F493129

General Info

Members Datasets Scaffolds Average Seq Length
1337 384 2674 206

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0224729|Ga0501031_0224729_19_639
Length 198
Sequence MATLAFNHEEIAPAELRPELLELDGISRATVEAHYKLYQGYVGKRNEILAKLKEIDASAANQVYSELRALKVDLTFAIGGVKNHELYFAHLGAARDLIERDFGSVSAWRQDLKATGMAGRGWAWTAYDWDEGRLFNYVGDAQNTFPVWNATALVALDVYEHAYFLDYQTDRGAYIDAFFANLDWAVINHWIARYGIPL

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
349 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 10.7
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 6.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0224729 3300049568 Bacteria 1222
2 JGI25407J50210_10000406 3300003373 Bacteria 8306
3 JGI25407J50210_10105595 3300003373 Unclassified 695
4 JGI25404J52841_10031131 3300003659 Bacteria 1141
5 Ga0058862_12804081 3300004803 Unclassified 682
6 Ga0070658_10007279 3300005327 Bacteria 8935
7 Ga0070658_10016442 3300005327 Bacteria 5921
8 Ga0070658_10018409 3300005327 Bacteria 5591
9 Ga0070658_10023899 3300005327 Bacteria 4902
10 Ga0070658_10045188 3300005327 Bacteria 3560
11 Ga0070658_10063796 3300005327 Bacteria 3004
12 Ga0070658_10330556 3300005327 Bacteria 1302
13 Ga0070683_100001807 3300005329 Bacteria 16677
14 Ga0070683_100025873 3300005329 Bacteria 5278
15 Ga0070683_100104075 3300005329 Bacteria 2675
16 Ga0070683_100109721 3300005329 Bacteria 2603
17 Ga0070683_100521542 3300005329 Bacteria 1135
18 Ga0070680_100005165 3300005336 Bacteria 9872
19 Ga0070680_100008385 3300005336 Bacteria 7913
20 Ga0070680_100031458 3300005336 Bacteria 4267
21 Ga0070680_100059865 3300005336 Bacteria 3117
22 Ga0070680_100070210 3300005336 Bacteria 2877
23 Ga0070680_100210639 3300005336 Bacteria 1640
24 Ga0070682_100006444 3300005337 Bacteria 6598
25 Ga0070682_100007437 3300005337 Bacteria 6178
26 Ga0070682_100036588 3300005337 Bacteria 3002
27 Ga0070682_100129219 3300005337 Bacteria 1707
28 Ga0070682_100212246 3300005337 Bacteria 1372
29 Ga0068868_100375920 3300005338 Bacteria 1222
30 Ga0068868_100433701 3300005338 Bacteria 1140
31 Ga0070660_100002597 3300005339 Bacteria 12396
32 Ga0070660_100033323 3300005339 Bacteria 3883
33 Ga0070660_100035531 3300005339 Bacteria 3772
34 Ga0070660_100036512 3300005339 Bacteria 3723
35 Ga0070660_100051709 3300005339 Bacteria 3165
36 Ga0070660_100255616 3300005339 Bacteria 1429
37 Ga0070660_100448203 3300005339 Bacteria 1070
38 Ga0070660_100890055 3300005339 Bacteria 750
39 Ga0070661_100060637 3300005344 Bacteria 2776
40 Ga0070661_100149095 3300005344 Bacteria 1767
41 Ga0070661_100198948 3300005344 Bacteria 1530
42 Ga0070661_100228848 3300005344 Bacteria 1428
43 Ga0070661_100485970 3300005344 Bacteria 987
44 Ga0070668_100055050 3300005347 Bacteria 3070
45 Ga0070669_100310707 3300005353 Unclassified 1270
46 Ga0070675_100510720 3300005354 Unclassified 1084
47 Ga0070671_100051385 3300005355 Bacteria 3428
48 Ga0070671_100412184 3300005355 Unclassified 1157
49 Ga0070674_100268265 3300005356 Bacteria 1348
50 Ga0070659_100004395 3300005366 Bacteria 10069
51 Ga0070659_100057680 3300005366 Bacteria 3062
52 Ga0070659_100099875 3300005366 Bacteria 2335
53 Ga0070659_100148398 3300005366 Bacteria 1912
54 Ga0070659_100261976 3300005366 Bacteria 1434
55 Ga0070667_100003479 3300005367 Bacteria 13421
56 Ga0070703_10060557 3300005406 Bacteria 1237
57 Ga0070703_10123623 3300005406 Bacteria 942
58 Ga0070709_10003722 3300005434 Bacteria 8190
59 Ga0070709_10050903 3300005434 Unclassified 2597
60 Ga0070709_10130578 3300005434 Bacteria 1714
61 Ga0070709_10158636 3300005434 Bacteria 1571
62 Ga0070714_100013517 3300005435 Bacteria 6543
63 Ga0070714_100037631 3300005435 Bacteria 4066
64 Ga0070714_100059600 3300005435 Bacteria 3273
65 Ga0070714_100070863 3300005435 Bacteria 3013
66 Ga0070714_100095864 3300005435 Bacteria 2606
67 Ga0070714_100124811 3300005435 Bacteria 2294
68 Ga0070714_100130895 3300005435 Bacteria 2242
69 Ga0070714_100136048 3300005435 Bacteria 2200
70 Ga0070714_100976224 3300005435 Bacteria 824
71 Ga0070714_101189961 3300005435 Bacteria 743
72 Ga0070713_100001998 3300005436 Bacteria 13163
73 Ga0070713_100265387 3300005436 Bacteria 1570
74 Ga0070713_100308905 3300005436 Bacteria 1458
75 Ga0070710_10005665 3300005437 Bacteria 5946
76 Ga0070710_10007312 3300005437 Bacteria 5342
77 Ga0070710_10016667 3300005437 Bacteria 3743
78 Ga0070711_100081482 3300005439 Bacteria 2306
79 Ga0070711_100112742 3300005439 Bacteria 1999
80 Ga0070711_100145863 3300005439 Bacteria 1780
81 Ga0070711_100423068 3300005439 Bacteria 1086
82 Ga0070705_100037024 3300005440 Bacteria 2749
83 Ga0070705_100059373 3300005440 Bacteria 2264
84 Ga0070705_100179007 3300005440 Bacteria 1434
85 Ga0070705_100224227 3300005440 Bacteria 1303
86 Ga0070705_100311543 3300005440 Unclassified 1132
87 Ga0070705_100405553 3300005440 Bacteria 1010
88 Ga0070700_100419500 3300005441 Bacteria 1011
89 Ga0070694_100295446 3300005444 Bacteria 1240
90 Ga0070694_100507401 3300005444 Bacteria 960
91 Ga0070708_100018186 3300005445 Bacteria 5880
92 Ga0070708_100245475 3300005445 Bacteria 1681
93 Ga0070708_100294937 3300005445 Bacteria 1527
94 Ga0070708_100321184 3300005445 Bacteria 1458
95 Ga0070708_101027438 3300005445 Unclassified 773
96 Ga0070678_100015863 3300005456 Bacteria 4800
97 Ga0070678_100114690 3300005456 Bacteria 2114
98 Ga0070678_100122116 3300005456 Bacteria 2056
99 Ga0070678_100601529 3300005456 Bacteria 982
100 Ga0070662_100003257 3300005457 Bacteria 10099
101 Ga0070681_10009902 3300005458 Bacteria 9392
102 Ga0070681_10041547 3300005458 Bacteria 4608
103 Ga0070681_10059950 3300005458 Bacteria 3784
104 Ga0070681_10067407 3300005458 Bacteria 3547
105 Ga0070681_10123713 3300005458 Bacteria 2519
106 Ga0070681_10132007 3300005458 Bacteria 2430
107 Ga0070681_10168988 3300005458 Bacteria 2109
108 Ga0070681_10206106 3300005458 Bacteria 1883
109 Ga0070681_10291291 3300005458 Bacteria 1542
110 Ga0070681_10310337 3300005458 Bacteria 1487
111 Ga0070681_10606948 3300005458 Unclassified 1009
112 Ga0070681_10771992 3300005458 Unclassified 878
113 Ga0070706_100008962 3300005467 Bacteria 9318
114 Ga0070706_100059607 3300005467 Bacteria 3523
115 Ga0070706_100062103 3300005467 Bacteria 3451
116 Ga0070706_100125776 3300005467 Unclassified 2390
117 Ga0070706_100126808 3300005467 Unclassified 2380
118 Ga0070706_100618664 3300005467 Bacteria 1006
119 Ga0070707_100046410 3300005468 Bacteria 4158
120 Ga0070707_100161113 3300005468 Bacteria 2186
121 Ga0070707_100335246 3300005468 Unclassified 1469
122 Ga0070707_100648225 3300005468 Bacteria 1019
123 Ga0070698_100005322 3300005471 Bacteria 14087
124 Ga0070698_100014780 3300005471 Bacteria 8249
125 Ga0070698_100080180 3300005471 Bacteria 3259
126 Ga0070698_100135529 3300005471 Bacteria 2416
127 Ga0070698_100162960 3300005471 Bacteria 2173
128 Ga0070698_100268237 3300005471 Bacteria 1638
129 Ga0070699_100042022 3300005518 Bacteria 3955
130 Ga0070699_100137129 3300005518 Bacteria 2159
131 Ga0070699_100396932 3300005518 Unclassified 1247
132 Ga0070699_100948073 3300005518 Bacteria 789
133 Ga0070679_100004066 3300005530 Bacteria 13481
134 Ga0070679_100025803 3300005530 Bacteria 5766
135 Ga0070679_100027640 3300005530 Bacteria 5584
136 Ga0070679_100028850 3300005530 Bacteria 5473
137 Ga0070679_100037951 3300005530 Bacteria 4787
138 Ga0070679_100050658 3300005530 Bacteria 4136
139 Ga0070679_100110933 3300005530 Bacteria 2729
140 Ga0070679_100151713 3300005530 Bacteria 2294
141 Ga0070679_100177502 3300005530 Bacteria 2103
142 Ga0070679_100207108 3300005530 Bacteria 1925
143 Ga0070679_100233019 3300005530 Unclassified 1801
144 Ga0070679_100331490 3300005530 Bacteria 1470
145 Ga0070679_100431677 3300005530 Bacteria 1262
146 Ga0070679_101015164 3300005530 Unclassified 774
147 Ga0070679_101114931 3300005530 Unclassified 734
148 Ga0070684_100023906 3300005535 Bacteria 5120
149 Ga0070684_100242871 3300005535 Bacteria 1645
150 Ga0070684_100635944 3300005535 Bacteria 993
151 Ga0070684_101504183 3300005535 Bacteria 634
152 Ga0070697_100200390 3300005536 Bacteria 1697
153 Ga0070697_100203393 3300005536 Bacteria 1683
154 Ga0070697_100274780 3300005536 Bacteria 1445
155 Ga0070672_100685084 3300005543 Bacteria 897
156 Ga0070686_100136160 3300005544 Bacteria 1704
157 Ga0070686_100169653 3300005544 Bacteria 1542
158 Ga0070686_100205805 3300005544 Bacteria 1414
159 Ga0070695_100000072 3300005545 Bacteria 40551
160 Ga0070695_100076079 3300005545 Bacteria 2210
161 Ga0070696_100110647 3300005546 Bacteria 1978
162 Ga0070696_100209651 3300005546 Bacteria 1458
163 Ga0070696_100261439 3300005546 Bacteria 1313
164 Ga0070696_100371358 3300005546 Bacteria 1112
165 Ga0070696_100431632 3300005546 Bacteria 1036
166 Ga0070696_100626162 3300005546 Unclassified 870
167 Ga0070693_100015674 3300005547 Bacteria 3907
168 Ga0070693_100028442 3300005547 Bacteria 3039
169 Ga0070693_100455362 3300005547 Bacteria 899
170 Ga0070665_100035400 3300005548 Bacteria 5020
171 Ga0070665_100354567 3300005548 Bacteria 1473
172 Ga0070704_100468804 3300005549 Bacteria 1088
173 Ga0068855_100005085 3300005563 Bacteria 16033
174 Ga0068855_100019212 3300005563 Bacteria 8213
175 Ga0068855_100029823 3300005563 Bacteria 6522
176 Ga0068855_100038293 3300005563 Bacteria 5697
177 Ga0068855_100044913 3300005563 Bacteria 5227
178 Ga0068855_100048881 3300005563 Bacteria 4991
179 Ga0068855_100116002 3300005563 Bacteria 3069
180 Ga0068855_100257627 3300005563 Bacteria 1944
181 Ga0068855_100561612 3300005563 Bacteria 1234
182 Ga0068855_100823065 3300005563 Bacteria 985
183 Ga0068855_101455644 3300005563 Unclassified 704
184 Ga0068855_101517828 3300005563 Bacteria 687
185 Ga0068857_100063397 3300005577 Bacteria 3285
186 Ga0068857_100269379 3300005577 Bacteria 1565
187 Ga0068857_100496676 3300005577 Bacteria 1145
188 Ga0068857_100562920 3300005577 Bacteria 1075
189 Ga0068856_100047359 3300005614 Bacteria 4234
190 Ga0068856_100173859 3300005614 Bacteria 2166
191 Ga0068856_100263364 3300005614 Bacteria 1739
192 Ga0068856_100311608 3300005614 Bacteria 1591
193 Ga0068856_100350708 3300005614 Bacteria 1494
194 Ga0068856_100469047 3300005614 Bacteria 1280
195 Ga0068856_100494864 3300005614 Bacteria 1243
196 Ga0068856_100807316 3300005614 Unclassified 958
197 Ga0068856_100923255 3300005614 Bacteria 892
198 Ga0068852_100013931 3300005616 Bacteria 6167
199 Ga0068852_100064432 3300005616 Bacteria 3194
200 Ga0068852_100093137 3300005616 Bacteria 2700
201 Ga0068852_100575629 3300005616 Bacteria 1128
202 Ga0068864_100249667 3300005618 Bacteria 1647
203 Ga0068866_10136692 3300005718 Bacteria 1402
204 Ga0068861_100207059 3300005719 Bacteria 1650
205 Ga0068870_10158781 3300005840 Bacteria 1339
206 Ga0068870_10412388 3300005840 Unclassified 882
207 Ga0068863_100691113 3300005841 Unclassified 1014
208 Ga0068858_100115993 3300005842 Bacteria 2503
209 Ga0068860_100249481 3300005843 Bacteria 1728
210 Ga0081455_10010130 3300005937 Bacteria 9604
211 Ga0081455_10011947 3300005937 Bacteria 8690
212 Ga0081455_10013084 3300005937 Bacteria 8225
213 Ga0081455_10154163 3300005937 Bacteria 1768
214 Ga0081455_10404193 3300005937 Bacteria 947
215 Ga0081538_10000608 3300005981 Bacteria 39645
216 Ga0081538_10003497 3300005981 Bacteria 14811
217 Ga0081538_10024849 3300005981 Bacteria 4251
218 Ga0081538_10061893 3300005981 Bacteria 2139
219 Ga0081538_10063468 3300005981 Bacteria 2097
220 Ga0081538_10075587 3300005981 Bacteria 1827
221 Ga0081538_10076907 3300005981 Unclassified 1801
222 Ga0081540_1002169 3300005983 Bacteria 16260
223 Ga0081539_10000249 3300005985 Bacteria 125691
224 Ga0081539_10006242 3300005985 Bacteria 11540
225 Ga0081539_10106973 3300005985 Bacteria 1415
