F493129
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1337 | 384 | 2674 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0224729|Ga0501031_0224729_19_639 |
| Length | 198 |
| Sequence | MATLAFNHEEIAPAELRPELLELDGISRATVEAHYKLYQGYVGKRNEILAKLKEIDASAANQVYSELRALKVDLTFAIGGVKNHELYFAHLGAARDLIERDFGSVSAWRQDLKATGMAGRGWAWTAYDWDEGRLFNYVGDAQNTFPVWNATALVALDVYEHAYFLDYQTDRGAYIDAFFANLDWAVINHWIARYGIPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 110 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 237 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 238 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 250 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.13 |
| Metatranscriptomes | 1.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.45 |
| Nodule | 0 |
| Rhizoplane | 10.7 |
| Rhizosphere | 88.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501031_0224729 | 3300049568 | Bacteria | 1222 |
| 2 | JGI25407J50210_10000406 | 3300003373 | Bacteria | 8306 |
| 3 | JGI25407J50210_10105595 | 3300003373 | Unclassified | 695 |
| 4 | JGI25404J52841_10031131 | 3300003659 | Bacteria | 1141 |
| 5 | Ga0058862_12804081 | 3300004803 | Unclassified | 682 |
| 6 | Ga0070658_10007279 | 3300005327 | Bacteria | 8935 |
| 7 | Ga0070658_10016442 | 3300005327 | Bacteria | 5921 |
| 8 | Ga0070658_10018409 | 3300005327 | Bacteria | 5591 |
| 9 | Ga0070658_10023899 | 3300005327 | Bacteria | 4902 |
| 10 | Ga0070658_10045188 | 3300005327 | Bacteria | 3560 |
| 11 | Ga0070658_10063796 | 3300005327 | Bacteria | 3004 |
| 12 | Ga0070658_10330556 | 3300005327 | Bacteria | 1302 |
| 13 | Ga0070683_100001807 | 3300005329 | Bacteria | 16677 |
| 14 | Ga0070683_100025873 | 3300005329 | Bacteria | 5278 |
| 15 | Ga0070683_100104075 | 3300005329 | Bacteria | 2675 |
| 16 | Ga0070683_100109721 | 3300005329 | Bacteria | 2603 |
| 17 | Ga0070683_100521542 | 3300005329 | Bacteria | 1135 |
| 18 | Ga0070680_100005165 | 3300005336 | Bacteria | 9872 |
| 19 | Ga0070680_100008385 | 3300005336 | Bacteria | 7913 |
| 20 | Ga0070680_100031458 | 3300005336 | Bacteria | 4267 |
| 21 | Ga0070680_100059865 | 3300005336 | Bacteria | 3117 |
| 22 | Ga0070680_100070210 | 3300005336 | Bacteria | 2877 |
| 23 | Ga0070680_100210639 | 3300005336 | Bacteria | 1640 |
| 24 | Ga0070682_100006444 | 3300005337 | Bacteria | 6598 |
| 25 | Ga0070682_100007437 | 3300005337 | Bacteria | 6178 |
| 26 | Ga0070682_100036588 | 3300005337 | Bacteria | 3002 |
| 27 | Ga0070682_100129219 | 3300005337 | Bacteria | 1707 |
| 28 | Ga0070682_100212246 | 3300005337 | Bacteria | 1372 |
| 29 | Ga0068868_100375920 | 3300005338 | Bacteria | 1222 |
| 30 | Ga0068868_100433701 | 3300005338 | Bacteria | 1140 |
| 31 | Ga0070660_100002597 | 3300005339 | Bacteria | 12396 |
| 32 | Ga0070660_100033323 | 3300005339 | Bacteria | 3883 |
| 33 | Ga0070660_100035531 | 3300005339 | Bacteria | 3772 |
| 34 | Ga0070660_100036512 | 3300005339 | Bacteria | 3723 |
| 35 | Ga0070660_100051709 | 3300005339 | Bacteria | 3165 |
| 36 | Ga0070660_100255616 | 3300005339 | Bacteria | 1429 |
| 37 | Ga0070660_100448203 | 3300005339 | Bacteria | 1070 |
| 38 | Ga0070660_100890055 | 3300005339 | Bacteria | 750 |
| 39 | Ga0070661_100060637 | 3300005344 | Bacteria | 2776 |
| 40 | Ga0070661_100149095 | 3300005344 | Bacteria | 1767 |
| 41 | Ga0070661_100198948 | 3300005344 | Bacteria | 1530 |
| 42 | Ga0070661_100228848 | 3300005344 | Bacteria | 1428 |
| 43 | Ga0070661_100485970 | 3300005344 | Bacteria | 987 |
| 44 | Ga0070668_100055050 | 3300005347 | Bacteria | 3070 |
| 45 | Ga0070669_100310707 | 3300005353 | Unclassified | 1270 |
| 46 | Ga0070675_100510720 | 3300005354 | Unclassified | 1084 |
| 47 | Ga0070671_100051385 | 3300005355 | Bacteria | 3428 |
| 48 | Ga0070671_100412184 | 3300005355 | Unclassified | 1157 |
| 49 | Ga0070674_100268265 | 3300005356 | Bacteria | 1348 |
| 50 | Ga0070659_100004395 | 3300005366 | Bacteria | 10069 |
| 51 | Ga0070659_100057680 | 3300005366 | Bacteria | 3062 |
| 52 | Ga0070659_100099875 | 3300005366 | Bacteria | 2335 |
| 53 | Ga0070659_100148398 | 3300005366 | Bacteria | 1912 |
| 54 | Ga0070659_100261976 | 3300005366 | Bacteria | 1434 |
| 55 | Ga0070667_100003479 | 3300005367 | Bacteria | 13421 |
| 56 | Ga0070703_10060557 | 3300005406 | Bacteria | 1237 |
| 57 | Ga0070703_10123623 | 3300005406 | Bacteria | 942 |
| 58 | Ga0070709_10003722 | 3300005434 | Bacteria | 8190 |
| 59 | Ga0070709_10050903 | 3300005434 | Unclassified | 2597 |
| 60 | Ga0070709_10130578 | 3300005434 | Bacteria | 1714 |
| 61 | Ga0070709_10158636 | 3300005434 | Bacteria | 1571 |
| 62 | Ga0070714_100013517 | 3300005435 | Bacteria | 6543 |
| 63 | Ga0070714_100037631 | 3300005435 | Bacteria | 4066 |
| 64 | Ga0070714_100059600 | 3300005435 | Bacteria | 3273 |
| 65 | Ga0070714_100070863 | 3300005435 | Bacteria | 3013 |
| 66 | Ga0070714_100095864 | 3300005435 | Bacteria | 2606 |
| 67 | Ga0070714_100124811 | 3300005435 | Bacteria | 2294 |
| 68 | Ga0070714_100130895 | 3300005435 | Bacteria | 2242 |
| 69 | Ga0070714_100136048 | 3300005435 | Bacteria | 2200 |
| 70 | Ga0070714_100976224 | 3300005435 | Bacteria | 824 |
| 71 | Ga0070714_101189961 | 3300005435 | Bacteria | 743 |
| 72 | Ga0070713_100001998 | 3300005436 | Bacteria | 13163 |
| 73 | Ga0070713_100265387 | 3300005436 | Bacteria | 1570 |
| 74 | Ga0070713_100308905 | 3300005436 | Bacteria | 1458 |
| 75 | Ga0070710_10005665 | 3300005437 | Bacteria | 5946 |
| 76 | Ga0070710_10007312 | 3300005437 | Bacteria | 5342 |
| 77 | Ga0070710_10016667 | 3300005437 | Bacteria | 3743 |
| 78 | Ga0070711_100081482 | 3300005439 | Bacteria | 2306 |
| 79 | Ga0070711_100112742 | 3300005439 | Bacteria | 1999 |
| 80 | Ga0070711_100145863 | 3300005439 | Bacteria | 1780 |
| 81 | Ga0070711_100423068 | 3300005439 | Bacteria | 1086 |
| 82 | Ga0070705_100037024 | 3300005440 | Bacteria | 2749 |
| 83 | Ga0070705_100059373 | 3300005440 | Bacteria | 2264 |
| 84 | Ga0070705_100179007 | 3300005440 | Bacteria | 1434 |
| 85 | Ga0070705_100224227 | 3300005440 | Bacteria | 1303 |
| 86 | Ga0070705_100311543 | 3300005440 | Unclassified | 1132 |
| 87 | Ga0070705_100405553 | 3300005440 | Bacteria | 1010 |
| 88 | Ga0070700_100419500 | 3300005441 | Bacteria | 1011 |
| 89 | Ga0070694_100295446 | 3300005444 | Bacteria | 1240 |
| 90 | Ga0070694_100507401 | 3300005444 | Bacteria | 960 |
| 91 | Ga0070708_100018186 | 3300005445 | Bacteria | 5880 |
| 92 | Ga0070708_100245475 | 3300005445 | Bacteria | 1681 |
| 93 | Ga0070708_100294937 | 3300005445 | Bacteria | 1527 |
| 94 | Ga0070708_100321184 | 3300005445 | Bacteria | 1458 |
| 95 | Ga0070708_101027438 | 3300005445 | Unclassified | 773 |
| 96 | Ga0070678_100015863 | 3300005456 | Bacteria | 4800 |
| 97 | Ga0070678_100114690 | 3300005456 | Bacteria | 2114 |
| 98 | Ga0070678_100122116 | 3300005456 | Bacteria | 2056 |
| 99 | Ga0070678_100601529 | 3300005456 | Bacteria | 982 |
| 100 | Ga0070662_100003257 | 3300005457 | Bacteria | 10099 |
| 101 | Ga0070681_10009902 | 3300005458 | Bacteria | 9392 |
| 102 | Ga0070681_10041547 | 3300005458 | Bacteria | 4608 |
| 103 | Ga0070681_10059950 | 3300005458 | Bacteria | 3784 |
| 104 | Ga0070681_10067407 | 3300005458 | Bacteria | 3547 |
| 105 | Ga0070681_10123713 | 3300005458 | Bacteria | 2519 |
| 106 | Ga0070681_10132007 | 3300005458 | Bacteria | 2430 |
| 107 | Ga0070681_10168988 | 3300005458 | Bacteria | 2109 |
| 108 | Ga0070681_10206106 | 3300005458 | Bacteria | 1883 |
| 109 | Ga0070681_10291291 | 3300005458 | Bacteria | 1542 |
| 110 | Ga0070681_10310337 | 3300005458 | Bacteria | 1487 |
| 111 | Ga0070681_10606948 | 3300005458 | Unclassified | 1009 |
| 112 | Ga0070681_10771992 | 3300005458 | Unclassified | 878 |
| 113 | Ga0070706_100008962 | 3300005467 | Bacteria | 9318 |
| 114 | Ga0070706_100059607 | 3300005467 | Bacteria | 3523 |
| 115 | Ga0070706_100062103 | 3300005467 | Bacteria | 3451 |
| 116 | Ga0070706_100125776 | 3300005467 | Unclassified | 2390 |
| 117 | Ga0070706_100126808 | 3300005467 | Unclassified | 2380 |
| 118 | Ga0070706_100618664 | 3300005467 | Bacteria | 1006 |
| 119 | Ga0070707_100046410 | 3300005468 | Bacteria | 4158 |
| 120 | Ga0070707_100161113 | 3300005468 | Bacteria | 2186 |
| 121 | Ga0070707_100335246 | 3300005468 | Unclassified | 1469 |
| 122 | Ga0070707_100648225 | 3300005468 | Bacteria | 1019 |
| 123 | Ga0070698_100005322 | 3300005471 | Bacteria | 14087 |
| 124 | Ga0070698_100014780 | 3300005471 | Bacteria | 8249 |
| 125 | Ga0070698_100080180 | 3300005471 | Bacteria | 3259 |
| 126 | Ga0070698_100135529 | 3300005471 | Bacteria | 2416 |
| 127 | Ga0070698_100162960 | 3300005471 | Bacteria | 2173 |
| 128 | Ga0070698_100268237 | 3300005471 | Bacteria | 1638 |
| 129 | Ga0070699_100042022 | 3300005518 | Bacteria | 3955 |
| 130 | Ga0070699_100137129 | 3300005518 | Bacteria | 2159 |
| 131 | Ga0070699_100396932 | 3300005518 | Unclassified | 1247 |
| 132 | Ga0070699_100948073 | 3300005518 | Bacteria | 789 |
| 133 | Ga0070679_100004066 | 3300005530 | Bacteria | 13481 |
| 134 | Ga0070679_100025803 | 3300005530 | Bacteria | 5766 |
| 135 | Ga0070679_100027640 | 3300005530 | Bacteria | 5584 |
| 136 | Ga0070679_100028850 | 3300005530 | Bacteria | 5473 |
| 137 | Ga0070679_100037951 | 3300005530 | Bacteria | 4787 |
| 138 | Ga0070679_100050658 | 3300005530 | Bacteria | 4136 |
| 139 | Ga0070679_100110933 | 3300005530 | Bacteria | 2729 |
| 140 | Ga0070679_100151713 | 3300005530 | Bacteria | 2294 |
| 141 | Ga0070679_100177502 | 3300005530 | Bacteria | 2103 |
| 142 | Ga0070679_100207108 | 3300005530 | Bacteria | 1925 |
| 143 | Ga0070679_100233019 | 3300005530 | Unclassified | 1801 |
| 144 | Ga0070679_100331490 | 3300005530 | Bacteria | 1470 |
| 145 | Ga0070679_100431677 | 3300005530 | Bacteria | 1262 |
| 146 | Ga0070679_101015164 | 3300005530 | Unclassified | 774 |
| 147 | Ga0070679_101114931 | 3300005530 | Unclassified | 734 |
| 148 | Ga0070684_100023906 | 3300005535 | Bacteria | 5120 |
| 149 | Ga0070684_100242871 | 3300005535 | Bacteria | 1645 |
| 150 | Ga0070684_100635944 | 3300005535 | Bacteria | 993 |
| 151 | Ga0070684_101504183 | 3300005535 | Bacteria | 634 |
| 152 | Ga0070697_100200390 | 3300005536 | Bacteria | 1697 |
| 153 | Ga0070697_100203393 | 3300005536 | Bacteria | 1683 |
| 154 | Ga0070697_100274780 | 3300005536 | Bacteria | 1445 |
| 155 | Ga0070672_100685084 | 3300005543 | Bacteria | 897 |
| 156 | Ga0070686_100136160 | 3300005544 | Bacteria | 1704 |
| 157 | Ga0070686_100169653 | 3300005544 | Bacteria | 1542 |
| 158 | Ga0070686_100205805 | 3300005544 | Bacteria | 1414 |
| 159 | Ga0070695_100000072 | 3300005545 | Bacteria | 40551 |
| 160 | Ga0070695_100076079 | 3300005545 | Bacteria | 2210 |
| 161 | Ga0070696_100110647 | 3300005546 | Bacteria | 1978 |
| 162 | Ga0070696_100209651 | 3300005546 | Bacteria | 1458 |
| 163 | Ga0070696_100261439 | 3300005546 | Bacteria | 1313 |
| 164 | Ga0070696_100371358 | 3300005546 | Bacteria | 1112 |
| 165 | Ga0070696_100431632 | 3300005546 | Bacteria | 1036 |
| 166 | Ga0070696_100626162 | 3300005546 | Unclassified | 870 |
| 167 | Ga0070693_100015674 | 3300005547 | Bacteria | 3907 |
| 168 | Ga0070693_100028442 | 3300005547 | Bacteria | 3039 |
| 169 | Ga0070693_100455362 | 3300005547 | Bacteria | 899 |
| 170 | Ga0070665_100035400 | 3300005548 | Bacteria | 5020 |
| 171 | Ga0070665_100354567 | 3300005548 | Bacteria | 1473 |
| 172 | Ga0070704_100468804 | 3300005549 | Bacteria | 1088 |
| 173 | Ga0068855_100005085 | 3300005563 | Bacteria | 16033 |
| 174 | Ga0068855_100019212 | 3300005563 | Bacteria | 8213 |
| 175 | Ga0068855_100029823 | 3300005563 | Bacteria | 6522 |
| 176 | Ga0068855_100038293 | 3300005563 | Bacteria | 5697 |
| 177 | Ga0068855_100044913 | 3300005563 | Bacteria | 5227 |
| 178 | Ga0068855_100048881 | 3300005563 | Bacteria | 4991 |
| 179 | Ga0068855_100116002 | 3300005563 | Bacteria | 3069 |
| 180 | Ga0068855_100257627 | 3300005563 | Bacteria | 1944 |
| 181 | Ga0068855_100561612 | 3300005563 | Bacteria | 1234 |
| 182 | Ga0068855_100823065 | 3300005563 | Bacteria | 985 |
| 183 | Ga0068855_101455644 | 3300005563 | Unclassified | 704 |
| 184 | Ga0068855_101517828 | 3300005563 | Bacteria | 687 |
| 185 | Ga0068857_100063397 | 3300005577 | Bacteria | 3285 |
| 186 | Ga0068857_100269379 | 3300005577 | Bacteria | 1565 |
| 187 | Ga0068857_100496676 | 3300005577 | Bacteria | 1145 |
| 188 | Ga0068857_100562920 | 3300005577 | Bacteria | 1075 |
| 189 | Ga0068856_100047359 | 3300005614 | Bacteria | 4234 |
| 190 | Ga0068856_100173859 | 3300005614 | Bacteria | 2166 |
| 191 | Ga0068856_100263364 | 3300005614 | Bacteria | 1739 |
| 192 | Ga0068856_100311608 | 3300005614 | Bacteria | 1591 |
| 193 | Ga0068856_100350708 | 3300005614 | Bacteria | 1494 |
| 194 | Ga0068856_100469047 | 3300005614 | Bacteria | 1280 |
| 195 | Ga0068856_100494864 | 3300005614 | Bacteria | 1243 |
| 196 | Ga0068856_100807316 | 3300005614 | Unclassified | 958 |
| 197 | Ga0068856_100923255 | 3300005614 | Bacteria | 892 |
| 198 | Ga0068852_100013931 | 3300005616 | Bacteria | 6167 |
| 199 | Ga0068852_100064432 | 3300005616 | Bacteria | 3194 |
| 200 | Ga0068852_100093137 | 3300005616 | Bacteria | 2700 |
| 201 | Ga0068852_100575629 | 3300005616 | Bacteria | 1128 |
| 202 | Ga0068864_100249667 | 3300005618 | Bacteria | 1647 |
| 203 | Ga0068866_10136692 | 3300005718 | Bacteria | 1402 |
| 204 | Ga0068861_100207059 | 3300005719 | Bacteria | 1650 |
| 205 | Ga0068870_10158781 | 3300005840 | Bacteria | 1339 |
| 206 | Ga0068870_10412388 | 3300005840 | Unclassified | 882 |
| 207 | Ga0068863_100691113 | 3300005841 | Unclassified | 1014 |
| 208 | Ga0068858_100115993 | 3300005842 | Bacteria | 2503 |
| 209 | Ga0068860_100249481 | 3300005843 | Bacteria | 1728 |
| 210 | Ga0081455_10010130 | 3300005937 | Bacteria | 9604 |
| 211 | Ga0081455_10011947 | 3300005937 | Bacteria | 8690 |
| 212 | Ga0081455_10013084 | 3300005937 | Bacteria | 8225 |
| 213 | Ga0081455_10154163 | 3300005937 | Bacteria | 1768 |
| 214 | Ga0081455_10404193 | 3300005937 | Bacteria | 947 |
| 215 | Ga0081538_10000608 | 3300005981 | Bacteria | 39645 |
| 216 | Ga0081538_10003497 | 3300005981 | Bacteria | 14811 |
| 217 | Ga0081538_10024849 | 3300005981 | Bacteria | 4251 |
| 218 | Ga0081538_10061893 | 3300005981 | Bacteria | 2139 |
| 219 | Ga0081538_10063468 | 3300005981 | Bacteria | 2097 |
| 220 | Ga0081538_10075587 | 3300005981 | Bacteria | 1827 |
| 221 | Ga0081538_10076907 | 3300005981 | Unclassified | 1801 |
| 222 | Ga0081540_1002169 | 3300005983 | Bacteria | 16260 |
| 223 | Ga0081539_10000249 | 3300005985 | Bacteria | 125691 |
| 224 | Ga0081539_10006242 | 3300005985 | Bacteria | 11540 |
| 225 | Ga0081539_10106973 | 3300005985 | Bacteria | 1415 |
| 226 | Ga0081539_10170466 | 3300005985 | Bacteria | 1030 |
| 227 | Ga0070717_10015238 | 3300006028 | Bacteria | 5932 |
| 228 | Ga0070717_10024925 | 3300006028 | Bacteria | 4753 |
| 229 | Ga0070717_10060212 | 3300006028 | Bacteria | 3144 |
| 230 | Ga0070717_10088702 | 3300006028 | Bacteria | 2607 |
| 231 | Ga0070717_10151533 | 3300006028 | Bacteria | 2006 |
| 232 | Ga0075365_10032892 | 3300006038 | Bacteria | 3337 |
| 233 | Ga0075364_10068432 | 3300006051 | Bacteria | 2335 |
| 234 | Ga0070715_10000369 | 3300006163 | Bacteria | 11279 |
| 235 | Ga0070715_10008347 | 3300006163 | Bacteria | 3606 |
| 236 | Ga0070715_10014448 | 3300006163 | Bacteria | 2925 |
| 237 | Ga0070715_10070538 | 3300006163 | Bacteria | 1560 |
| 238 | Ga0070716_100009180 | 3300006173 | Bacteria | 4924 |
| 239 | Ga0070716_100043141 | 3300006173 | Bacteria | 2520 |
| 240 | Ga0070716_100406159 | 3300006173 | Bacteria | 981 |
| 241 | Ga0070712_100008944 | 3300006175 | Bacteria | 6307 |
| 242 | Ga0070712_100025190 | 3300006175 | Bacteria | 3952 |
| 243 | Ga0070712_100046410 | 3300006175 | Bacteria | 3003 |
| 244 | Ga0070712_100254314 | 3300006175 | Bacteria | 1405 |
| 245 | Ga0070712_100345159 | 3300006175 | Bacteria | 1217 |
| 246 | Ga0070712_100689822 | 3300006175 | Bacteria | 870 |
| 247 | Ga0075362_10042301 | 3300006177 | Bacteria | 2013 |
| 248 | Ga0097621_100137043 | 3300006237 | Bacteria | 2088 |
| 249 | Ga0097621_100316811 | 3300006237 | Bacteria | 1381 |
| 250 | Ga0097621_100847822 | 3300006237 | Bacteria | 849 |
