592
995 Ga0207674_10001119 3300026116 Bacteria 34786
996 Ga0207674_10001346 3300026116 Bacteria 31774
997 Ga0207674_10009238 3300026116 Bacteria 11300
998 Ga0207674_11172262 3300026116 Unclassified 738
999 Ga0207674_12217091 3300026116 Unclassified 512
1000 Ga0207675_100002274 3300026118 Bacteria 19086
1001 Ga0207675_100003771 3300026118 Bacteria 14760
1002 Ga0207675_100003855 3300026118 Bacteria 14579
1003 Ga0207675_100220347 3300026118 Bacteria 1828
1004 Ga0207675_100232559 3300026118 Bacteria 1779
1005 Ga0207675_100899962 3300026118 Unclassified 901
1006 Ga0207683_10336593 3300026121 Unclassified 1384
1007 Ga0207698_10030025 3300026142 Bacteria 3903
1008 Ga0207698_10058127 3300026142 Unclassified 2995
1009 Ga0207698_10461732 3300026142 Unclassified 1228
1010 Ga0207698_10759933 3300026142 Unclassified 969
1011 Ga0207698_11281958 3300026142 Bacteria 747
1012 Ga0207698_11358409 3300026142 Unclassified 725
1013 Ga0207698_11665798 3300026142 Bacteria 653
1014 Ga0207698_11676101 3300026142 Unclassified 651
1015 Ga0209983_1040851 3300027665 Bacteria 1003
1016 Ga0209974_10342199 3300027876 Unclassified 579
1017 Ga0207428_10023817 3300027907 Bacteria 5142
1018 Ga0207428_10034926 3300027907 Bacteria 4114
1019 Ga0207428_10047517 3300027907 Unclassified 3446
1020 Ga0207428_10060800 3300027907 Bacteria 2992
1021 Ga0207428_10157922 3300027907 Bacteria 1723
1022 Ga0207428_10258530 3300027907 Bacteria 1297
1023 Ga0207428_10339716 3300027907 Unclassified 1106
1024 Ga0268266_10138074 3300028379 Bacteria 2185
1025 Ga0268265_10032524 3300028380 Bacteria 3782
1026 Ga0268265_10079514 3300028380 Bacteria 2582
1027 Ga0268265_11548456 3300028380 Unclassified 667
1028 Ga0268264_10078776 3300028381 Bacteria 2810
1029 Ga0268264_10134491 3300028381 Unclassified 2196
1030 Ga0268264_10216239 3300028381 Bacteria 1762
1031 Ga0268264_10634138 3300028381 Unclassified 1056
1032 Ga0268264_10836333 3300028381 Unclassified 921
1033 Ga0268264_11060286 3300028381 Bacteria 818
1034 Ga0268264_11447146 3300028381 Bacteria 698
1035 Ga0268264_11618224 3300028381 Unclassified 658
1036 Ga0268264_12135007 3300028381 Unclassified 568
1037 Ga0265338_10265855 3300028800 Bacteria 1259
1038 Ga0265338_10783562 3300028800 Unclassified 654
1039 Ga0316178_1065459 3300030735 Unclassified 543
1040 Ga0265766_1012762 3300030863 Unclassified 624
1041 Ga0265761_107455 3300030889 Unclassified 598
1042 Ga0265760_10108614 3300031090 Unclassified 882
1043 Ga0265760_10298254 3300031090 Unclassified 570
1044 Ga0265340_10060438 3300031247 Bacteria 1815
1045 Ga0265313_10003726 3300031595 Bacteria 12129
1046 Ga0265313_10037651 3300031595 Unclassified 2415
1047 Ga0265314_10000216 3300031711 Bacteria 85672
1048 Ga0265314_10215465 3300031711 Unclassified 1124
1049 Ga0307405_12090089 3300031731 Unclassified 508
1050 Ga0307413_10552266 3300031824 Bacteria 934
1051 Ga0307413_11115968 3300031824 Unclassified 682
1052 Ga0307410_11025746 3300031852 Unclassified 712
1053 Ga0307406_10792529 3300031901 Unclassified 799
1054 Ga0307416_100940942 3300032002 Unclassified 966
1055 Ga0307416_102527223 3300032002 Unclassified 612
1056 Ga0307411_10084496 3300032005 Bacteria 2196
1057 Ga0373934_0008713 3300035086 Bacteria 3786
1058 Ga0373934_0011047 3300035086 Unclassified 3397
1059 Ga0373934_0025370 3300035086 Unclassified 2295
1060 Ga0373934_0192680 3300035086 Unclassified 839
1061 Ga0373934_0477963 3300035086 Bacteria 523
1062 Ga0373949_0310785 3300035090 Bacteria 502
1063 Ga0373952_0190577 3300035092 Unclassified 596
1064 Ga0373923_0001630 3300035111 Bacteria 6545
1065 Ga0373923_0032759 3300035111 Unclassified 2101
1066 Ga0373923_0276864 3300035111 Bacteria 790
1067 Ga0373923_0633190 3300035111 Unclassified 528
1068 Ga0373923_0651865 3300035111 Unclassified 521
1069 Ga0373932_0215559 3300035112 Unclassified 688
1070 Ga0373936_0085361 3300035113 Bacteria 1318
1071 Ga0373936_0151066 3300035113 Bacteria 1007
1072 Ga0373945_0436833 3300035116 Unclassified 577
1073 Ga0373953_0016546 3300035117 Bacteria 2694
1074 Ga0373953_0323307 3300035117 Bacteria 674
1075 Ga0373954_0009618 3300035118 Unclassified 4255
1076 Ga0373954_0025706 3300035118 Unclassified 2695
1077 Ga0373954_0031641 3300035118 Bacteria 2443
1078 Ga0373954_0051598 3300035118 Unclassified 1932
1079 Ga0373954_0057398 3300035118 Unclassified 1833
1080 Ga0373954_0094897 3300035118 Bacteria 1436
1081 Ga0373954_0219683 3300035118 Bacteria 935
1082 Ga0373954_0579479 3300035118 Unclassified 556
1083 Ga0373956_0051017 3300035119 Unclassified 1859
1084 Ga0373956_0092851 3300035119 Bacteria 1394
1085 Ga0373957_0011268 3300035120 Unclassified 2980
1086 Ga0373957_0084898 3300035120 Bacteria 1253
1087 Ga0373957_0086224 3300035120 Bacteria 1244
1088 Ga0373957_0210694 3300035120 Unclassified 812
1089 Ga0373957_0273425 3300035120 Unclassified 713
1090 Ga0373943_0309150 3300035170 Bacteria 899
1091 Ga0373943_0701557 3300035170 Bacteria 600
1092 Ga0373946_0424304 3300035171 Bacteria 674
1093 Ga0373955_0011914 3300035172 Unclassified 4165
1094 Ga0373955_0020013 3300035172 Unclassified 3357
1095 Ga0373955_0069483 3300035172 Bacteria 1965
1096 Ga0373955_0129042 3300035172 Bacteria 1475
1097 Ga0373955_0255000 3300035172 Bacteria 1052
1098 Ga0373955_0620131 3300035172 Unclassified 663
1099 Ga0373955_0629694 3300035172 Bacteria 657
1100 Ga0373962_0103317 3300035242 Bacteria 891
1101 Ga0373924_0056918 3300035410 Unclassified 1630
1102 Ga0373924_0151665 3300035410 Bacteria 1014
1103 Ga0373931_0163170 3300035691 Bacteria 1308
1104 Ga0373935_0221628 3300035692 Unclassified 1314
1105 Ga0373935_1061923 3300035692 Bacteria 602
1106 Ga0373935_1172377 3300035692 Bacteria 572
1107 Ga0373927_0031610 3300035695 Bacteria 3449
1108 Ga0373927_0033707 3300035695 Unclassified 3333
1109 Ga0373927_0093199 3300035695 Bacteria 1957
1110 Ga0373933_0006501 3300035724 Bacteria 6364
1111 Ga0373933_0011568 3300035724 Unclassified 4869
1112 Ga0373933_0078309 3300035724 Bacteria 2022
1113 Ga0373933_0110163 3300035724 Bacteria 1717
1114 Ga0373933_0156543 3300035724 Unclassified 1445
1115 Ga0373933_0223485 3300035724 Bacteria 1208
1116 Ga0373947_0179077 3300035725 Bacteria 1379
1117 Ga0373947_0195393 3300035725 Bacteria 1322
1118 Ga0373937_0007916 3300036401 Bacteria 9210
1119 Ga0373937_0016065 3300036401 Bacteria 6640
1120 Ga0373937_0033347 3300036401 Bacteria 4675
1121 Ga0373937_0051686 3300036401 Bacteria 3767