226 Ga0081539_10170466 3300005985 Bacteria 1030
227 Ga0070717_10015238 3300006028 Bacteria 5932
228 Ga0070717_10024925 3300006028 Bacteria 4753
229 Ga0070717_10060212 3300006028 Bacteria 3144
230 Ga0070717_10088702 3300006028 Bacteria 2607
231 Ga0070717_10151533 3300006028 Bacteria 2006
232 Ga0075365_10032892 3300006038 Bacteria 3337
233 Ga0075364_10068432 3300006051 Bacteria 2335
234 Ga0070715_10000369 3300006163 Bacteria 11279
235 Ga0070715_10008347 3300006163 Bacteria 3606
236 Ga0070715_10014448 3300006163 Bacteria 2925
237 Ga0070715_10070538 3300006163 Bacteria 1560
238 Ga0070716_100009180 3300006173 Bacteria 4924
239 Ga0070716_100043141 3300006173 Bacteria 2520
240 Ga0070716_100406159 3300006173 Bacteria 981
241 Ga0070712_100008944 3300006175 Bacteria 6307
242 Ga0070712_100025190 3300006175 Bacteria 3952
243 Ga0070712_100046410 3300006175 Bacteria 3003
244 Ga0070712_100254314 3300006175 Bacteria 1405
245 Ga0070712_100345159 3300006175 Bacteria 1217
246 Ga0070712_100689822 3300006175 Bacteria 870
247 Ga0075362_10042301 3300006177 Bacteria 2013
248 Ga0097621_100137043 3300006237 Bacteria 2088
249 Ga0097621_100316811 3300006237 Bacteria 1381
250 Ga0097621_100847822 3300006237 Bacteria 849
251 Ga0068871_100021730 3300006358 Bacteria 4938
252 Ga0068871_100230124 3300006358 Bacteria 1609
253 Ga0075431_100158475 3300006847 Bacteria 2328
254 Ga0075431_100467628 3300006847 Unclassified 1255
255 Ga0075433_10001077 3300006852 Bacteria 19642
256 Ga0075433_10014274 3300006852 Bacteria 6488
257 Ga0075433_10315344 3300006852 Bacteria 1384
258 Ga0075433_10372783 3300006852 Bacteria 1260
259 Ga0075434_100001096 3300006871 Bacteria 22184
260 Ga0075434_100006796 3300006871 Bacteria 10520
261 Ga0075434_100039502 3300006871 Bacteria 4676
262 Ga0075434_100132935 3300006871 Bacteria 2508
263 Ga0075434_100241490 3300006871 Bacteria 1826
264 Ga0075434_100400865 3300006871 Bacteria 1393
265 Ga0075434_100752016 3300006871 Bacteria 992
266 Ga0068865_100215942 3300006881 Bacteria 1497
267 Ga0068865_100513825 3300006881 Bacteria 1001
268 Ga0075436_100031886 3300006914 Bacteria 3631
269 Ga0075436_100110031 3300006914 Bacteria 1922
270 Ga0075436_100136574 3300006914 Bacteria 1722
271 Ga0075436_100363286 3300006914 Bacteria 1045
272 Ga0075435_100005919 3300007076 Bacteria 8605
273 Ga0075435_100031675 3300007076 Bacteria 4168
274 Ga0075435_100035768 3300007076 Bacteria 3942
275 Ga0075435_100151557 3300007076 Bacteria 1949
276 Ga0105251_10154493 3300009011 Bacteria 1035
277 Ga0105240_10004954 3300009093 Bacteria 20027
278 Ga0105240_10036261 3300009093 Bacteria 6346
279 Ga0105240_10038819 3300009093 Bacteria 6104
280 Ga0105240_10054046 3300009093 Bacteria 5035
281 Ga0105245_10019791 3300009098 Bacteria 5900
282 Ga0105245_10041003 3300009098 Bacteria 4126
283 Ga0105245_10090363 3300009098 Bacteria 2816
284 Ga0105245_10145871 3300009098 Bacteria 2233
285 Ga0105245_10442054 3300009098 Bacteria 1307
286 Ga0105245_10459503 3300009098 Bacteria 1283
287 Ga0105247_10041288 3300009101 Bacteria 2823
288 Ga0114129_10005843 3300009147 Bacteria 17425
289 Ga0114129_10185248 3300009147 Bacteria 2830
290 Ga0114129_10419545 3300009147 Bacteria 1760
291 Ga0105243_10062609 3300009148 Bacteria 2979
292 Ga0105243_10097129 3300009148 Bacteria 2438
293 Ga0105243_10134430 3300009148 Unclassified 2102
294 Ga0105241_10051884 3300009174 Bacteria 3129
295 Ga0105241_10270638 3300009174 Bacteria 1447
296 Ga0105242_10149150 3300009176 Bacteria 2038
297 Ga0105248_10107475 3300009177 Bacteria 3146
298 Ga0105237_10010187 3300009545 Bacteria 10016
299 Ga0105237_10268530 3300009545 Bacteria 1709
300 Ga0105238_10019187 3300009551 Bacteria 6967
301 Ga0105238_10234776 3300009551 Bacteria 1811
302 Ga0105238_10265336 3300009551 Bacteria 1697
303 Ga0105238_10558409 3300009551 Bacteria 1150
304 Ga0105238_10767160 3300009551 Bacteria 979
305 Ga0105249_10002534 3300009553 Bacteria 15805
306 Ga0105249_10468208 3300009553 Bacteria 1301
307 Ga0105249_10939691 3300009553 Bacteria 932
308 Ga0105239_10011104 3300010375 Bacteria 10051
309 Ga0105239_10021787 3300010375 Bacteria 7064
310 Ga0105239_11104296 3300010375 Bacteria 913
311 Ga0105246_10094003 3300011119 Bacteria 2167
312 Ga0105246_10221038 3300011119 Bacteria 1485
313 Ga0157339_1002406 3300012505 Bacteria 1261
314 Ga0157373_10025244 3300013100 Bacteria 4300
315 Ga0157373_10216385 3300013100 Bacteria 1351
316 Ga0157373_10356313 3300013100 Bacteria 1044
317 Ga0157371_10073516 3300013102 Bacteria 2421
318 Ga0157371_10309312 3300013102 Bacteria 1145
319 Ga0157370_10011897 3300013104 Bacteria 9077
320 Ga0157370_10018188 3300013104 Bacteria 7073
321 Ga0157370_10029004 3300013104 Bacteria 5437
322 Ga0157370_10032773 3300013104 Bacteria 5072
323 Ga0157370_10060710 3300013104 Bacteria 3588
324 Ga0157370_10079311 3300013104 Bacteria 3092
325 Ga0157370_10098873 3300013104 Bacteria 2735
326 Ga0157370_10563386 3300013104 Bacteria 1044
327 Ga0157369_10005681 3300013105 Bacteria 14493
328 Ga0157369_10007107 3300013105 Bacteria 12909
329 Ga0157369_10030256 3300013105 Bacteria 5973
330 Ga0157369_10039970 3300013105 Bacteria 5124
331 Ga0157369_10048742 3300013105 Bacteria 4596
332 Ga0157369_10205096 3300013105 Bacteria 2068
333 Ga0157369_10274977 3300013105 Bacteria 1754
334 Ga0157369_10284826 3300013105 Bacteria 1721
335 Ga0157369_10405539 3300013105 Bacteria 1414
336 Ga0157369_11329741 3300013105 Bacteria 732
337 Ga0157374_10077371 3300013296 Bacteria 3148
338 Ga0157374_10192836 3300013296 Bacteria 1993
339 Ga0157374_10736866 3300013296 Bacteria 1000
340 Ga0163162_10055567 3300013306 Bacteria 3987
341 Ga0163162_10591805 3300013306 Bacteria 1236
342 Ga0157372_10121400 3300013307 Bacteria 3002
343 Ga0157372_10192805 3300013307 Bacteria 2360
344 Ga0157372_10224415 3300013307 Bacteria 2178
345 Ga0157372_10290175 3300013307 Bacteria 1903
346 Ga0157372_10356989 3300013307 Bacteria 1703
347 Ga0157372_10369272 3300013307 Bacteria 1672
348 Ga0157372_10784022 3300013307 Bacteria 1108
349 Ga0157372_11137461 3300013307 Bacteria 903
350 Ga0157372_11878525 3300013307 Bacteria 688
351 Ga0157375_10099964 3300013308 Bacteria 2980
352 Ga0157375_10299788 3300013308 Unclassified 1771
353 Ga0163163_10030599 3300014325 Bacteria 5188
354 Ga0157380_10129375 3300014326 Bacteria 2151
355 Ga0182008_10002853 3300014497 Bacteria 10702
356 Ga0182008_10017072 3300014497 Bacteria 3767
357 Ga0157377_10407124 3300014745 Bacteria 928
358 Ga0157376_10036990 3300014969 Bacteria 3958
359 Ga0157376_10066985 3300014969 Bacteria 3036
360 Ga0182006_1020291 3300015261 Bacteria 2785
361 Ga0182006_1077392 3300015261 Bacteria 1220
362 Ga0182005_1041905 3300015265 Bacteria 1245
363 Ga0182005_1124175 3300015265 Bacteria 737
364 Ga0163161_10008801 3300017792 Bacteria 6978
365 Ga0197907_10190807 3300020069 Unclassified 1712
366 Ga0197907_10345131 3300020069 Bacteria 2267
367 Ga0206356_10418251 3300020070 Bacteria 2386
368 Ga0206356_10567364 3300020070 Bacteria 1436
369 Ga0206356_11120154 3300020070 Unclassified 691
370 Ga0206356_11870338 3300020070 Unclassified 1605
371 Ga0206355_1177548 3300020076 Bacteria 949
372 Ga0206355_1576338 3300020076 Bacteria 1372
373 Ga0206351_10051768 3300020077 Bacteria 778
374 Ga0206351_10105922 3300020077 Bacteria 2414
375 Ga0206350_10058088 3300020080 Bacteria 869
376 Ga0206350_10991345 3300020080 Bacteria 1610
377 Ga0206354_10891471 3300020081 Bacteria 1417
378 Ga0206354_11040985 3300020081 Bacteria 5311
379 Ga0206353_10141117 3300020082 Bacteria 4174
380 Ga0206353_10237848 3300020082 Bacteria 1995
381 Ga0206353_10758799 3300020082 Bacteria 6368
382 Ga0206353_11116827 3300020082 Bacteria 5448
383 Ga0206353_11735253 3300020082 Unclassified 792
384 Ga0154015_1506938 3300020610 Bacteria 1274
385 Ga0213876_10023023 3300021384 Bacteria 3292
386 Ga0213871_10053915 3300021441 Bacteria 1108
387 Ga0224712_10041044 3300022467 Bacteria 1745
388 Ga0224712_10326882 3300022467 Bacteria 721
389 Ga0207653_10003996 3300025885 Bacteria 4639
390 Ga0207692_10122008 3300025898 Bacteria 1461
391 Ga0207642_10063024 3300025899 Bacteria 1732
392 Ga0207685_10017643 3300025905 Bacteria 2314
393 Ga0207685_10050254 3300025905 Bacteria 1606
394 Ga0207685_10101345 3300025905 Bacteria 1232
395 Ga0207685_10151808 3300025905 Bacteria 1049
396 Ga0207699_10033199 3300025906 Bacteria 2915
397 Ga0207699_10080059 3300025906 Bacteria 2023
398 Ga0207643_10095670 3300025908 Bacteria 1736
399 Ga0207705_10004374 3300025909 Bacteria 10682
400 Ga0207705_10008362 3300025909 Bacteria 7554
401 Ga0207705_10026222 3300025909 Bacteria 4158
402 Ga0207705_10052290 3300025909 Bacteria 2940
403 Ga0207705_10373070 3300025909 Bacteria 1102
404 Ga0207705_10676393 3300025909 Unclassified 802
405 Ga0207684_10078742 3300025910 Bacteria 2803
406 Ga0207684_10122725 3300025910 Bacteria 2228
407 Ga0207684_10272592 3300025910 Bacteria 1460
408 Ga0207684_10426771 3300025910 Bacteria 1139
409 Ga0207684_10753328 3300025910 Bacteria 825
410 Ga0207654_10185373 3300025911 Bacteria 1360
411 Ga0207654_10209629 3300025911 Bacteria 1287
412 Ga0207707_10009041 3300025912 Bacteria 8656
413 Ga0207707_10009936 3300025912 Bacteria 8251
414 Ga0207707_10033241 3300025912 Bacteria 4515
415 Ga0207707_10039214 3300025912 Bacteria 4141
416 Ga0207707_10047465 3300025912 Bacteria 3739
417 Ga0207707_10063976 3300025912 Bacteria 3201
418 Ga0207707_10068938 3300025912 Bacteria 3082
419 Ga0207707_10161192 3300025912 Bacteria 1961
420 Ga0207707_10177498 3300025912 Bacteria 1860
421 Ga0207707_10293791 3300025912 Bacteria 1406
422 Ga0207707_10294529 3300025912 Bacteria 1404
423 Ga0207707_10515954 3300025912 Bacteria 1018
424 Ga0207695_10027324 3300025913 Bacteria 6356
425 Ga0207695_10106193 3300025913 Bacteria 2794
426 Ga0207695_10238431 3300025913 Bacteria 1721
427 Ga0207671_10093594 3300025914 Bacteria 2267
428 Ga0207693_10000461 3300025915 Bacteria 37199
429 Ga0207693_10000702 3300025915 Bacteria 30049
430 Ga0207693_10008489 3300025915 Bacteria 8409
431 Ga0207693_10011291 3300025915 Bacteria 7232
432 Ga0207693_10016960 3300025915 Bacteria 5817
433 Ga0207693_10032098 3300025915 Bacteria 4146
434 Ga0207693_10127862 3300025915 Bacteria 1997
435 Ga0207693_10207424 3300025915 Bacteria 1541
436 Ga0207693_10222606 3300025915 Bacteria 1482
437 Ga0207693_10312327 3300025915 Bacteria 1231
438 Ga0207693_10575375 3300025915 Bacteria 878
439 Ga0207693_10747578 3300025915 Unclassified 756
440 Ga0207663_10052554 3300025916 Bacteria 2542
441 Ga0207663_10075199 3300025916 Bacteria 2191
442 Ga0207663_10251632 3300025916 Bacteria 1301
443 Ga0207660_10014233 3300025917 Bacteria 5226
444 Ga0207660_10028841 3300025917 Bacteria 3801
445 Ga0207660_10066020 3300025917 Bacteria 2616
446 Ga0207660_10167138 3300025917 Bacteria 1701
447 Ga0207660_10494391 3300025917 Bacteria 992
448 Ga0207657_10002868 3300025919 Bacteria 18530
449 Ga0207657_10003083 3300025919 Bacteria 17829
450 Ga0207657_10005015 3300025919 Bacteria 13899
451 Ga0207657_10008807 3300025919 Bacteria 10208
452 Ga0207657_10014143 3300025919 Bacteria 7807
453 Ga0207657_10063292 3300025919 Bacteria 3163
454 Ga0207657_10140443 3300025919 Bacteria 1974
455 Ga0207657_10400515 3300025919 Bacteria 1079
456 Ga0207649_10053356 3300025920 Bacteria 2512
457 Ga0207649_10099768 3300025920 Bacteria 1919
458 Ga0207649_10119401 3300025920 Bacteria 1775
459 Ga0207649_10181027 3300025920 Bacteria 1475
460 Ga0207649_10284467 3300025920 Bacteria 1203
461 Ga0207652_10008595 3300025921 Bacteria 8217
462 Ga0207652_10026326 3300025921 Bacteria 4843
463 Ga0207652_10026918 3300025921 Bacteria 4792
464 Ga0207652_10030274 3300025921 Bacteria 4531
465 Ga0207652_10030667 3300025921 Bacteria 4505
466 Ga0207652_10030742 3300025921 Bacteria 4500