| 251 | Ga0068871_100021730 | 3300006358 | Bacteria | 4938 |
| 252 | Ga0068871_100230124 | 3300006358 | Bacteria | 1609 |
| 253 | Ga0075431_100158475 | 3300006847 | Bacteria | 2328 |
| 254 | Ga0075431_100467628 | 3300006847 | Unclassified | 1255 |
| 255 | Ga0075433_10001077 | 3300006852 | Bacteria | 19642 |
| 256 | Ga0075433_10014274 | 3300006852 | Bacteria | 6488 |
| 257 | Ga0075433_10315344 | 3300006852 | Bacteria | 1384 |
| 258 | Ga0075433_10372783 | 3300006852 | Bacteria | 1260 |
| 259 | Ga0075434_100001096 | 3300006871 | Bacteria | 22184 |
| 260 | Ga0075434_100006796 | 3300006871 | Bacteria | 10520 |
| 261 | Ga0075434_100039502 | 3300006871 | Bacteria | 4676 |
| 262 | Ga0075434_100132935 | 3300006871 | Bacteria | 2508 |
| 263 | Ga0075434_100241490 | 3300006871 | Bacteria | 1826 |
| 264 | Ga0075434_100400865 | 3300006871 | Bacteria | 1393 |
| 265 | Ga0075434_100752016 | 3300006871 | Bacteria | 992 |
| 266 | Ga0068865_100215942 | 3300006881 | Bacteria | 1497 |
| 267 | Ga0068865_100513825 | 3300006881 | Bacteria | 1001 |
| 268 | Ga0075436_100031886 | 3300006914 | Bacteria | 3631 |
| 269 | Ga0075436_100110031 | 3300006914 | Bacteria | 1922 |
| 270 | Ga0075436_100136574 | 3300006914 | Bacteria | 1722 |
| 271 | Ga0075436_100363286 | 3300006914 | Bacteria | 1045 |
| 272 | Ga0075435_100005919 | 3300007076 | Bacteria | 8605 |
| 273 | Ga0075435_100031675 | 3300007076 | Bacteria | 4168 |
| 274 | Ga0075435_100035768 | 3300007076 | Bacteria | 3942 |
| 275 | Ga0075435_100151557 | 3300007076 | Bacteria | 1949 |
| 276 | Ga0105251_10154493 | 3300009011 | Bacteria | 1035 |
| 277 | Ga0105240_10004954 | 3300009093 | Bacteria | 20027 |
| 278 | Ga0105240_10036261 | 3300009093 | Bacteria | 6346 |
| 279 | Ga0105240_10038819 | 3300009093 | Bacteria | 6104 |
| 280 | Ga0105240_10054046 | 3300009093 | Bacteria | 5035 |
| 281 | Ga0105245_10019791 | 3300009098 | Bacteria | 5900 |
| 282 | Ga0105245_10041003 | 3300009098 | Bacteria | 4126 |
| 283 | Ga0105245_10090363 | 3300009098 | Bacteria | 2816 |
| 284 | Ga0105245_10145871 | 3300009098 | Bacteria | 2233 |
| 285 | Ga0105245_10442054 | 3300009098 | Bacteria | 1307 |
| 286 | Ga0105245_10459503 | 3300009098 | Bacteria | 1283 |
| 287 | Ga0105247_10041288 | 3300009101 | Bacteria | 2823 |
| 288 | Ga0114129_10005843 | 3300009147 | Bacteria | 17425 |
| 289 | Ga0114129_10185248 | 3300009147 | Bacteria | 2830 |
| 290 | Ga0114129_10419545 | 3300009147 | Bacteria | 1760 |
| 291 | Ga0105243_10062609 | 3300009148 | Bacteria | 2979 |
| 292 | Ga0105243_10097129 | 3300009148 | Bacteria | 2438 |
| 293 | Ga0105243_10134430 | 3300009148 | Unclassified | 2102 |
| 294 | Ga0105241_10051884 | 3300009174 | Bacteria | 3129 |
| 295 | Ga0105241_10270638 | 3300009174 | Bacteria | 1447 |
| 296 | Ga0105242_10149150 | 3300009176 | Bacteria | 2038 |
| 297 | Ga0105248_10107475 | 3300009177 | Bacteria | 3146 |
| 298 | Ga0105237_10010187 | 3300009545 | Bacteria | 10016 |
| 299 | Ga0105237_10268530 | 3300009545 | Bacteria | 1709 |
| 300 | Ga0105238_10019187 | 3300009551 | Bacteria | 6967 |
| 301 | Ga0105238_10234776 | 3300009551 | Bacteria | 1811 |
| 302 | Ga0105238_10265336 | 3300009551 | Bacteria | 1697 |
| 303 | Ga0105238_10558409 | 3300009551 | Bacteria | 1150 |
| 304 | Ga0105238_10767160 | 3300009551 | Bacteria | 979 |
| 305 | Ga0105249_10002534 | 3300009553 | Bacteria | 15805 |
| 306 | Ga0105249_10468208 | 3300009553 | Bacteria | 1301 |
| 307 | Ga0105249_10939691 | 3300009553 | Bacteria | 932 |
| 308 | Ga0105239_10011104 | 3300010375 | Bacteria | 10051 |
| 309 | Ga0105239_10021787 | 3300010375 | Bacteria | 7064 |
| 310 | Ga0105239_11104296 | 3300010375 | Bacteria | 913 |
| 311 | Ga0105246_10094003 | 3300011119 | Bacteria | 2167 |
| 312 | Ga0105246_10221038 | 3300011119 | Bacteria | 1485 |
| 313 | Ga0157339_1002406 | 3300012505 | Bacteria | 1261 |
| 314 | Ga0157373_10025244 | 3300013100 | Bacteria | 4300 |
| 315 | Ga0157373_10216385 | 3300013100 | Bacteria | 1351 |
| 316 | Ga0157373_10356313 | 3300013100 | Bacteria | 1044 |
| 317 | Ga0157371_10073516 | 3300013102 | Bacteria | 2421 |
| 318 | Ga0157371_10309312 | 3300013102 | Bacteria | 1145 |
| 319 | Ga0157370_10011897 | 3300013104 | Bacteria | 9077 |
| 320 | Ga0157370_10018188 | 3300013104 | Bacteria | 7073 |
| 321 | Ga0157370_10029004 | 3300013104 | Bacteria | 5437 |
| 322 | Ga0157370_10032773 | 3300013104 | Bacteria | 5072 |
| 323 | Ga0157370_10060710 | 3300013104 | Bacteria | 3588 |
| 324 | Ga0157370_10079311 | 3300013104 | Bacteria | 3092 |
| 325 | Ga0157370_10098873 | 3300013104 | Bacteria | 2735 |
| 326 | Ga0157370_10563386 | 3300013104 | Bacteria | 1044 |
| 327 | Ga0157369_10005681 | 3300013105 | Bacteria | 14493 |
| 328 | Ga0157369_10007107 | 3300013105 | Bacteria | 12909 |
| 329 | Ga0157369_10030256 | 3300013105 | Bacteria | 5973 |
| 330 | Ga0157369_10039970 | 3300013105 | Bacteria | 5124 |
| 331 | Ga0157369_10048742 | 3300013105 | Bacteria | 4596 |
| 332 | Ga0157369_10205096 | 3300013105 | Bacteria | 2068 |
| 333 | Ga0157369_10274977 | 3300013105 | Bacteria | 1754 |
| 334 | Ga0157369_10284826 | 3300013105 | Bacteria | 1721 |
| 335 | Ga0157369_10405539 | 3300013105 | Bacteria | 1414 |
| 336 | Ga0157369_11329741 | 3300013105 | Bacteria | 732 |
| 337 | Ga0157374_10077371 | 3300013296 | Bacteria | 3148 |
| 338 | Ga0157374_10192836 | 3300013296 | Bacteria | 1993 |
| 339 | Ga0157374_10736866 | 3300013296 | Bacteria | 1000 |
| 340 | Ga0163162_10055567 | 3300013306 | Bacteria | 3987 |
| 341 | Ga0163162_10591805 | 3300013306 | Bacteria | 1236 |
| 342 | Ga0157372_10121400 | 3300013307 | Bacteria | 3002 |
| 343 | Ga0157372_10192805 | 3300013307 | Bacteria | 2360 |
| 344 | Ga0157372_10224415 | 3300013307 | Bacteria | 2178 |
| 345 | Ga0157372_10290175 | 3300013307 | Bacteria | 1903 |
| 346 | Ga0157372_10356989 | 3300013307 | Bacteria | 1703 |
| 347 | Ga0157372_10369272 | 3300013307 | Bacteria | 1672 |
| 348 | Ga0157372_10784022 | 3300013307 | Bacteria | 1108 |
| 349 | Ga0157372_11137461 | 3300013307 | Bacteria | 903 |
| 350 | Ga0157372_11878525 | 3300013307 | Bacteria | 688 |
| 351 | Ga0157375_10099964 | 3300013308 | Bacteria | 2980 |
| 352 | Ga0157375_10299788 | 3300013308 | Unclassified | 1771 |
| 353 | Ga0163163_10030599 | 3300014325 | Bacteria | 5188 |
| 354 | Ga0157380_10129375 | 3300014326 | Bacteria | 2151 |
| 355 | Ga0182008_10002853 | 3300014497 | Bacteria | 10702 |
| 356 | Ga0182008_10017072 | 3300014497 | Bacteria | 3767 |
| 357 | Ga0157377_10407124 | 3300014745 | Bacteria | 928 |
| 358 | Ga0157376_10036990 | 3300014969 | Bacteria | 3958 |
| 359 | Ga0157376_10066985 | 3300014969 | Bacteria | 3036 |
| 360 | Ga0182006_1020291 | 3300015261 | Bacteria | 2785 |
| 361 | Ga0182006_1077392 | 3300015261 | Bacteria | 1220 |
| 362 | Ga0182005_1041905 | 3300015265 | Bacteria | 1245 |
| 363 | Ga0182005_1124175 | 3300015265 | Bacteria | 737 |
| 364 | Ga0163161_10008801 | 3300017792 | Bacteria | 6978 |
| 365 | Ga0197907_10190807 | 3300020069 | Unclassified | 1712 |
| 366 | Ga0197907_10345131 | 3300020069 | Bacteria | 2267 |
| 367 | Ga0206356_10418251 | 3300020070 | Bacteria | 2386 |
| 368 | Ga0206356_10567364 | 3300020070 | Bacteria | 1436 |
| 369 | Ga0206356_11120154 | 3300020070 | Unclassified | 691 |
| 370 | Ga0206356_11870338 | 3300020070 | Unclassified | 1605 |
| 371 | Ga0206355_1177548 | 3300020076 | Bacteria | 949 |
| 372 | Ga0206355_1576338 | 3300020076 | Bacteria | 1372 |
| 373 | Ga0206351_10051768 | 3300020077 | Bacteria | 778 |
| 374 | Ga0206351_10105922 | 3300020077 | Bacteria | 2414 |
| 375 | Ga0206350_10058088 | 3300020080 | Bacteria | 869 |
| 376 | Ga0206350_10991345 | 3300020080 | Bacteria | 1610 |
| 377 | Ga0206354_10891471 | 3300020081 | Bacteria | 1417 |
| 378 | Ga0206354_11040985 | 3300020081 | Bacteria | 5311 |
| 379 | Ga0206353_10141117 | 3300020082 | Bacteria | 4174 |
| 380 | Ga0206353_10237848 | 3300020082 | Bacteria | 1995 |
| 381 | Ga0206353_10758799 | 3300020082 | Bacteria | 6368 |
| 382 | Ga0206353_11116827 | 3300020082 | Bacteria | 5448 |
| 383 | Ga0206353_11735253 | 3300020082 | Unclassified | 792 |
| 384 | Ga0154015_1506938 | 3300020610 | Bacteria | 1274 |
| 385 | Ga0213876_10023023 | 3300021384 | Bacteria | 3292 |
| 386 | Ga0213871_10053915 | 3300021441 | Bacteria | 1108 |
| 387 | Ga0224712_10041044 | 3300022467 | Bacteria | 1745 |
| 388 | Ga0224712_10326882 | 3300022467 | Bacteria | 721 |
| 389 | Ga0207653_10003996 | 3300025885 | Bacteria | 4639 |
| 390 | Ga0207692_10122008 | 3300025898 | Bacteria | 1461 |
| 391 | Ga0207642_10063024 | 3300025899 | Bacteria | 1732 |
| 392 | Ga0207685_10017643 | 3300025905 | Bacteria | 2314 |
| 393 | Ga0207685_10050254 | 3300025905 | Bacteria | 1606 |
| 394 | Ga0207685_10101345 | 3300025905 | Bacteria | 1232 |
| 395 | Ga0207685_10151808 | 3300025905 | Bacteria | 1049 |
| 396 | Ga0207699_10033199 | 3300025906 | Bacteria | 2915 |
| 397 | Ga0207699_10080059 | 3300025906 | Bacteria | 2023 |
| 398 | Ga0207643_10095670 | 3300025908 | Bacteria | 1736 |
| 399 | Ga0207705_10004374 | 3300025909 | Bacteria | 10682 |
| 400 | Ga0207705_10008362 | 3300025909 | Bacteria | 7554 |
| 401 | Ga0207705_10026222 | 3300025909 | Bacteria | 4158 |
| 402 | Ga0207705_10052290 | 3300025909 | Bacteria | 2940 |
| 403 | Ga0207705_10373070 | 3300025909 | Bacteria | 1102 |
| 404 | Ga0207705_10676393 | 3300025909 | Unclassified | 802 |
| 405 | Ga0207684_10078742 | 3300025910 | Bacteria | 2803 |
| 406 | Ga0207684_10122725 | 3300025910 | Bacteria | 2228 |
| 407 | Ga0207684_10272592 | 3300025910 | Bacteria | 1460 |
| 408 | Ga0207684_10426771 | 3300025910 | Bacteria | 1139 |
| 409 | Ga0207684_10753328 | 3300025910 | Bacteria | 825 |
| 410 | Ga0207654_10185373 | 3300025911 | Bacteria | 1360 |
| 411 | Ga0207654_10209629 | 3300025911 | Bacteria | 1287 |
| 412 | Ga0207707_10009041 | 3300025912 | Bacteria | 8656 |
| 413 | Ga0207707_10009936 | 3300025912 | Bacteria | 8251 |
| 414 | Ga0207707_10033241 | 3300025912 | Bacteria | 4515 |
| 415 | Ga0207707_10039214 | 3300025912 | Bacteria | 4141 |
| 416 | Ga0207707_10047465 | 3300025912 | Bacteria | 3739 |
| 417 | Ga0207707_10063976 | 3300025912 | Bacteria | 3201 |
| 418 | Ga0207707_10068938 | 3300025912 | Bacteria | 3082 |
| 419 | Ga0207707_10161192 | 3300025912 | Bacteria | 1961 |
| 420 | Ga0207707_10177498 | 3300025912 | Bacteria | 1860 |
| 421 | Ga0207707_10293791 | 3300025912 | Bacteria | 1406 |
| 422 | Ga0207707_10294529 | 3300025912 | Bacteria | 1404 |
| 423 | Ga0207707_10515954 | 3300025912 | Bacteria | 1018 |
| 424 | Ga0207695_10027324 | 3300025913 | Bacteria | 6356 |
| 425 | Ga0207695_10106193 | 3300025913 | Bacteria | 2794 |
| 426 | Ga0207695_10238431 | 3300025913 | Bacteria | 1721 |
| 427 | Ga0207671_10093594 | 3300025914 | Bacteria | 2267 |
| 428 | Ga0207693_10000461 | 3300025915 | Bacteria | 37199 |
| 429 | Ga0207693_10000702 | 3300025915 | Bacteria | 30049 |
| 430 | Ga0207693_10008489 | 3300025915 | Bacteria | 8409 |
| 431 | Ga0207693_10011291 | 3300025915 | Bacteria | 7232 |
| 432 | Ga0207693_10016960 | 3300025915 | Bacteria | 5817 |
| 433 | Ga0207693_10032098 | 3300025915 | Bacteria | 4146 |
| 434 | Ga0207693_10127862 | 3300025915 | Bacteria | 1997 |
| 435 | Ga0207693_10207424 | 3300025915 | Bacteria | 1541 |
| 436 | Ga0207693_10222606 | 3300025915 | Bacteria | 1482 |
| 437 | Ga0207693_10312327 | 3300025915 | Bacteria | 1231 |
| 438 | Ga0207693_10575375 | 3300025915 | Bacteria | 878 |
| 439 | Ga0207693_10747578 | 3300025915 | Unclassified | 756 |
| 440 | Ga0207663_10052554 | 3300025916 | Bacteria | 2542 |
| 441 | Ga0207663_10075199 | 3300025916 | Bacteria | 2191 |
| 442 | Ga0207663_10251632 | 3300025916 | Bacteria | 1301 |
| 443 | Ga0207660_10014233 | 3300025917 | Bacteria | 5226 |
| 444 | Ga0207660_10028841 | 3300025917 | Bacteria | 3801 |
| 445 | Ga0207660_10066020 | 3300025917 | Bacteria | 2616 |
| 446 | Ga0207660_10167138 | 3300025917 | Bacteria | 1701 |
| 447 | Ga0207660_10494391 | 3300025917 | Bacteria | 992 |
| 448 | Ga0207657_10002868 | 3300025919 | Bacteria | 18530 |
| 449 | Ga0207657_10003083 | 3300025919 | Bacteria | 17829 |
| 450 | Ga0207657_10005015 | 3300025919 | Bacteria | 13899 |
| 451 | Ga0207657_10008807 | 3300025919 | Bacteria | 10208 |
| 452 | Ga0207657_10014143 | 3300025919 | Bacteria | 7807 |
| 453 | Ga0207657_10063292 | 3300025919 | Bacteria | 3163 |
| 454 | Ga0207657_10140443 | 3300025919 | Bacteria | 1974 |
| 455 | Ga0207657_10400515 | 3300025919 | Bacteria | 1079 |
| 456 | Ga0207649_10053356 | 3300025920 | Bacteria | 2512 |
| 457 | Ga0207649_10099768 | 3300025920 | Bacteria | 1919 |
| 458 | Ga0207649_10119401 | 3300025920 | Bacteria | 1775 |
| 459 | Ga0207649_10181027 | 3300025920 | Bacteria | 1475 |
| 460 | Ga0207649_10284467 | 3300025920 | Bacteria | 1203 |
| 461 | Ga0207652_10008595 | 3300025921 | Bacteria | 8217 |
| 462 | Ga0207652_10026326 | 3300025921 | Bacteria | 4843 |
| 463 | Ga0207652_10026918 | 3300025921 | Bacteria | 4792 |
| 464 | Ga0207652_10030274 | 3300025921 | Bacteria | 4531 |
| 465 | Ga0207652_10030667 | 3300025921 | Bacteria | 4505 |
| 466 | Ga0207652_10030742 | 3300025921 | Bacteria | 4500 |
| 467 | Ga0207652_10052565 | 3300025921 | Bacteria | 3497 |
| 468 | Ga0207652_10086696 | 3300025921 | Bacteria | 2745 |
| 469 | Ga0207652_10348095 | 3300025921 | Bacteria | 1337 |
| 470 | Ga0207652_10556198 | 3300025921 | Bacteria | 1031 |
| 471 | Ga0207646_10078163 | 3300025922 | Bacteria | 2957 |
| 472 | Ga0207646_10110025 | 3300025922 | Bacteria | 2472 |
| 473 | Ga0207646_10883508 | 3300025922 | Unclassified | 793 |
| 474 | Ga0207694_10158109 | 3300025924 | Bacteria | 1829 |
| 475 | Ga0207694_10185525 | 3300025924 | Bacteria | 1688 |
| 476 | Ga0207694_10266024 | 3300025924 | Bacteria | 1406 |
| 477 | Ga0207694_10334248 | 3300025924 | Bacteria | 1252 |
| 478 | Ga0207694_10787324 | 3300025924 | Bacteria | 803 |
| 479 | Ga0207687_10096274 | 3300025927 | Bacteria | 2169 |
| 480 | Ga0207687_10142997 | 3300025927 | Bacteria | 1817 |
| 481 | Ga0207687_10175149 | 3300025927 | Bacteria | 1658 |
| 482 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 483 | Ga0207700_10030373 | 3300025928 | Bacteria | 3826 |
| 484 | Ga0207700_10167035 | 3300025928 | Bacteria | 1832 |
| 485 | Ga0207700_10303550 | 3300025928 | Bacteria | 1379 |
| 486 | Ga0207700_10713367 | 3300025928 | Bacteria | 895 |
| 487 | Ga0207664_10008730 | 3300025929 | Bacteria | 7085 |
| 488 | Ga0207664_10042035 | 3300025929 | Bacteria | 3565 |
| 489 | Ga0207664_10061003 | 3300025929 | Bacteria | 3007 |
| 490 | Ga0207664_10065134 | 3300025929 | Bacteria | 2917 |
| 491 | Ga0207664_10066266 | 3300025929 | Bacteria | 2894 |
| 492 | Ga0207664_10067844 | 3300025929 | Bacteria | 2863 |
| 493 | Ga0207664_10079940 | 3300025929 | Bacteria | 2656 |
| 494 | Ga0207664_10298402 | 3300025929 | Bacteria | 1417 |
| 495 | Ga0207644_10627433 | 3300025931 | Bacteria | 893 |
| 496 | Ga0207644_10669034 | 3300025931 | Bacteria | 865 |
| 497 | Ga0207690_10018829 | 3300025932 | Bacteria | 4240 |
| 498 | Ga0207690_10197890 | 3300025932 | Bacteria | 1524 |
| 499 | Ga0207690_11075618 | 3300025932 | Bacteria | 670 |
| 500 | Ga0207706_10007121 | 3300025933 | Bacteria | 10353 |
| 501 | Ga0207706_10015927 | 3300025933 | Bacteria | 6793 |
| 502 | Ga0207686_10159011 | 3300025934 | Bacteria | 1582 |
| 503 | Ga0207686_10521099 | 3300025934 | Bacteria | 925 |
| 504 | Ga0207686_10743127 | 3300025934 | Bacteria | 783 |
| 505 | Ga0207709_10265412 | 3300025935 | Bacteria | 1261 |
| 506 | Ga0207669_10593441 | 3300025937 | Bacteria | 899 |
| 507 | Ga0207704_10134375 | 3300025938 | Bacteria | 1719 |
| 508 | Ga0207704_10203795 | 3300025938 | Bacteria | 1450 |
| 509 | Ga0207704_10467756 | 3300025938 | Bacteria | 1010 |
| 510 | Ga0207665_10000146 | 3300025939 | Bacteria | 47929 |
| 511 | Ga0207665_10021141 | 3300025939 | Bacteria | 4277 |
| 512 | Ga0207665_10049684 | 3300025939 | Bacteria | 2819 |
| 513 | Ga0207665_10119006 | 3300025939 | Bacteria | 1864 |
| 514 | Ga0207689_10171619 | 3300025942 | Bacteria | 1788 |
| 515 | Ga0207661_10015658 | 3300025944 | Bacteria | 5587 |
| 516 | Ga0207661_10018237 | 3300025944 | Bacteria | 5212 |
| 517 | Ga0207661_10046700 | 3300025944 | Bacteria | 3434 |