1122 Ga0373937_0071823 3300036401 Unclassified 3192
1123 Ga0373937_0102790 3300036401 Bacteria 2653
1124 Ga0373937_0152835 3300036401 Bacteria 2162
1125 Ga0373937_0159609 3300036401 Bacteria 2114
1126 Ga0373937_0184876 3300036401 Unclassified 1957
1127 Ga0373937_0289994 3300036401 Bacteria 1546
1128 Ga0373937_0318383 3300036401 Bacteria 1472
1129 Ga0373937_0554995 3300036401 Bacteria 1091
1130 Ga0373937_0603185 3300036401 Unclassified 1042
1131 Ga0373937_1328886 3300036401 Unclassified 667
1132 Ga0373937_1729560 3300036401 Unclassified 572
1133 Ga0265778_025300 3300036457 Unclassified 749
1134 Ga0373925_0022844 3300037068 Bacteria 4564
1135 Ga0373925_0030612 3300037068 Unclassified 3951
1136 Ga0373925_0069136 3300037068 Bacteria 2667
1137 Ga0373925_0075906 3300037068 Bacteria 2548
1138 Ga0373925_0171978 3300037068 Unclassified 1711
1139 Ga0373925_0418951 3300037068 Unclassified 1094
1140 Ga0373925_0741198 3300037068 Bacteria 810
1141 Ga0373925_1569217 3300037068 Bacteria 538
1142 Ga0436364_0322271 3300037853 Bacteria 1224
1143 Ga0436364_0408987 3300037853 Unclassified 736
1144 Ga0436364_0502698 3300037853 Bacteria 6112
1145 Ga0436364_1160244 3300037853 Unclassified 2656
1146 Ga0436364_1532637 3300037853 Bacteria 11509
1147 Ga0436365_0148535 3300039437 Unclassified 2863
1148 Ga0436363_0251377 3300039450 Unclassified 1339
1149 Ga0436363_0583931 3300039450 Unclassified 1497
1150 Ga0436362_0326765 3300039453 Unclassified 563
1151 Ga0436362_0653106 3300039453 Unclassified 2143
1152 Ga0439439_0227515 3300041406 Bacteria 548
1153 Ga0439453_0002949 3300041408 Unclassified 2402
1154 Ga0439448_0055837 3300042005 Unclassified 1299
1155 Ga0450910_102440 3300042147 Bacteria 515
1156 Ga0439435_0001943 3300042436 Bacteria 3973
1157 Ga0450916_058727 3300042530 Bacteria 621
1158 Ga0495592_0133697 3300046454 Bacteria 1732
1159 Ga0495592_0289042 3300046454 Unclassified 1069
1160 Ga0495651_0024889 3300046462 Unclassified 4657
1161 Ga0495580_0008386 3300046472 Bacteria 8220
1162 Ga0495580_0012657 3300046472 Bacteria 6469
1163 Ga0495580_0018987 3300046472 Bacteria 5113
1164 Ga0495580_0032844 3300046472 Unclassified 3741
1165 Ga0495580_0072887 3300046472 Bacteria 2398
1166 Ga0495580_0176328 3300046472 Bacteria 1476
1167 Ga0495580_0217229 3300046472 Unclassified 1314
1168 Ga0495580_0646951 3300046472 Unclassified 695
1169 Ga0495580_0798583 3300046472 Unclassified 612
1170 Ga0495582_0188291 3300046473 Bacteria 1177
1171 Ga0495639_0248034 3300046475 Unclassified 880
1172 Ga0495639_0359164 3300046475 Unclassified 732
1173 Ga0495639_0759167 3300046475 Unclassified 502
1174 Ga0495664_0515565 3300046477 Unclassified 714
1175 Ga0495664_0578955 3300046477 Unclassified 668
1176 Ga0495584_0035393 3300046491 Unclassified 2524
1177 Ga0495594_0128079 3300046499 Archaea 1437
1178 Ga0495608_0062113 3300046511 Bacteria 2455
1179 Ga0495608_0067259 3300046511 Unclassified 2344
1180 Ga0495618_0535614 3300046514 Unclassified 703
1181 Ga0495618_0595623 3300046514 Unclassified 658
1182 Ga0495628_0426329 3300046516 Bacteria 966
1183 Ga0495630_0617809 3300046517 Bacteria 831
1184 Ga0495663_0020425 3300046525 Unclassified 1901
1185 Ga0495663_0150397 3300046525 Bacteria 794
1186 Ga0495642_0027494 3300046528 Bacteria 2264
1187 Ga0495642_0226901 3300046528 Bacteria 816
1188 Ga0495652_0069906 3300046529 Bacteria 2937
1189 Ga0495652_0183777 3300046529 Unclassified 1602
1190 Ga0495652_0506020 3300046529 Unclassified 837
1191 Ga0495652_0683770 3300046529 Unclassified 692
1192 Ga0495652_0957639 3300046529 Bacteria 562
1193 Ga0495652_1095066 3300046529 Unclassified 517
1194 Ga0495586_0040857 3300046535 Bacteria 2497
1195 Ga0495586_0076146 3300046535 Bacteria 1838
1196 Ga0495586_0108233 3300046535 Bacteria 1546
1197 Ga0495587_0001148 3300046536 Bacteria 17383
1198 Ga0495587_0011486 3300046536 Bacteria 5609
1199 Ga0495587_0013274 3300046536 Bacteria 5179
1200 Ga0495587_0141376 3300046536 Unclassified 1374
1201 Ga0495587_0222737 3300046536 Unclassified 1064
1202 Ga0495598_0027162 3300046537 Bacteria 1576
1203 Ga0495609_0015778 3300046538 Bacteria 3531
1204 Ga0495621_0372411 3300046539 Bacteria 602
1205 Ga0495645_0159263 3300046543 Unclassified 1562
1206 Ga0495645_0216685 3300046543 Unclassified 1290
1207 Ga0495645_0518724 3300046543 Bacteria 743
1208 Ga0495667_0058295 3300046559 Bacteria 2537
1209 Ga0495667_0124185 3300046559 Unclassified 1666
1210 Ga0495667_0610827 3300046559 Unclassified 679
1211 Ga0495656_0011957 3300046615 Bacteria 3194
1212 Ga0495635_0488039 3300046663 Bacteria 812
1213 Ga0495635_0590106 3300046663 Bacteria 726
1214 Ga0495659_0075681 3300046664 Bacteria 1268
1215 Ga0495659_0116345 3300046664 Unclassified 1048
1216 Ga0495657_0545635 3300046675 Unclassified 674
1217 Ga0495657_0893905 3300046675 Bacteria 505
1218 Ga0495599_0002747 3300046678 Bacteria 10267
1219 Ga0495599_0005840 3300046678 Bacteria 7393
1220 Ga0495599_0089696 3300046678 Bacteria 1919
1221 Ga0495599_0123211 3300046678 Unclassified 1611
1222 Ga0495599_0402358 3300046678 Bacteria 815
1223 Ga0495599_0479268 3300046678 Unclassified 734
1224 Ga0495599_0654289 3300046678 Unclassified 608
1225 Ga0495623_0055150 3300046679 Bacteria 2506
1226 Ga0495647_0070439 3300046681 Bacteria 1399
1227 Ga0495669_0170874 3300046684 Bacteria 1034
1228 Ga0495613_0032157 3300046689 Unclassified 3897
1229 Ga0495613_0033856 3300046689 Bacteria 3795
1230 Ga0495613_0402817 3300046689 Bacteria 933
1231 Ga0495600_0096251 3300046809 Bacteria 1930
1232 Ga0495600_0113205 3300046809 Unclassified 1767
1233 Ga0495581_0134208 3300047315 Bacteria 1443
1234 Ga0495604_0425390 3300047317 Bacteria 871
1235 Ga0495636_0017244 3300047318 Unclassified 2889
1236 Ga0495636_0114688 3300047318 Bacteria 1188
1237 Ga0495636_0468121 3300047318 Unclassified 607
1238 Ga0495674_0073136 3300047319 Bacteria 2956
1239 Ga0495674_0162803 3300047319 Unclassified 1866
1240 Ga0495680_0531040 3300047322 Bacteria 795
1241 Ga0495680_0583449 3300047322 Bacteria 750
1242 Ga0495675_0054515 3300047444 Unclassified 2537
1243 Ga0495675_0280381 3300047444 Bacteria 994
1244 Ga0495675_0554746 3300047444 Bacteria 655
1245 Ga0495677_0025708 3300047445 Unclassified 2136
1246 Ga0495677_0327133 3300047445 Unclassified 604
1247 Ga0495684_0005160 3300047471 Bacteria 10178
1248 Ga0495684_0008399 3300047471 Bacteria 7997
1249 Ga0495684_0491259 3300047471 Unclassified 846
1250 Ga0495602_0004288 3300048088 Bacteria 14849