467 Ga0207652_10052565 3300025921 Bacteria 3497
468 Ga0207652_10086696 3300025921 Bacteria 2745
469 Ga0207652_10348095 3300025921 Bacteria 1337
470 Ga0207652_10556198 3300025921 Bacteria 1031
471 Ga0207646_10078163 3300025922 Bacteria 2957
472 Ga0207646_10110025 3300025922 Bacteria 2472
473 Ga0207646_10883508 3300025922 Unclassified 793
474 Ga0207694_10158109 3300025924 Bacteria 1829
475 Ga0207694_10185525 3300025924 Bacteria 1688
476 Ga0207694_10266024 3300025924 Bacteria 1406
477 Ga0207694_10334248 3300025924 Bacteria 1252
478 Ga0207694_10787324 3300025924 Bacteria 803
479 Ga0207687_10096274 3300025927 Bacteria 2169
480 Ga0207687_10142997 3300025927 Bacteria 1817
481 Ga0207687_10175149 3300025927 Bacteria 1658
482 Ga0207700_10000001 3300025928 Bacteria 1122509
483 Ga0207700_10030373 3300025928 Bacteria 3826
484 Ga0207700_10167035 3300025928 Bacteria 1832
485 Ga0207700_10303550 3300025928 Bacteria 1379
486 Ga0207700_10713367 3300025928 Bacteria 895
487 Ga0207664_10008730 3300025929 Bacteria 7085
488 Ga0207664_10042035 3300025929 Bacteria 3565
489 Ga0207664_10061003 3300025929 Bacteria 3007
490 Ga0207664_10065134 3300025929 Bacteria 2917
491 Ga0207664_10066266 3300025929 Bacteria 2894
492 Ga0207664_10067844 3300025929 Bacteria 2863
493 Ga0207664_10079940 3300025929 Bacteria 2656
494 Ga0207664_10298402 3300025929 Bacteria 1417
495 Ga0207644_10627433 3300025931 Bacteria 893
496 Ga0207644_10669034 3300025931 Bacteria 865
497 Ga0207690_10018829 3300025932 Bacteria 4240
498 Ga0207690_10197890 3300025932 Bacteria 1524
499 Ga0207690_11075618 3300025932 Bacteria 670
500 Ga0207706_10007121 3300025933 Bacteria 10353
501 Ga0207706_10015927 3300025933 Bacteria 6793
502 Ga0207686_10159011 3300025934 Bacteria 1582
503 Ga0207686_10521099 3300025934 Bacteria 925
504 Ga0207686_10743127 3300025934 Bacteria 783
505 Ga0207709_10265412 3300025935 Bacteria 1261
506 Ga0207669_10593441 3300025937 Bacteria 899
507 Ga0207704_10134375 3300025938 Bacteria 1719
508 Ga0207704_10203795 3300025938 Bacteria 1450
509 Ga0207704_10467756 3300025938 Bacteria 1010
510 Ga0207665_10000146 3300025939 Bacteria 47929
511 Ga0207665_10021141 3300025939 Bacteria 4277
512 Ga0207665_10049684 3300025939 Bacteria 2819
513 Ga0207665_10119006 3300025939 Bacteria 1864
514 Ga0207689_10171619 3300025942 Bacteria 1788
515 Ga0207661_10015658 3300025944 Bacteria 5587
516 Ga0207661_10018237 3300025944 Bacteria 5212
517 Ga0207661_10046700 3300025944 Bacteria 3434
518 Ga0207661_10095601 3300025944 Bacteria 2484
519 Ga0207661_10139938 3300025944 Bacteria 2082
520 Ga0207661_10786084 3300025944 Bacteria 876
521 Ga0207667_10023766 3300025949 Bacteria 6745
522 Ga0207667_10042931 3300025949 Bacteria 4801
523 Ga0207667_10049080 3300025949 Bacteria 4460
524 Ga0207667_10063696 3300025949 Bacteria 3852
525 Ga0207667_10094646 3300025949 Bacteria 3084
526 Ga0207667_10112308 3300025949 Bacteria 2810
527 Ga0207667_10163545 3300025949 Bacteria 2288
528 Ga0207667_10284003 3300025949 Bacteria 1691
529 Ga0207667_10308824 3300025949 Bacteria 1615
530 Ga0207667_10486804 3300025949 Bacteria 1252
531 Ga0207651_10194042 3300025960 Bacteria 1622
532 Ga0207712_10076970 3300025961 Bacteria 2417
533 Ga0207640_10581670 3300025981 Bacteria 945
534 Ga0207658_10014093 3300025986 Bacteria 5475
535 Ga0207677_10119414 3300026023 Bacteria 1980
536 Ga0207677_10129902 3300026023 Bacteria 1911
537 Ga0207677_10479382 3300026023 Bacteria 1071
538 Ga0207677_10630034 3300026023 Unclassified 944
539 Ga0207703_10206964 3300026035 Bacteria 1747
540 Ga0207639_11082502 3300026041 Bacteria 751
541 Ga0207678_10489210 3300026067 Bacteria 1072
542 Ga0207678_10555866 3300026067 Bacteria 1004
543 Ga0207708_10113974 3300026075 Bacteria 2101
544 Ga0207702_10245026 3300026078 Bacteria 1681
545 Ga0207702_10433490 3300026078 Bacteria 1273
546 Ga0207702_10456585 3300026078 Bacteria 1240
547 Ga0207702_10475285 3300026078 Bacteria 1216
548 Ga0207648_10088051 3300026089 Bacteria 2711
549 Ga0207676_11117201 3300026095 Bacteria 779
550 Ga0207674_10019053 3300026116 Bacteria 7437
551 Ga0207674_10043887 3300026116 Bacteria 4608
552 Ga0207674_10087770 3300026116 Bacteria 3104
553 Ga0207674_10170622 3300026116 Bacteria 2129
554 Ga0207674_10578081 3300026116 Bacteria 1085
555 Ga0207675_100006643 3300026118 Bacteria 10939
556 Ga0207675_100187622 3300026118 Bacteria 1982
557 Ga0207683_10012401 3300026121 Bacteria 7273
558 Ga0207683_10014743 3300026121 Bacteria 6654
559 Ga0207683_10545586 3300026121 Bacteria 1072
560 Ga0207683_10750272 3300026121 Bacteria 905
561 Ga0207698_10051628 3300026142 Bacteria 3145
562 Ga0207698_10180109 3300026142 Bacteria 1871
563 Ga0207698_10442539 3300026142 Bacteria 1252
564 Ga0207428_10095826 3300027907 Bacteria 2299
565 Ga0268266_10304158 3300028379 Bacteria 1488
566 Ga0268265_10329218 3300028380 Bacteria 1387
567 Ga0265326_10097812 3300028558 Unclassified 832
568 Ga0265319_1001275 3300028563 Bacteria 15284
569 Ga0265319_1005524 3300028563 Bacteria 6041
570 Ga0265319_1031145 3300028563 Bacteria 1859
571 Ga0265319_1040736 3300028563 Bacteria 1570
572 Ga0265334_10000542 3300028573 Bacteria 19259
573 Ga0265334_10008317 3300028573 Bacteria 4414
574 Ga0265318_10000276 3300028577 Bacteria 43159
575 Ga0265318_10015788 3300028577 Bacteria 3132
576 Ga0265318_10076336 3300028577 Bacteria 1239
577 Ga0265323_10024468 3300028653 Bacteria 2295
578 Ga0265322_10024396 3300028654 Bacteria 1729
579 Ga0265336_10047508 3300028666 Unclassified 1303
580 Ga0265338_10017462 3300028800 Bacteria 7730
581 Ga0265338_10024846 3300028800 Bacteria 6105
582 Ga0265338_10055972 3300028800 Bacteria 3503
583 Ga0265338_10122790 3300028800 Unclassified 2066
584 Ga0265338_10170725 3300028800 Bacteria 1668
585 Ga0265324_10013644 3300029957 Bacteria 3025
586 Ga0265324_10145453 3300029957 Unclassified 805
587 Ga0265330_10000888 3300031235 Bacteria 18608
588 Ga0265330_10011338 3300031235 Bacteria 4183
589 Ga0265332_10012350 3300031238 Bacteria 3790
590 Ga0265328_10001224 3300031239 Bacteria 11887
591 Ga0265320_10035999 3300031240 Bacteria 2505
592 Ga0265320_10101522 3300031240 Bacteria 1324
593 Ga0265325_10001745 3300031241 Bacteria 15083
594 Ga0265325_10071493 3300031241 Bacteria 1741
595 Ga0265325_10082195 3300031241 Bacteria 1599
596 Ga0265329_10029686 3300031242 Unclassified 1785
597 Ga0265340_10001237 3300031247 Bacteria 14637
598 Ga0265340_10046610 3300031247 Bacteria 2114
599 Ga0265340_10208973 3300031247 Unclassified 876
600 Ga0265339_10042865 3300031249 Bacteria 2504
601 Ga0265331_10000959 3300031250 Bacteria 22955
602 Ga0265331_10021613 3300031250 Bacteria 3291
603 Ga0265331_10200273 3300031250 Bacteria 900
604 Ga0265327_10012224 3300031251 Bacteria 5819
605 Ga0265327_10069980 3300031251 Unclassified 1759
606 Ga0265316_10002153 3300031344 Bacteria 20707
607 Ga0265316_10024056 3300031344 Bacteria 5113
608 Ga0265316_10289811 3300031344 Bacteria 1194
609 Ga0307408_100063581 3300031548 Bacteria 2700
610 Ga0307408_100334019 3300031548 Bacteria 1281
611 Ga0265313_10002758 3300031595 Bacteria 14812
612 Ga0265313_10058544 3300031595 Bacteria 1815
613 Ga0265313_10115907 3300031595 Bacteria 1173
614 Ga0265314_10018097 3300031711 Bacteria 5507
615 Ga0265314_10027632 3300031711 Bacteria 4246
616 Ga0265342_10011564 3300031712 Bacteria 6030
617 Ga0265342_10152463 3300031712 Bacteria 1282
618 Ga0307405_10044112 3300031731 Bacteria 2725
619 Ga0307410_10009172 3300031852 Bacteria 5535
620 Ga0307406_10158612 3300031901 Unclassified 1623
621 Ga0307406_10270158 3300031901 Unclassified 1291
622 Ga0307407_10073184 3300031903 Bacteria 2046
623 Ga0307412_10036218 3300031911 Bacteria 3159
624 Ga0307412_10605937 3300031911 Bacteria 928
625 Ga0307409_100004736 3300031995 Bacteria 7704
626 Ga0307416_100025483 3300032002 Bacteria 4335
627 Ga0307416_100059067 3300032002 Bacteria 3114
628 Ga0307416_100093554 3300032002 Bacteria 2590
629 Ga0307416_100119644 3300032002 Bacteria 2343
630 Ga0307411_10005329 3300032005 Bacteria 6300
631 Ga0307415_100001447 3300032126 Bacteria 11375
632 Ga0307415_100021574 3300032126 Bacteria 3962
633 Ga0307415_100121329 3300032126 Unclassified 1960
634 Ga0307415_100496769 3300032126 Bacteria 1066
635 Ga0373948_0006809 3300034817 Unclassified 1903
636 Ga0373959_0049596 3300034820 Bacteria 903
637 Ga0373926_0025609 3300035083 Bacteria 2060
638 Ga0373926_0040375 3300035083 Bacteria 1665
639 Ga0373926_0057815 3300035083 Unclassified 1409
640 Ga0373928_0005155 3300035084 Bacteria 2494
641 Ga0373929_0005100 3300035085 Bacteria 2361
642 Ga0373929_0018931 3300035085 Bacteria 1373
643 Ga0373944_0009624 3300035089 Bacteria 2624
644 Ga0373944_0081566 3300035089 Bacteria 1069
645 Ga0373949_0021962 3300035090 Bacteria 1468
646 Ga0373932_0002679 3300035112 Bacteria 4433
647 Ga0373936_0049871 3300035113 Bacteria 1692
648 Ga0373936_0216551 3300035113 Bacteria 848
649 Ga0373939_0003023 3300035114 Bacteria 3949
650 Ga0373939_0043509 3300035114 Bacteria 1363
651 Ga0373941_0004411 3300035115 Bacteria 3251
652 Ga0373941_0019264 3300035115 Bacteria 1897
653 Ga0373945_0002294 3300035116 Bacteria 5986
654 Ga0373943_0000138 3300035170 Bacteria 27619
655 Ga0373943_0009977 3300035170 Bacteria 4257
656 Ga0373943_0026436 3300035170 Bacteria 2719
657 Ga0373946_0004089 3300035171 Bacteria 5200
658 Ga0373942_0010786 3300035207 Unclassified 2154
659 Ga0373962_0105163 3300035242 Bacteria 885
660 Ga0373931_0076962 3300035691 Bacteria 1833
661 Ga0373931_0254857 3300035691 Bacteria 1068
662 Ga0373935_0011408 3300035692 Bacteria 5335
663 Ga0373935_0230730 3300035692 Unclassified 1289
664 Ga0373927_0003815 3300035695 Bacteria 10696
665 Ga0373927_0026654 3300035695 Bacteria 3778
666 Ga0373947_0000341 3300035725 Bacteria 26341
667 Ga0373947_0001997 3300035725 Bacteria 12467
668 Ga0373947_0012643 3300035725 Bacteria 4840
669 Ga0373947_0098462 3300035725 Bacteria 1834
670 Ga0373937_0193520 3300036401 Bacteria 1911
671 Ga0373937_0295087 3300036401 Bacteria 1532
672 Ga0373925_0005884 3300037068 Bacteria 9089
673 Ga0373925_0013009 3300037068 Bacteria 6026
674 Ga0373925_0015551 3300037068 Bacteria 5505
675 Ga0373925_0058299 3300037068 Bacteria 2895
676 Ga0395899_0002546 3300037312 Bacteria 14762
677 Ga0395899_0005507 3300037312 Bacteria 9807
678 Ga0395899_0010299 3300037312 Bacteria 7168
679 Ga0395899_0013850 3300037312 Bacteria 6161
680 Ga0395899_0023030 3300037312 Bacteria 4720
681 Ga0395899_0033666 3300037312 Bacteria 3848
682 Ga0395899_0061130 3300037312 Bacteria 2774
683 Ga0395899_0090643 3300037312 Bacteria 2216
684 Ga0395899_0095253 3300037312 Bacteria 2153
685 Ga0395899_0098507 3300037312 Bacteria 2112
686 Ga0395899_0100614 3300037312 Bacteria 2087
687 Ga0395899_0103058 3300037312 Bacteria 2058
688 Ga0395899_0162991 3300037312 Bacteria 1574
689 Ga0395900_0004292 3300037418 Bacteria 15113
690 Ga0395900_0005329 3300037418 Bacteria 13477
691 Ga0395900_0007939 3300037418 Bacteria 10922
692 Ga0395900_0009570 3300037418 Bacteria 9934
693 Ga0395900_0009982 3300037418 Bacteria 9718
694 Ga0395900_0010097 3300037418 Bacteria 9657
695 Ga0395900_0041260 3300037418 Bacteria 4757
696 Ga0395900_0042835 3300037418 Bacteria 4664
697 Ga0395900_0065552 3300037418 Unclassified 3731
698 Ga0395900_0070152 3300037418 Bacteria 3602
699 Ga0395900_0087704 3300037418 Bacteria 3198
700 Ga0395900_0096441 3300037418 Bacteria 3038
701 Ga0395900_0108791 3300037418 Bacteria 2847
702 Ga0395900_0165659 3300037418 Bacteria 2252
703 Ga0395900_0181992 3300037418 Bacteria 2135
704 Ga0395900_0353226 3300037418 Unclassified 1443
705 Ga0395900_0396334 3300037418 Bacteria 1345
706 Ga0395900_0420102 3300037418 Bacteria 1298
707 Ga0395900_0466149 3300037418 Bacteria 1217