| 518 | Ga0207661_10095601 | 3300025944 | Bacteria | 2484 |
| 519 | Ga0207661_10139938 | 3300025944 | Bacteria | 2082 |
| 520 | Ga0207661_10786084 | 3300025944 | Bacteria | 876 |
| 521 | Ga0207667_10023766 | 3300025949 | Bacteria | 6745 |
| 522 | Ga0207667_10042931 | 3300025949 | Bacteria | 4801 |
| 523 | Ga0207667_10049080 | 3300025949 | Bacteria | 4460 |
| 524 | Ga0207667_10063696 | 3300025949 | Bacteria | 3852 |
| 525 | Ga0207667_10094646 | 3300025949 | Bacteria | 3084 |
| 526 | Ga0207667_10112308 | 3300025949 | Bacteria | 2810 |
| 527 | Ga0207667_10163545 | 3300025949 | Bacteria | 2288 |
| 528 | Ga0207667_10284003 | 3300025949 | Bacteria | 1691 |
| 529 | Ga0207667_10308824 | 3300025949 | Bacteria | 1615 |
| 530 | Ga0207667_10486804 | 3300025949 | Bacteria | 1252 |
| 531 | Ga0207651_10194042 | 3300025960 | Bacteria | 1622 |
| 532 | Ga0207712_10076970 | 3300025961 | Bacteria | 2417 |
| 533 | Ga0207640_10581670 | 3300025981 | Bacteria | 945 |
| 534 | Ga0207658_10014093 | 3300025986 | Bacteria | 5475 |
| 535 | Ga0207677_10119414 | 3300026023 | Bacteria | 1980 |
| 536 | Ga0207677_10129902 | 3300026023 | Bacteria | 1911 |
| 537 | Ga0207677_10479382 | 3300026023 | Bacteria | 1071 |
| 538 | Ga0207677_10630034 | 3300026023 | Unclassified | 944 |
| 539 | Ga0207703_10206964 | 3300026035 | Bacteria | 1747 |
| 540 | Ga0207639_11082502 | 3300026041 | Bacteria | 751 |
| 541 | Ga0207678_10489210 | 3300026067 | Bacteria | 1072 |
| 542 | Ga0207678_10555866 | 3300026067 | Bacteria | 1004 |
| 543 | Ga0207708_10113974 | 3300026075 | Bacteria | 2101 |
| 544 | Ga0207702_10245026 | 3300026078 | Bacteria | 1681 |
| 545 | Ga0207702_10433490 | 3300026078 | Bacteria | 1273 |
| 546 | Ga0207702_10456585 | 3300026078 | Bacteria | 1240 |
| 547 | Ga0207702_10475285 | 3300026078 | Bacteria | 1216 |
| 548 | Ga0207648_10088051 | 3300026089 | Bacteria | 2711 |
| 549 | Ga0207676_11117201 | 3300026095 | Bacteria | 779 |
| 550 | Ga0207674_10019053 | 3300026116 | Bacteria | 7437 |
| 551 | Ga0207674_10043887 | 3300026116 | Bacteria | 4608 |
| 552 | Ga0207674_10087770 | 3300026116 | Bacteria | 3104 |
| 553 | Ga0207674_10170622 | 3300026116 | Bacteria | 2129 |
| 554 | Ga0207674_10578081 | 3300026116 | Bacteria | 1085 |
| 555 | Ga0207675_100006643 | 3300026118 | Bacteria | 10939 |
| 556 | Ga0207675_100187622 | 3300026118 | Bacteria | 1982 |
| 557 | Ga0207683_10012401 | 3300026121 | Bacteria | 7273 |
| 558 | Ga0207683_10014743 | 3300026121 | Bacteria | 6654 |
| 559 | Ga0207683_10545586 | 3300026121 | Bacteria | 1072 |
| 560 | Ga0207683_10750272 | 3300026121 | Bacteria | 905 |
| 561 | Ga0207698_10051628 | 3300026142 | Bacteria | 3145 |
| 562 | Ga0207698_10180109 | 3300026142 | Bacteria | 1871 |
| 563 | Ga0207698_10442539 | 3300026142 | Bacteria | 1252 |
| 564 | Ga0207428_10095826 | 3300027907 | Bacteria | 2299 |
| 565 | Ga0268266_10304158 | 3300028379 | Bacteria | 1488 |
| 566 | Ga0268265_10329218 | 3300028380 | Bacteria | 1387 |
| 567 | Ga0265326_10097812 | 3300028558 | Unclassified | 832 |
| 568 | Ga0265319_1001275 | 3300028563 | Bacteria | 15284 |
| 569 | Ga0265319_1005524 | 3300028563 | Bacteria | 6041 |
| 570 | Ga0265319_1031145 | 3300028563 | Bacteria | 1859 |
| 571 | Ga0265319_1040736 | 3300028563 | Bacteria | 1570 |
| 572 | Ga0265334_10000542 | 3300028573 | Bacteria | 19259 |
| 573 | Ga0265334_10008317 | 3300028573 | Bacteria | 4414 |
| 574 | Ga0265318_10000276 | 3300028577 | Bacteria | 43159 |
| 575 | Ga0265318_10015788 | 3300028577 | Bacteria | 3132 |
| 576 | Ga0265318_10076336 | 3300028577 | Bacteria | 1239 |
| 577 | Ga0265323_10024468 | 3300028653 | Bacteria | 2295 |
| 578 | Ga0265322_10024396 | 3300028654 | Bacteria | 1729 |
| 579 | Ga0265336_10047508 | 3300028666 | Unclassified | 1303 |
| 580 | Ga0265338_10017462 | 3300028800 | Bacteria | 7730 |
| 581 | Ga0265338_10024846 | 3300028800 | Bacteria | 6105 |
| 582 | Ga0265338_10055972 | 3300028800 | Bacteria | 3503 |
| 583 | Ga0265338_10122790 | 3300028800 | Unclassified | 2066 |
| 584 | Ga0265338_10170725 | 3300028800 | Bacteria | 1668 |
| 585 | Ga0265324_10013644 | 3300029957 | Bacteria | 3025 |
| 586 | Ga0265324_10145453 | 3300029957 | Unclassified | 805 |
| 587 | Ga0265330_10000888 | 3300031235 | Bacteria | 18608 |
| 588 | Ga0265330_10011338 | 3300031235 | Bacteria | 4183 |
| 589 | Ga0265332_10012350 | 3300031238 | Bacteria | 3790 |
| 590 | Ga0265328_10001224 | 3300031239 | Bacteria | 11887 |
| 591 | Ga0265320_10035999 | 3300031240 | Bacteria | 2505 |
| 592 | Ga0265320_10101522 | 3300031240 | Bacteria | 1324 |
| 593 | Ga0265325_10001745 | 3300031241 | Bacteria | 15083 |
| 594 | Ga0265325_10071493 | 3300031241 | Bacteria | 1741 |
| 595 | Ga0265325_10082195 | 3300031241 | Bacteria | 1599 |
| 596 | Ga0265329_10029686 | 3300031242 | Unclassified | 1785 |
| 597 | Ga0265340_10001237 | 3300031247 | Bacteria | 14637 |
| 598 | Ga0265340_10046610 | 3300031247 | Bacteria | 2114 |
| 599 | Ga0265340_10208973 | 3300031247 | Unclassified | 876 |
| 600 | Ga0265339_10042865 | 3300031249 | Bacteria | 2504 |
| 601 | Ga0265331_10000959 | 3300031250 | Bacteria | 22955 |
| 602 | Ga0265331_10021613 | 3300031250 | Bacteria | 3291 |
| 603 | Ga0265331_10200273 | 3300031250 | Bacteria | 900 |
| 604 | Ga0265327_10012224 | 3300031251 | Bacteria | 5819 |
| 605 | Ga0265327_10069980 | 3300031251 | Unclassified | 1759 |
| 606 | Ga0265316_10002153 | 3300031344 | Bacteria | 20707 |
| 607 | Ga0265316_10024056 | 3300031344 | Bacteria | 5113 |
| 608 | Ga0265316_10289811 | 3300031344 | Bacteria | 1194 |
| 609 | Ga0307408_100063581 | 3300031548 | Bacteria | 2700 |
| 610 | Ga0307408_100334019 | 3300031548 | Bacteria | 1281 |
| 611 | Ga0265313_10002758 | 3300031595 | Bacteria | 14812 |
| 612 | Ga0265313_10058544 | 3300031595 | Bacteria | 1815 |
| 613 | Ga0265313_10115907 | 3300031595 | Bacteria | 1173 |
| 614 | Ga0265314_10018097 | 3300031711 | Bacteria | 5507 |
| 615 | Ga0265314_10027632 | 3300031711 | Bacteria | 4246 |
| 616 | Ga0265342_10011564 | 3300031712 | Bacteria | 6030 |
| 617 | Ga0265342_10152463 | 3300031712 | Bacteria | 1282 |
| 618 | Ga0307405_10044112 | 3300031731 | Bacteria | 2725 |
| 619 | Ga0307410_10009172 | 3300031852 | Bacteria | 5535 |
| 620 | Ga0307406_10158612 | 3300031901 | Unclassified | 1623 |
| 621 | Ga0307406_10270158 | 3300031901 | Unclassified | 1291 |
| 622 | Ga0307407_10073184 | 3300031903 | Bacteria | 2046 |
| 623 | Ga0307412_10036218 | 3300031911 | Bacteria | 3159 |
| 624 | Ga0307412_10605937 | 3300031911 | Bacteria | 928 |
| 625 | Ga0307409_100004736 | 3300031995 | Bacteria | 7704 |
| 626 | Ga0307416_100025483 | 3300032002 | Bacteria | 4335 |
| 627 | Ga0307416_100059067 | 3300032002 | Bacteria | 3114 |
| 628 | Ga0307416_100093554 | 3300032002 | Bacteria | 2590 |
| 629 | Ga0307416_100119644 | 3300032002 | Bacteria | 2343 |
| 630 | Ga0307411_10005329 | 3300032005 | Bacteria | 6300 |
| 631 | Ga0307415_100001447 | 3300032126 | Bacteria | 11375 |
| 632 | Ga0307415_100021574 | 3300032126 | Bacteria | 3962 |
| 633 | Ga0307415_100121329 | 3300032126 | Unclassified | 1960 |
| 634 | Ga0307415_100496769 | 3300032126 | Bacteria | 1066 |
| 635 | Ga0373948_0006809 | 3300034817 | Unclassified | 1903 |
| 636 | Ga0373959_0049596 | 3300034820 | Bacteria | 903 |
| 637 | Ga0373926_0025609 | 3300035083 | Bacteria | 2060 |
| 638 | Ga0373926_0040375 | 3300035083 | Bacteria | 1665 |
| 639 | Ga0373926_0057815 | 3300035083 | Unclassified | 1409 |
| 640 | Ga0373928_0005155 | 3300035084 | Bacteria | 2494 |
| 641 | Ga0373929_0005100 | 3300035085 | Bacteria | 2361 |
| 642 | Ga0373929_0018931 | 3300035085 | Bacteria | 1373 |
| 643 | Ga0373944_0009624 | 3300035089 | Bacteria | 2624 |
| 644 | Ga0373944_0081566 | 3300035089 | Bacteria | 1069 |
| 645 | Ga0373949_0021962 | 3300035090 | Bacteria | 1468 |
| 646 | Ga0373932_0002679 | 3300035112 | Bacteria | 4433 |
| 647 | Ga0373936_0049871 | 3300035113 | Bacteria | 1692 |
| 648 | Ga0373936_0216551 | 3300035113 | Bacteria | 848 |
| 649 | Ga0373939_0003023 | 3300035114 | Bacteria | 3949 |
| 650 | Ga0373939_0043509 | 3300035114 | Bacteria | 1363 |
| 651 | Ga0373941_0004411 | 3300035115 | Bacteria | 3251 |
| 652 | Ga0373941_0019264 | 3300035115 | Bacteria | 1897 |
| 653 | Ga0373945_0002294 | 3300035116 | Bacteria | 5986 |
| 654 | Ga0373943_0000138 | 3300035170 | Bacteria | 27619 |
| 655 | Ga0373943_0009977 | 3300035170 | Bacteria | 4257 |
| 656 | Ga0373943_0026436 | 3300035170 | Bacteria | 2719 |
| 657 | Ga0373946_0004089 | 3300035171 | Bacteria | 5200 |
| 658 | Ga0373942_0010786 | 3300035207 | Unclassified | 2154 |
| 659 | Ga0373962_0105163 | 3300035242 | Bacteria | 885 |
| 660 | Ga0373931_0076962 | 3300035691 | Bacteria | 1833 |
| 661 | Ga0373931_0254857 | 3300035691 | Bacteria | 1068 |
| 662 | Ga0373935_0011408 | 3300035692 | Bacteria | 5335 |
| 663 | Ga0373935_0230730 | 3300035692 | Unclassified | 1289 |
| 664 | Ga0373927_0003815 | 3300035695 | Bacteria | 10696 |
| 665 | Ga0373927_0026654 | 3300035695 | Bacteria | 3778 |
| 666 | Ga0373947_0000341 | 3300035725 | Bacteria | 26341 |
| 667 | Ga0373947_0001997 | 3300035725 | Bacteria | 12467 |
| 668 | Ga0373947_0012643 | 3300035725 | Bacteria | 4840 |
| 669 | Ga0373947_0098462 | 3300035725 | Bacteria | 1834 |
| 670 | Ga0373937_0193520 | 3300036401 | Bacteria | 1911 |
| 671 | Ga0373937_0295087 | 3300036401 | Bacteria | 1532 |
| 672 | Ga0373925_0005884 | 3300037068 | Bacteria | 9089 |
| 673 | Ga0373925_0013009 | 3300037068 | Bacteria | 6026 |
| 674 | Ga0373925_0015551 | 3300037068 | Bacteria | 5505 |
| 675 | Ga0373925_0058299 | 3300037068 | Bacteria | 2895 |
| 676 | Ga0395899_0002546 | 3300037312 | Bacteria | 14762 |
| 677 | Ga0395899_0005507 | 3300037312 | Bacteria | 9807 |
| 678 | Ga0395899_0010299 | 3300037312 | Bacteria | 7168 |
| 679 | Ga0395899_0013850 | 3300037312 | Bacteria | 6161 |
| 680 | Ga0395899_0023030 | 3300037312 | Bacteria | 4720 |
| 681 | Ga0395899_0033666 | 3300037312 | Bacteria | 3848 |
| 682 | Ga0395899_0061130 | 3300037312 | Bacteria | 2774 |
| 683 | Ga0395899_0090643 | 3300037312 | Bacteria | 2216 |
| 684 | Ga0395899_0095253 | 3300037312 | Bacteria | 2153 |
| 685 | Ga0395899_0098507 | 3300037312 | Bacteria | 2112 |
| 686 | Ga0395899_0100614 | 3300037312 | Bacteria | 2087 |
| 687 | Ga0395899_0103058 | 3300037312 | Bacteria | 2058 |
| 688 | Ga0395899_0162991 | 3300037312 | Bacteria | 1574 |
| 689 | Ga0395900_0004292 | 3300037418 | Bacteria | 15113 |
| 690 | Ga0395900_0005329 | 3300037418 | Bacteria | 13477 |
| 691 | Ga0395900_0007939 | 3300037418 | Bacteria | 10922 |
| 692 | Ga0395900_0009570 | 3300037418 | Bacteria | 9934 |
| 693 | Ga0395900_0009982 | 3300037418 | Bacteria | 9718 |
| 694 | Ga0395900_0010097 | 3300037418 | Bacteria | 9657 |
| 695 | Ga0395900_0041260 | 3300037418 | Bacteria | 4757 |
| 696 | Ga0395900_0042835 | 3300037418 | Bacteria | 4664 |
| 697 | Ga0395900_0065552 | 3300037418 | Unclassified | 3731 |
| 698 | Ga0395900_0070152 | 3300037418 | Bacteria | 3602 |
| 699 | Ga0395900_0087704 | 3300037418 | Bacteria | 3198 |
| 700 | Ga0395900_0096441 | 3300037418 | Bacteria | 3038 |
| 701 | Ga0395900_0108791 | 3300037418 | Bacteria | 2847 |
| 702 | Ga0395900_0165659 | 3300037418 | Bacteria | 2252 |
| 703 | Ga0395900_0181992 | 3300037418 | Bacteria | 2135 |
| 704 | Ga0395900_0353226 | 3300037418 | Unclassified | 1443 |
| 705 | Ga0395900_0396334 | 3300037418 | Bacteria | 1345 |
| 706 | Ga0395900_0420102 | 3300037418 | Bacteria | 1298 |
| 707 | Ga0395900_0466149 | 3300037418 | Bacteria | 1217 |
| 708 | Ga0395900_0487187 | 3300037418 | Unclassified | 1185 |
| 709 | Ga0395900_0633417 | 3300037418 | Bacteria | 1007 |
| 710 | Ga0395900_0955006 | 3300037418 | Bacteria | 778 |
| 711 | Ga0395898_0001631 | 3300037466 | Bacteria | 30388 |
| 712 | Ga0395898_0002095 | 3300037466 | Bacteria | 24808 |
| 713 | Ga0395898_0006255 | 3300037466 | Bacteria | 12739 |
| 714 | Ga0395898_0006291 | 3300037466 | Bacteria | 12692 |
| 715 | Ga0395898_0019037 | 3300037466 | Bacteria | 6990 |
| 716 | Ga0395898_0023536 | 3300037466 | Bacteria | 6223 |
| 717 | Ga0395898_0032301 | 3300037466 | Bacteria | 5224 |
| 718 | Ga0395898_0032496 | 3300037466 | Bacteria | 5209 |
| 719 | Ga0395898_0066573 | 3300037466 | Bacteria | 3489 |
| 720 | Ga0395898_0108137 | 3300037466 | Bacteria | 2666 |
| 721 | Ga0395898_0125916 | 3300037466 | Bacteria | 2454 |
| 722 | Ga0395898_0155567 | 3300037466 | Bacteria | 2187 |
| 723 | Ga0395898_0170507 | 3300037466 | Unclassified | 2080 |
| 724 | Ga0395898_0179127 | 3300037466 | Bacteria | 2025 |
| 725 | Ga0395898_0187122 | 3300037466 | Bacteria | 1979 |
| 726 | Ga0395898_0289532 | 3300037466 | Bacteria | 1562 |
| 727 | Ga0395898_0353186 | 3300037466 | Bacteria | 1402 |
| 728 | Ga0395898_0391793 | 3300037466 | Bacteria | 1324 |
| 729 | Ga0395898_0418877 | 3300037466 | Bacteria | 1276 |
| 730 | Ga0395898_0509023 | 3300037466 | Bacteria | 1145 |
| 731 | Ga0395898_0543911 | 3300037466 | Bacteria | 1103 |
| 732 | Ga0395898_0590166 | 3300037466 | Unclassified | 1053 |
| 733 | Ga0395905_0004797 | 3300037471 | Bacteria | 13962 |
| 734 | Ga0395905_0004929 | 3300037471 | Bacteria | 13743 |
| 735 | Ga0395905_0009450 | 3300037471 | Bacteria | 9528 |
| 736 | Ga0395905_0010819 | 3300037471 | Bacteria | 8838 |
| 737 | Ga0395905_0039716 | 3300037471 | Bacteria | 4415 |
| 738 | Ga0395905_0046976 | 3300037471 | Bacteria | 4047 |
| 739 | Ga0395905_0055930 | 3300037471 | Bacteria | 3693 |
| 740 | Ga0395905_0065572 | 3300037471 | Bacteria | 3400 |
| 741 | Ga0395905_0075743 | 3300037471 | Bacteria | 3153 |
| 742 | Ga0395905_0087562 | 3300037471 | Bacteria | 2920 |
| 743 | Ga0395905_0134619 | 3300037471 | Bacteria | 2324 |
| 744 | Ga0395905_0170797 | 3300037471 | Bacteria | 2042 |
| 745 | Ga0395905_0181290 | 3300037471 | Bacteria | 1977 |
| 746 | Ga0395905_0301215 | 3300037471 | Bacteria | 1491 |
| 747 | Ga0395905_0401169 | 3300037471 | Bacteria | 1266 |
| 748 | Ga0395905_0628352 | 3300037471 | Bacteria | 976 |
| 749 | Ga0395905_0669211 | 3300037471 | Bacteria | 940 |
| 750 | Ga0395905_0684576 | 3300037471 | Unclassified | 928 |
| 751 | Ga0395901_0000370 | 3300038443 | Bacteria | 54012 |
| 752 | Ga0395901_0002781 | 3300038443 | Bacteria | 17641 |
| 753 | Ga0395901_0007108 | 3300038443 | Bacteria | 11313 |
| 754 | Ga0395901_0008638 | 3300038443 | Bacteria | 10290 |
| 755 | Ga0395901_0008830 | 3300038443 | Bacteria | 10202 |
| 756 | Ga0395901_0010224 | 3300038443 | Bacteria | 9505 |
| 757 | Ga0395901_0015385 | 3300038443 | Bacteria | 7788 |
| 758 | Ga0395901_0017424 | 3300038443 | Bacteria | 7333 |
| 759 | Ga0395901_0021691 | 3300038443 | Bacteria | 6581 |
| 760 | Ga0395901_0031941 | 3300038443 | Bacteria | 5430 |
| 761 | Ga0395901_0043130 | 3300038443 | Bacteria | 4680 |
| 762 | Ga0395901_0060529 | 3300038443 | Bacteria | 3940 |
| 763 | Ga0395901_0085451 | 3300038443 | Bacteria | 3298 |
| 764 | Ga0395901_0099551 | 3300038443 | Bacteria | 3048 |
| 765 | Ga0395901_0123264 | 3300038443 | Bacteria | 2723 |
| 766 | Ga0395901_0136253 | 3300038443 | Bacteria | 2580 |
| 767 | Ga0395901_0172238 | 3300038443 | Bacteria | 2271 |
| 768 | Ga0395901_0175044 | 3300038443 | Bacteria | 2251 |
| 769 | Ga0395901_0190818 | 3300038443 | Bacteria | 2149 |
| 770 | Ga0395901_0209330 | 3300038443 | Unclassified | 2042 |
| 771 | Ga0395901_0279796 | 3300038443 | Bacteria | 1733 |
| 772 | Ga0395901_0311270 | 3300038443 | Bacteria | 1631 |
| 773 | Ga0395901_0473359 | 3300038443 | Bacteria | 1278 |
| 774 | Ga0395901_0600070 | 3300038443 | Bacteria | 1110 |
| 775 | Ga0395901_0679821 | 3300038443 | Bacteria | 1029 |
| 776 | Ga0436365_0045703 | 3300039437 | Bacteria | 849 |
| 777 | Ga0436365_0408949 | 3300039437 | Bacteria | 1085 |
| 778 | Ga0436360_0331421 | 3300039438 | Bacteria | 2721 |
| 779 | Ga0436363_0152649 | 3300039450 | Bacteria | 857 |
| 780 | Ga0439453_0002584 | 3300041408 | Unclassified | 2513 |
| 781 | Ga0451853_1962744 | 3300041512 | Bacteria | 922 |
| 782 | Ga0451853_2140449 | 3300041512 | Unclassified | 862 |
| 783 | Ga0439451_003932 | 3300042009 | Bacteria | 3021 |
| 784 | Ga0439454_000703 | 3300042011 | Bacteria | 2838 |
| 785 | Ga0450915_000315 | 3300042119 | Bacteria | 1610 |