1251 Ga0495602_0027992 3300048088 Bacteria 5405
1252 Ga0495602_1028660 3300048088 Unclassified 542
1253 Ga0496101_1223163 3300048904 Unclassified 588
1254 Ga0496104_0114079 3300048907 Plasmid 2591
1255 Ga0496104_0159263 3300048907 Bacteria 2166
1256 Ga0496105_0339015 3300048908 Bacteria 1202
1257 Ga0496107_1227927 3300048910 Unclassified 538
1258 Ga0496108_0280509 3300048911 Bacteria 1451
1259 Ga0496109_0310786 3300048912 Bacteria 1487
1260 Ga0496109_1183307 3300048912 Unclassified 701
1261 Ga0496112_0068296 3300048915 Bacteria 3509
1262 Ga0496112_1233309 3300048915 Unclassified 664
1263 Ga0496113_0089071 3300048916 Bacteria 2375
1264 Ga0496114_0000515 3300048917 Bacteria 28421
1265 Ga0496115_0203300 3300048918 Unclassified 1636
1266 Ga0496115_0631447 3300048918 Unclassified 849
1267 Ga0501031_1004704 3300049568 Unclassified 533
1268 Ga0501036_0827086 3300049572 Unclassified 762
1269 Ga0501036_1210707 3300049572 Unclassified 615
1270 Ga0501039_0543551 3300049575 Bacteria 912
1271 Ga0501040_0615093 3300049576 Bacteria 785
1272 Ga0501041_0089304 3300049577 Bacteria 1903
1273 Ga0501042_0314539 3300049578 Bacteria 1131
1274 Ga0501042_1088986 3300049578 Unclassified 582
1275 Ga0501043_0864408 3300049579 Bacteria 651
1276 Ga0501048_0457116 3300049582 Bacteria 915
1277 Ga0501048_0614575 3300049582 Bacteria 780
1278 Ga0501048_1058334 3300049582 Bacteria 584
1279 Ga0501068_0600910 3300049584 Unclassified 717
1280 Ga0501071_0071166 3300049587 Bacteria 2535
1281 Ga0501071_0081775 3300049587 Unclassified 2364
1282 Ga0501071_0907566 3300049587 Bacteria 680
1283 Ga0501071_1081316 3300049587 Unclassified 620
1284 Ga0501072_0032837 3300049588 Bacteria 4066
1285 Ga0501072_0103475 3300049588 Unclassified 2263
1286 Ga0501074_0355926 3300049590 Unclassified 1039
1287 Ga0501075_0072953 3300049591 Bacteria 2595
1288 Ga0501075_0400545 3300049591 Unclassified 1046
1289 Ga0501075_0818820 3300049591 Bacteria 708
1290 Ga0501076_0525307 3300049592 Bacteria 976
1291 Ga0501076_0734288 3300049592 Unclassified 815
1292 Ga0501076_0950862 3300049592 Bacteria 708
1293 Ga0501079_0659506 3300049741 Bacteria 824
1294 Ga0501081_1051522 3300049743 Bacteria 616
1295 nmdc:mga05p37_1255215_c1 3300050507 Unclassified 760
1296 nmdc:mga05p37_1267785_c1 3300050507 Unclassified 754
1297 nmdc:mga05p37_41774_c1 3300050507 Bacteria 5631
1298 nmdc:mga05p37_9001_c1 3300050507 Bacteria 8870
1299 nmdc:mga09592_20174_c1 3300050508 Bacteria 5477
1300 nmdc:mga09592_563462_c1 3300050508 Unclassified 978
1301 nmdc:mga09592_6242_c1 3300050508 Bacteria 9705
1302 nmdc:mga09592_6838_c1 3300050508 Bacteria 9283
1303 nmdc:mga0qj67_14222_c1 3300050509 Bacteria 6015
1304 nmdc:mga0qj67_18992_c1 3300050509 Bacteria 5246
1305 nmdc:mga0qj67_243841_c1 3300050509 Bacteria 1458
1306 nmdc:mga0qj67_320250_c1 3300050509 Bacteria 1255
1307 nmdc:mga0qj67_74584_c1 3300050509 Bacteria 2711
1308 nmdc:mga06r32_47913_c1 3300050510 Bacteria 4084
1309 nmdc:mga08y16_146855_c1 3300050511 Bacteria 2452
1310 nmdc:mga08y16_159457_c1 3300050511 Bacteria 2344
1311 nmdc:mga08y16_21290_c1 3300050511 Bacteria 6846
1312 nmdc:mga08y16_28325_c1 3300050511 Bacteria 5905
1313 nmdc:mga08y16_38725_c1 3300050511 Bacteria 5004
1314 nmdc:mga08y16_534348_c1 3300050511 Bacteria 1188
1315 nmdc:mga08y16_715_c1 3300050511 Bacteria 31535
1316 nmdc:mga0n895_131017_c1 3300050512 Bacteria 2533
1317 nmdc:mga0n895_1467169_c1 3300050512 Bacteria 649
1318 nmdc:mga0n895_370138_c1 3300050512 Bacteria 1451
1319 nmdc:mga0n895_584126_c1 3300050512 Bacteria 1121
1320 nmdc:mga0rr50_1182568_c1 3300050513 Unclassified 650
1321 nmdc:mga0rr50_130167_c1 3300050513 Bacteria 2014
1322 nmdc:mga0rr50_277036_c1 3300050513 Bacteria 1399
1323 nmdc:mga0rr50_613594_c1 3300050513 Bacteria 928
1324 nmdc:mga08x19_325325_c1 3300050514 Unclassified 1070
1325 nmdc:mga08x19_432811_c1 3300050514 Unclassified 925
1326 nmdc:mga08x19_650892_c1 3300050514 Bacteria 747
1327 nmdc:mga08x19_720487_c1 3300050514 Unclassified 708
1328 nmdc:mga0a205_129296_c2 3300050515 Bacteria 807
1329 nmdc:mga0a205_177397_c1 3300050515 Bacteria 2026
1330 Ga0495601_0163507 3300053077 Bacteria 1455
1331 Ga0495601_0392563 3300053077 Unclassified 900
1332 Ga0495595_0443513 3300053084 Bacteria 660
1333 Ga0495619_0132605 3300053085 Unclassified 1713
1334 Ga0495619_0569993 3300053085 Unclassified 776
1335 Ga0495619_0822349 3300053085 Bacteria 628
1336 Ga0500641_0147194 3300053096 Bacteria 1017
1337 Ga0500568_0000723 3300053139 Bacteria 23653
1338 Ga0590074_068829 3300059423 Unclassified 665
1339 Ga0105247_10808210
1340 Ga0058863_11384065
1341 Ga0058863_11860520
1342 Ga0058861_11360516
1343 Ga0058861_11653710
1344 Ga0058861_11906043
1345 Ga0058860_10572999
1346 Ga0058862_10882323
1347 Ga0058862_12292071
1348 Ga0058862_12848695
1349 Ga0058862_12883805
1350 Ga0065704_10227521
1351 Ga0065707_10215388
1352 Ga0070658_10309734
1353 Ga0070676_10188458
1354 Ga0070676_10414428
1355 Ga0070676_11582046
1356 Ga0070683_100002345
1357 Ga0070683_100007027
1358 Ga0070683_100007330
1359 Ga0070683_100026483
1360 Ga0070683_100031320
1361 Ga0070683_100034975
1362 Ga0070683_100050632
1363 Ga0070683_100056252
1364 Ga0070683_100062857
1365 Ga0070683_100069695
1366 Ga0070683_100069785
1367 Ga0070683_100079969
1368 Ga0070683_100243025
1369 Ga0070683_100324622
1370 Ga0070683_100596853
1371 Ga0070683_100828048
1372 Ga0070683_101015345
1373 Ga0070683_101034575
1374 Ga0070683_101204223
1375 Ga0070690_100050211
1376 Ga0070690_100317884
1377 Ga0070690_100786286
1378 Ga0070670_100005882
1379 Ga0070670_100320100
1380 Ga0068869_100078093
1381 Ga0068869_100193464
1382 Ga0068869_100588296
1383 Ga0068869_100977678
1384 Ga0068869_101370855
1385 Ga0068869_101734854
1386 Ga0070666_10024073
1387 Ga0070666_10215985
1388 Ga0070666_10405754
1389 Ga0070666_10422344
1390 Ga0070666_10559303
1391 Ga0070680_100013477
1392 Ga0070680_100029837
1393 Ga0070680_100151391
1394 Ga0070680_100229327
1395 Ga0070680_101308905
1396 Ga0070682_100457078
1397 Ga0070682_101110468
1398 Ga0070682_101298510
1399 Ga0068868_100023014
1400 Ga0068868_100137746
1401 Ga0068868_101293173
1402 Ga0070660_100038870
1403 Ga0070660_100046368
1404 Ga0070660_100074978
1405 Ga0070660_100112143
1406 Ga0070660_100217900
1407 Ga0070689_100114995
1408 Ga0070689_100206846
1409 Ga0070689_100472252
1410 Ga0070691_10012040
1411 Ga0070691_10018047
1412 Ga0070691_10134706
1413 Ga0070691_10333633