708 Ga0395900_0487187 3300037418 Unclassified 1185
709 Ga0395900_0633417 3300037418 Bacteria 1007
710 Ga0395900_0955006 3300037418 Bacteria 778
711 Ga0395898_0001631 3300037466 Bacteria 30388
712 Ga0395898_0002095 3300037466 Bacteria 24808
713 Ga0395898_0006255 3300037466 Bacteria 12739
714 Ga0395898_0006291 3300037466 Bacteria 12692
715 Ga0395898_0019037 3300037466 Bacteria 6990
716 Ga0395898_0023536 3300037466 Bacteria 6223
717 Ga0395898_0032301 3300037466 Bacteria 5224
718 Ga0395898_0032496 3300037466 Bacteria 5209
719 Ga0395898_0066573 3300037466 Bacteria 3489
720 Ga0395898_0108137 3300037466 Bacteria 2666
721 Ga0395898_0125916 3300037466 Bacteria 2454
722 Ga0395898_0155567 3300037466 Bacteria 2187
723 Ga0395898_0170507 3300037466 Unclassified 2080
724 Ga0395898_0179127 3300037466 Bacteria 2025
725 Ga0395898_0187122 3300037466 Bacteria 1979
726 Ga0395898_0289532 3300037466 Bacteria 1562
727 Ga0395898_0353186 3300037466 Bacteria 1402
728 Ga0395898_0391793 3300037466 Bacteria 1324
729 Ga0395898_0418877 3300037466 Bacteria 1276
730 Ga0395898_0509023 3300037466 Bacteria 1145
731 Ga0395898_0543911 3300037466 Bacteria 1103
732 Ga0395898_0590166 3300037466 Unclassified 1053
733 Ga0395905_0004797 3300037471 Bacteria 13962
734 Ga0395905_0004929 3300037471 Bacteria 13743
735 Ga0395905_0009450 3300037471 Bacteria 9528
736 Ga0395905_0010819 3300037471 Bacteria 8838
737 Ga0395905_0039716 3300037471 Bacteria 4415
738 Ga0395905_0046976 3300037471 Bacteria 4047
739 Ga0395905_0055930 3300037471 Bacteria 3693
740 Ga0395905_0065572 3300037471 Bacteria 3400
741 Ga0395905_0075743 3300037471 Bacteria 3153
742 Ga0395905_0087562 3300037471 Bacteria 2920
743 Ga0395905_0134619 3300037471 Bacteria 2324
744 Ga0395905_0170797 3300037471 Bacteria 2042
745 Ga0395905_0181290 3300037471 Bacteria 1977
746 Ga0395905_0301215 3300037471 Bacteria 1491
747 Ga0395905_0401169 3300037471 Bacteria 1266
748 Ga0395905_0628352 3300037471 Bacteria 976
749 Ga0395905_0669211 3300037471 Bacteria 940
750 Ga0395905_0684576 3300037471 Unclassified 928
751 Ga0395901_0000370 3300038443 Bacteria 54012
752 Ga0395901_0002781 3300038443 Bacteria 17641
753 Ga0395901_0007108 3300038443 Bacteria 11313
754 Ga0395901_0008638 3300038443 Bacteria 10290
755 Ga0395901_0008830 3300038443 Bacteria 10202
756 Ga0395901_0010224 3300038443 Bacteria 9505
757 Ga0395901_0015385 3300038443 Bacteria 7788
758 Ga0395901_0017424 3300038443 Bacteria 7333
759 Ga0395901_0021691 3300038443 Bacteria 6581
760 Ga0395901_0031941 3300038443 Bacteria 5430
761 Ga0395901_0043130 3300038443 Bacteria 4680
762 Ga0395901_0060529 3300038443 Bacteria 3940
763 Ga0395901_0085451 3300038443 Bacteria 3298
764 Ga0395901_0099551 3300038443 Bacteria 3048
765 Ga0395901_0123264 3300038443 Bacteria 2723
766 Ga0395901_0136253 3300038443 Bacteria 2580
767 Ga0395901_0172238 3300038443 Bacteria 2271
768 Ga0395901_0175044 3300038443 Bacteria 2251
769 Ga0395901_0190818 3300038443 Bacteria 2149
770 Ga0395901_0209330 3300038443 Unclassified 2042
771 Ga0395901_0279796 3300038443 Bacteria 1733
772 Ga0395901_0311270 3300038443 Bacteria 1631
773 Ga0395901_0473359 3300038443 Bacteria 1278
774 Ga0395901_0600070 3300038443 Bacteria 1110
775 Ga0395901_0679821 3300038443 Bacteria 1029
776 Ga0436365_0045703 3300039437 Bacteria 849
777 Ga0436365_0408949 3300039437 Bacteria 1085
778 Ga0436360_0331421 3300039438 Bacteria 2721
779 Ga0436363_0152649 3300039450 Bacteria 857
780 Ga0439453_0002584 3300041408 Unclassified 2513
781 Ga0451853_1962744 3300041512 Bacteria 922
782 Ga0451853_2140449 3300041512 Unclassified 862
783 Ga0439451_003932 3300042009 Bacteria 3021
784 Ga0439454_000703 3300042011 Bacteria 2838
785 Ga0450915_000315 3300042119 Bacteria 1610
786 Ga0439434_0021593 3300042435 Unclassified 1934
787 Ga0439464_0142132 3300042439 Bacteria 748
788 Ga0439460_0080028 3300042461 Bacteria 1024
789 Ga0466969_0001022 3300044656 Bacteria 15129
790 Ga0466965_0033821 3300044683 Bacteria 2499
791 Ga0466965_0137473 3300044683 Bacteria 1270
792 Ga0466965_0195053 3300044683 Bacteria 1072
793 Ga0466966_0012031 3300044684 Bacteria 5734
794 Ga0466966_0067725 3300044684 Bacteria 2242
795 Ga0466966_0180162 3300044684 Bacteria 1282
796 Ga0466966_0265413 3300044684 Bacteria 1033
797 Ga0466961_0001191 3300044693 Bacteria 16033
798 Ga0466961_0018390 3300044693 Bacteria 4494
799 Ga0466961_0074851 3300044693 Bacteria 2147
800 Ga0466961_0121201 3300044693 Bacteria 1642
801 Ga0466961_0132631 3300044693 Bacteria 1561
802 Ga0466961_0221409 3300044693 Bacteria 1166
803 Ga0466961_0416819 3300044693 Bacteria 814
804 Ga0466963_0000914 3300044694 Bacteria 15029
805 Ga0466963_0001196 3300044694 Bacteria 13665
806 Ga0466963_0001298 3300044694 Bacteria 13275
807 Ga0466963_0001427 3300044694 Bacteria 12874
808 Ga0466963_0002207 3300044694 Bacteria 10769
809 Ga0466963_0008622 3300044694 Bacteria 6120
810 Ga0466963_0017329 3300044694 Bacteria 4489
811 Ga0466963_0017933 3300044694 Bacteria 4417
812 Ga0466963_0025101 3300044694 Bacteria 3798
813 Ga0466963_0043425 3300044694 Bacteria 2955
814 Ga0466963_0048505 3300044694 Bacteria 2806
815 Ga0466963_0066982 3300044694 Bacteria 2409
816 Ga0466963_0084695 3300044694 Bacteria 2151
817 Ga0466963_0094273 3300044694 Bacteria 2041
818 Ga0466963_0266345 3300044694 Unclassified 1203
819 Ga0466963_0267948 3300044694 Bacteria 1200
820 Ga0466963_0306672 3300044694 Bacteria 1117
821 Ga0466964_0000233 3300044706 Bacteria 15978
822 Ga0466964_0001964 3300044706 Bacteria 7208
823 Ga0466964_0005348 3300044706 Bacteria 4769
824 Ga0466964_0019611 3300044706 Bacteria 2601
825 Ga0466964_0043634 3300044706 Bacteria 1819
826 Ga0466964_0078904 3300044706 Bacteria 1408
827 Ga0453684_1065801 3300044712 Bacteria 856
828 Ga0466971_0000350 3300044719 Bacteria 17732
829 Ga0466971_0003188 3300044719 Bacteria 6997
830 Ga0466971_0026888 3300044719 Bacteria 2575
831 Ga0466971_0103101 3300044719 Bacteria 1312
832 Ga0466971_0119714 3300044719 Bacteria 1218
833 Ga0466968_0001689 3300044735 Bacteria 7940
834 Ga0466968_0002266 3300044735 Bacteria 7030
835 Ga0466968_0036088 3300044735 Bacteria 2070
836 Ga0466968_0160153 3300044735 Bacteria 1038
837 Ga0466968_0161678 3300044735 Bacteria 1034
838 Ga0466970_0063311 3300044765 Bacteria 1983
839 Ga0466970_0106285 3300044765 Bacteria 1531
840 Ga0466970_0114880 3300044765 Bacteria 1471
841 Ga0466957_0029553 3300044842 Bacteria 3269
842 Ga0466957_0107554 3300044842 Bacteria 1765
843 Ga0466957_0153241 3300044842 Bacteria 1492
844 Ga0466957_0204107 3300044842 Bacteria 1299
845 Ga0466960_0015693 3300044901 Bacteria 3271
846 Ga0466960_0090430 3300044901 Bacteria 1559
847 Ga0466959_0004794 3300045049 Bacteria 9127
848 Ga0466959_0040920 3300045049 Bacteria 3423
849 Ga0466959_0041197 3300045049 Bacteria 3410
850 Ga0466959_0135980 3300045049 Bacteria 1740
851 Ga0466959_0614810 3300045049 Bacteria 730
852 Ga0451576_0307526 3300045051 Bacteria 1658
853 Ga0466958_0000492 3300045836 Bacteria 16518
854 Ga0466958_0000876 3300045836 Bacteria 13433
855 Ga0466958_0001126 3300045836 Bacteria 12360
856 Ga0466958_0002049 3300045836 Bacteria 9957
857 Ga0466958_0004846 3300045836 Bacteria 7163
858 Ga0466958_0008105 3300045836 Bacteria 5813
859 Ga0466958_0037288 3300045836 Bacteria 2913
860 Ga0466958_0074057 3300045836 Bacteria 2086
861 Ga0466958_0108466 3300045836 Bacteria 1732
862 Ga0466958_0186531 3300045836 Bacteria 1317
863 Ga0466967_0001317 3300045976 Bacteria 14199
864 Ga0466967_0003283 3300045976 Bacteria 10492
865 Ga0466967_0004635 3300045976 Bacteria 9319
866 Ga0466967_0009901 3300045976 Bacteria 7111
867 Ga0466967_0013679 3300045976 Bacteria 6284
868 Ga0466967_0018661 3300045976 Bacteria 5552
869 Ga0466967_0019638 3300045976 Bacteria 5439
870 Ga0466967_0019874 3300045976 Bacteria 5413
871 Ga0466967_0020088 3300045976 Bacteria 5389
872 Ga0466967_0025389 3300045976 Bacteria 4885
873 Ga0466967_0030402 3300045976 Bacteria 4532
874 Ga0466967_0030404 3300045976 Bacteria 4532
875 Ga0466967_0030640 3300045976 Bacteria 4517
876 Ga0466967_0041340 3300045976 Bacteria 3974
877 Ga0466967_0043208 3300045976 Bacteria 3901
878 Ga0466967_0046522 3300045976 Bacteria 3778
879 Ga0466967_0063686 3300045976 Bacteria 3277
880 Ga0466967_0068456 3300045976 Bacteria 3170
881 Ga0466967_0070566 3300045976 Bacteria 3125
882 Ga0466967_0071017 3300045976 Bacteria 3116
883 Ga0466967_0078771 3300045976 Bacteria 2969
884 Ga0466967_0117299 3300045976 Bacteria 2453
885 Ga0466967_0168476 3300045976 Bacteria 2059
886 Ga0466967_0363050 3300045976 Bacteria 1403
887 Ga0466967_0372857 3300045976 Bacteria 1384
888 Ga0466967_0398526 3300045976 Bacteria 1339
889 Ga0466967_0405502 3300045976 Bacteria 1327
890 Ga0466967_0733478 3300045976 Bacteria 979
891 Ga0495592_0010091 3300046454 Bacteria 7113
892 Ga0495603_0048410 3300046455 Bacteria 2531
893 Ga0495629_0001540 3300046459 Bacteria 18100
894 Ga0495629_0043195 3300046459 Bacteria 3165
895 Ga0495629_0054498 3300046459 Bacteria 2797
896 Ga0495629_0154537 3300046459 Bacteria 1594
897 Ga0495641_0000345 3300046461 Bacteria 38081
898 Ga0495641_0007704 3300046461 Bacteria 6680
899 Ga0495641_0082697 3300046461 Bacteria 1438
900 Ga0495641_0158876 3300046461 Bacteria 1011
901 Ga0495651_0061025 3300046462 Bacteria 2886
902 Ga0495651_0216805 3300046462 Bacteria 1327
903 Ga0495653_0031375 3300046463 Bacteria 4223
904 Ga0495653_0058748 3300046463 Bacteria 2923
905 Ga0495653_0067578 3300046463 Bacteria 2684
906 Ga0495653_0246594 3300046463 Bacteria 1187
907 Ga0495580_0113602 3300046472 Bacteria 1881
908 Ga0495582_0001048 3300046473 Bacteria 15517
909 Ga0495582_0051190 3300046473 Bacteria 2276
910 Ga0495582_0128748 3300046473 Bacteria 1429
911 Ga0495605_0056627 3300046474 Bacteria 1890
912 Ga0495605_0076891 3300046474 Bacteria 1567
913 Ga0495639_0001922 3300046475 Bacteria 9221
914 Ga0495639_0005637 3300046475 Bacteria 5386
915 Ga0495639_0013660 3300046475 Bacteria 3512
916 Ga0495662_0006548 3300046476 Bacteria 5816
917 Ga0495662_0035412 3300046476 Bacteria 2408
918 Ga0495662_0113919 3300046476 Bacteria 1326
919 Ga0495664_0018381 3300046477 Bacteria 4003
920 Ga0495664_0033236 3300046477 Bacteria 3031
921 Ga0495664_0366805 3300046477 Bacteria 866
922 Ga0495585_0144735 3300046492 Bacteria 1243
923 Ga0495596_0033129 3300046500 Bacteria 2057
924 Ga0495596_0097745 3300046500 Unclassified 1140
925 Ga0495607_0014777 3300046501 Bacteria 5075
926 Ga0495608_0014286 3300046511 Bacteria 5510
927 Ga0495608_0066666 3300046511 Bacteria 2356
928 Ga0495608_0143594 3300046511 Bacteria 1523
929 Ga0495608_0306503 3300046511 Bacteria 983
930 Ga0495618_0030099 3300046514 Bacteria 3389
931 Ga0495618_0300554 3300046514 Bacteria 997
932 Ga0495628_0013401 3300046516 Bacteria 6898
933 Ga0495628_0086213 3300046516 Bacteria 2435
934 Ga0495628_0210053 3300046516 Bacteria 1464
935 Ga0495630_0004423 3300046517 Bacteria 9861
936 Ga0495630_0004589 3300046517 Bacteria 9685
937 Ga0495630_0019816 3300046517 Bacteria 4950
938 Ga0495630_0026576 3300046517 Bacteria 4286
939 Ga0495630_0074042 3300046517 Bacteria 2564
940 Ga0495630_0634288 3300046517 Bacteria 818
941 Ga0495630_0856793 3300046517 Bacteria 693
942 Ga0495637_0122992 3300046520 Bacteria 997
943 Ga0495644_0014567 3300046523 Bacteria 3011
944 Ga0495663_0014503 3300046525 Bacteria 2210
945 Ga0495663_0057717 3300046525 Unclassified 1215
946 Ga0495666_0001773 3300046526 Bacteria 10651
947 Ga0495666_0025487 3300046526 Bacteria 2920
948 Ga0495652_0068656 3300046529 Bacteria 2969
949 Ga0495652_0212969 3300046529 Bacteria 1457
950 Ga0495652_0309765 3300046529 Bacteria 1144
951 Ga0495665_0001821 3300046531 Bacteria 11503
952 Ga0495665_0044257 3300046531 Unclassified 2365