| 786 | Ga0439434_0021593 | 3300042435 | Unclassified | 1934 |
| 787 | Ga0439464_0142132 | 3300042439 | Bacteria | 748 |
| 788 | Ga0439460_0080028 | 3300042461 | Bacteria | 1024 |
| 789 | Ga0466969_0001022 | 3300044656 | Bacteria | 15129 |
| 790 | Ga0466965_0033821 | 3300044683 | Bacteria | 2499 |
| 791 | Ga0466965_0137473 | 3300044683 | Bacteria | 1270 |
| 792 | Ga0466965_0195053 | 3300044683 | Bacteria | 1072 |
| 793 | Ga0466966_0012031 | 3300044684 | Bacteria | 5734 |
| 794 | Ga0466966_0067725 | 3300044684 | Bacteria | 2242 |
| 795 | Ga0466966_0180162 | 3300044684 | Bacteria | 1282 |
| 796 | Ga0466966_0265413 | 3300044684 | Bacteria | 1033 |
| 797 | Ga0466961_0001191 | 3300044693 | Bacteria | 16033 |
| 798 | Ga0466961_0018390 | 3300044693 | Bacteria | 4494 |
| 799 | Ga0466961_0074851 | 3300044693 | Bacteria | 2147 |
| 800 | Ga0466961_0121201 | 3300044693 | Bacteria | 1642 |
| 801 | Ga0466961_0132631 | 3300044693 | Bacteria | 1561 |
| 802 | Ga0466961_0221409 | 3300044693 | Bacteria | 1166 |
| 803 | Ga0466961_0416819 | 3300044693 | Bacteria | 814 |
| 804 | Ga0466963_0000914 | 3300044694 | Bacteria | 15029 |
| 805 | Ga0466963_0001196 | 3300044694 | Bacteria | 13665 |
| 806 | Ga0466963_0001298 | 3300044694 | Bacteria | 13275 |
| 807 | Ga0466963_0001427 | 3300044694 | Bacteria | 12874 |
| 808 | Ga0466963_0002207 | 3300044694 | Bacteria | 10769 |
| 809 | Ga0466963_0008622 | 3300044694 | Bacteria | 6120 |
| 810 | Ga0466963_0017329 | 3300044694 | Bacteria | 4489 |
| 811 | Ga0466963_0017933 | 3300044694 | Bacteria | 4417 |
| 812 | Ga0466963_0025101 | 3300044694 | Bacteria | 3798 |
| 813 | Ga0466963_0043425 | 3300044694 | Bacteria | 2955 |
| 814 | Ga0466963_0048505 | 3300044694 | Bacteria | 2806 |
| 815 | Ga0466963_0066982 | 3300044694 | Bacteria | 2409 |
| 816 | Ga0466963_0084695 | 3300044694 | Bacteria | 2151 |
| 817 | Ga0466963_0094273 | 3300044694 | Bacteria | 2041 |
| 818 | Ga0466963_0266345 | 3300044694 | Unclassified | 1203 |
| 819 | Ga0466963_0267948 | 3300044694 | Bacteria | 1200 |
| 820 | Ga0466963_0306672 | 3300044694 | Bacteria | 1117 |
| 821 | Ga0466964_0000233 | 3300044706 | Bacteria | 15978 |
| 822 | Ga0466964_0001964 | 3300044706 | Bacteria | 7208 |
| 823 | Ga0466964_0005348 | 3300044706 | Bacteria | 4769 |
| 824 | Ga0466964_0019611 | 3300044706 | Bacteria | 2601 |
| 825 | Ga0466964_0043634 | 3300044706 | Bacteria | 1819 |
| 826 | Ga0466964_0078904 | 3300044706 | Bacteria | 1408 |
| 827 | Ga0453684_1065801 | 3300044712 | Bacteria | 856 |
| 828 | Ga0466971_0000350 | 3300044719 | Bacteria | 17732 |
| 829 | Ga0466971_0003188 | 3300044719 | Bacteria | 6997 |
| 830 | Ga0466971_0026888 | 3300044719 | Bacteria | 2575 |
| 831 | Ga0466971_0103101 | 3300044719 | Bacteria | 1312 |
| 832 | Ga0466971_0119714 | 3300044719 | Bacteria | 1218 |
| 833 | Ga0466968_0001689 | 3300044735 | Bacteria | 7940 |
| 834 | Ga0466968_0002266 | 3300044735 | Bacteria | 7030 |
| 835 | Ga0466968_0036088 | 3300044735 | Bacteria | 2070 |
| 836 | Ga0466968_0160153 | 3300044735 | Bacteria | 1038 |
| 837 | Ga0466968_0161678 | 3300044735 | Bacteria | 1034 |
| 838 | Ga0466970_0063311 | 3300044765 | Bacteria | 1983 |
| 839 | Ga0466970_0106285 | 3300044765 | Bacteria | 1531 |
| 840 | Ga0466970_0114880 | 3300044765 | Bacteria | 1471 |
| 841 | Ga0466957_0029553 | 3300044842 | Bacteria | 3269 |
| 842 | Ga0466957_0107554 | 3300044842 | Bacteria | 1765 |
| 843 | Ga0466957_0153241 | 3300044842 | Bacteria | 1492 |
| 844 | Ga0466957_0204107 | 3300044842 | Bacteria | 1299 |
| 845 | Ga0466960_0015693 | 3300044901 | Bacteria | 3271 |
| 846 | Ga0466960_0090430 | 3300044901 | Bacteria | 1559 |
| 847 | Ga0466959_0004794 | 3300045049 | Bacteria | 9127 |
| 848 | Ga0466959_0040920 | 3300045049 | Bacteria | 3423 |
| 849 | Ga0466959_0041197 | 3300045049 | Bacteria | 3410 |
| 850 | Ga0466959_0135980 | 3300045049 | Bacteria | 1740 |
| 851 | Ga0466959_0614810 | 3300045049 | Bacteria | 730 |
| 852 | Ga0451576_0307526 | 3300045051 | Bacteria | 1658 |
| 853 | Ga0466958_0000492 | 3300045836 | Bacteria | 16518 |
| 854 | Ga0466958_0000876 | 3300045836 | Bacteria | 13433 |
| 855 | Ga0466958_0001126 | 3300045836 | Bacteria | 12360 |
| 856 | Ga0466958_0002049 | 3300045836 | Bacteria | 9957 |
| 857 | Ga0466958_0004846 | 3300045836 | Bacteria | 7163 |
| 858 | Ga0466958_0008105 | 3300045836 | Bacteria | 5813 |
| 859 | Ga0466958_0037288 | 3300045836 | Bacteria | 2913 |
| 860 | Ga0466958_0074057 | 3300045836 | Bacteria | 2086 |
| 861 | Ga0466958_0108466 | 3300045836 | Bacteria | 1732 |
| 862 | Ga0466958_0186531 | 3300045836 | Bacteria | 1317 |
| 863 | Ga0466967_0001317 | 3300045976 | Bacteria | 14199 |
| 864 | Ga0466967_0003283 | 3300045976 | Bacteria | 10492 |
| 865 | Ga0466967_0004635 | 3300045976 | Bacteria | 9319 |
| 866 | Ga0466967_0009901 | 3300045976 | Bacteria | 7111 |
| 867 | Ga0466967_0013679 | 3300045976 | Bacteria | 6284 |
| 868 | Ga0466967_0018661 | 3300045976 | Bacteria | 5552 |
| 869 | Ga0466967_0019638 | 3300045976 | Bacteria | 5439 |
| 870 | Ga0466967_0019874 | 3300045976 | Bacteria | 5413 |
| 871 | Ga0466967_0020088 | 3300045976 | Bacteria | 5389 |
| 872 | Ga0466967_0025389 | 3300045976 | Bacteria | 4885 |
| 873 | Ga0466967_0030402 | 3300045976 | Bacteria | 4532 |
| 874 | Ga0466967_0030404 | 3300045976 | Bacteria | 4532 |
| 875 | Ga0466967_0030640 | 3300045976 | Bacteria | 4517 |
| 876 | Ga0466967_0041340 | 3300045976 | Bacteria | 3974 |
| 877 | Ga0466967_0043208 | 3300045976 | Bacteria | 3901 |
| 878 | Ga0466967_0046522 | 3300045976 | Bacteria | 3778 |
| 879 | Ga0466967_0063686 | 3300045976 | Bacteria | 3277 |
| 880 | Ga0466967_0068456 | 3300045976 | Bacteria | 3170 |
| 881 | Ga0466967_0070566 | 3300045976 | Bacteria | 3125 |
| 882 | Ga0466967_0071017 | 3300045976 | Bacteria | 3116 |
| 883 | Ga0466967_0078771 | 3300045976 | Bacteria | 2969 |
| 884 | Ga0466967_0117299 | 3300045976 | Bacteria | 2453 |
| 885 | Ga0466967_0168476 | 3300045976 | Bacteria | 2059 |
| 886 | Ga0466967_0363050 | 3300045976 | Bacteria | 1403 |
| 887 | Ga0466967_0372857 | 3300045976 | Bacteria | 1384 |
| 888 | Ga0466967_0398526 | 3300045976 | Bacteria | 1339 |
| 889 | Ga0466967_0405502 | 3300045976 | Bacteria | 1327 |
| 890 | Ga0466967_0733478 | 3300045976 | Bacteria | 979 |
| 891 | Ga0495592_0010091 | 3300046454 | Bacteria | 7113 |
| 892 | Ga0495603_0048410 | 3300046455 | Bacteria | 2531 |
| 893 | Ga0495629_0001540 | 3300046459 | Bacteria | 18100 |
| 894 | Ga0495629_0043195 | 3300046459 | Bacteria | 3165 |
| 895 | Ga0495629_0054498 | 3300046459 | Bacteria | 2797 |
| 896 | Ga0495629_0154537 | 3300046459 | Bacteria | 1594 |
| 897 | Ga0495641_0000345 | 3300046461 | Bacteria | 38081 |
| 898 | Ga0495641_0007704 | 3300046461 | Bacteria | 6680 |
| 899 | Ga0495641_0082697 | 3300046461 | Bacteria | 1438 |
| 900 | Ga0495641_0158876 | 3300046461 | Bacteria | 1011 |
| 901 | Ga0495651_0061025 | 3300046462 | Bacteria | 2886 |
| 902 | Ga0495651_0216805 | 3300046462 | Bacteria | 1327 |
| 903 | Ga0495653_0031375 | 3300046463 | Bacteria | 4223 |
| 904 | Ga0495653_0058748 | 3300046463 | Bacteria | 2923 |
| 905 | Ga0495653_0067578 | 3300046463 | Bacteria | 2684 |
| 906 | Ga0495653_0246594 | 3300046463 | Bacteria | 1187 |
| 907 | Ga0495580_0113602 | 3300046472 | Bacteria | 1881 |
| 908 | Ga0495582_0001048 | 3300046473 | Bacteria | 15517 |
| 909 | Ga0495582_0051190 | 3300046473 | Bacteria | 2276 |
| 910 | Ga0495582_0128748 | 3300046473 | Bacteria | 1429 |
| 911 | Ga0495605_0056627 | 3300046474 | Bacteria | 1890 |
| 912 | Ga0495605_0076891 | 3300046474 | Bacteria | 1567 |
| 913 | Ga0495639_0001922 | 3300046475 | Bacteria | 9221 |
| 914 | Ga0495639_0005637 | 3300046475 | Bacteria | 5386 |
| 915 | Ga0495639_0013660 | 3300046475 | Bacteria | 3512 |
| 916 | Ga0495662_0006548 | 3300046476 | Bacteria | 5816 |
| 917 | Ga0495662_0035412 | 3300046476 | Bacteria | 2408 |
| 918 | Ga0495662_0113919 | 3300046476 | Bacteria | 1326 |
| 919 | Ga0495664_0018381 | 3300046477 | Bacteria | 4003 |
| 920 | Ga0495664_0033236 | 3300046477 | Bacteria | 3031 |
| 921 | Ga0495664_0366805 | 3300046477 | Bacteria | 866 |
| 922 | Ga0495585_0144735 | 3300046492 | Bacteria | 1243 |
| 923 | Ga0495596_0033129 | 3300046500 | Bacteria | 2057 |
| 924 | Ga0495596_0097745 | 3300046500 | Unclassified | 1140 |
| 925 | Ga0495607_0014777 | 3300046501 | Bacteria | 5075 |
| 926 | Ga0495608_0014286 | 3300046511 | Bacteria | 5510 |
| 927 | Ga0495608_0066666 | 3300046511 | Bacteria | 2356 |
| 928 | Ga0495608_0143594 | 3300046511 | Bacteria | 1523 |
| 929 | Ga0495608_0306503 | 3300046511 | Bacteria | 983 |
| 930 | Ga0495618_0030099 | 3300046514 | Bacteria | 3389 |
| 931 | Ga0495618_0300554 | 3300046514 | Bacteria | 997 |
| 932 | Ga0495628_0013401 | 3300046516 | Bacteria | 6898 |
| 933 | Ga0495628_0086213 | 3300046516 | Bacteria | 2435 |
| 934 | Ga0495628_0210053 | 3300046516 | Bacteria | 1464 |
| 935 | Ga0495630_0004423 | 3300046517 | Bacteria | 9861 |
| 936 | Ga0495630_0004589 | 3300046517 | Bacteria | 9685 |
| 937 | Ga0495630_0019816 | 3300046517 | Bacteria | 4950 |
| 938 | Ga0495630_0026576 | 3300046517 | Bacteria | 4286 |
| 939 | Ga0495630_0074042 | 3300046517 | Bacteria | 2564 |
| 940 | Ga0495630_0634288 | 3300046517 | Bacteria | 818 |
| 941 | Ga0495630_0856793 | 3300046517 | Bacteria | 693 |
| 942 | Ga0495637_0122992 | 3300046520 | Bacteria | 997 |
| 943 | Ga0495644_0014567 | 3300046523 | Bacteria | 3011 |
| 944 | Ga0495663_0014503 | 3300046525 | Bacteria | 2210 |
| 945 | Ga0495663_0057717 | 3300046525 | Unclassified | 1215 |
| 946 | Ga0495666_0001773 | 3300046526 | Bacteria | 10651 |
| 947 | Ga0495666_0025487 | 3300046526 | Bacteria | 2920 |
| 948 | Ga0495652_0068656 | 3300046529 | Bacteria | 2969 |
| 949 | Ga0495652_0212969 | 3300046529 | Bacteria | 1457 |
| 950 | Ga0495652_0309765 | 3300046529 | Bacteria | 1144 |
| 951 | Ga0495665_0001821 | 3300046531 | Bacteria | 11503 |
| 952 | Ga0495665_0044257 | 3300046531 | Unclassified | 2365 |
| 953 | Ga0495665_0226950 | 3300046531 | Bacteria | 965 |
| 954 | Ga0495640_0006831 | 3300046533 | Bacteria | 8994 |
| 955 | Ga0495640_0011558 | 3300046533 | Bacteria | 6787 |
| 956 | Ga0495640_0035333 | 3300046533 | Bacteria | 3537 |
| 957 | Ga0495640_0055283 | 3300046533 | Unclassified | 2715 |
| 958 | Ga0495640_0087369 | 3300046533 | Bacteria | 2062 |
| 959 | Ga0495586_0052091 | 3300046535 | Bacteria | 2215 |
| 960 | Ga0495587_0074226 | 3300046536 | Bacteria | 1975 |
| 961 | Ga0495587_0227501 | 3300046536 | Bacteria | 1051 |
| 962 | Ga0495598_0063417 | 3300046537 | Bacteria | 1146 |
| 963 | Ga0495598_0066037 | 3300046537 | Bacteria | 1128 |
| 964 | Ga0495645_0111378 | 3300046543 | Bacteria | 1936 |
| 965 | Ga0495667_0006269 | 3300046559 | Bacteria | 8065 |
| 966 | Ga0495667_0024684 | 3300046559 | Bacteria | 4048 |
| 967 | Ga0495667_0033526 | 3300046559 | Bacteria | 3436 |
| 968 | Ga0495667_0523925 | 3300046559 | Bacteria | 741 |
| 969 | Ga0495656_0056885 | 3300046615 | Bacteria | 1691 |
| 970 | Ga0495656_0068538 | 3300046615 | Bacteria | 1569 |
| 971 | Ga0495656_0340869 | 3300046615 | Bacteria | 775 |
| 972 | Ga0495668_0056101 | 3300046616 | Bacteria | 2175 |
| 973 | Ga0495634_0011233 | 3300046642 | Bacteria | 6529 |
| 974 | Ga0495634_0045402 | 3300046642 | Bacteria | 2970 |
| 975 | Ga0495634_0098949 | 3300046642 | Bacteria | 1886 |
| 976 | Ga0495634_0112610 | 3300046642 | Unclassified | 1748 |
| 977 | Ga0495635_0025411 | 3300046663 | Bacteria | 4125 |
| 978 | Ga0495635_0059627 | 3300046663 | Bacteria | 2624 |
| 979 | Ga0495635_0060626 | 3300046663 | Unclassified | 2599 |
| 980 | Ga0495659_0024285 | 3300046664 | Bacteria | 2067 |
| 981 | Ga0495659_0078481 | 3300046664 | Bacteria | 1249 |
| 982 | Ga0495661_0207929 | 3300046665 | Bacteria | 1021 |
| 983 | Ga0495661_0217056 | 3300046665 | Bacteria | 993 |
| 984 | Ga0495661_0326713 | 3300046665 | Unclassified | 761 |
| 985 | Ga0495661_0355249 | 3300046665 | Bacteria | 721 |
| 986 | Ga0495657_0089649 | 3300046675 | Bacteria | 1975 |
| 987 | Ga0495657_0125014 | 3300046675 | Bacteria | 1616 |
| 988 | Ga0495599_0010401 | 3300046678 | Bacteria | 5692 |
| 989 | Ga0495599_0031007 | 3300046678 | Bacteria | 3356 |
| 990 | Ga0495623_0158336 | 3300046679 | Bacteria | 1333 |
| 991 | Ga0495646_0057450 | 3300046680 | Bacteria | 2329 |
| 992 | Ga0495646_0107840 | 3300046680 | Bacteria | 1588 |
| 993 | Ga0495647_0001758 | 3300046681 | Bacteria | 6719 |
| 994 | Ga0495647_0015615 | 3300046681 | Bacteria | 2663 |
| 995 | Ga0495647_0180771 | 3300046681 | Bacteria | 917 |
| 996 | Ga0495658_0014748 | 3300046683 | Bacteria | 3997 |
| 997 | Ga0495613_0003061 | 3300046689 | Bacteria | 12491 |
| 998 | Ga0495613_0006852 | 3300046689 | Bacteria | 8507 |
| 999 | Ga0495613_0012262 | 3300046689 | Bacteria | 6369 |
| 1000 | Ga0495613_0241034 | 3300046689 | Bacteria | 1264 |
| 1001 | Ga0495613_0363199 | 3300046689 | Bacteria | 992 |
| 1002 | Ga0495624_0012668 | 3300046690 | Bacteria | 5759 |
| 1003 | Ga0495624_0310965 | 3300046690 | Bacteria | 949 |
| 1004 | Ga0495670_0168439 | 3300046691 | Bacteria | 1153 |
| 1005 | Ga0495670_0277107 | 3300046691 | Bacteria | 897 |
| 1006 | Ga0495589_0036770 | 3300046794 | Bacteria | 2454 |
| 1007 | Ga0495589_0094783 | 3300046794 | Bacteria | 1448 |
| 1008 | Ga0495600_0027301 | 3300046809 | Bacteria | 3689 |
| 1009 | Ga0495600_0029037 | 3300046809 | Bacteria | 3580 |
| 1010 | Ga0495600_0037562 | 3300046809 | Bacteria | 3149 |
| 1011 | Ga0495600_0091930 | 3300046809 | Bacteria | 1979 |
| 1012 | Ga0495581_0000640 | 3300047315 | Bacteria | 18312 |
| 1013 | Ga0495581_0060409 | 3300047315 | Unclassified | 2190 |
| 1014 | Ga0495581_0081532 | 3300047315 | Bacteria | 1873 |
| 1015 | Ga0495581_0504783 | 3300047315 | Bacteria | 703 |
| 1016 | Ga0495604_0175080 | 3300047317 | Unclassified | 1505 |
| 1017 | Ga0495636_0033683 | 3300047318 | Bacteria | 2106 |
| 1018 | Ga0495674_0003918 | 3300047319 | Bacteria | 14455 |
| 1019 | Ga0495674_0011997 | 3300047319 | Bacteria | 8171 |
| 1020 | Ga0495674_0069697 | 3300047319 | Bacteria | 3040 |
| 1021 | Ga0495674_0334072 | 3300047319 | Bacteria | 1232 |
| 1022 | Ga0495674_0400817 | 3300047319 | Bacteria | 1107 |
| 1023 | Ga0495674_0624824 | 3300047319 | Bacteria | 851 |
| 1024 | Ga0495674_0731160 | 3300047319 | Unclassified | 775 |
| 1025 | Ga0495674_0811335 | 3300047319 | Bacteria | 727 |
| 1026 | Ga0495676_0003723 | 3300047321 | Bacteria | 13840 |
| 1027 | Ga0495676_0137379 | 3300047321 | Bacteria | 1756 |
| 1028 | Ga0495676_0142362 | 3300047321 | Bacteria | 1717 |
| 1029 | Ga0495680_0003420 | 3300047322 | Bacteria | 15660 |
| 1030 | Ga0495680_0007640 | 3300047322 | Bacteria | 9871 |
| 1031 | Ga0495680_0009501 | 3300047322 | Bacteria | 8739 |
| 1032 | Ga0495680_0059275 | 3300047322 | Bacteria | 2956 |
| 1033 | Ga0495680_0069617 | 3300047322 | Bacteria | 2684 |
| 1034 | Ga0495680_0106490 | 3300047322 | Bacteria | 2084 |
| 1035 | Ga0495680_0128468 | 3300047322 | Bacteria | 1864 |
| 1036 | Ga0495680_0184195 | 3300047322 | Bacteria | 1505 |
| 1037 | Ga0495683_0255591 | 3300047323 | Bacteria | 767 |
| 1038 | Ga0495675_0252150 | 3300047444 | Bacteria | 1060 |
| 1039 | Ga0495677_0083639 | 3300047445 | Bacteria | 1198 |
| 1040 | Ga0495685_106620 | 3300047447 | Bacteria | 924 |
| 1041 | Ga0495684_0009129 | 3300047471 | Bacteria | 7658 |
| 1042 | Ga0495684_0009734 | 3300047471 | Bacteria | 7416 |
| 1043 | Ga0495684_0025768 | 3300047471 | Bacteria | 4518 |
| 1044 | Ga0495684_0026040 | 3300047471 | Bacteria | 4495 |
| 1045 | Ga0495684_0100572 | 3300047471 | Unclassified | 2186 |
| 1046 | Ga0495593_0007309 | 3300047673 | Bacteria | 6471 |
| 1047 | Ga0495593_0009917 | 3300047673 | Bacteria | 5524 |
| 1048 | Ga0495593_0113406 | 3300047673 | Unclassified | 1383 |
| 1049 | Ga0495602_0037471 | 3300048088 | Bacteria | 4500 |
| 1050 | Ga0495602_0190863 | 3300048088 | Bacteria | 1571 |
| 1051 | Ga0495602_0211878 | 3300048088 | Bacteria | 1470 |
| 1052 | Ga0495614_0003782 | 3300048089 | Bacteria | 6804 |
| 1053 | Ga0495614_0013122 | 3300048089 | Bacteria | 3634 |
| 1054 | Ga0495614_0113314 | 3300048089 | Bacteria | 1192 |
| 1055 | Ga0496100_0016415 | 3300048903 | Bacteria | 4349 |