1414 Ga0070691_10456970
1415 Ga0070687_100952647
1416 Ga0070661_100060635
1417 Ga0070661_100264588
1418 Ga0070661_100337359
1419 Ga0070661_100349870
1420 Ga0070692_10109473
1421 Ga0070692_10191505
1422 Ga0070668_100337956
1423 Ga0070669_100428240
1424 Ga0070669_101022808
1425 Ga0070675_100149917
1426 Ga0070675_100194911
1427 Ga0070675_100214200
1428 Ga0070671_100040252
1429 Ga0070671_100157345
1430 Ga0070671_100917285
1431 Ga0070674_100335792
1432 Ga0070674_100513238
1433 Ga0070674_100542029
1434 Ga0070674_100996114
1435 Ga0070673_100005787
1436 Ga0070673_100106619
1437 Ga0070673_100124756
1438 Ga0070673_100169976
1439 Ga0070673_100182409
1440 Ga0070673_100256744
1441 Ga0070673_100424792
1442 Ga0070673_100896624
1443 Ga0070688_100074661
1444 Ga0070688_101739814
1445 Ga0070659_100047286
1446 Ga0070659_100075163
1447 Ga0070667_100001720
1448 Ga0070667_100147324
1449 Ga0070667_100974453
1450 Ga0070667_101886084
1451 Ga0070703_10232305
1452 Ga0070709_10028638
1453 Ga0070709_10064165
1454 Ga0070709_10222275
1455 Ga0070709_10415598
1456 Ga0070714_100044338
1457 Ga0070714_100368355
1458 Ga0070714_100455186
1459 Ga0070713_100016997
1460 Ga0070713_100028621
1461 Ga0070713_100030488
1462 Ga0070713_100054358
1463 Ga0070713_100107017
1464 Ga0070713_100175678
1465 Ga0070713_100636098
1466 Ga0070713_100690245
1467 Ga0070713_100817213
1468 Ga0070710_10395325
1469 Ga0070710_10457965
1470 Ga0070710_10506795
1471 Ga0070701_10004374
1472 Ga0070701_10018944
1473 Ga0070701_10038134
1474 Ga0070711_100046631
1475 Ga0070711_100075032
1476 Ga0070711_100092618
1477 Ga0070711_100104359
1478 Ga0070711_100152967
1479 Ga0070711_100162332
1480 Ga0070711_100434143
1481 Ga0070711_102007357
1482 Ga0070705_100001435
1483 Ga0070705_100002500
1484 Ga0070705_100133950
1485 Ga0070705_100200815
1486 Ga0070705_100792466
1487 Ga0070705_100943505
1488 Ga0070705_101458352
1489 Ga0070700_100032779
1490 Ga0070700_100071387
1491 Ga0070700_100095694
1492 Ga0070700_100214486
1493 Ga0070694_100003150
1494 Ga0070694_100108601
1495 Ga0070694_100279690
1496 Ga0070694_100305915
1497 Ga0070694_100355481
1498 Ga0070694_100417269
1499 Ga0070694_100548720
1500 Ga0070694_100641547
1501 Ga0070663_100834405
1502 Ga0070678_100470508
1503 Ga0070662_100004942
1504 Ga0070662_100181864
1505 Ga0070662_100311062
1506 Ga0070681_10002128
1507 Ga0070681_10004375
1508 Ga0070681_10059269
1509 Ga0070681_10241004
1510 Ga0068867_100100292
1511 Ga0068867_100149478
1512 Ga0068867_100359435
1513 Ga0068867_100732239
1514 Ga0068867_101183253
1515 Ga0070685_10277332
1516 Ga0070706_100387980
1517 Ga0070698_100009281
1518 Ga0070698_100198166
1519 Ga0070698_100932935
1520 Ga0070698_100960636
1521 Ga0070699_100009166
1522 Ga0070699_100069062
1523 Ga0070699_101650130
1524 Ga0070679_100000317
1525 Ga0070679_100000639
1526 Ga0070679_100042258
1527 Ga0070679_100607365
1528 Ga0070679_101033822
1529 Ga0070679_101042627
1530 Ga0070684_100001053
1531 Ga0070684_100009305
1532 Ga0070684_100009843
1533 Ga0070684_100023219
1534 Ga0070684_100053538
1535 Ga0070684_100066215
1536 Ga0070684_100083416
1537 Ga0070684_100084648
1538 Ga0070684_100128939
1539 Ga0070684_100248814
1540 Ga0070684_100373886
1541 Ga0070684_101167988
1542 Ga0070697_100271570
1543 Ga0070697_100620213
1544 Ga0070697_100807347
1545 Ga0070697_101959118
1546 Ga0068853_100038010
1547 Ga0068853_100053906
1548 Ga0068853_100110004
1549 Ga0068853_100112737
1550 Ga0068853_100180352
1551 Ga0068853_100773026
1552 Ga0068853_101847532
1553 Ga0070672_100102173
1554 Ga0070672_100639645
1555 Ga0070672_101656389
1556 Ga0070686_100141638
1557 Ga0070686_100181556
1558 Ga0070686_100303310
1559 Ga0070686_100463144
1560 Ga0070686_100806880
1561 Ga0070695_100000407
1562 Ga0070695_100025631
1563 Ga0070695_100152647
1564 Ga0070695_100161808
1565 Ga0070695_100270632
1566 Ga0070695_100401465
1567 Ga0070696_100000265
1568 Ga0070696_100012427
1569 Ga0070696_100348614
1570 Ga0070696_100515654
1571 Ga0070696_100763280
1572 Ga0070696_100881679
1573 Ga0070696_101528324
1574 Ga0070696_101627935
1575 Ga0070693_100015589
1576 Ga0070693_100027826
1577 Ga0070693_100079038
1578 Ga0070693_100094819
1579 Ga0070693_100157229
1580 Ga0070693_100524306
1581 Ga0070693_100834722
1582 Ga0070693_101197686
1583 Ga0070665_100029385
1584 Ga0070665_100471424
1585 Ga0070704_100001131
1586 Ga0070704_100004525
1587 Ga0070704_100006854
1588 Ga0070704_100098296
1589 Ga0070704_100145312
1590 Ga0070704_101572347
1591 Ga0068855_100001577
1592 Ga0068855_100004380
1593 Ga0068855_100004802
1594 Ga0068855_100079247
1595 Ga0068855_100085923
1596 Ga0068855_100263485
1597 Ga0068855_100350783
1598 Ga0068855_100374191
1599 Ga0068855_100442408
1600 Ga0068855_100546995
1601 Ga0068855_101284731
1602 Ga0070664_100009191
1603 Ga0070664_100033980
1604 Ga0070664_100461521
1605 Ga0070664_101156707
1606 Ga0070664_101769445
1607 Ga0068857_100000258
1608 Ga0068857_100004932
1609 Ga0068857_100005540
1610 Ga0068857_100027212
1611 Ga0068857_100035682
1612 Ga0068857_100170260
1613 Ga0068857_101192127
1614 Ga0068854_100085439
1615 Ga0068854_100921715
1616 Ga0068854_101701363
1617 Ga0068856_100003558
1618 Ga0068856_100010203
1619 Ga0068856_100030989
1620 Ga0068856_100034694
1621 Ga0068856_100048690
1622 Ga0068856_100062628
1623 Ga0068856_100075098
1624 Ga0068856_100113605
1625 Ga0068856_100169115
1626 Ga0068856_100194880
1627 Ga0068856_100403588
1628 Ga0068856_100425021
1629 Ga0068856_100755802
1630 Ga0070702_100209624
1631 Ga0068852_100009583
1632 Ga0068852_100017258
1633 Ga0068852_100268314
1634 Ga0068852_101113263
1635 Ga0068852_101178096
1636 Ga0068852_102023223
1637 Ga0068852_102423238
1638 Ga0068859_100008801
1639 Ga0068859_100012958
1640 Ga0068859_100026501
1641 Ga0068859_100059021
1642 Ga0068859_100211503
1643 Ga0068859_100494008
1644 Ga0068859_100525913
1645 Ga0068859_101088092
1646 Ga0068864_100006937
1647 Ga0068864_100077999
1648 Ga0068864_100235391
1649 Ga0068864_100348485
1650 Ga0068866_10182525
1651 Ga0068866_10205960
1652 Ga0068866_10497184
1653 Ga0068866_10892475
1654 Ga0068861_100005313
1655 Ga0068861_100006410
1656 Ga0068861_100026627
1657 Ga0068861_100167407
1658 Ga0068861_100835351
1659 Ga0068861_101032376
1660 Ga0068851_10078327
1661 Ga0068851_10715605
1662 Ga0068870_11154938
1663 Ga0068863_100015411
1664 Ga0068863_100117366
1665 Ga0068863_100303809
1666 Ga0068863_100467116
1667 Ga0068863_100478709
1668 Ga0068863_101005994