953 Ga0495665_0226950 3300046531 Bacteria 965
954 Ga0495640_0006831 3300046533 Bacteria 8994
955 Ga0495640_0011558 3300046533 Bacteria 6787
956 Ga0495640_0035333 3300046533 Bacteria 3537
957 Ga0495640_0055283 3300046533 Unclassified 2715
958 Ga0495640_0087369 3300046533 Bacteria 2062
959 Ga0495586_0052091 3300046535 Bacteria 2215
960 Ga0495587_0074226 3300046536 Bacteria 1975
961 Ga0495587_0227501 3300046536 Bacteria 1051
962 Ga0495598_0063417 3300046537 Bacteria 1146
963 Ga0495598_0066037 3300046537 Bacteria 1128
964 Ga0495645_0111378 3300046543 Bacteria 1936
965 Ga0495667_0006269 3300046559 Bacteria 8065
966 Ga0495667_0024684 3300046559 Bacteria 4048
967 Ga0495667_0033526 3300046559 Bacteria 3436
968 Ga0495667_0523925 3300046559 Bacteria 741
969 Ga0495656_0056885 3300046615 Bacteria 1691
970 Ga0495656_0068538 3300046615 Bacteria 1569
971 Ga0495656_0340869 3300046615 Bacteria 775
972 Ga0495668_0056101 3300046616 Bacteria 2175
973 Ga0495634_0011233 3300046642 Bacteria 6529
974 Ga0495634_0045402 3300046642 Bacteria 2970
975 Ga0495634_0098949 3300046642 Bacteria 1886
976 Ga0495634_0112610 3300046642 Unclassified 1748
977 Ga0495635_0025411 3300046663 Bacteria 4125
978 Ga0495635_0059627 3300046663 Bacteria 2624
979 Ga0495635_0060626 3300046663 Unclassified 2599
980 Ga0495659_0024285 3300046664 Bacteria 2067
981 Ga0495659_0078481 3300046664 Bacteria 1249
982 Ga0495661_0207929 3300046665 Bacteria 1021
983 Ga0495661_0217056 3300046665 Bacteria 993
984 Ga0495661_0326713 3300046665 Unclassified 761
985 Ga0495661_0355249 3300046665 Bacteria 721
986 Ga0495657_0089649 3300046675 Bacteria 1975
987 Ga0495657_0125014 3300046675 Bacteria 1616
988 Ga0495599_0010401 3300046678 Bacteria 5692
989 Ga0495599_0031007 3300046678 Bacteria 3356
990 Ga0495623_0158336 3300046679 Bacteria 1333
991 Ga0495646_0057450 3300046680 Bacteria 2329
992 Ga0495646_0107840 3300046680 Bacteria 1588
993 Ga0495647_0001758 3300046681 Bacteria 6719
994 Ga0495647_0015615 3300046681 Bacteria 2663
995 Ga0495647_0180771 3300046681 Bacteria 917
996 Ga0495658_0014748 3300046683 Bacteria 3997
997 Ga0495613_0003061 3300046689 Bacteria 12491
998 Ga0495613_0006852 3300046689 Bacteria 8507
999 Ga0495613_0012262 3300046689 Bacteria 6369
1000 Ga0495613_0241034 3300046689 Bacteria 1264
1001 Ga0495613_0363199 3300046689 Bacteria 992
1002 Ga0495624_0012668 3300046690 Bacteria 5759
1003 Ga0495624_0310965 3300046690 Bacteria 949
1004 Ga0495670_0168439 3300046691 Bacteria 1153
1005 Ga0495670_0277107 3300046691 Bacteria 897
1006 Ga0495589_0036770 3300046794 Bacteria 2454
1007 Ga0495589_0094783 3300046794 Bacteria 1448
1008 Ga0495600_0027301 3300046809 Bacteria 3689
1009 Ga0495600_0029037 3300046809 Bacteria 3580
1010 Ga0495600_0037562 3300046809 Bacteria 3149
1011 Ga0495600_0091930 3300046809 Bacteria 1979
1012 Ga0495581_0000640 3300047315 Bacteria 18312
1013 Ga0495581_0060409 3300047315 Unclassified 2190
1014 Ga0495581_0081532 3300047315 Bacteria 1873
1015 Ga0495581_0504783 3300047315 Bacteria 703
1016 Ga0495604_0175080 3300047317 Unclassified 1505
1017 Ga0495636_0033683 3300047318 Bacteria 2106
1018 Ga0495674_0003918 3300047319 Bacteria 14455
1019 Ga0495674_0011997 3300047319 Bacteria 8171
1020 Ga0495674_0069697 3300047319 Bacteria 3040
1021 Ga0495674_0334072 3300047319 Bacteria 1232
1022 Ga0495674_0400817 3300047319 Bacteria 1107
1023 Ga0495674_0624824 3300047319 Bacteria 851
1024 Ga0495674_0731160 3300047319 Unclassified 775
1025 Ga0495674_0811335 3300047319 Bacteria 727
1026 Ga0495676_0003723 3300047321 Bacteria 13840
1027 Ga0495676_0137379 3300047321 Bacteria 1756
1028 Ga0495676_0142362 3300047321 Bacteria 1717
1029 Ga0495680_0003420 3300047322 Bacteria 15660
1030 Ga0495680_0007640 3300047322 Bacteria 9871
1031 Ga0495680_0009501 3300047322 Bacteria 8739
1032 Ga0495680_0059275 3300047322 Bacteria 2956
1033 Ga0495680_0069617 3300047322 Bacteria 2684
1034 Ga0495680_0106490 3300047322 Bacteria 2084
1035 Ga0495680_0128468 3300047322 Bacteria 1864
1036 Ga0495680_0184195 3300047322 Bacteria 1505
1037 Ga0495683_0255591 3300047323 Bacteria 767
1038 Ga0495675_0252150 3300047444 Bacteria 1060
1039 Ga0495677_0083639 3300047445 Bacteria 1198
1040 Ga0495685_106620 3300047447 Bacteria 924
1041 Ga0495684_0009129 3300047471 Bacteria 7658
1042 Ga0495684_0009734 3300047471 Bacteria 7416
1043 Ga0495684_0025768 3300047471 Bacteria 4518
1044 Ga0495684_0026040 3300047471 Bacteria 4495
1045 Ga0495684_0100572 3300047471 Unclassified 2186
1046 Ga0495593_0007309 3300047673 Bacteria 6471
1047 Ga0495593_0009917 3300047673 Bacteria 5524
1048 Ga0495593_0113406 3300047673 Unclassified 1383
1049 Ga0495602_0037471 3300048088 Bacteria 4500
1050 Ga0495602_0190863 3300048088 Bacteria 1571
1051 Ga0495602_0211878 3300048088 Bacteria 1470
1052 Ga0495614_0003782 3300048089 Bacteria 6804
1053 Ga0495614_0013122 3300048089 Bacteria 3634
1054 Ga0495614_0113314 3300048089 Bacteria 1192
1055 Ga0496100_0016415 3300048903 Bacteria 4349
1056 Ga0496100_0056176 3300048903 Bacteria 2575
1057 Ga0496100_0085771 3300048903 Bacteria 2137
1058 Ga0496100_0133843 3300048903 Bacteria 1749
1059 Ga0496100_0662367 3300048903 Bacteria 813
1060 Ga0496100_0673465 3300048903 Bacteria 806
1061 Ga0496101_0019418 3300048904 Bacteria 4639
1062 Ga0496101_0044715 3300048904 Bacteria 3169
1063 Ga0496101_0147626 3300048904 Unclassified 1796
1064 Ga0496101_0205586 3300048904 Bacteria 1523
1065 Ga0496101_0219394 3300048904 Bacteria 1475
1066 Ga0496101_0447588 3300048904 Bacteria 1019
1067 Ga0496102_0020289 3300048905 Bacteria 5873
1068 Ga0496102_0036831 3300048905 Bacteria 4409
1069 Ga0496102_0037438 3300048905 Bacteria 4376
1070 Ga0496102_0092371 3300048905 Bacteria 2802
1071 Ga0496102_0141408 3300048905 Bacteria 2257
1072 Ga0496102_0162458 3300048905 Bacteria 2101
1073 Ga0496102_0284794 3300048905 Unclassified 1557
1074 Ga0496102_0299731 3300048905 Bacteria 1515
1075 Ga0496103_0005924 3300048906 Bacteria 7306
1076 Ga0496103_0012326 3300048906 Bacteria 5072
1077 Ga0496103_0019732 3300048906 Bacteria 4046
1078 Ga0496103_0092671 3300048906 Bacteria 1907
1079 Ga0496103_0151496 3300048906 Unclassified 1485
1080 Ga0496103_0218169 3300048906 Bacteria 1227
1081 Ga0496103_0254755 3300048906 Bacteria 1129
1082 Ga0496103_0571310 3300048906 Bacteria 721
1083 Ga0496104_0000597 3300048907 Bacteria 30871
1084 Ga0496104_0013270 3300048907 Bacteria 7426
1085 Ga0496104_0013604 3300048907 Bacteria 7336
1086 Ga0496104_0031080 3300048907 Bacteria 4964
1087 Ga0496104_0052918 3300048907 Bacteria 3835
1088 Ga0496104_0074798 3300048907 Bacteria 3225
1089 Ga0496104_0129318 3300048907 Bacteria 2425
1090 Ga0496104_0257327 3300048907 Bacteria 1658
1091 Ga0496104_0502552 3300048907 Bacteria 1123
1092 Ga0496105_0001972 3300048908 Bacteria 14767
1093 Ga0496105_0004171 3300048908 Bacteria 10852
1094 Ga0496105_0039193 3300048908 Bacteria 3904
1095 Ga0496105_0061821 3300048908 Bacteria 3090
1096 Ga0496105_0115274 3300048908 Bacteria 2216
1097 Ga0496105_0212297 3300048908 Bacteria 1577
1098 Ga0496105_0259761 3300048908 Bacteria 1405
1099 Ga0496106_0002814 3300048909 Bacteria 12904
1100 Ga0496106_0008591 3300048909 Bacteria 7556
1101 Ga0496106_0025881 3300048909 Bacteria 4365
1102 Ga0496106_0040822 3300048909 Bacteria 3476
1103 Ga0496106_0045709 3300048909 Bacteria 3289
1104 Ga0496106_0162704 3300048909 Bacteria 1765
1105 Ga0496106_0325518 3300048909 Bacteria 1234
1106 Ga0496107_0021210 3300048910 Bacteria 4592
1107 Ga0496107_0033970 3300048910 Bacteria 3650
1108 Ga0496107_0067508 3300048910 Bacteria 2595
1109 Ga0496107_0222777 3300048910 Unclassified 1403
1110 Ga0496107_0453477 3300048910 Bacteria 952
1111 Ga0496108_0002280 3300048911 Bacteria 15370
1112 Ga0496108_0022242 3300048911 Bacteria 5213
1113 Ga0496108_0027385 3300048911 Bacteria 4706
1114 Ga0496108_0039676 3300048911 Bacteria 3923
1115 Ga0496108_0048543 3300048911 Bacteria 3549
1116 Ga0496108_0092962 3300048911 Bacteria 2565
1117 Ga0496108_0288167 3300048911 Bacteria 1430
1118 Ga0496108_0341157 3300048911 Bacteria 1307
1119 Ga0496108_0367695 3300048911 Bacteria 1255
1120 Ga0496109_0001523 3300048912 Bacteria 19293
1121 Ga0496109_0002331 3300048912 Bacteria 15816
1122 Ga0496109_0002799 3300048912 Bacteria 14605
1123 Ga0496109_0019767 3300048912 Bacteria 5941
1124 Ga0496109_0044373 3300048912 Bacteria 4033
1125 Ga0496109_0075962 3300048912 Bacteria 3089
1126 Ga0496109_0223782 3300048912 Unclassified 1770
1127 Ga0496109_0237574 3300048912 Bacteria 1714
1128 Ga0496109_0276534 3300048912 Bacteria 1582
1129 Ga0496109_0684785 3300048912 Bacteria 963
1130 Ga0496109_0869168 3300048912 Bacteria 839
1131 Ga0496110_0000705 3300048913 Bacteria 23089
1132 Ga0496110_0007799 3300048913 Bacteria 8577
1133 Ga0496110_0034853 3300048913 Bacteria 4363
1134 Ga0496110_0051582 3300048913 Bacteria 3615
1135 Ga0496110_0056524 3300048913 Bacteria 3453
1136 Ga0496110_0080639 3300048913 Bacteria 2900
1137 Ga0496110_0126756 3300048913 Unclassified 2303
1138 Ga0496110_0173140 3300048913 Bacteria 1959
1139 Ga0496110_0216147 3300048913 Bacteria 1743
1140 Ga0496110_0252949 3300048913 Bacteria 1603
1141 Ga0496110_0359636 3300048913 Bacteria 1326
1142 Ga0496110_0516604 3300048913 Bacteria 1087
1143 Ga0496110_0645599 3300048913 Bacteria 958
1144 Ga0496110_0745444 3300048913 Bacteria 882
1145 Ga0496111_0000376 3300048914 Bacteria 22245
1146 Ga0496111_0012316 3300048914 Bacteria 5786
1147 Ga0496111_0027287 3300048914 Bacteria 4038
1148 Ga0496111_0029684 3300048914 Bacteria 3884
1149 Ga0496111_0041012 3300048914 Bacteria 3321
1150 Ga0496111_0053296 3300048914 Bacteria 2922
1151 Ga0496111_0075106 3300048914 Bacteria 2462
1152 Ga0496111_0075143 3300048914 Bacteria 2462
1153 Ga0496111_0094976 3300048914 Bacteria 2187
1154 Ga0496111_0122181 3300048914 Bacteria 1923
1155 Ga0496111_0446654 3300048914 Bacteria 954
1156 Ga0496111_0745917 3300048914 Bacteria 710
1157 Ga0496112_0003554 3300048915 Bacteria 12948
1158 Ga0496112_0005672 3300048915 Bacteria 10846
1159 Ga0496112_0016462 3300048915 Bacteria 6928
1160 Ga0496112_0031983 3300048915 Bacteria 5108
1161 Ga0496112_0081396 3300048915 Bacteria 3202
1162 Ga0496112_0083785 3300048915 Bacteria 3154
1163 Ga0496112_0089498 3300048915 Unclassified 3046
1164 Ga0496112_0090358 3300048915 Bacteria 3031
1165 Ga0496112_0098079 3300048915 Bacteria 2900
1166 Ga0496112_0125752 3300048915 Bacteria 2535
1167 Ga0496112_0236190 3300048915 Bacteria 1781
1168 Ga0496112_0339565 3300048915 Bacteria 1445
1169 Ga0496112_0378110 3300048915 Bacteria 1357
1170 Ga0496112_0540549 3300048915 Bacteria 1099
1171 Ga0496112_0635487 3300048915 Bacteria 998
1172 Ga0496112_0943085 3300048915 Bacteria 784
1173 Ga0496112_1052825 3300048915 Bacteria 732
1174 Ga0496113_0000365 3300048916 Bacteria 21766
1175 Ga0496113_0011892 3300048916 Bacteria 5833
1176 Ga0496113_0025896 3300048916 Bacteria 4187
1177 Ga0496113_0062165 3300048916 Bacteria 2819
1178 Ga0496113_0108695 3300048916 Bacteria 2156
1179 Ga0496113_0342515 3300048916 Unclassified 1199
1180 Ga0496113_0422676 3300048916 Bacteria 1070
1181 Ga0496113_0494573 3300048916 Bacteria 982
1182 Ga0496113_0680796 3300048916 Bacteria 822
1183 Ga0496114_0000875 3300048917 Bacteria 22544
1184 Ga0496114_0003727 3300048917 Bacteria 11741
1185 Ga0496114_0003888 3300048917 Bacteria 11517
1186 Ga0496114_0006300 3300048917 Bacteria 9338
1187 Ga0496114_0071477 3300048917 Bacteria 2916
1188 Ga0496114_0081498 3300048917 Bacteria 2733
1189 Ga0496114_0085145 3300048917 Bacteria 2677
1190 Ga0496115_0015946 3300048918 Bacteria 5712
1191 Ga0496115_0021221 3300048918 Bacteria 5014
1192 Ga0496115_0026457 3300048918 Bacteria 4528
1193 Ga0496115_0038292 3300048918 Bacteria 3804
1194 Ga0496115_0152250 3300048918 Bacteria 1910