| 1056 | Ga0496100_0056176 | 3300048903 | Bacteria | 2575 |
| 1057 | Ga0496100_0085771 | 3300048903 | Bacteria | 2137 |
| 1058 | Ga0496100_0133843 | 3300048903 | Bacteria | 1749 |
| 1059 | Ga0496100_0662367 | 3300048903 | Bacteria | 813 |
| 1060 | Ga0496100_0673465 | 3300048903 | Bacteria | 806 |
| 1061 | Ga0496101_0019418 | 3300048904 | Bacteria | 4639 |
| 1062 | Ga0496101_0044715 | 3300048904 | Bacteria | 3169 |
| 1063 | Ga0496101_0147626 | 3300048904 | Unclassified | 1796 |
| 1064 | Ga0496101_0205586 | 3300048904 | Bacteria | 1523 |
| 1065 | Ga0496101_0219394 | 3300048904 | Bacteria | 1475 |
| 1066 | Ga0496101_0447588 | 3300048904 | Bacteria | 1019 |
| 1067 | Ga0496102_0020289 | 3300048905 | Bacteria | 5873 |
| 1068 | Ga0496102_0036831 | 3300048905 | Bacteria | 4409 |
| 1069 | Ga0496102_0037438 | 3300048905 | Bacteria | 4376 |
| 1070 | Ga0496102_0092371 | 3300048905 | Bacteria | 2802 |
| 1071 | Ga0496102_0141408 | 3300048905 | Bacteria | 2257 |
| 1072 | Ga0496102_0162458 | 3300048905 | Bacteria | 2101 |
| 1073 | Ga0496102_0284794 | 3300048905 | Unclassified | 1557 |
| 1074 | Ga0496102_0299731 | 3300048905 | Bacteria | 1515 |
| 1075 | Ga0496103_0005924 | 3300048906 | Bacteria | 7306 |
| 1076 | Ga0496103_0012326 | 3300048906 | Bacteria | 5072 |
| 1077 | Ga0496103_0019732 | 3300048906 | Bacteria | 4046 |
| 1078 | Ga0496103_0092671 | 3300048906 | Bacteria | 1907 |
| 1079 | Ga0496103_0151496 | 3300048906 | Unclassified | 1485 |
| 1080 | Ga0496103_0218169 | 3300048906 | Bacteria | 1227 |
| 1081 | Ga0496103_0254755 | 3300048906 | Bacteria | 1129 |
| 1082 | Ga0496103_0571310 | 3300048906 | Bacteria | 721 |
| 1083 | Ga0496104_0000597 | 3300048907 | Bacteria | 30871 |
| 1084 | Ga0496104_0013270 | 3300048907 | Bacteria | 7426 |
| 1085 | Ga0496104_0013604 | 3300048907 | Bacteria | 7336 |
| 1086 | Ga0496104_0031080 | 3300048907 | Bacteria | 4964 |
| 1087 | Ga0496104_0052918 | 3300048907 | Bacteria | 3835 |
| 1088 | Ga0496104_0074798 | 3300048907 | Bacteria | 3225 |
| 1089 | Ga0496104_0129318 | 3300048907 | Bacteria | 2425 |
| 1090 | Ga0496104_0257327 | 3300048907 | Bacteria | 1658 |
| 1091 | Ga0496104_0502552 | 3300048907 | Bacteria | 1123 |
| 1092 | Ga0496105_0001972 | 3300048908 | Bacteria | 14767 |
| 1093 | Ga0496105_0004171 | 3300048908 | Bacteria | 10852 |
| 1094 | Ga0496105_0039193 | 3300048908 | Bacteria | 3904 |
| 1095 | Ga0496105_0061821 | 3300048908 | Bacteria | 3090 |
| 1096 | Ga0496105_0115274 | 3300048908 | Bacteria | 2216 |
| 1097 | Ga0496105_0212297 | 3300048908 | Bacteria | 1577 |
| 1098 | Ga0496105_0259761 | 3300048908 | Bacteria | 1405 |
| 1099 | Ga0496106_0002814 | 3300048909 | Bacteria | 12904 |
| 1100 | Ga0496106_0008591 | 3300048909 | Bacteria | 7556 |
| 1101 | Ga0496106_0025881 | 3300048909 | Bacteria | 4365 |
| 1102 | Ga0496106_0040822 | 3300048909 | Bacteria | 3476 |
| 1103 | Ga0496106_0045709 | 3300048909 | Bacteria | 3289 |
| 1104 | Ga0496106_0162704 | 3300048909 | Bacteria | 1765 |
| 1105 | Ga0496106_0325518 | 3300048909 | Bacteria | 1234 |
| 1106 | Ga0496107_0021210 | 3300048910 | Bacteria | 4592 |
| 1107 | Ga0496107_0033970 | 3300048910 | Bacteria | 3650 |
| 1108 | Ga0496107_0067508 | 3300048910 | Bacteria | 2595 |
| 1109 | Ga0496107_0222777 | 3300048910 | Unclassified | 1403 |
| 1110 | Ga0496107_0453477 | 3300048910 | Bacteria | 952 |
| 1111 | Ga0496108_0002280 | 3300048911 | Bacteria | 15370 |
| 1112 | Ga0496108_0022242 | 3300048911 | Bacteria | 5213 |
| 1113 | Ga0496108_0027385 | 3300048911 | Bacteria | 4706 |
| 1114 | Ga0496108_0039676 | 3300048911 | Bacteria | 3923 |
| 1115 | Ga0496108_0048543 | 3300048911 | Bacteria | 3549 |
| 1116 | Ga0496108_0092962 | 3300048911 | Bacteria | 2565 |
| 1117 | Ga0496108_0288167 | 3300048911 | Bacteria | 1430 |
| 1118 | Ga0496108_0341157 | 3300048911 | Bacteria | 1307 |
| 1119 | Ga0496108_0367695 | 3300048911 | Bacteria | 1255 |
| 1120 | Ga0496109_0001523 | 3300048912 | Bacteria | 19293 |
| 1121 | Ga0496109_0002331 | 3300048912 | Bacteria | 15816 |
| 1122 | Ga0496109_0002799 | 3300048912 | Bacteria | 14605 |
| 1123 | Ga0496109_0019767 | 3300048912 | Bacteria | 5941 |
| 1124 | Ga0496109_0044373 | 3300048912 | Bacteria | 4033 |
| 1125 | Ga0496109_0075962 | 3300048912 | Bacteria | 3089 |
| 1126 | Ga0496109_0223782 | 3300048912 | Unclassified | 1770 |
| 1127 | Ga0496109_0237574 | 3300048912 | Bacteria | 1714 |
| 1128 | Ga0496109_0276534 | 3300048912 | Bacteria | 1582 |
| 1129 | Ga0496109_0684785 | 3300048912 | Bacteria | 963 |
| 1130 | Ga0496109_0869168 | 3300048912 | Bacteria | 839 |
| 1131 | Ga0496110_0000705 | 3300048913 | Bacteria | 23089 |
| 1132 | Ga0496110_0007799 | 3300048913 | Bacteria | 8577 |
| 1133 | Ga0496110_0034853 | 3300048913 | Bacteria | 4363 |
| 1134 | Ga0496110_0051582 | 3300048913 | Bacteria | 3615 |
| 1135 | Ga0496110_0056524 | 3300048913 | Bacteria | 3453 |
| 1136 | Ga0496110_0080639 | 3300048913 | Bacteria | 2900 |
| 1137 | Ga0496110_0126756 | 3300048913 | Unclassified | 2303 |
| 1138 | Ga0496110_0173140 | 3300048913 | Bacteria | 1959 |
| 1139 | Ga0496110_0216147 | 3300048913 | Bacteria | 1743 |
| 1140 | Ga0496110_0252949 | 3300048913 | Bacteria | 1603 |
| 1141 | Ga0496110_0359636 | 3300048913 | Bacteria | 1326 |
| 1142 | Ga0496110_0516604 | 3300048913 | Bacteria | 1087 |
| 1143 | Ga0496110_0645599 | 3300048913 | Bacteria | 958 |
| 1144 | Ga0496110_0745444 | 3300048913 | Bacteria | 882 |
| 1145 | Ga0496111_0000376 | 3300048914 | Bacteria | 22245 |
| 1146 | Ga0496111_0012316 | 3300048914 | Bacteria | 5786 |
| 1147 | Ga0496111_0027287 | 3300048914 | Bacteria | 4038 |
| 1148 | Ga0496111_0029684 | 3300048914 | Bacteria | 3884 |
| 1149 | Ga0496111_0041012 | 3300048914 | Bacteria | 3321 |
| 1150 | Ga0496111_0053296 | 3300048914 | Bacteria | 2922 |
| 1151 | Ga0496111_0075106 | 3300048914 | Bacteria | 2462 |
| 1152 | Ga0496111_0075143 | 3300048914 | Bacteria | 2462 |
| 1153 | Ga0496111_0094976 | 3300048914 | Bacteria | 2187 |
| 1154 | Ga0496111_0122181 | 3300048914 | Bacteria | 1923 |
| 1155 | Ga0496111_0446654 | 3300048914 | Bacteria | 954 |
| 1156 | Ga0496111_0745917 | 3300048914 | Bacteria | 710 |
| 1157 | Ga0496112_0003554 | 3300048915 | Bacteria | 12948 |
| 1158 | Ga0496112_0005672 | 3300048915 | Bacteria | 10846 |
| 1159 | Ga0496112_0016462 | 3300048915 | Bacteria | 6928 |
| 1160 | Ga0496112_0031983 | 3300048915 | Bacteria | 5108 |
| 1161 | Ga0496112_0081396 | 3300048915 | Bacteria | 3202 |
| 1162 | Ga0496112_0083785 | 3300048915 | Bacteria | 3154 |
| 1163 | Ga0496112_0089498 | 3300048915 | Unclassified | 3046 |
| 1164 | Ga0496112_0090358 | 3300048915 | Bacteria | 3031 |
| 1165 | Ga0496112_0098079 | 3300048915 | Bacteria | 2900 |
| 1166 | Ga0496112_0125752 | 3300048915 | Bacteria | 2535 |
| 1167 | Ga0496112_0236190 | 3300048915 | Bacteria | 1781 |
| 1168 | Ga0496112_0339565 | 3300048915 | Bacteria | 1445 |
| 1169 | Ga0496112_0378110 | 3300048915 | Bacteria | 1357 |
| 1170 | Ga0496112_0540549 | 3300048915 | Bacteria | 1099 |
| 1171 | Ga0496112_0635487 | 3300048915 | Bacteria | 998 |
| 1172 | Ga0496112_0943085 | 3300048915 | Bacteria | 784 |
| 1173 | Ga0496112_1052825 | 3300048915 | Bacteria | 732 |
| 1174 | Ga0496113_0000365 | 3300048916 | Bacteria | 21766 |
| 1175 | Ga0496113_0011892 | 3300048916 | Bacteria | 5833 |
| 1176 | Ga0496113_0025896 | 3300048916 | Bacteria | 4187 |
| 1177 | Ga0496113_0062165 | 3300048916 | Bacteria | 2819 |
| 1178 | Ga0496113_0108695 | 3300048916 | Bacteria | 2156 |
| 1179 | Ga0496113_0342515 | 3300048916 | Unclassified | 1199 |
| 1180 | Ga0496113_0422676 | 3300048916 | Bacteria | 1070 |
| 1181 | Ga0496113_0494573 | 3300048916 | Bacteria | 982 |
| 1182 | Ga0496113_0680796 | 3300048916 | Bacteria | 822 |
| 1183 | Ga0496114_0000875 | 3300048917 | Bacteria | 22544 |
| 1184 | Ga0496114_0003727 | 3300048917 | Bacteria | 11741 |
| 1185 | Ga0496114_0003888 | 3300048917 | Bacteria | 11517 |
| 1186 | Ga0496114_0006300 | 3300048917 | Bacteria | 9338 |
| 1187 | Ga0496114_0071477 | 3300048917 | Bacteria | 2916 |
| 1188 | Ga0496114_0081498 | 3300048917 | Bacteria | 2733 |
| 1189 | Ga0496114_0085145 | 3300048917 | Bacteria | 2677 |
| 1190 | Ga0496115_0015946 | 3300048918 | Bacteria | 5712 |
| 1191 | Ga0496115_0021221 | 3300048918 | Bacteria | 5014 |
| 1192 | Ga0496115_0026457 | 3300048918 | Bacteria | 4528 |
| 1193 | Ga0496115_0038292 | 3300048918 | Bacteria | 3804 |
| 1194 | Ga0496115_0152250 | 3300048918 | Bacteria | 1910 |
| 1195 | Ga0496115_0255717 | 3300048918 | Bacteria | 1441 |
| 1196 | Ga0496115_0263124 | 3300048918 | Bacteria | 1418 |
| 1197 | Ga0496115_0388021 | 3300048918 | Bacteria | 1135 |
| 1198 | Ga0501031_0015574 | 3300049568 | Bacteria | 4936 |
| 1199 | Ga0501031_0249094 | 3300049568 | Bacteria | 1155 |
| 1200 | Ga0501032_0041691 | 3300049569 | Bacteria | 3116 |
| 1201 | Ga0501033_0003478 | 3300049570 | Bacteria | 12916 |
| 1202 | Ga0501036_0120170 | 3300049572 | Bacteria | 2219 |
| 1203 | Ga0501036_0228234 | 3300049572 | Bacteria | 1563 |
| 1204 | Ga0501036_0253053 | 3300049572 | Bacteria | 1476 |
| 1205 | Ga0501036_0613279 | 3300049572 | Bacteria | 902 |
| 1206 | Ga0501037_0429802 | 3300049573 | Unclassified | 903 |
| 1207 | Ga0501038_0007188 | 3300049574 | Bacteria | 10293 |
| 1208 | Ga0501039_0006217 | 3300049575 | Bacteria | 9069 |
| 1209 | Ga0501040_0006556 | 3300049576 | Bacteria | 7557 |
| 1210 | Ga0501040_0056858 | 3300049576 | Bacteria | 2685 |
| 1211 | Ga0501041_0051932 | 3300049577 | Bacteria | 2499 |
| 1212 | Ga0501041_0112294 | 3300049577 | Bacteria | 1691 |
| 1213 | Ga0501041_0253714 | 3300049577 | Bacteria | 1106 |
| 1214 | Ga0501041_0388813 | 3300049577 | Unclassified | 883 |
| 1215 | Ga0501042_0108718 | 3300049578 | Bacteria | 1996 |
| 1216 | Ga0501042_0134720 | 3300049578 | Bacteria | 1781 |
| 1217 | Ga0501042_0193588 | 3300049578 | Unclassified | 1466 |
| 1218 | Ga0501046_0088158 | 3300049580 | Bacteria | 2390 |
| 1219 | Ga0501046_0253414 | 3300049580 | Bacteria | 1295 |
| 1220 | Ga0501047_0065789 | 3300049581 | Bacteria | 3494 |
| 1221 | Ga0501047_0334410 | 3300049581 | Bacteria | 1353 |
| 1222 | Ga0501047_0508346 | 3300049581 | Bacteria | 1031 |
| 1223 | Ga0501048_0004133 | 3300049582 | Bacteria | 11066 |
| 1224 | Ga0501048_0043247 | 3300049582 | Bacteria | 3225 |
| 1225 | Ga0501048_0290927 | 3300049582 | Bacteria | 1162 |
| 1226 | Ga0501067_0009283 | 3300049583 | Bacteria | 5448 |
| 1227 | Ga0501067_0011107 | 3300049583 | Bacteria | 4982 |
| 1228 | Ga0501067_0062842 | 3300049583 | Bacteria | 2056 |
| 1229 | Ga0501067_0097317 | 3300049583 | Bacteria | 1634 |
| 1230 | Ga0501067_0147539 | 3300049583 | Bacteria | 1310 |
| 1231 | Ga0501068_0014707 | 3300049584 | Bacteria | 4477 |
| 1232 | Ga0501068_0177369 | 3300049584 | Bacteria | 1347 |
| 1233 | Ga0501069_0005135 | 3300049585 | Bacteria | 6797 |
| 1234 | Ga0501069_0010254 | 3300049585 | Bacteria | 4958 |
| 1235 | Ga0501069_0011091 | 3300049585 | Bacteria | 4781 |
| 1236 | Ga0501069_0285999 | 3300049585 | Bacteria | 965 |
| 1237 | Ga0501069_0553666 | 3300049585 | Bacteria | 688 |
| 1238 | Ga0501070_0001687 | 3300049586 | Bacteria | 19581 |
| 1239 | Ga0501070_0020705 | 3300049586 | Bacteria | 5518 |
| 1240 | Ga0501070_0065141 | 3300049586 | Bacteria | 3017 |
| 1241 | Ga0501070_0115152 | 3300049586 | Bacteria | 2221 |
| 1242 | Ga0501070_0172154 | 3300049586 | Bacteria | 1783 |
| 1243 | Ga0501070_0197781 | 3300049586 | Unclassified | 1651 |
| 1244 | Ga0501071_0030185 | 3300049587 | Bacteria | 3833 |
| 1245 | Ga0501071_0035802 | 3300049587 | Bacteria | 3537 |
| 1246 | Ga0501071_0133404 | 3300049587 | Bacteria | 1846 |
| 1247 | Ga0501071_0305393 | 3300049587 | Bacteria | 1207 |
| 1248 | Ga0501071_0475411 | 3300049587 | Bacteria | 957 |
| 1249 | Ga0501072_0025169 | 3300049588 | Bacteria | 4634 |
| 1250 | Ga0501072_0338490 | 3300049588 | Bacteria | 1195 |
| 1251 | Ga0501072_0349252 | 3300049588 | Bacteria | 1174 |
| 1252 | Ga0501073_0021069 | 3300049589 | Bacteria | 4701 |
| 1253 | Ga0501073_0194205 | 3300049589 | Bacteria | 1404 |
| 1254 | Ga0501074_0033377 | 3300049590 | Bacteria | 3729 |
| 1255 | Ga0501074_0050163 | 3300049590 | Bacteria | 3012 |
| 1256 | Ga0501075_0021220 | 3300049591 | Bacteria | 4733 |
| 1257 | Ga0501075_0215136 | 3300049591 | Bacteria | 1466 |
| 1258 | Ga0501075_0339142 | 3300049591 | Bacteria | 1145 |
| 1259 | Ga0501076_0074317 | 3300049592 | Unclassified | 2722 |
| 1260 | Ga0501077_0010555 | 3300049593 | Bacteria | 5751 |
| 1261 | Ga0501077_0393909 | 3300049593 | Bacteria | 885 |
| 1262 | Ga0501079_0043846 | 3300049741 | Bacteria | 3452 |
| 1263 | Ga0501079_0125266 | 3300049741 | Bacteria | 1999 |
| 1264 | Ga0501079_0158570 | 3300049741 | Bacteria | 1764 |
| 1265 | Ga0501079_0179968 | 3300049741 | Bacteria | 1650 |
| 1266 | Ga0501079_0336072 | 3300049741 | Bacteria | 1183 |
| 1267 | Ga0501080_0002220 | 3300049742 | Bacteria | 16878 |
| 1268 | Ga0501080_0020012 | 3300049742 | Bacteria | 6195 |
| 1269 | Ga0501080_0103637 | 3300049742 | Bacteria | 2638 |
| 1270 | Ga0501080_0645064 | 3300049742 | Bacteria | 937 |
| 1271 | Ga0501035_0270052 | 3300049822 | Bacteria | 1440 |
| 1272 | Ga0501044_0330937 | 3300049823 | Bacteria | 1446 |
| 1273 | Ga0501045_0074232 | 3300049824 | Bacteria | 2504 |
| 1274 | Ga0501045_0140853 | 3300049824 | Bacteria | 1793 |
| 1275 | Ga0501045_0141827 | 3300049824 | Bacteria | 1787 |
| 1276 | nmdc:mga03683_351791_c1 | 3300050489 | Bacteria | 697 |
| 1277 | nmdc:mga0yw44_209626_c1 | 3300050492 | Bacteria | 1289 |
| 1278 | nmdc:mga0yw44_87322_c1 | 3300050492 | Bacteria | 1966 |
| 1279 | nmdc:mga05p37_107311_c1 | 3300050507 | Bacteria | 3435 |
| 1280 | nmdc:mga05p37_127566_c1 | 3300050507 | Bacteria | 3123 |
| 1281 | nmdc:mga05p37_542042_c1 | 3300050507 | Unclassified | 1326 |
| 1282 | nmdc:mga05p37_553118_c1 | 3300050507 | Bacteria | 1309 |
| 1283 | nmdc:mga05p37_91702_c1 | 3300050507 | Bacteria | 3744 |
| 1284 | nmdc:mga06r32_184713_c1 | 3300050510 | Bacteria | 2071 |
| 1285 | nmdc:mga06r32_972358_c1 | 3300050510 | Bacteria | 803 |
| 1286 | nmdc:mga08y16_484210_c1 | 3300050511 | Bacteria | 1259 |
| 1287 | nmdc:mga08y16_903218_c1 | 3300050511 | Bacteria | 869 |
| 1288 | nmdc:mga0n895_212756_c1 | 3300050512 | Bacteria | 1963 |
| 1289 | nmdc:mga0n895_61794_c1 | 3300050512 | Bacteria | 3700 |
| 1290 | nmdc:mga0n895_736325_c1 | 3300050512 | Bacteria | 980 |
| 1291 | nmdc:mga0n895_94422_c1 | 3300050512 | Bacteria | 2995 |
| 1292 | nmdc:mga0rr50_1104_c1 | 3300050513 | Bacteria | 14644 |
| 1293 | nmdc:mga0rr50_12626_c1 | 3300050513 | Bacteria | 5468 |
| 1294 | nmdc:mga0rr50_2852_c1 | 3300050513 | Bacteria | 9830 |
| 1295 | nmdc:mga0rr50_436527_c1 | 3300050513 | Bacteria | 1109 |
| 1296 | nmdc:mga08x19_142283_c1 | 3300050514 | Unclassified | 1621 |
| 1297 | nmdc:mga08x19_19984_c1 | 3300050514 | Bacteria | 4120 |
| 1298 | nmdc:mga08x19_24515_c1 | 3300050514 | Bacteria | 3751 |
| 1299 | nmdc:mga08x19_343034_c1 | 3300050514 | Bacteria | 1042 |
| 1300 | nmdc:mga08x19_63446_c1 | 3300050514 | Bacteria | 2397 |
| 1301 | nmdc:mga0a205_112190_c1 | 3300050515 | Bacteria | 2626 |
| 1302 | nmdc:mga0a205_277764_c1 | 3300050515 | Bacteria | 1551 |
| 1303 | nmdc:mga0a205_515_c1 | 3300050515 | Bacteria | 30339 |
| 1304 | nmdc:mga0a205_9751_c1 | 3300050515 | Bacteria | 8798 |
| 1305 | Ga0495601_0014598 | 3300053077 | Bacteria | 4734 |
| 1306 | Ga0495601_0076650 | 3300053077 | Bacteria | 2141 |
| 1307 | Ga0495601_0087702 | 3300053077 | Unclassified | 2000 |
| 1308 | Ga0495612_0011591 | 3300053078 | Bacteria | 3551 |
| 1309 | Ga0495612_0106127 | 3300053078 | Unclassified | 1199 |
| 1310 | Ga0495655_0023757 | 3300053083 | Bacteria | 1417 |
| 1311 | Ga0495595_0023425 | 3300053084 | Bacteria | 2718 |
| 1312 | Ga0495595_0023655 | 3300053084 | Bacteria | 2707 |
| 1313 | Ga0495595_0136298 | 3300053084 | Bacteria | 1202 |
| 1314 | Ga0495619_0001634 | 3300053085 | Bacteria | 14778 |
| 1315 | Ga0495619_0001785 | 3300053085 | Bacteria | 14310 |
| 1316 | Ga0495619_0026394 | 3300053085 | Bacteria | 3737 |
| 1317 | Ga0495619_0047443 | 3300053085 | Bacteria | 2828 |
| 1318 | Ga0495619_0143491 | 3300053085 | Bacteria | 1645 |
| 1319 | Ga0495619_0412282 | 3300053085 | Bacteria | 932 |