1669 Ga0068858_100017530
1670 Ga0068858_100048367
1671 Ga0068858_100055499
1672 Ga0068858_100094353
1673 Ga0068858_100099888
1674 Ga0068858_100115429
1675 Ga0068858_100167608
1676 Ga0068858_100457005
1677 Ga0068858_100529589
1678 Ga0068858_100985601
1679 Ga0068858_101013366
1680 Ga0068858_101287710
1681 Ga0068858_101544909
1682 Ga0068860_100042646
1683 Ga0068860_100045862
1684 Ga0068860_100248656
1685 Ga0068860_100266306
1686 Ga0068860_100407982
1687 Ga0068860_100778569
1688 Ga0068860_101658591
1689 Ga0068862_100108121
1690 Ga0068862_100123311
1691 Ga0068862_100226343
1692 Ga0068862_100724522
1693 Ga0070717_10638574
1694 Ga0075432_10123011
1695 Ga0070715_10993176
1696 Ga0070712_100939191
1697 Ga0097621_100001713
1698 Ga0097621_100044563
1699 Ga0097621_100074616
1700 Ga0097621_100098703
1701 Ga0097621_100159274
1702 Ga0097621_100257700
1703 Ga0097621_100273876
1704 Ga0097621_100360336
1705 Ga0097621_101257981
1706 Ga0068871_100004335
1707 Ga0068871_100005439
1708 Ga0068871_100035400
1709 Ga0068871_100037842
1710 Ga0068871_100119170
1711 Ga0068871_100119280
1712 Ga0068871_100135605
1713 Ga0068871_100598174
1714 Ga0068871_100778149
1715 Ga0068871_100800608
1716 Ga0068871_100941247
1717 Ga0075428_100007745
1718 Ga0075428_100017987
1719 Ga0075428_100247730
1720 Ga0075430_100005720
1721 Ga0075430_100072688
1722 Ga0075430_100228350
1723 Ga0075430_100842287
1724 Ga0075430_101137886
1725 Ga0075431_100064718
1726 Ga0075431_100152444
1727 Ga0075431_101944344
1728 Ga0075433_10447888
1729 Ga0075433_10567027
1730 Ga0075434_100128556
1731 Ga0075434_100654962
1732 Ga0075434_100722181
1733 Ga0075434_101667684
1734 Ga0075429_100045776
1735 Ga0075429_100067494
1736 Ga0075429_100085822
1737 Ga0075429_100151178
1738 Ga0068865_100031670
1739 Ga0068865_100031693
1740 Ga0068865_100098943
1741 Ga0068865_100487359
1742 Ga0068865_100956431
1743 Ga0068865_101606170
1744 Ga0075436_100290454
1745 Ga0075436_100349979
1746 Ga0075436_100367120
1747 Ga0075436_100376584
1748 Ga0075436_101125609
1749 Ga0097620_100008801
1750 Ga0097620_100012958
1751 Ga0097620_100026501
1752 Ga0097620_100059022
1753 Ga0097620_100211504
1754 Ga0097620_100494032
1755 Ga0097620_100525853
1756 Ga0097620_101087907
1757 Ga0075435_100089398
1758 Ga0075435_100127083
1759 Ga0075435_100375399
1760 Ga0105240_10003712
1761 Ga0105240_10009712
1762 Ga0105240_10009808
1763 Ga0105240_10023985
1764 Ga0105240_10034115
1765 Ga0105240_10035184
1766 Ga0105240_10041342
1767 Ga0105240_10205588
1768 Ga0105240_10219055
1769 Ga0105240_10267218
1770 Ga0105240_11047394
1771 Ga0105240_11276118
1772 Ga0105240_11679224
1773 Ga0111539_10000958
1774 Ga0111539_10003608
1775 Ga0111539_10019744
1776 Ga0111539_10027853
1777 Ga0111539_10068616
1778 Ga0111539_10249338
1779 Ga0111539_10481335
1780 Ga0111539_11371072
1781 Ga0105245_10000754
1782 Ga0105245_10002867
1783 Ga0105245_10003919
1784 Ga0105245_10005756
1785 Ga0105245_10113908
1786 Ga0105245_10129763
1787 Ga0105245_10276027
1788 Ga0105245_10279186
1789 Ga0105245_10375500
1790 Ga0105245_10502835
1791 Ga0105245_10568068
1792 Ga0105245_10768019
1793 Ga0105245_11188548
1794 Ga0105245_11201318
1795 Ga0105245_11366157
1796 Ga0105245_11902657
1797 Ga0105245_11928547
1798 Ga0105245_12533262
1799 Ga0105247_10006758
1800 Ga0105247_10085628
1801 Ga0105247_10762319
1802 Ga0114129_10033252
1803 Ga0114129_10043256
1804 Ga0114129_10089655
1805 Ga0114129_10257597
1806 Ga0114129_11155077
1807 Ga0105243_10031200
1808 Ga0105243_10098187
1809 Ga0105243_10169464
1810 Ga0105243_10198107
1811 Ga0105243_10428371
1812 Ga0105243_10594427
1813 Ga0105243_10597125
1814 Ga0105243_10777265
1815 Ga0105243_10897446
1816 Ga0105243_11263761
1817 Ga0105241_10001981
1818 Ga0105241_10011630
1819 Ga0105241_10024030
1820 Ga0105241_10027465
1821 Ga0105241_10032106
1822 Ga0105241_10041476
1823 Ga0105241_10051576
1824 Ga0105241_10200353
1825 Ga0105241_10231934
1826 Ga0105241_10363931
1827 Ga0105241_10515037
1828 Ga0105241_10552410
1829 Ga0105241_11080366
1830 Ga0105242_10007238
1831 Ga0105242_10042795
1832 Ga0105242_10077281
1833 Ga0105242_10170661
1834 Ga0105242_10301643
1835 Ga0105242_10451686
1836 Ga0105242_10466061
1837 Ga0105242_10495189
1838 Ga0105242_10560194
1839 Ga0105242_10855356
1840 Ga0105242_11095123
1841 Ga0105242_11233312
1842 Ga0105242_11583147
1843 Ga0105248_10011826
1844 Ga0105248_10013168
1845 Ga0105248_10014349
1846 Ga0105248_10018424
1847 Ga0105248_10086468
1848 Ga0105248_10299821
1849 Ga0105248_10539373
1850 Ga0105248_10623352
1851 Ga0105248_10811860
1852 Ga0105248_11139912
1853 Ga0105248_11139966
1854 Ga0105248_11317254
1855 Ga0105237_10002229
1856 Ga0105237_10007164
1857 Ga0105237_10008691
1858 Ga0105237_10022516
1859 Ga0105237_10081337
1860 Ga0105237_10097535
1861 Ga0105237_10254467
1862 Ga0105237_10517210
1863 Ga0105237_10548644
1864 Ga0105237_10924609
1865 Ga0105237_12684996
1866 Ga0105238_10000501
1867 Ga0105238_10006331
1868 Ga0105238_10006587
1869 Ga0105238_10015716
1870 Ga0105238_10020664
1871 Ga0105238_10025280
1872 Ga0105238_10027385
1873 Ga0105238_10032749
1874 Ga0105238_10034653
1875 Ga0105238_10036307
1876 Ga0105238_10050586
1877 Ga0105238_10056869
1878 Ga0105238_10131851
1879 Ga0105238_10216919
1880 Ga0105238_10388061
1881 Ga0105238_10941832
1882 Ga0105238_11140645
1883 Ga0105249_10003722
1884 Ga0105249_10056752
1885 Ga0105249_10087873
1886 Ga0105249_10516197
1887 Ga0105249_10633142
1888 Ga0105249_10752844
1889 Ga0105249_11183634
1890 Ga0105249_11556958
1891 Ga0105249_12083674
1892 Ga0105239_10006720
1893 Ga0105239_10008026
1894 Ga0105239_10014929
1895 Ga0105239_10016121
1896 Ga0105239_10018915
1897 Ga0105239_10019532
1898 Ga0105239_10074835
1899 Ga0105239_10138119
1900 Ga0105239_10140003
1901 Ga0105239_10190256
1902 Ga0105239_10212868
1903 Ga0105239_10410491
1904 Ga0105239_10445548
1905 Ga0105239_10449699
1906 Ga0105239_10484894
1907 Ga0105239_11902886
1908 Ga0105239_12719388
1909 Ga0105246_10001430
1910 Ga0105246_10002423
1911 Ga0105246_10006397
1912 Ga0105246_10023226
1913 Ga0105246_10152689
1914 Ga0105246_10265826
1915 Ga0105246_10787935
1916 Ga0105246_10938555
1917 Ga0105246_11809137
1918 Ga0157371_10105868
1919 Ga0157371_10451920
1920 Ga0157370_10000997
1921 Ga0157370_10002206
1922 Ga0157370_10006724
1923 Ga0157370_10014006
1924 Ga0157370_10016306
1925 Ga0157370_10043153
1926 Ga0157370_11043857
1927 Ga0157369_10002687
1928 Ga0157369_10005354
1929 Ga0157369_10015762