1195 Ga0496115_0255717 3300048918 Bacteria 1441
1196 Ga0496115_0263124 3300048918 Bacteria 1418
1197 Ga0496115_0388021 3300048918 Bacteria 1135
1198 Ga0501031_0015574 3300049568 Bacteria 4936
1199 Ga0501031_0249094 3300049568 Bacteria 1155
1200 Ga0501032_0041691 3300049569 Bacteria 3116
1201 Ga0501033_0003478 3300049570 Bacteria 12916
1202 Ga0501036_0120170 3300049572 Bacteria 2219
1203 Ga0501036_0228234 3300049572 Bacteria 1563
1204 Ga0501036_0253053 3300049572 Bacteria 1476
1205 Ga0501036_0613279 3300049572 Bacteria 902
1206 Ga0501037_0429802 3300049573 Unclassified 903
1207 Ga0501038_0007188 3300049574 Bacteria 10293
1208 Ga0501039_0006217 3300049575 Bacteria 9069
1209 Ga0501040_0006556 3300049576 Bacteria 7557
1210 Ga0501040_0056858 3300049576 Bacteria 2685
1211 Ga0501041_0051932 3300049577 Bacteria 2499
1212 Ga0501041_0112294 3300049577 Bacteria 1691
1213 Ga0501041_0253714 3300049577 Bacteria 1106
1214 Ga0501041_0388813 3300049577 Unclassified 883
1215 Ga0501042_0108718 3300049578 Bacteria 1996
1216 Ga0501042_0134720 3300049578 Bacteria 1781
1217 Ga0501042_0193588 3300049578 Unclassified 1466
1218 Ga0501046_0088158 3300049580 Bacteria 2390
1219 Ga0501046_0253414 3300049580 Bacteria 1295
1220 Ga0501047_0065789 3300049581 Bacteria 3494
1221 Ga0501047_0334410 3300049581 Bacteria 1353
1222 Ga0501047_0508346 3300049581 Bacteria 1031
1223 Ga0501048_0004133 3300049582 Bacteria 11066
1224 Ga0501048_0043247 3300049582 Bacteria 3225
1225 Ga0501048_0290927 3300049582 Bacteria 1162
1226 Ga0501067_0009283 3300049583 Bacteria 5448
1227 Ga0501067_0011107 3300049583 Bacteria 4982
1228 Ga0501067_0062842 3300049583 Bacteria 2056
1229 Ga0501067_0097317 3300049583 Bacteria 1634
1230 Ga0501067_0147539 3300049583 Bacteria 1310
1231 Ga0501068_0014707 3300049584 Bacteria 4477
1232 Ga0501068_0177369 3300049584 Bacteria 1347
1233 Ga0501069_0005135 3300049585 Bacteria 6797
1234 Ga0501069_0010254 3300049585 Bacteria 4958
1235 Ga0501069_0011091 3300049585 Bacteria 4781
1236 Ga0501069_0285999 3300049585 Bacteria 965
1237 Ga0501069_0553666 3300049585 Bacteria 688
1238 Ga0501070_0001687 3300049586 Bacteria 19581
1239 Ga0501070_0020705 3300049586 Bacteria 5518
1240 Ga0501070_0065141 3300049586 Bacteria 3017
1241 Ga0501070_0115152 3300049586 Bacteria 2221
1242 Ga0501070_0172154 3300049586 Bacteria 1783
1243 Ga0501070_0197781 3300049586 Unclassified 1651
1244 Ga0501071_0030185 3300049587 Bacteria 3833
1245 Ga0501071_0035802 3300049587 Bacteria 3537
1246 Ga0501071_0133404 3300049587 Bacteria 1846
1247 Ga0501071_0305393 3300049587 Bacteria 1207
1248 Ga0501071_0475411 3300049587 Bacteria 957
1249 Ga0501072_0025169 3300049588 Bacteria 4634
1250 Ga0501072_0338490 3300049588 Bacteria 1195
1251 Ga0501072_0349252 3300049588 Bacteria 1174
1252 Ga0501073_0021069 3300049589 Bacteria 4701
1253 Ga0501073_0194205 3300049589 Bacteria 1404
1254 Ga0501074_0033377 3300049590 Bacteria 3729
1255 Ga0501074_0050163 3300049590 Bacteria 3012
1256 Ga0501075_0021220 3300049591 Bacteria 4733
1257 Ga0501075_0215136 3300049591 Bacteria 1466
1258 Ga0501075_0339142 3300049591 Bacteria 1145
1259 Ga0501076_0074317 3300049592 Unclassified 2722
1260 Ga0501077_0010555 3300049593 Bacteria 5751
1261 Ga0501077_0393909 3300049593 Bacteria 885
1262 Ga0501079_0043846 3300049741 Bacteria 3452
1263 Ga0501079_0125266 3300049741 Bacteria 1999
1264 Ga0501079_0158570 3300049741 Bacteria 1764
1265 Ga0501079_0179968 3300049741 Bacteria 1650
1266 Ga0501079_0336072 3300049741 Bacteria 1183
1267 Ga0501080_0002220 3300049742 Bacteria 16878
1268 Ga0501080_0020012 3300049742 Bacteria 6195
1269 Ga0501080_0103637 3300049742 Bacteria 2638
1270 Ga0501080_0645064 3300049742 Bacteria 937
1271 Ga0501035_0270052 3300049822 Bacteria 1440
1272 Ga0501044_0330937 3300049823 Bacteria 1446
1273 Ga0501045_0074232 3300049824 Bacteria 2504
1274 Ga0501045_0140853 3300049824 Bacteria 1793
1275 Ga0501045_0141827 3300049824 Bacteria 1787
1276 nmdc:mga03683_351791_c1 3300050489 Bacteria 697
1277 nmdc:mga0yw44_209626_c1 3300050492 Bacteria 1289
1278 nmdc:mga0yw44_87322_c1 3300050492 Bacteria 1966
1279 nmdc:mga05p37_107311_c1 3300050507 Bacteria 3435
1280 nmdc:mga05p37_127566_c1 3300050507 Bacteria 3123
1281 nmdc:mga05p37_542042_c1 3300050507 Unclassified 1326
1282 nmdc:mga05p37_553118_c1 3300050507 Bacteria 1309
1283 nmdc:mga05p37_91702_c1 3300050507 Bacteria 3744
1284 nmdc:mga06r32_184713_c1 3300050510 Bacteria 2071
1285 nmdc:mga06r32_972358_c1 3300050510 Bacteria 803
1286 nmdc:mga08y16_484210_c1 3300050511 Bacteria 1259
1287 nmdc:mga08y16_903218_c1 3300050511 Bacteria 869
1288 nmdc:mga0n895_212756_c1 3300050512 Bacteria 1963
1289 nmdc:mga0n895_61794_c1 3300050512 Bacteria 3700
1290 nmdc:mga0n895_736325_c1 3300050512 Bacteria 980
1291 nmdc:mga0n895_94422_c1 3300050512 Bacteria 2995
1292 nmdc:mga0rr50_1104_c1 3300050513 Bacteria 14644
1293 nmdc:mga0rr50_12626_c1 3300050513 Bacteria 5468
1294 nmdc:mga0rr50_2852_c1 3300050513 Bacteria 9830
1295 nmdc:mga0rr50_436527_c1 3300050513 Bacteria 1109
1296 nmdc:mga08x19_142283_c1 3300050514 Unclassified 1621
1297 nmdc:mga08x19_19984_c1 3300050514 Bacteria 4120
1298 nmdc:mga08x19_24515_c1 3300050514 Bacteria 3751
1299 nmdc:mga08x19_343034_c1 3300050514 Bacteria 1042
1300 nmdc:mga08x19_63446_c1 3300050514 Bacteria 2397
1301 nmdc:mga0a205_112190_c1 3300050515 Bacteria 2626
1302 nmdc:mga0a205_277764_c1 3300050515 Bacteria 1551
1303 nmdc:mga0a205_515_c1 3300050515 Bacteria 30339
1304 nmdc:mga0a205_9751_c1 3300050515 Bacteria 8798
1305 Ga0495601_0014598 3300053077 Bacteria 4734
1306 Ga0495601_0076650 3300053077 Bacteria 2141
1307 Ga0495601_0087702 3300053077 Unclassified 2000
1308 Ga0495612_0011591 3300053078 Bacteria 3551
1309 Ga0495612_0106127 3300053078 Unclassified 1199
1310 Ga0495655_0023757 3300053083 Bacteria 1417
1311 Ga0495595_0023425 3300053084 Bacteria 2718
1312 Ga0495595_0023655 3300053084 Bacteria 2707
1313 Ga0495595_0136298 3300053084 Bacteria 1202
1314 Ga0495619_0001634 3300053085 Bacteria 14778
1315 Ga0495619_0001785 3300053085 Bacteria 14310
1316 Ga0495619_0026394 3300053085 Bacteria 3737
1317 Ga0495619_0047443 3300053085 Bacteria 2828
1318 Ga0495619_0143491 3300053085 Bacteria 1645
1319 Ga0495619_0412282 3300053085 Bacteria 932
1320 Ga0501084_0058435 3300054114 Bacteria 3227
1321 Ga0501084_0083864 3300054114 Bacteria 2675
1322 Ga0501084_0193152 3300054114 Bacteria 1718
1323 Ga0590071_039404 3300059421 Unclassified 1136
1324 Ga0587080_026740 3300059503 Bacteria 981
1325 Ga0587069_030973 3300059642 Bacteria 865
1326 Ga0501082_0022132 3300060353 Bacteria 5478
1327 Ga0501082_0119272 3300060353 Bacteria 2286
1328 Ga0501082_0358301 3300060353 Bacteria 1272
1329 Ga0466962_0001433 3300061719 Bacteria 11119
1330 Ga0466962_0004216 3300061719 Bacteria 6887
1331 Ga0466962_0004975 3300061719 Bacteria 6391
1332 Ga0466962_0023407 3300061719 Bacteria 2969
1333 Ga0466962_0062581 3300061719 Bacteria 1777
1334 Ga0530510_0024738 3300061734 Bacteria 4289
1335 Ga0530510_0026118 3300061734 Bacteria 4177
1336 Ga0530510_0031504 3300061734 Bacteria 3812
1337 Ga0530510_0287929 3300061734 Bacteria 1228
1338 Ga0501031_0224729
1339 JGI25407J50210_10000406
1340 JGI25407J50210_10105595
1341 JGI25404J52841_10031131
1342 Ga0058862_12804081
1343 Ga0070658_10007279
1344 Ga0070658_10016442
1345 Ga0070658_10018409
1346 Ga0070658_10023899
1347 Ga0070658_10045188
1348 Ga0070658_10063796
1349 Ga0070658_10330556
1350 Ga0070683_100001807
1351 Ga0070683_100025873
1352 Ga0070683_100104075
1353 Ga0070683_100109721
1354 Ga0070683_100521542
1355 Ga0070680_100005165
1356 Ga0070680_100008385
1357 Ga0070680_100031458
1358 Ga0070680_100059865
1359 Ga0070680_100070210
1360 Ga0070680_100210639
1361 Ga0070682_100006444
1362 Ga0070682_100007437
1363 Ga0070682_100036588
1364 Ga0070682_100129219
1365 Ga0070682_100212246
1366 Ga0068868_100375920
1367 Ga0068868_100433701
1368 Ga0070660_100002597
1369 Ga0070660_100033323
1370 Ga0070660_100035531
1371 Ga0070660_100036512
1372 Ga0070660_100051709
1373 Ga0070660_100255616
1374 Ga0070660_100448203
1375 Ga0070660_100890055
1376 Ga0070661_100060637
1377 Ga0070661_100149095
1378 Ga0070661_100198948
1379 Ga0070661_100228848
1380 Ga0070661_100485970
1381 Ga0070668_100055050
1382 Ga0070669_100310707
1383 Ga0070675_100510720
1384 Ga0070671_100051385
1385 Ga0070671_100412184
1386 Ga0070674_100268265
1387 Ga0070659_100004395
1388 Ga0070659_100057680
1389 Ga0070659_100099875
1390 Ga0070659_100148398
1391 Ga0070659_100261976
1392 Ga0070667_100003479
1393 Ga0070703_10060557
1394 Ga0070703_10123623
1395 Ga0070709_10003722
1396 Ga0070709_10050903
1397 Ga0070709_10130578
1398 Ga0070709_10158636
1399 Ga0070714_100013517
1400 Ga0070714_100037631
1401 Ga0070714_100059600
1402 Ga0070714_100070863
1403 Ga0070714_100095864
1404 Ga0070714_100124811
1405 Ga0070714_100130895
1406 Ga0070714_100136048
1407 Ga0070714_100976224
1408 Ga0070714_101189961
1409 Ga0070713_100001998
1410 Ga0070713_100265387
1411 Ga0070713_100308905
1412 Ga0070710_10005665
1413 Ga0070710_10007312
1414 Ga0070710_10016667
1415 Ga0070711_100081482
1416 Ga0070711_100112742
1417 Ga0070711_100145863
1418 Ga0070711_100423068
1419 Ga0070705_100037024
1420 Ga0070705_100059373
1421 Ga0070705_100179007
1422 Ga0070705_100224227
1423 Ga0070705_100311543
1424 Ga0070705_100405553
1425 Ga0070700_100419500
1426 Ga0070694_100295446
1427 Ga0070694_100507401
1428 Ga0070708_100018186
1429 Ga0070708_100245475
1430 Ga0070708_100294937
1431 Ga0070708_100321184
1432 Ga0070708_101027438
1433 Ga0070678_100015863
1434 Ga0070678_100114690
1435 Ga0070678_100122116
1436 Ga0070678_100601529
1437 Ga0070662_100003257
1438 Ga0070681_10009902
1439 Ga0070681_10041547
1440 Ga0070681_10059950
1441 Ga0070681_10067407
1442 Ga0070681_10123713
1443 Ga0070681_10132007
1444 Ga0070681_10168988
1445 Ga0070681_10206106
1446 Ga0070681_10291291
1447 Ga0070681_10310337
1448 Ga0070681_10606948
1449 Ga0070681_10771992
1450 Ga0070706_100008962
1451 Ga0070706_100059607
1452 Ga0070706_100062103
1453 Ga0070706_100125776
1454 Ga0070706_100126808
1455 Ga0070706_100618664
1456 Ga0070707_100046410
1457 Ga0070707_100161113
1458 Ga0070707_100335246
1459 Ga0070707_100648225
1460 Ga0070698_100005322
1461 Ga0070698_100014780
1462 Ga0070698_100080180
1463 Ga0070698_100135529
1464 Ga0070698_100162960
1465 Ga0070698_100268237
1466 Ga0070699_100042022
1467 Ga0070699_100137129
1468 Ga0070699_100396932
1469 Ga0070699_100948073
1470 Ga0070679_100004066
1471 Ga0070679_100025803
1472 Ga0070679_100027640
1473 Ga0070679_100028850
1474 Ga0070679_100037951
1475 Ga0070679_100050658
1476 Ga0070679_100110933
1477 Ga0070679_100151713
1478 Ga0070679_100177502
1479 Ga0070679_100207108
1480 Ga0070679_100233019
1481 Ga0070679_100331490
1482 Ga0070679_100431677
1483 Ga0070679_101015164
1484 Ga0070679_101114931
1485 Ga0070684_100023906
1486 Ga0070684_100242871
1487 Ga0070684_100635944
1488 Ga0070684_101504183
1489 Ga0070697_100200390
1490 Ga0070697_100203393
1491 Ga0070697_100274780
1492 Ga0070672_100685084
1493 Ga0070686_100136160
1494 Ga0070686_100169653
1495 Ga0070686_100205805
1496 Ga0070695_100000072
1497 Ga0070695_100076079
1498 Ga0070696_100110647
1499 Ga0070696_100209651
1500 Ga0070696_100261439
1501 Ga0070696_100371358
1502 Ga0070696_100431632
1503 Ga0070696_100626162
1504 Ga0070693_100015674
1505 Ga0070693_100028442
1506 Ga0070693_100455362
1507 Ga0070665_100035400
1508 Ga0070665_100354567
1509 Ga0070704_100468804
1510 Ga0068855_100005085
1511 Ga0068855_100019212
1512 Ga0068855_100029823
1513 Ga0068855_100038293
1514 Ga0068855_100044913
1515 Ga0068855_100048881
1516 Ga0068855_100116002
1517 Ga0068855_100257627
1518 Ga0068855_100561612
1519 Ga0068855_100823065