| 1320 | Ga0501084_0058435 | 3300054114 | Bacteria | 3227 |
| 1321 | Ga0501084_0083864 | 3300054114 | Bacteria | 2675 |
| 1322 | Ga0501084_0193152 | 3300054114 | Bacteria | 1718 |
| 1323 | Ga0590071_039404 | 3300059421 | Unclassified | 1136 |
| 1324 | Ga0587080_026740 | 3300059503 | Bacteria | 981 |
| 1325 | Ga0587069_030973 | 3300059642 | Bacteria | 865 |
| 1326 | Ga0501082_0022132 | 3300060353 | Bacteria | 5478 |
| 1327 | Ga0501082_0119272 | 3300060353 | Bacteria | 2286 |
| 1328 | Ga0501082_0358301 | 3300060353 | Bacteria | 1272 |
| 1329 | Ga0466962_0001433 | 3300061719 | Bacteria | 11119 |
| 1330 | Ga0466962_0004216 | 3300061719 | Bacteria | 6887 |
| 1331 | Ga0466962_0004975 | 3300061719 | Bacteria | 6391 |
| 1332 | Ga0466962_0023407 | 3300061719 | Bacteria | 2969 |
| 1333 | Ga0466962_0062581 | 3300061719 | Bacteria | 1777 |
| 1334 | Ga0530510_0024738 | 3300061734 | Bacteria | 4289 |
| 1335 | Ga0530510_0026118 | 3300061734 | Bacteria | 4177 |
| 1336 | Ga0530510_0031504 | 3300061734 | Bacteria | 3812 |
| 1337 | Ga0530510_0287929 | 3300061734 | Bacteria | 1228 |
| 1338 | Ga0501031_0224729 | |||
| 1339 | JGI25407J50210_10000406 | |||
| 1340 | JGI25407J50210_10105595 | |||
| 1341 | JGI25404J52841_10031131 | |||
| 1342 | Ga0058862_12804081 | |||
| 1343 | Ga0070658_10007279 | |||
| 1344 | Ga0070658_10016442 | |||
| 1345 | Ga0070658_10018409 | |||
| 1346 | Ga0070658_10023899 | |||
| 1347 | Ga0070658_10045188 | |||
| 1348 | Ga0070658_10063796 | |||
| 1349 | Ga0070658_10330556 | |||
| 1350 | Ga0070683_100001807 | |||
| 1351 | Ga0070683_100025873 | |||
| 1352 | Ga0070683_100104075 | |||
| 1353 | Ga0070683_100109721 | |||
| 1354 | Ga0070683_100521542 | |||
| 1355 | Ga0070680_100005165 | |||
| 1356 | Ga0070680_100008385 | |||
| 1357 | Ga0070680_100031458 | |||
| 1358 | Ga0070680_100059865 | |||
| 1359 | Ga0070680_100070210 | |||
| 1360 | Ga0070680_100210639 | |||
| 1361 | Ga0070682_100006444 | |||
| 1362 | Ga0070682_100007437 | |||
| 1363 | Ga0070682_100036588 | |||
| 1364 | Ga0070682_100129219 | |||
| 1365 | Ga0070682_100212246 | |||
| 1366 | Ga0068868_100375920 | |||
| 1367 | Ga0068868_100433701 | |||
| 1368 | Ga0070660_100002597 | |||
| 1369 | Ga0070660_100033323 | |||
| 1370 | Ga0070660_100035531 | |||
| 1371 | Ga0070660_100036512 | |||
| 1372 | Ga0070660_100051709 | |||
| 1373 | Ga0070660_100255616 | |||
| 1374 | Ga0070660_100448203 | |||
| 1375 | Ga0070660_100890055 | |||
| 1376 | Ga0070661_100060637 | |||
| 1377 | Ga0070661_100149095 | |||
| 1378 | Ga0070661_100198948 | |||
| 1379 | Ga0070661_100228848 | |||
| 1380 | Ga0070661_100485970 | |||
| 1381 | Ga0070668_100055050 | |||
| 1382 | Ga0070669_100310707 | |||
| 1383 | Ga0070675_100510720 | |||
| 1384 | Ga0070671_100051385 | |||
| 1385 | Ga0070671_100412184 | |||
| 1386 | Ga0070674_100268265 | |||
| 1387 | Ga0070659_100004395 | |||
| 1388 | Ga0070659_100057680 | |||
| 1389 | Ga0070659_100099875 | |||
| 1390 | Ga0070659_100148398 | |||
| 1391 | Ga0070659_100261976 | |||
| 1392 | Ga0070667_100003479 | |||
| 1393 | Ga0070703_10060557 | |||
| 1394 | Ga0070703_10123623 | |||
| 1395 | Ga0070709_10003722 | |||
| 1396 | Ga0070709_10050903 | |||
| 1397 | Ga0070709_10130578 | |||
| 1398 | Ga0070709_10158636 | |||
| 1399 | Ga0070714_100013517 | |||
| 1400 | Ga0070714_100037631 | |||
| 1401 | Ga0070714_100059600 | |||
| 1402 | Ga0070714_100070863 | |||
| 1403 | Ga0070714_100095864 | |||
| 1404 | Ga0070714_100124811 | |||
| 1405 | Ga0070714_100130895 | |||
| 1406 | Ga0070714_100136048 | |||
| 1407 | Ga0070714_100976224 | |||
| 1408 | Ga0070714_101189961 | |||
| 1409 | Ga0070713_100001998 | |||
| 1410 | Ga0070713_100265387 | |||
| 1411 | Ga0070713_100308905 | |||
| 1412 | Ga0070710_10005665 | |||
| 1413 | Ga0070710_10007312 | |||
| 1414 | Ga0070710_10016667 | |||
| 1415 | Ga0070711_100081482 | |||
| 1416 | Ga0070711_100112742 | |||
| 1417 | Ga0070711_100145863 | |||
| 1418 | Ga0070711_100423068 | |||
| 1419 | Ga0070705_100037024 | |||
| 1420 | Ga0070705_100059373 | |||
| 1421 | Ga0070705_100179007 | |||
| 1422 | Ga0070705_100224227 | |||
| 1423 | Ga0070705_100311543 | |||
| 1424 | Ga0070705_100405553 | |||
| 1425 | Ga0070700_100419500 | |||
| 1426 | Ga0070694_100295446 | |||
| 1427 | Ga0070694_100507401 | |||
| 1428 | Ga0070708_100018186 | |||
| 1429 | Ga0070708_100245475 | |||
| 1430 | Ga0070708_100294937 | |||
| 1431 | Ga0070708_100321184 | |||
| 1432 | Ga0070708_101027438 | |||
| 1433 | Ga0070678_100015863 | |||
| 1434 | Ga0070678_100114690 | |||
| 1435 | Ga0070678_100122116 | |||
| 1436 | Ga0070678_100601529 | |||
| 1437 | Ga0070662_100003257 | |||
| 1438 | Ga0070681_10009902 | |||
| 1439 | Ga0070681_10041547 | |||
| 1440 | Ga0070681_10059950 | |||
| 1441 | Ga0070681_10067407 | |||
| 1442 | Ga0070681_10123713 | |||
| 1443 | Ga0070681_10132007 | |||
| 1444 | Ga0070681_10168988 | |||
| 1445 | Ga0070681_10206106 | |||
| 1446 | Ga0070681_10291291 | |||
| 1447 | Ga0070681_10310337 | |||
| 1448 | Ga0070681_10606948 | |||
| 1449 | Ga0070681_10771992 | |||
| 1450 | Ga0070706_100008962 | |||
| 1451 | Ga0070706_100059607 | |||
| 1452 | Ga0070706_100062103 | |||
| 1453 | Ga0070706_100125776 | |||
| 1454 | Ga0070706_100126808 | |||
| 1455 | Ga0070706_100618664 | |||
| 1456 | Ga0070707_100046410 | |||
| 1457 | Ga0070707_100161113 | |||
| 1458 | Ga0070707_100335246 | |||
| 1459 | Ga0070707_100648225 | |||
| 1460 | Ga0070698_100005322 | |||
| 1461 | Ga0070698_100014780 | |||
| 1462 | Ga0070698_100080180 | |||
| 1463 | Ga0070698_100135529 | |||
| 1464 | Ga0070698_100162960 | |||
| 1465 | Ga0070698_100268237 | |||
| 1466 | Ga0070699_100042022 | |||
| 1467 | Ga0070699_100137129 | |||
| 1468 | Ga0070699_100396932 | |||
| 1469 | Ga0070699_100948073 | |||
| 1470 | Ga0070679_100004066 | |||
| 1471 | Ga0070679_100025803 | |||
| 1472 | Ga0070679_100027640 | |||
| 1473 | Ga0070679_100028850 | |||
| 1474 | Ga0070679_100037951 | |||
| 1475 | Ga0070679_100050658 | |||
| 1476 | Ga0070679_100110933 | |||
| 1477 | Ga0070679_100151713 | |||
| 1478 | Ga0070679_100177502 | |||
| 1479 | Ga0070679_100207108 | |||
| 1480 | Ga0070679_100233019 | |||
| 1481 | Ga0070679_100331490 | |||
| 1482 | Ga0070679_100431677 | |||
| 1483 | Ga0070679_101015164 | |||
| 1484 | Ga0070679_101114931 | |||
| 1485 | Ga0070684_100023906 | |||
| 1486 | Ga0070684_100242871 | |||
| 1487 | Ga0070684_100635944 | |||
| 1488 | Ga0070684_101504183 | |||
| 1489 | Ga0070697_100200390 | |||
| 1490 | Ga0070697_100203393 | |||
| 1491 | Ga0070697_100274780 | |||
| 1492 | Ga0070672_100685084 | |||
| 1493 | Ga0070686_100136160 | |||
| 1494 | Ga0070686_100169653 | |||
| 1495 | Ga0070686_100205805 | |||
| 1496 | Ga0070695_100000072 | |||
| 1497 | Ga0070695_100076079 | |||
| 1498 | Ga0070696_100110647 | |||
| 1499 | Ga0070696_100209651 | |||
| 1500 | Ga0070696_100261439 | |||
| 1501 | Ga0070696_100371358 | |||
| 1502 | Ga0070696_100431632 | |||
| 1503 | Ga0070696_100626162 | |||
| 1504 | Ga0070693_100015674 | |||
| 1505 | Ga0070693_100028442 | |||
| 1506 | Ga0070693_100455362 | |||
| 1507 | Ga0070665_100035400 | |||
| 1508 | Ga0070665_100354567 | |||
| 1509 | Ga0070704_100468804 | |||
| 1510 | Ga0068855_100005085 | |||
| 1511 | Ga0068855_100019212 | |||
| 1512 | Ga0068855_100029823 | |||
| 1513 | Ga0068855_100038293 | |||
| 1514 | Ga0068855_100044913 | |||
| 1515 | Ga0068855_100048881 | |||
| 1516 | Ga0068855_100116002 | |||
| 1517 | Ga0068855_100257627 | |||
| 1518 | Ga0068855_100561612 | |||
| 1519 | Ga0068855_100823065 | |||
| 1520 | Ga0068855_101455644 | |||
| 1521 | Ga0068855_101517828 | |||
| 1522 | Ga0068857_100063397 | |||
| 1523 | Ga0068857_100269379 | |||
| 1524 | Ga0068857_100496676 | |||
| 1525 | Ga0068857_100562920 | |||
| 1526 | Ga0068856_100047359 | |||
| 1527 | Ga0068856_100173859 | |||
| 1528 | Ga0068856_100263364 | |||
| 1529 | Ga0068856_100311608 | |||
| 1530 | Ga0068856_100350708 | |||
| 1531 | Ga0068856_100469047 | |||
| 1532 | Ga0068856_100494864 | |||
| 1533 | Ga0068856_100807316 | |||
| 1534 | Ga0068856_100923255 | |||
| 1535 | Ga0068852_100013931 | |||
| 1536 | Ga0068852_100064432 | |||
| 1537 | Ga0068852_100093137 | |||
| 1538 | Ga0068852_100575629 | |||
| 1539 | Ga0068864_100249667 | |||
| 1540 | Ga0068866_10136692 | |||
| 1541 | Ga0068861_100207059 | |||
| 1542 | Ga0068870_10158781 | |||
| 1543 | Ga0068870_10412388 | |||
| 1544 | Ga0068863_100691113 | |||
| 1545 | Ga0068858_100115993 | |||
| 1546 | Ga0068860_100249481 | |||
| 1547 | Ga0081455_10010130 | |||
| 1548 | Ga0081455_10011947 | |||
| 1549 | Ga0081455_10013084 | |||
| 1550 | Ga0081455_10154163 | |||
| 1551 | Ga0081455_10404193 | |||
| 1552 | Ga0081538_10000608 | |||
| 1553 | Ga0081538_10003497 | |||
| 1554 | Ga0081538_10024849 | |||
| 1555 | Ga0081538_10061893 | |||
| 1556 | Ga0081538_10063468 | |||
| 1557 | Ga0081538_10075587 | |||
| 1558 | Ga0081538_10076907 | |||
| 1559 | Ga0081540_1002169 | |||
| 1560 | Ga0081539_10000249 | |||
| 1561 | Ga0081539_10006242 | |||
| 1562 | Ga0081539_10106973 | |||
| 1563 | Ga0081539_10170466 | |||
| 1564 | Ga0070717_10015238 | |||
| 1565 | Ga0070717_10024925 | |||
| 1566 | Ga0070717_10060212 | |||
| 1567 | Ga0070717_10088702 | |||
| 1568 | Ga0070717_10151533 | |||
| 1569 | Ga0075365_10032892 | |||
| 1570 | Ga0075364_10068432 | |||
| 1571 | Ga0070715_10000369 | |||
| 1572 | Ga0070715_10008347 | |||
| 1573 | Ga0070715_10014448 | |||
| 1574 | Ga0070715_10070538 | |||
| 1575 | Ga0070716_100009180 | |||
| 1576 | Ga0070716_100043141 | |||
| 1577 | Ga0070716_100406159 | |||
| 1578 | Ga0070712_100008944 | |||
| 1579 | Ga0070712_100025190 | |||
| 1580 | Ga0070712_100046410 | |||
| 1581 | Ga0070712_100254314 | |||
| 1582 | Ga0070712_100345159 | |||
| 1583 | Ga0070712_100689822 | |||
| 1584 | Ga0075362_10042301 | |||
| 1585 | Ga0097621_100137043 | |||
| 1586 | Ga0097621_100316811 | |||
| 1587 | Ga0097621_100847822 | |||
| 1588 | Ga0068871_100021730 | |||
| 1589 | Ga0068871_100230124 | |||
| 1590 | Ga0075431_100158475 | |||
| 1591 | Ga0075431_100467628 | |||
| 1592 | Ga0075433_10001077 | |||
| 1593 | Ga0075433_10014274 | |||
| 1594 | Ga0075433_10315344 | |||
| 1595 | Ga0075433_10372783 | |||
| 1596 | Ga0075434_100001096 | |||
| 1597 | Ga0075434_100006796 | |||
| 1598 | Ga0075434_100039502 | |||
| 1599 | Ga0075434_100132935 | |||
| 1600 | Ga0075434_100241490 | |||
| 1601 | Ga0075434_100400865 | |||
| 1602 | Ga0075434_100752016 | |||
| 1603 | Ga0068865_100215942 | |||
| 1604 | Ga0068865_100513825 | |||
| 1605 | Ga0075436_100031886 | |||
| 1606 | Ga0075436_100110031 | |||
| 1607 | Ga0075436_100136574 | |||
| 1608 | Ga0075436_100363286 | |||
| 1609 | Ga0075435_100005919 | |||
| 1610 | Ga0075435_100031675 | |||
| 1611 | Ga0075435_100035768 | |||
| 1612 | Ga0075435_100151557 | |||
| 1613 | Ga0105251_10154493 | |||
| 1614 | Ga0105240_10004954 | |||
| 1615 | Ga0105240_10036261 | |||
| 1616 | Ga0105240_10038819 | |||
| 1617 | Ga0105240_10054046 | |||
| 1618 | Ga0105245_10019791 | |||
| 1619 | Ga0105245_10041003 | |||
| 1620 | Ga0105245_10090363 | |||
| 1621 | Ga0105245_10145871 | |||
| 1622 | Ga0105245_10442054 | |||
| 1623 | Ga0105245_10459503 | |||
| 1624 | Ga0105247_10041288 | |||
| 1625 | Ga0114129_10005843 | |||
| 1626 | Ga0114129_10185248 | |||
| 1627 | Ga0114129_10419545 | |||
| 1628 | Ga0105243_10062609 | |||
| 1629 | Ga0105243_10097129 | |||
| 1630 | Ga0105243_10134430 | |||
| 1631 | Ga0105241_10051884 | |||
| 1632 | Ga0105241_10270638 | |||
| 1633 | Ga0105242_10149150 | |||
| 1634 | Ga0105248_10107475 | |||
| 1635 | Ga0105237_10010187 | |||
| 1636 | Ga0105237_10268530 | |||
| 1637 | Ga0105238_10019187 | |||
| 1638 | Ga0105238_10234776 | |||
| 1639 | Ga0105238_10265336 | |||
| 1640 | Ga0105238_10558409 | |||
| 1641 | Ga0105238_10767160 | |||
| 1642 | Ga0105249_10002534 | |||
| 1643 | Ga0105249_10468208 | |||
| 1644 | Ga0105249_10939691 | |||
| 1645 | Ga0105239_10011104 | |||
| 1646 | Ga0105239_10021787 | |||
| 1647 | Ga0105239_11104296 | |||
| 1648 | Ga0105246_10094003 | |||
| 1649 | Ga0105246_10221038 | |||
| 1650 | Ga0157339_1002406 | |||
| 1651 | Ga0157373_10025244 | |||
| 1652 | Ga0157373_10216385 | |||
| 1653 | Ga0157373_10356313 | |||
| 1654 | Ga0157371_10073516 | |||
| 1655 | Ga0157371_10309312 | |||
| 1656 | Ga0157370_10011897 | |||
| 1657 | Ga0157370_10018188 | |||
| 1658 | Ga0157370_10029004 | |||
| 1659 | Ga0157370_10032773 | |||
| 1660 | Ga0157370_10060710 | |||
| 1661 | Ga0157370_10079311 | |||
| 1662 | Ga0157370_10098873 | |||
| 1663 | Ga0157370_10563386 | |||
| 1664 | Ga0157369_10005681 | |||
| 1665 | Ga0157369_10007107 | |||
| 1666 | Ga0157369_10030256 | |||
| 1667 | Ga0157369_10039970 | |||
| 1668 | Ga0157369_10048742 | |||
| 1669 | Ga0157369_10205096 | |||
| 1670 | Ga0157369_10274977 | |||
| 1671 | Ga0157369_10284826 | |||
| 1672 | Ga0157369_10405539 | |||
| 1673 | Ga0157369_11329741 | |||
| 1674 | Ga0157374_10077371 | |||
| 1675 | Ga0157374_10192836 | |||
| 1676 | Ga0157374_10736866 | |||
| 1677 | Ga0163162_10055567 | |||
| 1678 | Ga0163162_10591805 | |||
| 1679 | Ga0157372_10121400 | |||
| 1680 | Ga0157372_10192805 | |||
| 1681 | Ga0157372_10224415 | |||
| 1682 | Ga0157372_10290175 | |||
| 1683 | Ga0157372_10356989 | |||
| 1684 | Ga0157372_10369272 | |||
| 1685 | Ga0157372_10784022 | |||
| 1686 | Ga0157372_11137461 | |||
| 1687 | Ga0157372_11878525 | |||
| 1688 | Ga0157375_10099964 | |||
| 1689 | Ga0157375_10299788 | |||
| 1690 | Ga0163163_10030599 | |||
| 1691 | Ga0157380_10129375 | |||
| 1692 | Ga0182008_10002853 | |||
| 1693 | Ga0182008_10017072 | |||
| 1694 | Ga0157377_10407124 | |||
| 1695 | Ga0157376_10036990 | |||
| 1696 | Ga0157376_10066985 | |||
| 1697 | Ga0182006_1020291 | |||
| 1698 | Ga0182006_1077392 | |||
| 1699 | Ga0182005_1041905 | |||
| 1700 | Ga0182005_1124175 | |||
| 1701 | Ga0163161_10008801 | |||
| 1702 | Ga0197907_10190807 | |||
| 1703 | Ga0197907_10345131 | |||
| 1704 | Ga0206356_10418251 | |||
| 1705 | Ga0206356_10567364 | |||
| 1706 | Ga0206356_11120154 | |||
| 1707 | Ga0206356_11870338 | |||
| 1708 | Ga0206355_1177548 | |||
| 1709 | Ga0206355_1576338 | |||
| 1710 | Ga0206351_10051768 | |||
| 1711 | Ga0206351_10105922 | |||
| 1712 | Ga0206350_10058088 | |||
| 1713 | Ga0206350_10991345 | |||
| 1714 | Ga0206354_10891471 | |||
| 1715 | Ga0206354_11040985 | |||
| 1716 | Ga0206353_10141117 | |||
| 1717 | Ga0206353_10237848 | |||
| 1718 | Ga0206353_10758799 | |||
| 1719 | Ga0206353_11116827 | |||
| 1720 | Ga0206353_11735253 | |||
| 1721 | Ga0154015_1506938 | |||
| 1722 | Ga0213876_10023023 | |||
| 1723 | Ga0213871_10053915 | |||
| 1724 | Ga0224712_10041044 | |||
| 1725 | Ga0224712_10326882 | |||
| 1726 | Ga0207653_10003996 | |||
| 1727 | Ga0207692_10122008 | |||
| 1728 | Ga0207642_10063024 | |||
| 1729 | Ga0207685_10017643 | |||
| 1730 | Ga0207685_10050254 | |||
| 1731 | Ga0207685_10101345 | |||
| 1732 | Ga0207685_10151808 | |||
| 1733 | Ga0207699_10033199 | |||
| 1734 | Ga0207699_10080059 | |||
| 1735 | Ga0207643_10095670 | |||
| 1736 | Ga0207705_10004374 | |||
| 1737 | Ga0207705_10008362 | |||
| 1738 | Ga0207705_10026222 | |||
| 1739 | Ga0207705_10052290 | |||
| 1740 | Ga0207705_10373070 | |||
| 1741 | Ga0207705_10676393 | |||
| 1742 | Ga0207684_10078742 | |||
| 1743 | Ga0207684_10122725 | |||
| 1744 | Ga0207684_10272592 | |||
| 1745 | Ga0207684_10426771 | |||
| 1746 | Ga0207684_10753328 | |||
| 1747 | Ga0207654_10185373 | |||
| 1748 | Ga0207654_10209629 | |||
| 1749 | Ga0207707_10009041 | |||
| 1750 | Ga0207707_10009936 | |||
| 1751 | Ga0207707_10033241 | |||
| 1752 | Ga0207707_10039214 | |||
| 1753 | Ga0207707_10047465 | |||
| 1754 | Ga0207707_10063976 | |||
| 1755 | Ga0207707_10068938 | |||
| 1756 | Ga0207707_10161192 | |||
| 1757 | Ga0207707_10177498 | |||
| 1758 | Ga0207707_10293791 | |||
| 1759 | Ga0207707_10294529 | |||
| 1760 | Ga0207707_10515954 | |||
| 1761 | Ga0207695_10027324 | |||
| 1762 | Ga0207695_10106193 | |||
| 1763 | Ga0207695_10238431 | |||
| 1764 | Ga0207671_10093594 | |||
| 1765 | Ga0207693_10000461 | |||
| 1766 | Ga0207693_10000702 | |||
| 1767 | Ga0207693_10008489 | |||
| 1768 | Ga0207693_10011291 | |||
| 1769 | Ga0207693_10016960 | |||
| 1770 | Ga0207693_10032098 | |||