1930 Ga0157369_10025785
1931 Ga0157369_10053765
1932 Ga0157369_10080526
1933 Ga0157369_10146031
1934 Ga0157369_10177368
1935 Ga0157369_10789969
1936 Ga0157369_11219750
1937 Ga0157369_11302290
1938 Ga0157374_10015751
1939 Ga0157374_10032701
1940 Ga0157374_10114113
1941 Ga0157374_10129332
1942 Ga0157374_10160587
1943 Ga0157374_10418116
1944 Ga0157374_10525097
1945 Ga0157374_10798042
1946 Ga0157374_10891249
1947 Ga0157374_10924086
1948 Ga0157374_11024379
1949 Ga0157378_10002798
1950 Ga0157378_10004041
1951 Ga0157378_10465355
1952 Ga0157378_10866816
1953 Ga0157378_11033114
1954 Ga0157378_11617900
1955 Ga0157378_12770649
1956 Ga0157378_13277404
1957 Ga0163162_10090963
1958 Ga0163162_10353274
1959 Ga0163162_10369517
1960 Ga0163162_10727026
1961 Ga0163162_11332136
1962 Ga0163162_11416531
1963 Ga0163162_12097785
1964 Ga0163162_12975431
1965 Ga0157372_10001007
1966 Ga0157372_10007331
1967 Ga0157372_10018708
1968 Ga0157372_10043736
1969 Ga0157372_10079946
1970 Ga0157372_10116247
1971 Ga0157372_10126745
1972 Ga0157372_10228683
1973 Ga0157372_10298647
1974 Ga0157372_10428805
1975 Ga0157372_10732126
1976 Ga0157372_11386798
1977 Ga0157375_10005619
1978 Ga0157375_10006921
1979 Ga0157375_10296682
1980 Ga0157375_10344053
1981 Ga0157375_10542131
1982 Ga0157375_11055096
1983 Ga0157375_11088474
1984 Ga0157375_11508388
1985 Ga0163163_10003209
1986 Ga0163163_10007001
1987 Ga0163163_10016291
1988 Ga0163163_10041340
1989 Ga0163163_10083126
1990 Ga0163163_10161842
1991 Ga0163163_10719115
1992 Ga0163163_10795672
1993 Ga0163163_11189163
1994 Ga0163163_11212101
1995 Ga0163163_11560441
1996 Ga0163163_11654389
1997 Ga0163163_12482759
1998 Ga0157380_10234790
1999 Ga0157380_10321361
2000 Ga0157380_10491402
2001 Ga0157377_10112470
2002 Ga0157377_11650735
2003 Ga0157379_10002290
2004 Ga0157379_10007941
2005 Ga0157379_10172978
2006 Ga0157379_10301958
2007 Ga0157379_10589147
2008 Ga0157379_11648638
2009 Ga0157376_10001111
2010 Ga0157376_10053435
2011 Ga0157376_10086011
2012 Ga0157376_10155812
2013 Ga0157376_10177946
2014 Ga0157376_10302621
2015 Ga0157376_10532277
2016 Ga0197907_10345105
2017 Ga0197907_11169527
2018 Ga0197907_11388186
2019 Ga0197907_11513640
2020 Ga0206356_10260711
2021 Ga0206356_10950623
2022 Ga0206356_11094542
2023 Ga0206356_11795575
2024 Ga0206349_1966464
2025 Ga0206355_1240202
2026 Ga0206355_1373007
2027 Ga0206351_10018568
2028 Ga0206352_10265365
2029 Ga0206352_10467909
2030 Ga0206352_10647886
2031 Ga0206352_10969492
2032 Ga0206350_10410420
2033 Ga0206350_10936759
2034 Ga0206350_11445424
2035 Ga0206353_10638504
2036 Ga0206353_10965158
2037 Ga0154015_1088118
2038 Ga0154015_1316610
2039 Ga0154015_1543362
2040 Ga0213876_10042224
2041 Ga0213875_10120989
2042 Ga0213875_10196336
2043 Ga0213875_10333362
2044 Ga0213875_10372449
2045 Ga0224712_10002814
2046 Ga0224712_10075851
2047 Ga0224712_10538292
2048 Ga0207653_10129309
2049 Ga0207692_10239797
2050 Ga0207692_10257194
2051 Ga0207642_10299173
2052 Ga0207642_10524103
2053 Ga0207710_10008409
2054 Ga0207710_10039475
2055 Ga0207710_10077349
2056 Ga0207688_10059826
2057 Ga0207680_10013380
2058 Ga0207680_10272733
2059 Ga0207685_10285361
2060 Ga0207685_10789037
2061 Ga0207699_10010851
2062 Ga0207699_10040041
2063 Ga0207699_10051436
2064 Ga0207699_10439831
2065 Ga0207699_11326260
2066 Ga0207645_10045868
2067 Ga0207645_10188582
2068 Ga0207705_10111014
2069 Ga0207705_10330822
2070 Ga0207654_10016430
2071 Ga0207654_10028865
2072 Ga0207654_10036838
2073 Ga0207654_10045743
2074 Ga0207654_10097603
2075 Ga0207654_10101058
2076 Ga0207654_10113388
2077 Ga0207654_10261512
2078 Ga0207654_10378544
2079 Ga0207654_11300093
2080 Ga0207707_10000239
2081 Ga0207707_10005887
2082 Ga0207707_10017387
2083 Ga0207707_10044979
2084 Ga0207707_10277788
2085 Ga0207707_11191863
2086 Ga0207695_10000688
2087 Ga0207695_10005342
2088 Ga0207695_10011291
2089 Ga0207695_10023442
2090 Ga0207695_10040357
2091 Ga0207695_10106740
2092 Ga0207695_10132059
2093 Ga0207695_10249922
2094 Ga0207695_11045500
2095 Ga0207671_10007282
2096 Ga0207671_10009145
2097 Ga0207671_10015198
2098 Ga0207671_10045192
2099 Ga0207671_10238237
2100 Ga0207671_10724871
2101 Ga0207663_10135976
2102 Ga0207663_10221892
2103 Ga0207663_10768809
2104 Ga0207663_11205911
2105 Ga0207663_11497263
2106 Ga0207660_10014708
2107 Ga0207660_10027061
2108 Ga0207660_10205912
2109 Ga0207660_10421633
2110 Ga0207660_10496146
2111 Ga0207660_10578862
2112 Ga0207662_10194867
2113 Ga0207662_10596903
2114 Ga0207657_10049976
2115 Ga0207657_10094357
2116 Ga0207657_10151274
2117 Ga0207657_10499321
2118 Ga0207649_10346133
2119 Ga0207649_10467036
2120 Ga0207649_10474559
2121 Ga0207649_10545018
2122 Ga0207649_10573183
2123 Ga0207649_10684279
2124 Ga0207652_10000872
2125 Ga0207652_10012468
2126 Ga0207652_10168082
2127 Ga0207652_10365969
2128 Ga0207681_10424427
2129 Ga0207681_11407598
2130 Ga0207694_10003106
2131 Ga0207694_10003534
2132 Ga0207694_10005943
2133 Ga0207694_10008251
2134 Ga0207694_10012985
2135 Ga0207694_10026656
2136 Ga0207694_10040522
2137 Ga0207694_10044764
2138 Ga0207694_10060786
2139 Ga0207694_10079545
2140 Ga0207694_10104193
2141 Ga0207694_10222267
2142 Ga0207694_10360924
2143 Ga0207694_10380640
2144 Ga0207694_10845343
2145 Ga0207694_10856305
2146 Ga0207650_10263270
2147 Ga0207650_10265981
2148 Ga0207650_10486603
2149 Ga0207659_10041379
2150 Ga0207659_10079002
2151 Ga0207659_10431108
2152 Ga0207687_10000339
2153 Ga0207687_10000965
2154 Ga0207687_10001193
2155 Ga0207687_10001331
2156 Ga0207687_10006593
2157 Ga0207687_10150546
2158 Ga0207687_10194132
2159 Ga0207687_10229603
2160 Ga0207687_10303138
2161 Ga0207687_10343124
2162 Ga0207687_10470260
2163 Ga0207687_10487811
2164 Ga0207687_10997971
2165 Ga0207700_10023058
2166 Ga0207700_10051165
2167 Ga0207700_10119581
2168 Ga0207700_10150242
2169 Ga0207700_10176176
2170 Ga0207700_10782845
2171 Ga0207700_10885628
2172 Ga0207700_11200041
2173 Ga0207664_10081362
2174 Ga0207644_10121378
2175 Ga0207690_10203052
2176 Ga0207690_10999151
2177 Ga0207706_10051290
2178 Ga0207706_10207083
2179 Ga0207706_10258272
2180 Ga0207706_10502552
2181 Ga0207706_10515764
2182 Ga0207686_10009052
2183 Ga0207686_10017571
2184 Ga0207686_10049240
2185 Ga0207686_10107567
2186 Ga0207686_10428083
2187 Ga0207686_10491542
2188 Ga0207686_10607029
2189 Ga0207686_11131628
2190 Ga0207686_11290022
2191 Ga0207686_11660720
2192 Ga0207709_10043392
2193 Ga0207709_10057515
2194 Ga0207709_10126861