1520 Ga0068855_101455644
1521 Ga0068855_101517828
1522 Ga0068857_100063397
1523 Ga0068857_100269379
1524 Ga0068857_100496676
1525 Ga0068857_100562920
1526 Ga0068856_100047359
1527 Ga0068856_100173859
1528 Ga0068856_100263364
1529 Ga0068856_100311608
1530 Ga0068856_100350708
1531 Ga0068856_100469047
1532 Ga0068856_100494864
1533 Ga0068856_100807316
1534 Ga0068856_100923255
1535 Ga0068852_100013931
1536 Ga0068852_100064432
1537 Ga0068852_100093137
1538 Ga0068852_100575629
1539 Ga0068864_100249667
1540 Ga0068866_10136692
1541 Ga0068861_100207059
1542 Ga0068870_10158781
1543 Ga0068870_10412388
1544 Ga0068863_100691113
1545 Ga0068858_100115993
1546 Ga0068860_100249481
1547 Ga0081455_10010130
1548 Ga0081455_10011947
1549 Ga0081455_10013084
1550 Ga0081455_10154163
1551 Ga0081455_10404193
1552 Ga0081538_10000608
1553 Ga0081538_10003497
1554 Ga0081538_10024849
1555 Ga0081538_10061893
1556 Ga0081538_10063468
1557 Ga0081538_10075587
1558 Ga0081538_10076907
1559 Ga0081540_1002169
1560 Ga0081539_10000249
1561 Ga0081539_10006242
1562 Ga0081539_10106973
1563 Ga0081539_10170466
1564 Ga0070717_10015238
1565 Ga0070717_10024925
1566 Ga0070717_10060212
1567 Ga0070717_10088702
1568 Ga0070717_10151533
1569 Ga0075365_10032892
1570 Ga0075364_10068432
1571 Ga0070715_10000369
1572 Ga0070715_10008347
1573 Ga0070715_10014448
1574 Ga0070715_10070538
1575 Ga0070716_100009180
1576 Ga0070716_100043141
1577 Ga0070716_100406159
1578 Ga0070712_100008944
1579 Ga0070712_100025190
1580 Ga0070712_100046410
1581 Ga0070712_100254314
1582 Ga0070712_100345159
1583 Ga0070712_100689822
1584 Ga0075362_10042301
1585 Ga0097621_100137043
1586 Ga0097621_100316811
1587 Ga0097621_100847822
1588 Ga0068871_100021730
1589 Ga0068871_100230124
1590 Ga0075431_100158475
1591 Ga0075431_100467628
1592 Ga0075433_10001077
1593 Ga0075433_10014274
1594 Ga0075433_10315344
1595 Ga0075433_10372783
1596 Ga0075434_100001096
1597 Ga0075434_100006796
1598 Ga0075434_100039502
1599 Ga0075434_100132935
1600 Ga0075434_100241490
1601 Ga0075434_100400865
1602 Ga0075434_100752016
1603 Ga0068865_100215942
1604 Ga0068865_100513825
1605 Ga0075436_100031886
1606 Ga0075436_100110031
1607 Ga0075436_100136574
1608 Ga0075436_100363286
1609 Ga0075435_100005919
1610 Ga0075435_100031675
1611 Ga0075435_100035768
1612 Ga0075435_100151557
1613 Ga0105251_10154493
1614 Ga0105240_10004954
1615 Ga0105240_10036261
1616 Ga0105240_10038819
1617 Ga0105240_10054046
1618 Ga0105245_10019791
1619 Ga0105245_10041003
1620 Ga0105245_10090363
1621 Ga0105245_10145871
1622 Ga0105245_10442054
1623 Ga0105245_10459503
1624 Ga0105247_10041288
1625 Ga0114129_10005843
1626 Ga0114129_10185248
1627 Ga0114129_10419545
1628 Ga0105243_10062609
1629 Ga0105243_10097129
1630 Ga0105243_10134430
1631 Ga0105241_10051884
1632 Ga0105241_10270638
1633 Ga0105242_10149150
1634 Ga0105248_10107475
1635 Ga0105237_10010187
1636 Ga0105237_10268530
1637 Ga0105238_10019187
1638 Ga0105238_10234776
1639 Ga0105238_10265336
1640 Ga0105238_10558409
1641 Ga0105238_10767160
1642 Ga0105249_10002534
1643 Ga0105249_10468208
1644 Ga0105249_10939691
1645 Ga0105239_10011104
1646 Ga0105239_10021787
1647 Ga0105239_11104296
1648 Ga0105246_10094003
1649 Ga0105246_10221038
1650 Ga0157339_1002406
1651 Ga0157373_10025244
1652 Ga0157373_10216385
1653 Ga0157373_10356313
1654 Ga0157371_10073516
1655 Ga0157371_10309312
1656 Ga0157370_10011897
1657 Ga0157370_10018188
1658 Ga0157370_10029004
1659 Ga0157370_10032773
1660 Ga0157370_10060710
1661 Ga0157370_10079311
1662 Ga0157370_10098873
1663 Ga0157370_10563386
1664 Ga0157369_10005681
1665 Ga0157369_10007107
1666 Ga0157369_10030256
1667 Ga0157369_10039970
1668 Ga0157369_10048742
1669 Ga0157369_10205096
1670 Ga0157369_10274977
1671 Ga0157369_10284826
1672 Ga0157369_10405539
1673 Ga0157369_11329741
1674 Ga0157374_10077371
1675 Ga0157374_10192836
1676 Ga0157374_10736866
1677 Ga0163162_10055567
1678 Ga0163162_10591805
1679 Ga0157372_10121400
1680 Ga0157372_10192805
1681 Ga0157372_10224415
1682 Ga0157372_10290175
1683 Ga0157372_10356989
1684 Ga0157372_10369272
1685 Ga0157372_10784022
1686 Ga0157372_11137461
1687 Ga0157372_11878525
1688 Ga0157375_10099964
1689 Ga0157375_10299788
1690 Ga0163163_10030599
1691 Ga0157380_10129375
1692 Ga0182008_10002853
1693 Ga0182008_10017072
1694 Ga0157377_10407124
1695 Ga0157376_10036990
1696 Ga0157376_10066985
1697 Ga0182006_1020291
1698 Ga0182006_1077392
1699 Ga0182005_1041905
1700 Ga0182005_1124175
1701 Ga0163161_10008801
1702 Ga0197907_10190807
1703 Ga0197907_10345131
1704 Ga0206356_10418251
1705 Ga0206356_10567364
1706 Ga0206356_11120154
1707 Ga0206356_11870338
1708 Ga0206355_1177548
1709 Ga0206355_1576338
1710 Ga0206351_10051768
1711 Ga0206351_10105922
1712 Ga0206350_10058088
1713 Ga0206350_10991345
1714 Ga0206354_10891471
1715 Ga0206354_11040985
1716 Ga0206353_10141117
1717 Ga0206353_10237848
1718 Ga0206353_10758799
1719 Ga0206353_11116827
1720 Ga0206353_11735253
1721 Ga0154015_1506938
1722 Ga0213876_10023023
1723 Ga0213871_10053915
1724 Ga0224712_10041044
1725 Ga0224712_10326882
1726 Ga0207653_10003996
1727 Ga0207692_10122008
1728 Ga0207642_10063024
1729 Ga0207685_10017643
1730 Ga0207685_10050254
1731 Ga0207685_10101345
1732 Ga0207685_10151808
1733 Ga0207699_10033199
1734 Ga0207699_10080059
1735 Ga0207643_10095670
1736 Ga0207705_10004374
1737 Ga0207705_10008362
1738 Ga0207705_10026222
1739 Ga0207705_10052290
1740 Ga0207705_10373070
1741 Ga0207705_10676393
1742 Ga0207684_10078742
1743 Ga0207684_10122725
1744 Ga0207684_10272592
1745 Ga0207684_10426771
1746 Ga0207684_10753328
1747 Ga0207654_10185373
1748 Ga0207654_10209629
1749 Ga0207707_10009041
1750 Ga0207707_10009936
1751 Ga0207707_10033241
1752 Ga0207707_10039214
1753 Ga0207707_10047465
1754 Ga0207707_10063976
1755 Ga0207707_10068938
1756 Ga0207707_10161192
1757 Ga0207707_10177498
1758 Ga0207707_10293791
1759 Ga0207707_10294529
1760 Ga0207707_10515954
1761 Ga0207695_10027324
1762 Ga0207695_10106193
1763 Ga0207695_10238431
1764 Ga0207671_10093594
1765 Ga0207693_10000461
1766 Ga0207693_10000702
1767 Ga0207693_10008489
1768 Ga0207693_10011291
1769 Ga0207693_10016960
1770 Ga0207693_10032098
1771 Ga0207693_10127862
1772 Ga0207693_10207424
1773 Ga0207693_10222606
1774 Ga0207693_10312327
1775 Ga0207693_10575375
1776 Ga0207693_10747578
1777 Ga0207663_10052554
1778 Ga0207663_10075199
1779 Ga0207663_10251632
1780 Ga0207660_10014233
1781 Ga0207660_10028841
1782 Ga0207660_10066020
1783 Ga0207660_10167138
1784 Ga0207660_10494391
1785 Ga0207657_10002868
1786 Ga0207657_10003083
1787 Ga0207657_10005015
1788 Ga0207657_10008807
1789 Ga0207657_10014143
1790 Ga0207657_10063292
1791 Ga0207657_10140443
1792 Ga0207657_10400515
1793 Ga0207649_10053356
1794 Ga0207649_10099768
1795 Ga0207649_10119401
1796 Ga0207649_10181027
1797 Ga0207649_10284467
1798 Ga0207652_10008595
1799 Ga0207652_10026326
1800 Ga0207652_10026918
1801 Ga0207652_10030274
1802 Ga0207652_10030667
1803 Ga0207652_10030742
1804 Ga0207652_10052565
1805 Ga0207652_10086696
1806 Ga0207652_10348095
1807 Ga0207652_10556198
1808 Ga0207646_10078163
1809 Ga0207646_10110025
1810 Ga0207646_10883508
1811 Ga0207694_10158109
1812 Ga0207694_10185525
1813 Ga0207694_10266024
1814 Ga0207694_10334248
1815 Ga0207694_10787324
1816 Ga0207687_10096274
1817 Ga0207687_10142997
1818 Ga0207687_10175149
1819 Ga0207700_10000001
1820 Ga0207700_10030373
1821 Ga0207700_10167035
1822 Ga0207700_10303550
1823 Ga0207700_10713367
1824 Ga0207664_10008730
1825 Ga0207664_10042035
1826 Ga0207664_10061003
1827 Ga0207664_10065134
1828 Ga0207664_10066266
1829 Ga0207664_10067844
1830 Ga0207664_10079940
1831 Ga0207664_10298402
1832 Ga0207644_10627433
1833 Ga0207644_10669034
1834 Ga0207690_10018829
1835 Ga0207690_10197890
1836 Ga0207690_11075618
1837 Ga0207706_10007121
1838 Ga0207706_10015927
1839 Ga0207686_10159011
1840 Ga0207686_10521099
1841 Ga0207686_10743127
1842 Ga0207709_10265412
1843 Ga0207669_10593441
1844 Ga0207704_10134375
1845 Ga0207704_10203795
1846 Ga0207704_10467756
1847 Ga0207665_10000146
1848 Ga0207665_10021141
1849 Ga0207665_10049684
1850 Ga0207665_10119006
1851 Ga0207689_10171619
1852 Ga0207661_10015658
1853 Ga0207661_10018237
1854 Ga0207661_10046700
1855 Ga0207661_10095601
1856 Ga0207661_10139938
1857 Ga0207661_10786084
1858 Ga0207667_10023766
1859 Ga0207667_10042931
1860 Ga0207667_10049080
1861 Ga0207667_10063696
1862 Ga0207667_10094646
1863 Ga0207667_10112308
1864 Ga0207667_10163545
1865 Ga0207667_10284003
1866 Ga0207667_10308824
1867 Ga0207667_10486804
1868 Ga0207651_10194042
1869 Ga0207712_10076970
1870 Ga0207640_10581670
1871 Ga0207658_10014093
1872 Ga0207677_10119414
1873 Ga0207677_10129902
1874 Ga0207677_10479382
1875 Ga0207677_10630034
1876 Ga0207703_10206964
1877 Ga0207639_11082502
1878 Ga0207678_10489210
1879 Ga0207678_10555866
1880 Ga0207708_10113974
1881 Ga0207702_10245026
1882 Ga0207702_10433490
1883 Ga0207702_10456585
1884 Ga0207702_10475285
1885 Ga0207648_10088051
1886 Ga0207676_11117201
1887 Ga0207674_10019053
1888 Ga0207674_10043887
1889 Ga0207674_10087770
1890 Ga0207674_10170622
1891 Ga0207674_10578081
1892 Ga0207675_100006643
1893 Ga0207675_100187622
1894 Ga0207683_10012401
1895 Ga0207683_10014743
1896 Ga0207683_10545586
1897 Ga0207683_10750272
1898 Ga0207698_10051628
1899 Ga0207698_10180109
1900 Ga0207698_10442539
1901 Ga0207428_10095826
1902 Ga0268266_10304158
1903 Ga0268265_10329218
1904 Ga0265326_10097812
1905 Ga0265319_1001275
1906 Ga0265319_1005524
1907 Ga0265319_1031145
1908 Ga0265319_1040736
1909 Ga0265334_10000542
1910 Ga0265334_10008317
1911 Ga0265318_10000276
1912 Ga0265318_10015788
1913 Ga0265318_10076336
1914 Ga0265323_10024468
1915 Ga0265322_10024396
1916 Ga0265336_10047508
1917 Ga0265338_10017462
1918 Ga0265338_10024846
1919 Ga0265338_10055972
1920 Ga0265338_10122790
1921 Ga0265338_10170725
1922 Ga0265324_10013644
1923 Ga0265324_10145453
1924 Ga0265330_10000888
1925 Ga0265330_10011338
1926 Ga0265332_10012350
1927 Ga0265328_10001224
1928 Ga0265320_10035999
1929 Ga0265320_10101522
1930 Ga0265325_10001745
1931 Ga0265325_10071493
1932 Ga0265325_10082195
1933 Ga0265329_10029686
1934 Ga0265340_10001237
1935 Ga0265340_10046610
1936 Ga0265340_10208973
1937 Ga0265339_10042865
1938 Ga0265331_10000959
1939 Ga0265331_10021613
1940 Ga0265331_10200273
1941 Ga0265327_10012224
1942 Ga0265327_10069980
1943 Ga0265316_10002153
1944 Ga0265316_10024056
1945 Ga0265316_10289811
1946 Ga0307408_100063581
1947 Ga0307408_100334019
1948 Ga0265313_10002758
1949 Ga0265313_10058544
1950 Ga0265313_10115907
1951 Ga0265314_10018097
1952 Ga0265314_10027632
1953 Ga0265342_10011564
1954 Ga0265342_10152463
1955 Ga0307405_10044112
1956 Ga0307410_10009172
1957 Ga0307406_10158612
1958 Ga0307406_10270158
1959 Ga0307407_10073184
1960 Ga0307412_10036218
1961 Ga0307412_10605937
1962 Ga0307409_100004736
1963 Ga0307416_100025483
1964 Ga0307416_100059067
1965 Ga0307416_100093554
1966 Ga0307416_100119644
1967 Ga0307411_10005329
1968 Ga0307415_100001447
1969 Ga0307415_100021574
1970 Ga0307415_100121329
1971 Ga0307415_100496769
1972 Ga0373948_0006809
1973 Ga0373959_0049596
1974 Ga0373926_0025609
1975 Ga0373926_0040375
1976 Ga0373926_0057815
1977 Ga0373928_0005155
1978 Ga0373929_0005100
1979 Ga0373929_0018931
1980 Ga0373944_0009624
1981 Ga0373944_0081566
1982 Ga0373949_0021962
1983 Ga0373932_0002679
1984 Ga0373936_0049871
1985 Ga0373936_0216551
1986 Ga0373939_0003023
1987 Ga0373939_0043509
1988 Ga0373941_0004411
1989 Ga0373941_0019264
1990 Ga0373945_0002294
1991 Ga0373943_0000138
1992 Ga0373943_0009977
1993 Ga0373943_0026436
1994 Ga0373946_0004089
1995 Ga0373942_0010786
1996 Ga0373962_0105163
1997 Ga0373931_0076962
1998 Ga0373931_0254857
1999 Ga0373935_0011408
2000 Ga0373935_0230730