| 1771 | Ga0207693_10127862 | |||
| 1772 | Ga0207693_10207424 | |||
| 1773 | Ga0207693_10222606 | |||
| 1774 | Ga0207693_10312327 | |||
| 1775 | Ga0207693_10575375 | |||
| 1776 | Ga0207693_10747578 | |||
| 1777 | Ga0207663_10052554 | |||
| 1778 | Ga0207663_10075199 | |||
| 1779 | Ga0207663_10251632 | |||
| 1780 | Ga0207660_10014233 | |||
| 1781 | Ga0207660_10028841 | |||
| 1782 | Ga0207660_10066020 | |||
| 1783 | Ga0207660_10167138 | |||
| 1784 | Ga0207660_10494391 | |||
| 1785 | Ga0207657_10002868 | |||
| 1786 | Ga0207657_10003083 | |||
| 1787 | Ga0207657_10005015 | |||
| 1788 | Ga0207657_10008807 | |||
| 1789 | Ga0207657_10014143 | |||
| 1790 | Ga0207657_10063292 | |||
| 1791 | Ga0207657_10140443 | |||
| 1792 | Ga0207657_10400515 | |||
| 1793 | Ga0207649_10053356 | |||
| 1794 | Ga0207649_10099768 | |||
| 1795 | Ga0207649_10119401 | |||
| 1796 | Ga0207649_10181027 | |||
| 1797 | Ga0207649_10284467 | |||
| 1798 | Ga0207652_10008595 | |||
| 1799 | Ga0207652_10026326 | |||
| 1800 | Ga0207652_10026918 | |||
| 1801 | Ga0207652_10030274 | |||
| 1802 | Ga0207652_10030667 | |||
| 1803 | Ga0207652_10030742 | |||
| 1804 | Ga0207652_10052565 | |||
| 1805 | Ga0207652_10086696 | |||
| 1806 | Ga0207652_10348095 | |||
| 1807 | Ga0207652_10556198 | |||
| 1808 | Ga0207646_10078163 | |||
| 1809 | Ga0207646_10110025 | |||
| 1810 | Ga0207646_10883508 | |||
| 1811 | Ga0207694_10158109 | |||
| 1812 | Ga0207694_10185525 | |||
| 1813 | Ga0207694_10266024 | |||
| 1814 | Ga0207694_10334248 | |||
| 1815 | Ga0207694_10787324 | |||
| 1816 | Ga0207687_10096274 | |||
| 1817 | Ga0207687_10142997 | |||
| 1818 | Ga0207687_10175149 | |||
| 1819 | Ga0207700_10000001 | |||
| 1820 | Ga0207700_10030373 | |||
| 1821 | Ga0207700_10167035 | |||
| 1822 | Ga0207700_10303550 | |||
| 1823 | Ga0207700_10713367 | |||
| 1824 | Ga0207664_10008730 | |||
| 1825 | Ga0207664_10042035 | |||
| 1826 | Ga0207664_10061003 | |||
| 1827 | Ga0207664_10065134 | |||
| 1828 | Ga0207664_10066266 | |||
| 1829 | Ga0207664_10067844 | |||
| 1830 | Ga0207664_10079940 | |||
| 1831 | Ga0207664_10298402 | |||
| 1832 | Ga0207644_10627433 | |||
| 1833 | Ga0207644_10669034 | |||
| 1834 | Ga0207690_10018829 | |||
| 1835 | Ga0207690_10197890 | |||
| 1836 | Ga0207690_11075618 | |||
| 1837 | Ga0207706_10007121 | |||
| 1838 | Ga0207706_10015927 | |||
| 1839 | Ga0207686_10159011 | |||
| 1840 | Ga0207686_10521099 | |||
| 1841 | Ga0207686_10743127 | |||
| 1842 | Ga0207709_10265412 | |||
| 1843 | Ga0207669_10593441 | |||
| 1844 | Ga0207704_10134375 | |||
| 1845 | Ga0207704_10203795 | |||
| 1846 | Ga0207704_10467756 | |||
| 1847 | Ga0207665_10000146 | |||
| 1848 | Ga0207665_10021141 | |||
| 1849 | Ga0207665_10049684 | |||
| 1850 | Ga0207665_10119006 | |||
| 1851 | Ga0207689_10171619 | |||
| 1852 | Ga0207661_10015658 | |||
| 1853 | Ga0207661_10018237 | |||
| 1854 | Ga0207661_10046700 | |||
| 1855 | Ga0207661_10095601 | |||
| 1856 | Ga0207661_10139938 | |||
| 1857 | Ga0207661_10786084 | |||
| 1858 | Ga0207667_10023766 | |||
| 1859 | Ga0207667_10042931 | |||
| 1860 | Ga0207667_10049080 | |||
| 1861 | Ga0207667_10063696 | |||
| 1862 | Ga0207667_10094646 | |||
| 1863 | Ga0207667_10112308 | |||
| 1864 | Ga0207667_10163545 | |||
| 1865 | Ga0207667_10284003 | |||
| 1866 | Ga0207667_10308824 | |||
| 1867 | Ga0207667_10486804 | |||
| 1868 | Ga0207651_10194042 | |||
| 1869 | Ga0207712_10076970 | |||
| 1870 | Ga0207640_10581670 | |||
| 1871 | Ga0207658_10014093 | |||
| 1872 | Ga0207677_10119414 | |||
| 1873 | Ga0207677_10129902 | |||
| 1874 | Ga0207677_10479382 | |||
| 1875 | Ga0207677_10630034 | |||
| 1876 | Ga0207703_10206964 | |||
| 1877 | Ga0207639_11082502 | |||
| 1878 | Ga0207678_10489210 | |||
| 1879 | Ga0207678_10555866 | |||
| 1880 | Ga0207708_10113974 | |||
| 1881 | Ga0207702_10245026 | |||
| 1882 | Ga0207702_10433490 | |||
| 1883 | Ga0207702_10456585 | |||
| 1884 | Ga0207702_10475285 | |||
| 1885 | Ga0207648_10088051 | |||
| 1886 | Ga0207676_11117201 | |||
| 1887 | Ga0207674_10019053 | |||
| 1888 | Ga0207674_10043887 | |||
| 1889 | Ga0207674_10087770 | |||
| 1890 | Ga0207674_10170622 | |||
| 1891 | Ga0207674_10578081 | |||
| 1892 | Ga0207675_100006643 | |||
| 1893 | Ga0207675_100187622 | |||
| 1894 | Ga0207683_10012401 | |||
| 1895 | Ga0207683_10014743 | |||
| 1896 | Ga0207683_10545586 | |||
| 1897 | Ga0207683_10750272 | |||
| 1898 | Ga0207698_10051628 | |||
| 1899 | Ga0207698_10180109 | |||
| 1900 | Ga0207698_10442539 | |||
| 1901 | Ga0207428_10095826 | |||
| 1902 | Ga0268266_10304158 | |||
| 1903 | Ga0268265_10329218 | |||
| 1904 | Ga0265326_10097812 | |||
| 1905 | Ga0265319_1001275 | |||
| 1906 | Ga0265319_1005524 | |||
| 1907 | Ga0265319_1031145 | |||
| 1908 | Ga0265319_1040736 | |||
| 1909 | Ga0265334_10000542 | |||
| 1910 | Ga0265334_10008317 | |||
| 1911 | Ga0265318_10000276 | |||
| 1912 | Ga0265318_10015788 | |||
| 1913 | Ga0265318_10076336 | |||
| 1914 | Ga0265323_10024468 | |||
| 1915 | Ga0265322_10024396 | |||
| 1916 | Ga0265336_10047508 | |||
| 1917 | Ga0265338_10017462 | |||
| 1918 | Ga0265338_10024846 | |||
| 1919 | Ga0265338_10055972 | |||
| 1920 | Ga0265338_10122790 | |||
| 1921 | Ga0265338_10170725 | |||
| 1922 | Ga0265324_10013644 | |||
| 1923 | Ga0265324_10145453 | |||
| 1924 | Ga0265330_10000888 | |||
| 1925 | Ga0265330_10011338 | |||
| 1926 | Ga0265332_10012350 | |||
| 1927 | Ga0265328_10001224 | |||
| 1928 | Ga0265320_10035999 | |||
| 1929 | Ga0265320_10101522 | |||
| 1930 | Ga0265325_10001745 | |||
| 1931 | Ga0265325_10071493 | |||
| 1932 | Ga0265325_10082195 | |||
| 1933 | Ga0265329_10029686 | |||
| 1934 | Ga0265340_10001237 | |||
| 1935 | Ga0265340_10046610 | |||
| 1936 | Ga0265340_10208973 | |||
| 1937 | Ga0265339_10042865 | |||
| 1938 | Ga0265331_10000959 | |||
| 1939 | Ga0265331_10021613 | |||
| 1940 | Ga0265331_10200273 | |||
| 1941 | Ga0265327_10012224 | |||
| 1942 | Ga0265327_10069980 | |||
| 1943 | Ga0265316_10002153 | |||
| 1944 | Ga0265316_10024056 | |||
| 1945 | Ga0265316_10289811 | |||
| 1946 | Ga0307408_100063581 | |||
| 1947 | Ga0307408_100334019 | |||
| 1948 | Ga0265313_10002758 | |||
| 1949 | Ga0265313_10058544 | |||
| 1950 | Ga0265313_10115907 | |||
| 1951 | Ga0265314_10018097 | |||
| 1952 | Ga0265314_10027632 | |||
| 1953 | Ga0265342_10011564 | |||
| 1954 | Ga0265342_10152463 | |||
| 1955 | Ga0307405_10044112 | |||
| 1956 | Ga0307410_10009172 | |||
| 1957 | Ga0307406_10158612 | |||
| 1958 | Ga0307406_10270158 | |||
| 1959 | Ga0307407_10073184 | |||
| 1960 | Ga0307412_10036218 | |||
| 1961 | Ga0307412_10605937 | |||
| 1962 | Ga0307409_100004736 | |||
| 1963 | Ga0307416_100025483 | |||
| 1964 | Ga0307416_100059067 | |||
| 1965 | Ga0307416_100093554 | |||
| 1966 | Ga0307416_100119644 | |||
| 1967 | Ga0307411_10005329 | |||
| 1968 | Ga0307415_100001447 | |||
| 1969 | Ga0307415_100021574 | |||
| 1970 | Ga0307415_100121329 | |||
| 1971 | Ga0307415_100496769 | |||
| 1972 | Ga0373948_0006809 | |||
| 1973 | Ga0373959_0049596 | |||
| 1974 | Ga0373926_0025609 | |||
| 1975 | Ga0373926_0040375 | |||
| 1976 | Ga0373926_0057815 | |||
| 1977 | Ga0373928_0005155 | |||
| 1978 | Ga0373929_0005100 | |||
| 1979 | Ga0373929_0018931 | |||
| 1980 | Ga0373944_0009624 | |||
| 1981 | Ga0373944_0081566 | |||
| 1982 | Ga0373949_0021962 | |||
| 1983 | Ga0373932_0002679 | |||
| 1984 | Ga0373936_0049871 | |||
| 1985 | Ga0373936_0216551 | |||
| 1986 | Ga0373939_0003023 | |||
| 1987 | Ga0373939_0043509 | |||
| 1988 | Ga0373941_0004411 | |||
| 1989 | Ga0373941_0019264 | |||
| 1990 | Ga0373945_0002294 | |||
| 1991 | Ga0373943_0000138 | |||
| 1992 | Ga0373943_0009977 | |||
| 1993 | Ga0373943_0026436 | |||
| 1994 | Ga0373946_0004089 | |||
| 1995 | Ga0373942_0010786 | |||
| 1996 | Ga0373962_0105163 | |||
| 1997 | Ga0373931_0076962 | |||
| 1998 | Ga0373931_0254857 | |||
| 1999 | Ga0373935_0011408 | |||
| 2000 | Ga0373935_0230730 | |||
| 2001 | Ga0373927_0003815 | |||
| 2002 | Ga0373927_0026654 | |||
| 2003 | Ga0373947_0000341 | |||
| 2004 | Ga0373947_0001997 | |||
| 2005 | Ga0373947_0012643 | |||
| 2006 | Ga0373947_0098462 | |||
| 2007 | Ga0373937_0193520 | |||
| 2008 | Ga0373937_0295087 | |||
| 2009 | Ga0373925_0005884 | |||
| 2010 | Ga0373925_0013009 | |||
| 2011 | Ga0373925_0015551 | |||
| 2012 | Ga0373925_0058299 | |||
| 2013 | Ga0395899_0002546 | |||
| 2014 | Ga0395899_0005507 | |||
| 2015 | Ga0395899_0010299 | |||
| 2016 | Ga0395899_0013850 | |||
| 2017 | Ga0395899_0023030 | |||
| 2018 | Ga0395899_0033666 | |||
| 2019 | Ga0395899_0061130 | |||
| 2020 | Ga0395899_0090643 | |||
| 2021 | Ga0395899_0095253 | |||
| 2022 | Ga0395899_0098507 | |||
| 2023 | Ga0395899_0100614 | |||
| 2024 | Ga0395899_0103058 | |||
| 2025 | Ga0395899_0162991 | |||
| 2026 | Ga0395900_0004292 | |||
| 2027 | Ga0395900_0005329 | |||
| 2028 | Ga0395900_0007939 | |||
| 2029 | Ga0395900_0009570 | |||
| 2030 | Ga0395900_0009982 | |||
| 2031 | Ga0395900_0010097 | |||
| 2032 | Ga0395900_0041260 | |||
| 2033 | Ga0395900_0042835 | |||
| 2034 | Ga0395900_0065552 | |||
| 2035 | Ga0395900_0070152 | |||
| 2036 | Ga0395900_0087704 | |||
| 2037 | Ga0395900_0096441 | |||
| 2038 | Ga0395900_0108791 | |||
| 2039 | Ga0395900_0165659 | |||
| 2040 | Ga0395900_0181992 | |||
| 2041 | Ga0395900_0353226 | |||
| 2042 | Ga0395900_0396334 | |||
| 2043 | Ga0395900_0420102 | |||
| 2044 | Ga0395900_0466149 | |||
| 2045 | Ga0395900_0487187 | |||
| 2046 | Ga0395900_0633417 | |||
| 2047 | Ga0395900_0955006 | |||
| 2048 | Ga0395898_0001631 | |||
| 2049 | Ga0395898_0002095 | |||
| 2050 | Ga0395898_0006255 | |||
| 2051 | Ga0395898_0006291 | |||
| 2052 | Ga0395898_0019037 | |||
| 2053 | Ga0395898_0023536 | |||
| 2054 | Ga0395898_0032301 | |||
| 2055 | Ga0395898_0032496 | |||
| 2056 | Ga0395898_0066573 | |||
| 2057 | Ga0395898_0108137 | |||
| 2058 | Ga0395898_0125916 | |||
| 2059 | Ga0395898_0155567 | |||
| 2060 | Ga0395898_0170507 | |||
| 2061 | Ga0395898_0179127 | |||
| 2062 | Ga0395898_0187122 | |||
| 2063 | Ga0395898_0289532 | |||
| 2064 | Ga0395898_0353186 | |||
| 2065 | Ga0395898_0391793 | |||
| 2066 | Ga0395898_0418877 | |||
| 2067 | Ga0395898_0509023 | |||
| 2068 | Ga0395898_0543911 | |||
| 2069 | Ga0395898_0590166 | |||
| 2070 | Ga0395905_0004797 | |||
| 2071 | Ga0395905_0004929 | |||
| 2072 | Ga0395905_0009450 | |||
| 2073 | Ga0395905_0010819 | |||
| 2074 | Ga0395905_0039716 | |||
| 2075 | Ga0395905_0046976 | |||
| 2076 | Ga0395905_0055930 | |||
| 2077 | Ga0395905_0065572 | |||
| 2078 | Ga0395905_0075743 | |||
| 2079 | Ga0395905_0087562 | |||
| 2080 | Ga0395905_0134619 | |||
| 2081 | Ga0395905_0170797 | |||
| 2082 | Ga0395905_0181290 | |||
| 2083 | Ga0395905_0301215 | |||
| 2084 | Ga0395905_0401169 | |||
| 2085 | Ga0395905_0628352 | |||
| 2086 | Ga0395905_0669211 | |||
| 2087 | Ga0395905_0684576 | |||
| 2088 | Ga0395901_0000370 | |||
| 2089 | Ga0395901_0002781 | |||
| 2090 | Ga0395901_0007108 | |||
| 2091 | Ga0395901_0008638 | |||
| 2092 | Ga0395901_0008830 | |||
| 2093 | Ga0395901_0010224 | |||
| 2094 | Ga0395901_0015385 | |||
| 2095 | Ga0395901_0017424 | |||
| 2096 | Ga0395901_0021691 | |||
| 2097 | Ga0395901_0031941 | |||
| 2098 | Ga0395901_0043130 | |||
| 2099 | Ga0395901_0060529 | |||
| 2100 | Ga0395901_0085451 | |||
| 2101 | Ga0395901_0099551 | |||
| 2102 | Ga0395901_0123264 | |||
| 2103 | Ga0395901_0136253 | |||
| 2104 | Ga0395901_0172238 | |||
| 2105 | Ga0395901_0175044 | |||
| 2106 | Ga0395901_0190818 | |||
| 2107 | Ga0395901_0209330 | |||
| 2108 | Ga0395901_0279796 | |||
| 2109 | Ga0395901_0311270 | |||
| 2110 | Ga0395901_0473359 | |||
| 2111 | Ga0395901_0600070 | |||
| 2112 | Ga0395901_0679821 | |||
| 2113 | Ga0436365_0045703 | |||
| 2114 | Ga0436365_0408949 | |||
| 2115 | Ga0436360_0331421 | |||
| 2116 | Ga0436363_0152649 | |||
| 2117 | Ga0439453_0002584 | |||
| 2118 | Ga0451853_1962744 | |||
| 2119 | Ga0451853_2140449 | |||
| 2120 | Ga0439451_003932 | |||
| 2121 | Ga0439454_000703 | |||
| 2122 | Ga0450915_000315 | |||
| 2123 | Ga0439434_0021593 | |||
| 2124 | Ga0439464_0142132 | |||
| 2125 | Ga0439460_0080028 | |||
| 2126 | Ga0466969_0001022 | |||
| 2127 | Ga0466965_0033821 | |||
| 2128 | Ga0466965_0137473 | |||
| 2129 | Ga0466965_0195053 | |||
| 2130 | Ga0466966_0012031 | |||
| 2131 | Ga0466966_0067725 | |||
| 2132 | Ga0466966_0180162 | |||
| 2133 | Ga0466966_0265413 | |||
| 2134 | Ga0466961_0001191 | |||
| 2135 | Ga0466961_0018390 | |||
| 2136 | Ga0466961_0074851 | |||
| 2137 | Ga0466961_0121201 | |||
| 2138 | Ga0466961_0132631 | |||
| 2139 | Ga0466961_0221409 | |||
| 2140 | Ga0466961_0416819 | |||
| 2141 | Ga0466963_0000914 | |||
| 2142 | Ga0466963_0001196 | |||
| 2143 | Ga0466963_0001298 | |||
| 2144 | Ga0466963_0001427 | |||
| 2145 | Ga0466963_0002207 | |||
| 2146 | Ga0466963_0008622 | |||
| 2147 | Ga0466963_0017329 | |||
| 2148 | Ga0466963_0017933 | |||
| 2149 | Ga0466963_0025101 | |||
| 2150 | Ga0466963_0043425 | |||
| 2151 | Ga0466963_0048505 | |||
| 2152 | Ga0466963_0066982 | |||
| 2153 | Ga0466963_0084695 | |||
| 2154 | Ga0466963_0094273 | |||
| 2155 | Ga0466963_0266345 | |||
| 2156 | Ga0466963_0267948 | |||
| 2157 | Ga0466963_0306672 | |||
| 2158 | Ga0466964_0000233 | |||
| 2159 | Ga0466964_0001964 | |||
| 2160 | Ga0466964_0005348 | |||
| 2161 | Ga0466964_0019611 | |||
| 2162 | Ga0466964_0043634 | |||
| 2163 | Ga0466964_0078904 | |||
| 2164 | Ga0453684_1065801 | |||
| 2165 | Ga0466971_0000350 | |||
| 2166 | Ga0466971_0003188 | |||
| 2167 | Ga0466971_0026888 | |||
| 2168 | Ga0466971_0103101 | |||
| 2169 | Ga0466971_0119714 | |||
| 2170 | Ga0466968_0001689 | |||
| 2171 | Ga0466968_0002266 | |||
| 2172 | Ga0466968_0036088 | |||
| 2173 | Ga0466968_0160153 | |||
| 2174 | Ga0466968_0161678 | |||
| 2175 | Ga0466970_0063311 | |||
| 2176 | Ga0466970_0106285 | |||
| 2177 | Ga0466970_0114880 | |||
| 2178 | Ga0466957_0029553 | |||
| 2179 | Ga0466957_0107554 | |||
| 2180 | Ga0466957_0153241 | |||
| 2181 | Ga0466957_0204107 | |||
| 2182 | Ga0466960_0015693 | |||
| 2183 | Ga0466960_0090430 | |||
| 2184 | Ga0466959_0004794 | |||
| 2185 | Ga0466959_0040920 | |||
| 2186 | Ga0466959_0041197 | |||
| 2187 | Ga0466959_0135980 | |||
| 2188 | Ga0466959_0614810 | |||
| 2189 | Ga0451576_0307526 | |||
| 2190 | Ga0466958_0000492 | |||
| 2191 | Ga0466958_0000876 | |||
| 2192 | Ga0466958_0001126 | |||
| 2193 | Ga0466958_0002049 | |||
| 2194 | Ga0466958_0004846 | |||
| 2195 | Ga0466958_0008105 | |||
| 2196 | Ga0466958_0037288 | |||
| 2197 | Ga0466958_0074057 | |||
| 2198 | Ga0466958_0108466 | |||
| 2199 | Ga0466958_0186531 | |||
| 2200 | Ga0466967_0001317 | |||
| 2201 | Ga0466967_0003283 | |||
| 2202 | Ga0466967_0004635 | |||
| 2203 | Ga0466967_0009901 | |||
| 2204 | Ga0466967_0013679 | |||
| 2205 | Ga0466967_0018661 | |||
| 2206 | Ga0466967_0019638 | |||
| 2207 | Ga0466967_0019874 | |||
| 2208 | Ga0466967_0020088 | |||
| 2209 | Ga0466967_0025389 | |||
| 2210 | Ga0466967_0030402 | |||
| 2211 | Ga0466967_0030404 | |||
| 2212 | Ga0466967_0030640 | |||
| 2213 | Ga0466967_0041340 | |||
| 2214 | Ga0466967_0043208 | |||
| 2215 | Ga0466967_0046522 | |||
| 2216 | Ga0466967_0063686 | |||
| 2217 | Ga0466967_0068456 | |||
| 2218 | Ga0466967_0070566 | |||
| 2219 | Ga0466967_0071017 | |||
| 2220 | Ga0466967_0078771 | |||
| 2221 | Ga0466967_0117299 | |||
| 2222 | Ga0466967_0168476 | |||
| 2223 | Ga0466967_0363050 | |||
| 2224 | Ga0466967_0372857 | |||
| 2225 | Ga0466967_0398526 | |||
| 2226 | Ga0466967_0405502 | |||
| 2227 | Ga0466967_0733478 | |||
| 2228 | Ga0495592_0010091 | |||
| 2229 | Ga0495603_0048410 | |||
| 2230 | Ga0495629_0001540 | |||
| 2231 | Ga0495629_0043195 | |||
| 2232 | Ga0495629_0054498 | |||
| 2233 | Ga0495629_0154537 | |||
| 2234 | Ga0495641_0000345 | |||
| 2235 | Ga0495641_0007704 | |||
| 2236 | Ga0495641_0082697 | |||
| 2237 | Ga0495641_0158876 | |||
| 2238 | Ga0495651_0061025 | |||
| 2239 | Ga0495651_0216805 | |||
| 2240 | Ga0495653_0031375 | |||
| 2241 | Ga0495653_0058748 | |||
| 2242 | Ga0495653_0067578 | |||
| 2243 | Ga0495653_0246594 | |||
| 2244 | Ga0495580_0113602 | |||
| 2245 | Ga0495582_0001048 | |||
| 2246 | Ga0495582_0051190 | |||
| 2247 | Ga0495582_0128748 | |||
| 2248 | Ga0495605_0056627 | |||
| 2249 | Ga0495605_0076891 | |||
| 2250 | Ga0495639_0001922 | |||