2195 Ga0207709_10508940
2196 Ga0207670_10071092
2197 Ga0207670_10127861
2198 Ga0207670_10261722
2199 Ga0207670_10380015
2200 Ga0207670_11787615
2201 Ga0207669_10052709
2202 Ga0207669_10584870
2203 Ga0207669_11303487
2204 Ga0207669_11590500
2205 Ga0207704_10006166
2206 Ga0207704_10172484
2207 Ga0207704_10609215
2208 Ga0207704_10707724
2209 Ga0207704_10708902
2210 Ga0207665_11510228
2211 Ga0207691_10161552
2212 Ga0207691_10559953
2213 Ga0207711_10003057
2214 Ga0207711_10009081
2215 Ga0207711_10009217
2216 Ga0207711_10025923
2217 Ga0207711_10106048
2218 Ga0207711_10168821
2219 Ga0207711_10295208
2220 Ga0207711_10388113
2221 Ga0207711_11936479
2222 Ga0207689_10044198
2223 Ga0207689_10101050
2224 Ga0207689_10141989
2225 Ga0207689_10188640
2226 Ga0207689_10208270
2227 Ga0207689_10247856
2228 Ga0207689_10324615
2229 Ga0207689_11140102
2230 Ga0207661_10006879
2231 Ga0207661_10014859
2232 Ga0207661_10017326
2233 Ga0207661_10018049
2234 Ga0207661_10023596
2235 Ga0207661_10040570
2236 Ga0207661_10084621
2237 Ga0207661_10111463
2238 Ga0207661_10167483
2239 Ga0207661_10268692
2240 Ga0207661_10323547
2241 Ga0207661_10693614
2242 Ga0207661_10832789
2243 Ga0207679_10012055
2244 Ga0207679_10192303
2245 Ga0207679_10343407
2246 Ga0207679_10604995
2247 Ga0207679_11078694
2248 Ga0207667_10001263
2249 Ga0207667_10002815
2250 Ga0207667_10005334
2251 Ga0207667_10007297
2252 Ga0207667_10088424
2253 Ga0207667_10165941
2254 Ga0207667_10268213
2255 Ga0207667_10281715
2256 Ga0207667_10686012
2257 Ga0207667_11222369
2258 Ga0207651_10009187
2259 Ga0207651_10136303
2260 Ga0207651_10149867
2261 Ga0207651_10181780
2262 Ga0207651_10519810
2263 Ga0207651_10552892
2264 Ga0207651_11317669
2265 Ga0207712_10003128
2266 Ga0207712_10062799
2267 Ga0207712_10430534
2268 Ga0207712_10953371
2269 Ga0207712_11313131
2270 Ga0207640_10074983
2271 Ga0207640_10362052
2272 Ga0207640_11272339
2273 Ga0207658_10116648
2274 Ga0207658_10299571
2275 Ga0207658_10529431
2276 Ga0207677_10212446
2277 Ga0207677_10348024
2278 Ga0207677_11595559
2279 Ga0207703_10023347
2280 Ga0207703_10107236
2281 Ga0207703_10141720
2282 Ga0207703_10142120
2283 Ga0207703_10271524
2284 Ga0207703_10514303
2285 Ga0207703_10524284
2286 Ga0207703_10972720
2287 Ga0207639_10013820
2288 Ga0207639_10046941
2289 Ga0207639_10126997
2290 Ga0207639_10152759
2291 Ga0207639_10181498
2292 Ga0207639_10369719
2293 Ga0207639_10465400
2294 Ga0207639_10820883
2295 Ga0207639_11397884
2296 Ga0207708_10021309
2297 Ga0207708_10037499
2298 Ga0207708_10188531
2299 Ga0207708_10255058
2300 Ga0207708_10352205
2301 Ga0207708_10387930
2302 Ga0207708_10458182
2303 Ga0207708_11677962
2304 Ga0207702_10004066
2305 Ga0207702_10005778
2306 Ga0207702_10015083
2307 Ga0207702_10045055
2308 Ga0207702_10045696
2309 Ga0207702_10068818
2310 Ga0207702_10075030
2311 Ga0207702_10102176
2312 Ga0207702_10178422
2313 Ga0207702_10324567
2314 Ga0207702_10697891
2315 Ga0207702_11634441
2316 Ga0207641_10348450
2317 Ga0207641_10531534
2318 Ga0207641_10550241
2319 Ga0207641_10638522
2320 Ga0207648_10074848
2321 Ga0207648_10128417
2322 Ga0207648_10366375
2323 Ga0207648_10859981
2324 Ga0207648_10976101
2325 Ga0207648_11979044
2326 Ga0207676_10035645
2327 Ga0207676_10055179
2328 Ga0207676_10808843
2329 Ga0207676_11832673
2330 Ga0207674_10000035
2331 Ga0207674_10000101
2332 Ga0207674_10000187
2333 Ga0207674_10001119
2334 Ga0207674_10001346
2335 Ga0207674_10009238
2336 Ga0207674_11172262
2337 Ga0207674_12217091
2338 Ga0207675_100002274
2339 Ga0207675_100003771
2340 Ga0207675_100003855
2341 Ga0207675_100220347
2342 Ga0207675_100232559
2343 Ga0207675_100899962
2344 Ga0207683_10336593
2345 Ga0207698_10030025
2346 Ga0207698_10058127
2347 Ga0207698_10461732
2348 Ga0207698_10759933
2349 Ga0207698_11281958
2350 Ga0207698_11358409
2351 Ga0207698_11665798
2352 Ga0207698_11676101
2353 Ga0209983_1040851
2354 Ga0209974_10342199
2355 Ga0207428_10023817
2356 Ga0207428_10034926
2357 Ga0207428_10047517
2358 Ga0207428_10060800
2359 Ga0207428_10157922
2360 Ga0207428_10258530
2361 Ga0207428_10339716
2362 Ga0268266_10138074
2363 Ga0268265_10032524
2364 Ga0268265_10079514
2365 Ga0268265_11548456
2366 Ga0268264_10078776
2367 Ga0268264_10134491
2368 Ga0268264_10216239
2369 Ga0268264_10634138
2370 Ga0268264_10836333
2371 Ga0268264_11060286
2372 Ga0268264_11447146
2373 Ga0268264_11618224
2374 Ga0268264_12135007
2375 Ga0265338_10265855
2376 Ga0265338_10783562
2377 Ga0316178_1065459
2378 Ga0265766_1012762
2379 Ga0265761_107455
2380 Ga0265760_10108614
2381 Ga0265760_10298254
2382 Ga0265340_10060438
2383 Ga0265313_10003726
2384 Ga0265313_10037651
2385 Ga0265314_10000216
2386 Ga0265314_10215465
2387 Ga0307405_12090089
2388 Ga0307413_10552266
2389 Ga0307413_11115968
2390 Ga0307410_11025746
2391 Ga0307406_10792529
2392 Ga0307416_100940942
2393 Ga0307416_102527223
2394 Ga0307411_10084496
2395 Ga0373934_0008713
2396 Ga0373934_0011047
2397 Ga0373934_0025370
2398 Ga0373934_0192680
2399 Ga0373934_0477963
2400 Ga0373949_0310785
2401 Ga0373952_0190577
2402 Ga0373923_0001630
2403 Ga0373923_0032759
2404 Ga0373923_0276864
2405 Ga0373923_0633190
2406 Ga0373923_0651865
2407 Ga0373932_0215559
2408 Ga0373936_0085361
2409 Ga0373936_0151066
2410 Ga0373945_0436833
2411 Ga0373953_0016546
2412 Ga0373953_0323307
2413 Ga0373954_0009618
2414 Ga0373954_0025706
2415 Ga0373954_0031641
2416 Ga0373954_0051598
2417 Ga0373954_0057398
2418 Ga0373954_0094897
2419 Ga0373954_0219683
2420 Ga0373954_0579479
2421 Ga0373956_0051017
2422 Ga0373956_0092851
2423 Ga0373957_0011268
2424 Ga0373957_0084898
2425 Ga0373957_0086224
2426 Ga0373957_0210694
2427 Ga0373957_0273425
2428 Ga0373943_0309150
2429 Ga0373943_0701557
2430 Ga0373946_0424304
2431 Ga0373955_0011914
2432 Ga0373955_0020013
2433 Ga0373955_0069483
2434 Ga0373955_0129042
2435 Ga0373955_0255000
2436 Ga0373955_0620131
2437 Ga0373955_0629694
2438 Ga0373962_0103317
2439 Ga0373924_0056918
2440 Ga0373924_0151665
2441 Ga0373931_0163170
2442 Ga0373935_0221628
2443 Ga0373935_1061923
2444 Ga0373935_1172377
2445 Ga0373927_0031610
2446 Ga0373927_0033707
2447 Ga0373927_0093199
2448 Ga0373933_0006501
2449 Ga0373933_0011568
2450 Ga0373933_0078309
2451 Ga0373933_0110163
2452 Ga0373933_0156543
2453 Ga0373933_0223485
2454 Ga0373947_0179077
2455 Ga0373947_0195393
2456 Ga0373937_0007916
2457 Ga0373937_0016065
2458 Ga0373937_0033347
2459 Ga0373937_0051686
2460 Ga0373937_0071823
2461 Ga0373937_0102790
2462 Ga0373937_0152835
2463 Ga0373937_0159609
2464 Ga0373937_0184876
2465 Ga0373937_0289994
2466 Ga0373937_0318383
2467 Ga0373937_0554995
2468 Ga0373937_0603185
2469 Ga0373937_1328886
2470 Ga0373937_1729560
2471 Ga0265778_025300
2472 Ga0373925_0022844
2473 Ga0373925_0030612
2474 Ga0373925_0069136
2475 Ga0373925_0075906
2476 Ga0373925_0171978
2477 Ga0373925_0418951
2478 Ga0373925_0741198
2479 Ga0373925_1569217
2480 Ga0436364_0322271
2481 Ga0436364_0408987
2482 Ga0436364_0502698
2483 Ga0436364_1160244
2484 Ga0436364_1532637
2485 Ga0436365_0148535
2486 Ga0436363_0251377
2487 Ga0436363_0583931
2488 Ga0436362_0326765
2489 Ga0436362_0653106
2490 Ga0439439_0227515
2491 Ga0439453_0002949
2492 Ga0439448_0055837
2493 Ga0450910_102440
2494 Ga0439435_0001943
2495 Ga0450916_058727
2496 Ga0495592_0133697
2497 Ga0495592_0289042
2498 Ga0495651_0024889
2499 Ga0495580_0008386
2500 Ga0495580_0012657
2501 Ga0495580_0018987
2502 Ga0495580_0032844
2503 Ga0495580_0072887
2504 Ga0495580_0176328
2505 Ga0495580_0217229
2506 Ga0495580_0646951
2507 Ga0495580_0798583
2508 Ga0495582_0188291
2509 Ga0495639_0248034
2510 Ga0495639_0359164
2511 Ga0495639_0759167
2512 Ga0495664_0515565
2513 Ga0495664_0578955
2514 Ga0495584_0035393
2515 Ga0495594_0128079
2516 Ga0495608_0062113
2517 Ga0495608_0067259
2518 Ga0495618_0535614
2519 Ga0495618_0595623
2520 Ga0495628_0426329
2521 Ga0495630_0617809
2522 Ga0495663_0020425
2523 Ga0495663_0150397
2524 Ga0495642_0027494
2525 Ga0495642_0226901
2526 Ga0495652_0069906
2527 Ga0495652_0183777
2528 Ga0495652_0506020
2529 Ga0495652_0683770
2530 Ga0495652_0957639
2531 Ga0495652_1095066
2532 Ga0495586_0040857
2533 Ga0495586_0076146
2534 Ga0495586_0108233
2535 Ga0495587_0001148
2536 Ga0495587_0011486
2537 Ga0495587_0013274
2538 Ga0495587_0141376
2539 Ga0495587_0222737
2540 Ga0495598_0027162
2541 Ga0495609_0015778
2542 Ga0495621_0372411
2543 Ga0495645_0159263
2544 Ga0495645_0216685
2545 Ga0495645_0518724
2546 Ga0495667_0058295
2547 Ga0495667_0124185
2548 Ga0495667_0610827
2549 Ga0495656_0011957
2550 Ga0495635_0488039
2551 Ga0495635_0590106
2552 Ga0495659_0075681
2553 Ga0495659_0116345
2554 Ga0495657_0545635
2555 Ga0495657_0893905
2556 Ga0495599_0002747
2557 Ga0495599_0005840
2558 Ga0495599_0089696
2559 Ga0495599_0123211
2560 Ga0495599_0402358
2561 Ga0495599_0479268
2562 Ga0495599_0654289
2563 Ga0495623_0055150
2564 Ga0495647_0070439
2565 Ga0495669_0170874
2566 Ga0495613_0032157
2567 Ga0495613_0033856
2568 Ga0495613_0402817
2569 Ga0495600_0096251
2570 Ga0495600_0113205
2571 Ga0495581_0134208
2572 Ga0495604_0425390
2573 Ga0495636_0017244
2574 Ga0495636_0114688
2575 Ga0495636_0468121
2576 Ga0495674_0073136
2577 Ga0495674_0162803
2578 Ga0495680_0531040
2579 Ga0495680_0583449
2580 Ga0495675_0054515
2581 Ga0495675_0280381
2582 Ga0495675_0554746
2583 Ga0495677_0025708
2584 Ga0495677_0327133
2585 Ga0495684_0005160
2586 Ga0495684_0008399
2587 Ga0495684_0491259
2588 Ga0495602_0004288
2589 Ga0495602_0027992
2590 Ga0495602_1028660
2591 Ga0496101_1223163
2592 Ga0496104_0114079
2593 Ga0496104_0159263
2594 Ga0496105_0339015
2595 Ga0496107_1227927
2596 Ga0496108_0280509
2597 Ga0496109_0310786
2598 Ga0496109_1183307
2599 Ga0496112_0068296
2600 Ga0496112_1233309
2601 Ga0496113_0089071
2602 Ga0496114_0000515
2603 Ga0496115_0203300
2604 Ga0496115_0631447
2605 Ga0501031_1004704
2606 Ga0501036_0827086
2607 Ga0501036_1210707
2608 Ga0501039_0543551
2609 Ga0501040_0615093
2610 Ga0501041_0089304
2611 Ga0501042_0314539
2612 Ga0501042_1088986
2613 Ga0501043_0864408
2614 Ga0501048_0457116
2615 Ga0501048_0614575
2616 Ga0501048_1058334
2617 Ga0501068_0600910
2618 Ga0501071_0071166
2619 Ga0501071_0081775
2620 Ga0501071_0907566
2621 Ga0501071_1081316
2622 Ga0501072_0032837
2623 Ga0501072_0103475
2624 Ga0501074_0355926
2625 Ga0501075_0072953
2626 Ga0501075_0400545
2627 Ga0501075_0818820
2628 Ga0501076_0525307
2629 Ga0501076_0734288
2630 Ga0501076_0950862
2631 Ga0501079_0659506
2632 Ga0501081_1051522
2633 nmdc:mga05p37_1255215_c1
2634 nmdc:mga05p37_1267785_c1
2635 nmdc:mga05p37_41774_c1
2636 nmdc:mga05p37_9001_c1
2637 nmdc:mga09592_20174_c1
2638 nmdc:mga09592_563462_c1
2639 nmdc:mga09592_6242_c1
2640 nmdc:mga09592_6838_c1
2641 nmdc:mga0qj67_14222_c1
2642 nmdc:mga0qj67_18992_c1
2643 nmdc:mga0qj67_243841_c1
2644 nmdc:mga0qj67_320250_c1
2645 nmdc:mga0qj67_74584_c1
2646 nmdc:mga06r32_47913_c1
2647 nmdc:mga08y16_146855_c1
2648 nmdc:mga08y16_159457_c1
2649 nmdc:mga08y16_21290_c1
2650 nmdc:mga08y16_28325_c1
2651 nmdc:mga08y16_38725_c1
2652 nmdc:mga08y16_534348_c1
2653 nmdc:mga08y16_715_c1
2654 nmdc:mga0n895_131017_c1
2655 nmdc:mga0n895_1467169_c1
2656 nmdc:mga0n895_370138_c1
2657 nmdc:mga0n895_584126_c1
2658 nmdc:mga0rr50_1182568_c1
2659 nmdc:mga0rr50_130167_c1
2660 nmdc:mga0rr50_277036_c1
2661 nmdc:mga0rr50_613594_c1
2662 nmdc:mga08x19_325325_c1
2663 nmdc:mga08x19_432811_c1
2664 nmdc:mga08x19_650892_c1
2665 nmdc:mga08x19_720487_c1
2666 nmdc:mga0a205_129296_c2
2667 nmdc:mga0a205_177397_c1
2668 Ga0495601_0163507
2669 Ga0495601_0392563
2670 Ga0495595_0443513
2671 Ga0495619_0132605
2672 Ga0495619_0569993
2673 Ga0495619_0822349
2674 Ga0500641_0147194
2675 Ga0500568_0000723
2676 Ga0590074_068829

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

27

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8056 38 96
5g3q-assembly2.cif.gz_B crystal structure of a hypothetical domain in wnk1 0.8008 35 72
8d0k-assembly1.cif.gz_F human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic 0.7916 38 72
1sru-assembly1.cif.gz_C crystal structure of full length e. coli ssb protein 0.7894 35 101
2jjd-assembly4.cif.gz_D protein tyrosine phosphatase, receptor type, e isoform 0.7765 43 70
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8975 43 72 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8726 43 70 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8489 37 96 2.40.50.140
af_Q9TZG4_240_302_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8212 39 72 2.60.40.1180
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8029 42 70 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A2V9CMA3-F1-model_v4 Uncharacterized protein 0.9701 41 124
AF-A0A661GE79-F1-model_v4 DNA-binding protein 0.9641 24 124
AF-A0A524HRQ9-F1-model_v4 Uncharacterized protein 0.963 31 123
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9617 39 124
AF-A0A7C2J476-F1-model_v4 DUF5666 domain-containing protein 0.9604 31 121

Map