| 2251 | Ga0495639_0005637 | |||
| 2252 | Ga0495639_0013660 | |||
| 2253 | Ga0495662_0006548 | |||
| 2254 | Ga0495662_0035412 | |||
| 2255 | Ga0495662_0113919 | |||
| 2256 | Ga0495664_0018381 | |||
| 2257 | Ga0495664_0033236 | |||
| 2258 | Ga0495664_0366805 | |||
| 2259 | Ga0495585_0144735 | |||
| 2260 | Ga0495596_0033129 | |||
| 2261 | Ga0495596_0097745 | |||
| 2262 | Ga0495607_0014777 | |||
| 2263 | Ga0495608_0014286 | |||
| 2264 | Ga0495608_0066666 | |||
| 2265 | Ga0495608_0143594 | |||
| 2266 | Ga0495608_0306503 | |||
| 2267 | Ga0495618_0030099 | |||
| 2268 | Ga0495618_0300554 | |||
| 2269 | Ga0495628_0013401 | |||
| 2270 | Ga0495628_0086213 | |||
| 2271 | Ga0495628_0210053 | |||
| 2272 | Ga0495630_0004423 | |||
| 2273 | Ga0495630_0004589 | |||
| 2274 | Ga0495630_0019816 | |||
| 2275 | Ga0495630_0026576 | |||
| 2276 | Ga0495630_0074042 | |||
| 2277 | Ga0495630_0634288 | |||
| 2278 | Ga0495630_0856793 | |||
| 2279 | Ga0495637_0122992 | |||
| 2280 | Ga0495644_0014567 | |||
| 2281 | Ga0495663_0014503 | |||
| 2282 | Ga0495663_0057717 | |||
| 2283 | Ga0495666_0001773 | |||
| 2284 | Ga0495666_0025487 | |||
| 2285 | Ga0495652_0068656 | |||
| 2286 | Ga0495652_0212969 | |||
| 2287 | Ga0495652_0309765 | |||
| 2288 | Ga0495665_0001821 | |||
| 2289 | Ga0495665_0044257 | |||
| 2290 | Ga0495665_0226950 | |||
| 2291 | Ga0495640_0006831 | |||
| 2292 | Ga0495640_0011558 | |||
| 2293 | Ga0495640_0035333 | |||
| 2294 | Ga0495640_0055283 | |||
| 2295 | Ga0495640_0087369 | |||
| 2296 | Ga0495586_0052091 | |||
| 2297 | Ga0495587_0074226 | |||
| 2298 | Ga0495587_0227501 | |||
| 2299 | Ga0495598_0063417 | |||
| 2300 | Ga0495598_0066037 | |||
| 2301 | Ga0495645_0111378 | |||
| 2302 | Ga0495667_0006269 | |||
| 2303 | Ga0495667_0024684 | |||
| 2304 | Ga0495667_0033526 | |||
| 2305 | Ga0495667_0523925 | |||
| 2306 | Ga0495656_0056885 | |||
| 2307 | Ga0495656_0068538 | |||
| 2308 | Ga0495656_0340869 | |||
| 2309 | Ga0495668_0056101 | |||
| 2310 | Ga0495634_0011233 | |||
| 2311 | Ga0495634_0045402 | |||
| 2312 | Ga0495634_0098949 | |||
| 2313 | Ga0495634_0112610 | |||
| 2314 | Ga0495635_0025411 | |||
| 2315 | Ga0495635_0059627 | |||
| 2316 | Ga0495635_0060626 | |||
| 2317 | Ga0495659_0024285 | |||
| 2318 | Ga0495659_0078481 | |||
| 2319 | Ga0495661_0207929 | |||
| 2320 | Ga0495661_0217056 | |||
| 2321 | Ga0495661_0326713 | |||
| 2322 | Ga0495661_0355249 | |||
| 2323 | Ga0495657_0089649 | |||
| 2324 | Ga0495657_0125014 | |||
| 2325 | Ga0495599_0010401 | |||
| 2326 | Ga0495599_0031007 | |||
| 2327 | Ga0495623_0158336 | |||
| 2328 | Ga0495646_0057450 | |||
| 2329 | Ga0495646_0107840 | |||
| 2330 | Ga0495647_0001758 | |||
| 2331 | Ga0495647_0015615 | |||
| 2332 | Ga0495647_0180771 | |||
| 2333 | Ga0495658_0014748 | |||
| 2334 | Ga0495613_0003061 | |||
| 2335 | Ga0495613_0006852 | |||
| 2336 | Ga0495613_0012262 | |||
| 2337 | Ga0495613_0241034 | |||
| 2338 | Ga0495613_0363199 | |||
| 2339 | Ga0495624_0012668 | |||
| 2340 | Ga0495624_0310965 | |||
| 2341 | Ga0495670_0168439 | |||
| 2342 | Ga0495670_0277107 | |||
| 2343 | Ga0495589_0036770 | |||
| 2344 | Ga0495589_0094783 | |||
| 2345 | Ga0495600_0027301 | |||
| 2346 | Ga0495600_0029037 | |||
| 2347 | Ga0495600_0037562 | |||
| 2348 | Ga0495600_0091930 | |||
| 2349 | Ga0495581_0000640 | |||
| 2350 | Ga0495581_0060409 | |||
| 2351 | Ga0495581_0081532 | |||
| 2352 | Ga0495581_0504783 | |||
| 2353 | Ga0495604_0175080 | |||
| 2354 | Ga0495636_0033683 | |||
| 2355 | Ga0495674_0003918 | |||
| 2356 | Ga0495674_0011997 | |||
| 2357 | Ga0495674_0069697 | |||
| 2358 | Ga0495674_0334072 | |||
| 2359 | Ga0495674_0400817 | |||
| 2360 | Ga0495674_0624824 | |||
| 2361 | Ga0495674_0731160 | |||
| 2362 | Ga0495674_0811335 | |||
| 2363 | Ga0495676_0003723 | |||
| 2364 | Ga0495676_0137379 | |||
| 2365 | Ga0495676_0142362 | |||
| 2366 | Ga0495680_0003420 | |||
| 2367 | Ga0495680_0007640 | |||
| 2368 | Ga0495680_0009501 | |||
| 2369 | Ga0495680_0059275 | |||
| 2370 | Ga0495680_0069617 | |||
| 2371 | Ga0495680_0106490 | |||
| 2372 | Ga0495680_0128468 | |||
| 2373 | Ga0495680_0184195 | |||
| 2374 | Ga0495683_0255591 | |||
| 2375 | Ga0495675_0252150 | |||
| 2376 | Ga0495677_0083639 | |||
| 2377 | Ga0495685_106620 | |||
| 2378 | Ga0495684_0009129 | |||
| 2379 | Ga0495684_0009734 | |||
| 2380 | Ga0495684_0025768 | |||
| 2381 | Ga0495684_0026040 | |||
| 2382 | Ga0495684_0100572 | |||
| 2383 | Ga0495593_0007309 | |||
| 2384 | Ga0495593_0009917 | |||
| 2385 | Ga0495593_0113406 | |||
| 2386 | Ga0495602_0037471 | |||
| 2387 | Ga0495602_0190863 | |||
| 2388 | Ga0495602_0211878 | |||
| 2389 | Ga0495614_0003782 | |||
| 2390 | Ga0495614_0013122 | |||
| 2391 | Ga0495614_0113314 | |||
| 2392 | Ga0496100_0016415 | |||
| 2393 | Ga0496100_0056176 | |||
| 2394 | Ga0496100_0085771 | |||
| 2395 | Ga0496100_0133843 | |||
| 2396 | Ga0496100_0662367 | |||
| 2397 | Ga0496100_0673465 | |||
| 2398 | Ga0496101_0019418 | |||
| 2399 | Ga0496101_0044715 | |||
| 2400 | Ga0496101_0147626 | |||
| 2401 | Ga0496101_0205586 | |||
| 2402 | Ga0496101_0219394 | |||
| 2403 | Ga0496101_0447588 | |||
| 2404 | Ga0496102_0020289 | |||
| 2405 | Ga0496102_0036831 | |||
| 2406 | Ga0496102_0037438 | |||
| 2407 | Ga0496102_0092371 | |||
| 2408 | Ga0496102_0141408 | |||
| 2409 | Ga0496102_0162458 | |||
| 2410 | Ga0496102_0284794 | |||
| 2411 | Ga0496102_0299731 | |||
| 2412 | Ga0496103_0005924 | |||
| 2413 | Ga0496103_0012326 | |||
| 2414 | Ga0496103_0019732 | |||
| 2415 | Ga0496103_0092671 | |||
| 2416 | Ga0496103_0151496 | |||
| 2417 | Ga0496103_0218169 | |||
| 2418 | Ga0496103_0254755 | |||
| 2419 | Ga0496103_0571310 | |||
| 2420 | Ga0496104_0000597 | |||
| 2421 | Ga0496104_0013270 | |||
| 2422 | Ga0496104_0013604 | |||
| 2423 | Ga0496104_0031080 | |||
| 2424 | Ga0496104_0052918 | |||
| 2425 | Ga0496104_0074798 | |||
| 2426 | Ga0496104_0129318 | |||
| 2427 | Ga0496104_0257327 | |||
| 2428 | Ga0496104_0502552 | |||
| 2429 | Ga0496105_0001972 | |||
| 2430 | Ga0496105_0004171 | |||
| 2431 | Ga0496105_0039193 | |||
| 2432 | Ga0496105_0061821 | |||
| 2433 | Ga0496105_0115274 | |||
| 2434 | Ga0496105_0212297 | |||
| 2435 | Ga0496105_0259761 | |||
| 2436 | Ga0496106_0002814 | |||
| 2437 | Ga0496106_0008591 | |||
| 2438 | Ga0496106_0025881 | |||
| 2439 | Ga0496106_0040822 | |||
| 2440 | Ga0496106_0045709 | |||
| 2441 | Ga0496106_0162704 | |||
| 2442 | Ga0496106_0325518 | |||
| 2443 | Ga0496107_0021210 | |||
| 2444 | Ga0496107_0033970 | |||
| 2445 | Ga0496107_0067508 | |||
| 2446 | Ga0496107_0222777 | |||
| 2447 | Ga0496107_0453477 | |||
| 2448 | Ga0496108_0002280 | |||
| 2449 | Ga0496108_0022242 | |||
| 2450 | Ga0496108_0027385 | |||
| 2451 | Ga0496108_0039676 | |||
| 2452 | Ga0496108_0048543 | |||
| 2453 | Ga0496108_0092962 | |||
| 2454 | Ga0496108_0288167 | |||
| 2455 | Ga0496108_0341157 | |||
| 2456 | Ga0496108_0367695 | |||
| 2457 | Ga0496109_0001523 | |||
| 2458 | Ga0496109_0002331 | |||
| 2459 | Ga0496109_0002799 | |||
| 2460 | Ga0496109_0019767 | |||
| 2461 | Ga0496109_0044373 | |||
| 2462 | Ga0496109_0075962 | |||
| 2463 | Ga0496109_0223782 | |||
| 2464 | Ga0496109_0237574 | |||
| 2465 | Ga0496109_0276534 | |||
| 2466 | Ga0496109_0684785 | |||
| 2467 | Ga0496109_0869168 | |||
| 2468 | Ga0496110_0000705 | |||
| 2469 | Ga0496110_0007799 | |||
| 2470 | Ga0496110_0034853 | |||
| 2471 | Ga0496110_0051582 | |||
| 2472 | Ga0496110_0056524 | |||
| 2473 | Ga0496110_0080639 | |||
| 2474 | Ga0496110_0126756 | |||
| 2475 | Ga0496110_0173140 | |||
| 2476 | Ga0496110_0216147 | |||
| 2477 | Ga0496110_0252949 | |||
| 2478 | Ga0496110_0359636 | |||
| 2479 | Ga0496110_0516604 | |||
| 2480 | Ga0496110_0645599 | |||
| 2481 | Ga0496110_0745444 | |||
| 2482 | Ga0496111_0000376 | |||
| 2483 | Ga0496111_0012316 | |||
| 2484 | Ga0496111_0027287 | |||
| 2485 | Ga0496111_0029684 | |||
| 2486 | Ga0496111_0041012 | |||
| 2487 | Ga0496111_0053296 | |||
| 2488 | Ga0496111_0075106 | |||
| 2489 | Ga0496111_0075143 | |||
| 2490 | Ga0496111_0094976 | |||
| 2491 | Ga0496111_0122181 | |||
| 2492 | Ga0496111_0446654 | |||
| 2493 | Ga0496111_0745917 | |||
| 2494 | Ga0496112_0003554 | |||
| 2495 | Ga0496112_0005672 | |||
| 2496 | Ga0496112_0016462 | |||
| 2497 | Ga0496112_0031983 | |||
| 2498 | Ga0496112_0081396 | |||
| 2499 | Ga0496112_0083785 | |||
| 2500 | Ga0496112_0089498 | |||
| 2501 | Ga0496112_0090358 | |||
| 2502 | Ga0496112_0098079 | |||
| 2503 | Ga0496112_0125752 | |||
| 2504 | Ga0496112_0236190 | |||
| 2505 | Ga0496112_0339565 | |||
| 2506 | Ga0496112_0378110 | |||
| 2507 | Ga0496112_0540549 | |||
| 2508 | Ga0496112_0635487 | |||
| 2509 | Ga0496112_0943085 | |||
| 2510 | Ga0496112_1052825 | |||
| 2511 | Ga0496113_0000365 | |||
| 2512 | Ga0496113_0011892 | |||
| 2513 | Ga0496113_0025896 | |||
| 2514 | Ga0496113_0062165 | |||
| 2515 | Ga0496113_0108695 | |||
| 2516 | Ga0496113_0342515 | |||
| 2517 | Ga0496113_0422676 | |||
| 2518 | Ga0496113_0494573 | |||
| 2519 | Ga0496113_0680796 | |||
| 2520 | Ga0496114_0000875 | |||
| 2521 | Ga0496114_0003727 | |||
| 2522 | Ga0496114_0003888 | |||
| 2523 | Ga0496114_0006300 | |||
| 2524 | Ga0496114_0071477 | |||
| 2525 | Ga0496114_0081498 | |||
| 2526 | Ga0496114_0085145 | |||
| 2527 | Ga0496115_0015946 | |||
| 2528 | Ga0496115_0021221 | |||
| 2529 | Ga0496115_0026457 | |||
| 2530 | Ga0496115_0038292 | |||
| 2531 | Ga0496115_0152250 | |||
| 2532 | Ga0496115_0255717 | |||
| 2533 | Ga0496115_0263124 | |||
| 2534 | Ga0496115_0388021 | |||
| 2535 | Ga0501031_0015574 | |||
| 2536 | Ga0501031_0249094 | |||
| 2537 | Ga0501032_0041691 | |||
| 2538 | Ga0501033_0003478 | |||
| 2539 | Ga0501036_0120170 | |||
| 2540 | Ga0501036_0228234 | |||
| 2541 | Ga0501036_0253053 | |||
| 2542 | Ga0501036_0613279 | |||
| 2543 | Ga0501037_0429802 | |||
| 2544 | Ga0501038_0007188 | |||
| 2545 | Ga0501039_0006217 | |||
| 2546 | Ga0501040_0006556 | |||
| 2547 | Ga0501040_0056858 | |||
| 2548 | Ga0501041_0051932 | |||
| 2549 | Ga0501041_0112294 | |||
| 2550 | Ga0501041_0253714 | |||
| 2551 | Ga0501041_0388813 | |||
| 2552 | Ga0501042_0108718 | |||
| 2553 | Ga0501042_0134720 | |||
| 2554 | Ga0501042_0193588 | |||
| 2555 | Ga0501046_0088158 | |||
| 2556 | Ga0501046_0253414 | |||
| 2557 | Ga0501047_0065789 | |||
| 2558 | Ga0501047_0334410 | |||
| 2559 | Ga0501047_0508346 | |||
| 2560 | Ga0501048_0004133 | |||
| 2561 | Ga0501048_0043247 | |||
| 2562 | Ga0501048_0290927 | |||
| 2563 | Ga0501067_0009283 | |||
| 2564 | Ga0501067_0011107 | |||
| 2565 | Ga0501067_0062842 | |||
| 2566 | Ga0501067_0097317 | |||
| 2567 | Ga0501067_0147539 | |||
| 2568 | Ga0501068_0014707 | |||
| 2569 | Ga0501068_0177369 | |||
| 2570 | Ga0501069_0005135 | |||
| 2571 | Ga0501069_0010254 | |||
| 2572 | Ga0501069_0011091 | |||
| 2573 | Ga0501069_0285999 | |||
| 2574 | Ga0501069_0553666 | |||
| 2575 | Ga0501070_0001687 | |||
| 2576 | Ga0501070_0020705 | |||
| 2577 | Ga0501070_0065141 | |||
| 2578 | Ga0501070_0115152 | |||
| 2579 | Ga0501070_0172154 | |||
| 2580 | Ga0501070_0197781 | |||
| 2581 | Ga0501071_0030185 | |||
| 2582 | Ga0501071_0035802 | |||
| 2583 | Ga0501071_0133404 | |||
| 2584 | Ga0501071_0305393 | |||
| 2585 | Ga0501071_0475411 | |||
| 2586 | Ga0501072_0025169 | |||
| 2587 | Ga0501072_0338490 | |||
| 2588 | Ga0501072_0349252 | |||
| 2589 | Ga0501073_0021069 | |||
| 2590 | Ga0501073_0194205 | |||
| 2591 | Ga0501074_0033377 | |||
| 2592 | Ga0501074_0050163 | |||
| 2593 | Ga0501075_0021220 | |||
| 2594 | Ga0501075_0215136 | |||
| 2595 | Ga0501075_0339142 | |||
| 2596 | Ga0501076_0074317 | |||
| 2597 | Ga0501077_0010555 | |||
| 2598 | Ga0501077_0393909 | |||
| 2599 | Ga0501079_0043846 | |||
| 2600 | Ga0501079_0125266 | |||
| 2601 | Ga0501079_0158570 | |||
| 2602 | Ga0501079_0179968 | |||
| 2603 | Ga0501079_0336072 | |||
| 2604 | Ga0501080_0002220 | |||
| 2605 | Ga0501080_0020012 | |||
| 2606 | Ga0501080_0103637 | |||
| 2607 | Ga0501080_0645064 | |||
| 2608 | Ga0501035_0270052 | |||
| 2609 | Ga0501044_0330937 | |||
| 2610 | Ga0501045_0074232 | |||
| 2611 | Ga0501045_0140853 | |||
| 2612 | Ga0501045_0141827 | |||
| 2613 | nmdc:mga03683_351791_c1 | |||
| 2614 | nmdc:mga0yw44_209626_c1 | |||
| 2615 | nmdc:mga0yw44_87322_c1 | |||
| 2616 | nmdc:mga05p37_107311_c1 | |||
| 2617 | nmdc:mga05p37_127566_c1 | |||
| 2618 | nmdc:mga05p37_542042_c1 | |||
| 2619 | nmdc:mga05p37_553118_c1 | |||
| 2620 | nmdc:mga05p37_91702_c1 | |||
| 2621 | nmdc:mga06r32_184713_c1 | |||
| 2622 | nmdc:mga06r32_972358_c1 | |||
| 2623 | nmdc:mga08y16_484210_c1 | |||
| 2624 | nmdc:mga08y16_903218_c1 | |||
| 2625 | nmdc:mga0n895_212756_c1 | |||
| 2626 | nmdc:mga0n895_61794_c1 | |||
| 2627 | nmdc:mga0n895_736325_c1 | |||
| 2628 | nmdc:mga0n895_94422_c1 | |||
| 2629 | nmdc:mga0rr50_1104_c1 | |||
| 2630 | nmdc:mga0rr50_12626_c1 | |||
| 2631 | nmdc:mga0rr50_2852_c1 | |||
| 2632 | nmdc:mga0rr50_436527_c1 | |||
| 2633 | nmdc:mga08x19_142283_c1 | |||
| 2634 | nmdc:mga08x19_19984_c1 | |||
| 2635 | nmdc:mga08x19_24515_c1 | |||
| 2636 | nmdc:mga08x19_343034_c1 | |||
| 2637 | nmdc:mga08x19_63446_c1 | |||
| 2638 | nmdc:mga0a205_112190_c1 | |||
| 2639 | nmdc:mga0a205_277764_c1 | |||
| 2640 | nmdc:mga0a205_515_c1 | |||
| 2641 | nmdc:mga0a205_9751_c1 | |||
| 2642 | Ga0495601_0014598 | |||
| 2643 | Ga0495601_0076650 | |||
| 2644 | Ga0495601_0087702 | |||
| 2645 | Ga0495612_0011591 | |||
| 2646 | Ga0495612_0106127 | |||
| 2647 | Ga0495655_0023757 | |||
| 2648 | Ga0495595_0023425 | |||
| 2649 | Ga0495595_0023655 | |||
| 2650 | Ga0495595_0136298 | |||
| 2651 | Ga0495619_0001634 | |||
| 2652 | Ga0495619_0001785 | |||
| 2653 | Ga0495619_0026394 | |||
| 2654 | Ga0495619_0047443 | |||
| 2655 | Ga0495619_0143491 | |||
| 2656 | Ga0495619_0412282 | |||
| 2657 | Ga0501084_0058435 | |||
| 2658 | Ga0501084_0083864 | |||
| 2659 | Ga0501084_0193152 | |||
| 2660 | Ga0590071_039404 | |||
| 2661 | Ga0587080_026740 | |||
| 2662 | Ga0587069_030973 | |||
| 2663 | Ga0501082_0022132 | |||
| 2664 | Ga0501082_0119272 | |||
| 2665 | Ga0501082_0358301 | |||
| 2666 | Ga0466962_0001433 | |||
| 2667 | Ga0466962_0004216 | |||
| 2668 | Ga0466962_0004975 | |||
| 2669 | Ga0466962_0023407 | |||
| 2670 | Ga0466962_0062581 | |||
| 2671 | Ga0530510_0024738 | |||
| 2672 | Ga0530510_0026118 | |||
| 2673 | Ga0530510_0031504 | |||
| 2674 | Ga0530510_0287929 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f6e-assembly1.cif.gz_B | crystal structure of the k182r, a183p mutant manganese superoxide dismutase from sacchromyces cerevisiae | 0.9177 | 34 | 224 |
| 3lsu-assembly1.cif.gz_B | crystal structure of sod2 from saccharomyces cerevisiae | 0.9171 | 34 | 224 |
| 4e4e-assembly1.cif.gz_A | crystal structure of the y34f mutant of saccharomyces cerevisiae manganese superoxide dismutase | 0.916 | 34 | 225 |
| 1b06-assembly1.cif.gz_A | superoxide dismutase from sulfolobus acidocaldarius | 0.9006 | 31 | 225 |
| 1var-assembly1.cif.gz_A | mitochondrial manganese superoxide dismutase variant with ile 58 replaced by thr | 0.899 | 34 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P41980_114_231_3.55.40.20 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.9009 | 121 | 224 | 3.55.40.20 |
| af_I1LCI3_113_243_3.55.40.20 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.8923 | 116 | 225 | 3.55.40.20 |
| af_Q5VRL3_214_359_3.55.40.20 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.8917 | 118 | 226 | 3.55.40.20 |
| 1xuqA02 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.8899 | 118 | 224 | 3.55.40.20 |
| af_B6TW42_23_136_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8782 | 55 | 104 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0SYJ9-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.952 | 107 | 230 |
GO:0004784
GO:0046872 |
| AF-A0A7W0NJF7-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9446 | 30 | 230 |
GO:0004784
GO:0046872 |
| AF-A0A7W0SYJ9-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9446 | 107 | 230 |
GO:0004784
GO:0046872 |
| AF-A0A7V6DDK2-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9421 | 101 | 226 |
GO:0004784
GO:0046872 |
| AF-A0A2M7EKS5-F1-model_v4 | Manganese/iron superoxide dismutase C-terminal domain-containing protein | 0.9373 | 98 | 226 |
GO:0004784
GO:0005737 GO:0046872 |