2001 Ga0373927_0003815
2002 Ga0373927_0026654
2003 Ga0373947_0000341
2004 Ga0373947_0001997
2005 Ga0373947_0012643
2006 Ga0373947_0098462
2007 Ga0373937_0193520
2008 Ga0373937_0295087
2009 Ga0373925_0005884
2010 Ga0373925_0013009
2011 Ga0373925_0015551
2012 Ga0373925_0058299
2013 Ga0395899_0002546
2014 Ga0395899_0005507
2015 Ga0395899_0010299
2016 Ga0395899_0013850
2017 Ga0395899_0023030
2018 Ga0395899_0033666
2019 Ga0395899_0061130
2020 Ga0395899_0090643
2021 Ga0395899_0095253
2022 Ga0395899_0098507
2023 Ga0395899_0100614
2024 Ga0395899_0103058
2025 Ga0395899_0162991
2026 Ga0395900_0004292
2027 Ga0395900_0005329
2028 Ga0395900_0007939
2029 Ga0395900_0009570
2030 Ga0395900_0009982
2031 Ga0395900_0010097
2032 Ga0395900_0041260
2033 Ga0395900_0042835
2034 Ga0395900_0065552
2035 Ga0395900_0070152
2036 Ga0395900_0087704
2037 Ga0395900_0096441
2038 Ga0395900_0108791
2039 Ga0395900_0165659
2040 Ga0395900_0181992
2041 Ga0395900_0353226
2042 Ga0395900_0396334
2043 Ga0395900_0420102
2044 Ga0395900_0466149
2045 Ga0395900_0487187
2046 Ga0395900_0633417
2047 Ga0395900_0955006
2048 Ga0395898_0001631
2049 Ga0395898_0002095
2050 Ga0395898_0006255
2051 Ga0395898_0006291
2052 Ga0395898_0019037
2053 Ga0395898_0023536
2054 Ga0395898_0032301
2055 Ga0395898_0032496
2056 Ga0395898_0066573
2057 Ga0395898_0108137
2058 Ga0395898_0125916
2059 Ga0395898_0155567
2060 Ga0395898_0170507
2061 Ga0395898_0179127
2062 Ga0395898_0187122
2063 Ga0395898_0289532
2064 Ga0395898_0353186
2065 Ga0395898_0391793
2066 Ga0395898_0418877
2067 Ga0395898_0509023
2068 Ga0395898_0543911
2069 Ga0395898_0590166
2070 Ga0395905_0004797
2071 Ga0395905_0004929
2072 Ga0395905_0009450
2073 Ga0395905_0010819
2074 Ga0395905_0039716
2075 Ga0395905_0046976
2076 Ga0395905_0055930
2077 Ga0395905_0065572
2078 Ga0395905_0075743
2079 Ga0395905_0087562
2080 Ga0395905_0134619
2081 Ga0395905_0170797
2082 Ga0395905_0181290
2083 Ga0395905_0301215
2084 Ga0395905_0401169
2085 Ga0395905_0628352
2086 Ga0395905_0669211
2087 Ga0395905_0684576
2088 Ga0395901_0000370
2089 Ga0395901_0002781
2090 Ga0395901_0007108
2091 Ga0395901_0008638
2092 Ga0395901_0008830
2093 Ga0395901_0010224
2094 Ga0395901_0015385
2095 Ga0395901_0017424
2096 Ga0395901_0021691
2097 Ga0395901_0031941
2098 Ga0395901_0043130
2099 Ga0395901_0060529
2100 Ga0395901_0085451
2101 Ga0395901_0099551
2102 Ga0395901_0123264
2103 Ga0395901_0136253
2104 Ga0395901_0172238
2105 Ga0395901_0175044
2106 Ga0395901_0190818
2107 Ga0395901_0209330
2108 Ga0395901_0279796
2109 Ga0395901_0311270
2110 Ga0395901_0473359
2111 Ga0395901_0600070
2112 Ga0395901_0679821
2113 Ga0436365_0045703
2114 Ga0436365_0408949
2115 Ga0436360_0331421
2116 Ga0436363_0152649
2117 Ga0439453_0002584
2118 Ga0451853_1962744
2119 Ga0451853_2140449
2120 Ga0439451_003932
2121 Ga0439454_000703
2122 Ga0450915_000315
2123 Ga0439434_0021593
2124 Ga0439464_0142132
2125 Ga0439460_0080028
2126 Ga0466969_0001022
2127 Ga0466965_0033821
2128 Ga0466965_0137473
2129 Ga0466965_0195053
2130 Ga0466966_0012031
2131 Ga0466966_0067725
2132 Ga0466966_0180162
2133 Ga0466966_0265413
2134 Ga0466961_0001191
2135 Ga0466961_0018390
2136 Ga0466961_0074851
2137 Ga0466961_0121201
2138 Ga0466961_0132631
2139 Ga0466961_0221409
2140 Ga0466961_0416819
2141 Ga0466963_0000914
2142 Ga0466963_0001196
2143 Ga0466963_0001298
2144 Ga0466963_0001427
2145 Ga0466963_0002207
2146 Ga0466963_0008622
2147 Ga0466963_0017329
2148 Ga0466963_0017933
2149 Ga0466963_0025101
2150 Ga0466963_0043425
2151 Ga0466963_0048505
2152 Ga0466963_0066982
2153 Ga0466963_0084695
2154 Ga0466963_0094273
2155 Ga0466963_0266345
2156 Ga0466963_0267948
2157 Ga0466963_0306672
2158 Ga0466964_0000233
2159 Ga0466964_0001964
2160 Ga0466964_0005348
2161 Ga0466964_0019611
2162 Ga0466964_0043634
2163 Ga0466964_0078904
2164 Ga0453684_1065801
2165 Ga0466971_0000350
2166 Ga0466971_0003188
2167 Ga0466971_0026888
2168 Ga0466971_0103101
2169 Ga0466971_0119714
2170 Ga0466968_0001689
2171 Ga0466968_0002266
2172 Ga0466968_0036088
2173 Ga0466968_0160153
2174 Ga0466968_0161678
2175 Ga0466970_0063311
2176 Ga0466970_0106285
2177 Ga0466970_0114880
2178 Ga0466957_0029553
2179 Ga0466957_0107554
2180 Ga0466957_0153241
2181 Ga0466957_0204107
2182 Ga0466960_0015693
2183 Ga0466960_0090430
2184 Ga0466959_0004794
2185 Ga0466959_0040920
2186 Ga0466959_0041197
2187 Ga0466959_0135980
2188 Ga0466959_0614810
2189 Ga0451576_0307526
2190 Ga0466958_0000492
2191 Ga0466958_0000876
2192 Ga0466958_0001126
2193 Ga0466958_0002049
2194 Ga0466958_0004846
2195 Ga0466958_0008105
2196 Ga0466958_0037288
2197 Ga0466958_0074057
2198 Ga0466958_0108466
2199 Ga0466958_0186531
2200 Ga0466967_0001317
2201 Ga0466967_0003283
2202 Ga0466967_0004635
2203 Ga0466967_0009901
2204 Ga0466967_0013679
2205 Ga0466967_0018661
2206 Ga0466967_0019638
2207 Ga0466967_0019874
2208 Ga0466967_0020088
2209 Ga0466967_0025389
2210 Ga0466967_0030402
2211 Ga0466967_0030404
2212 Ga0466967_0030640
2213 Ga0466967_0041340
2214 Ga0466967_0043208
2215 Ga0466967_0046522
2216 Ga0466967_0063686
2217 Ga0466967_0068456
2218 Ga0466967_0070566
2219 Ga0466967_0071017
2220 Ga0466967_0078771
2221 Ga0466967_0117299
2222 Ga0466967_0168476
2223 Ga0466967_0363050
2224 Ga0466967_0372857
2225 Ga0466967_0398526
2226 Ga0466967_0405502
2227 Ga0466967_0733478
2228 Ga0495592_0010091
2229 Ga0495603_0048410
2230 Ga0495629_0001540
2231 Ga0495629_0043195
2232 Ga0495629_0054498
2233 Ga0495629_0154537
2234 Ga0495641_0000345
2235 Ga0495641_0007704
2236 Ga0495641_0082697
2237 Ga0495641_0158876
2238 Ga0495651_0061025
2239 Ga0495651_0216805
2240 Ga0495653_0031375
2241 Ga0495653_0058748
2242 Ga0495653_0067578
2243 Ga0495653_0246594
2244 Ga0495580_0113602
2245 Ga0495582_0001048
2246 Ga0495582_0051190
2247 Ga0495582_0128748
2248 Ga0495605_0056627
2249 Ga0495605_0076891
2250 Ga0495639_0001922
2251 Ga0495639_0005637
2252 Ga0495639_0013660
2253 Ga0495662_0006548
2254 Ga0495662_0035412
2255 Ga0495662_0113919
2256 Ga0495664_0018381
2257 Ga0495664_0033236
2258 Ga0495664_0366805
2259 Ga0495585_0144735
2260 Ga0495596_0033129
2261 Ga0495596_0097745
2262 Ga0495607_0014777
2263 Ga0495608_0014286
2264 Ga0495608_0066666
2265 Ga0495608_0143594
2266 Ga0495608_0306503
2267 Ga0495618_0030099
2268 Ga0495618_0300554
2269 Ga0495628_0013401
2270 Ga0495628_0086213
2271 Ga0495628_0210053
2272 Ga0495630_0004423
2273 Ga0495630_0004589
2274 Ga0495630_0019816
2275 Ga0495630_0026576
2276 Ga0495630_0074042
2277 Ga0495630_0634288
2278 Ga0495630_0856793
2279 Ga0495637_0122992
2280 Ga0495644_0014567
2281 Ga0495663_0014503
2282 Ga0495663_0057717
2283 Ga0495666_0001773
2284 Ga0495666_0025487
2285 Ga0495652_0068656
2286 Ga0495652_0212969
2287 Ga0495652_0309765
2288 Ga0495665_0001821
2289 Ga0495665_0044257
2290 Ga0495665_0226950
2291 Ga0495640_0006831
2292 Ga0495640_0011558
2293 Ga0495640_0035333
2294 Ga0495640_0055283
2295 Ga0495640_0087369
2296 Ga0495586_0052091
2297 Ga0495587_0074226
2298 Ga0495587_0227501
2299 Ga0495598_0063417
2300 Ga0495598_0066037
2301 Ga0495645_0111378
2302 Ga0495667_0006269
2303 Ga0495667_0024684
2304 Ga0495667_0033526
2305 Ga0495667_0523925
2306 Ga0495656_0056885
2307 Ga0495656_0068538
2308 Ga0495656_0340869
2309 Ga0495668_0056101
2310 Ga0495634_0011233
2311 Ga0495634_0045402
2312 Ga0495634_0098949
2313 Ga0495634_0112610
2314 Ga0495635_0025411
2315 Ga0495635_0059627
2316 Ga0495635_0060626
2317 Ga0495659_0024285
2318 Ga0495659_0078481
2319 Ga0495661_0207929
2320 Ga0495661_0217056
2321 Ga0495661_0326713
2322 Ga0495661_0355249
2323 Ga0495657_0089649
2324 Ga0495657_0125014
2325 Ga0495599_0010401
2326 Ga0495599_0031007
2327 Ga0495623_0158336
2328 Ga0495646_0057450
2329 Ga0495646_0107840
2330 Ga0495647_0001758
2331 Ga0495647_0015615
2332 Ga0495647_0180771
2333 Ga0495658_0014748
2334 Ga0495613_0003061
2335 Ga0495613_0006852
2336 Ga0495613_0012262
2337 Ga0495613_0241034
2338 Ga0495613_0363199
2339 Ga0495624_0012668
2340 Ga0495624_0310965
2341 Ga0495670_0168439
2342 Ga0495670_0277107
2343 Ga0495589_0036770
2344 Ga0495589_0094783
2345 Ga0495600_0027301
2346 Ga0495600_0029037
2347 Ga0495600_0037562
2348 Ga0495600_0091930
2349 Ga0495581_0000640
2350 Ga0495581_0060409
2351 Ga0495581_0081532
2352 Ga0495581_0504783
2353 Ga0495604_0175080
2354 Ga0495636_0033683
2355 Ga0495674_0003918
2356 Ga0495674_0011997
2357 Ga0495674_0069697
2358 Ga0495674_0334072
2359 Ga0495674_0400817
2360 Ga0495674_0624824
2361 Ga0495674_0731160
2362 Ga0495674_0811335
2363 Ga0495676_0003723
2364 Ga0495676_0137379
2365 Ga0495676_0142362
2366 Ga0495680_0003420
2367 Ga0495680_0007640
2368 Ga0495680_0009501
2369 Ga0495680_0059275
2370 Ga0495680_0069617
2371 Ga0495680_0106490
2372 Ga0495680_0128468
2373 Ga0495680_0184195
2374 Ga0495683_0255591
2375 Ga0495675_0252150
2376 Ga0495677_0083639
2377 Ga0495685_106620
2378 Ga0495684_0009129
2379 Ga0495684_0009734
2380 Ga0495684_0025768
2381 Ga0495684_0026040
2382 Ga0495684_0100572
2383 Ga0495593_0007309
2384 Ga0495593_0009917
2385 Ga0495593_0113406
2386 Ga0495602_0037471
2387 Ga0495602_0190863
2388 Ga0495602_0211878
2389 Ga0495614_0003782
2390 Ga0495614_0013122
2391 Ga0495614_0113314
2392 Ga0496100_0016415
2393 Ga0496100_0056176
2394 Ga0496100_0085771
2395 Ga0496100_0133843
2396 Ga0496100_0662367
2397 Ga0496100_0673465
2398 Ga0496101_0019418
2399 Ga0496101_0044715
2400 Ga0496101_0147626
2401 Ga0496101_0205586
2402 Ga0496101_0219394
2403 Ga0496101_0447588
2404 Ga0496102_0020289
2405 Ga0496102_0036831
2406 Ga0496102_0037438
2407 Ga0496102_0092371
2408 Ga0496102_0141408
2409 Ga0496102_0162458
2410 Ga0496102_0284794
2411 Ga0496102_0299731
2412 Ga0496103_0005924
2413 Ga0496103_0012326
2414 Ga0496103_0019732
2415 Ga0496103_0092671
2416 Ga0496103_0151496
2417 Ga0496103_0218169
2418 Ga0496103_0254755
2419 Ga0496103_0571310
2420 Ga0496104_0000597
2421 Ga0496104_0013270
2422 Ga0496104_0013604
2423 Ga0496104_0031080
2424 Ga0496104_0052918
2425 Ga0496104_0074798
2426 Ga0496104_0129318
2427 Ga0496104_0257327
2428 Ga0496104_0502552
2429 Ga0496105_0001972
2430 Ga0496105_0004171
2431 Ga0496105_0039193
2432 Ga0496105_0061821
2433 Ga0496105_0115274
2434 Ga0496105_0212297
2435 Ga0496105_0259761
2436 Ga0496106_0002814
2437 Ga0496106_0008591
2438 Ga0496106_0025881
2439 Ga0496106_0040822
2440 Ga0496106_0045709
2441 Ga0496106_0162704
2442 Ga0496106_0325518
2443 Ga0496107_0021210
2444 Ga0496107_0033970
2445 Ga0496107_0067508
2446 Ga0496107_0222777
2447 Ga0496107_0453477
2448 Ga0496108_0002280
2449 Ga0496108_0022242
2450 Ga0496108_0027385
2451 Ga0496108_0039676
2452 Ga0496108_0048543
2453 Ga0496108_0092962
2454 Ga0496108_0288167
2455 Ga0496108_0341157
2456 Ga0496108_0367695
2457 Ga0496109_0001523
2458 Ga0496109_0002331
2459 Ga0496109_0002799
2460 Ga0496109_0019767
2461 Ga0496109_0044373
2462 Ga0496109_0075962
2463 Ga0496109_0223782
2464 Ga0496109_0237574
2465 Ga0496109_0276534
2466 Ga0496109_0684785
2467 Ga0496109_0869168
2468 Ga0496110_0000705
2469 Ga0496110_0007799
2470 Ga0496110_0034853
2471 Ga0496110_0051582
2472 Ga0496110_0056524
2473 Ga0496110_0080639
2474 Ga0496110_0126756
2475 Ga0496110_0173140
2476 Ga0496110_0216147
2477 Ga0496110_0252949
2478 Ga0496110_0359636
2479 Ga0496110_0516604
2480 Ga0496110_0645599
2481 Ga0496110_0745444
2482 Ga0496111_0000376
2483 Ga0496111_0012316
2484 Ga0496111_0027287
2485 Ga0496111_0029684
2486 Ga0496111_0041012
2487 Ga0496111_0053296
2488 Ga0496111_0075106
2489 Ga0496111_0075143
2490 Ga0496111_0094976
2491 Ga0496111_0122181
2492 Ga0496111_0446654
2493 Ga0496111_0745917
2494 Ga0496112_0003554
2495 Ga0496112_0005672
2496 Ga0496112_0016462
2497 Ga0496112_0031983
2498 Ga0496112_0081396
2499 Ga0496112_0083785
2500 Ga0496112_0089498
2501 Ga0496112_0090358
2502 Ga0496112_0098079
2503 Ga0496112_0125752
2504 Ga0496112_0236190
2505 Ga0496112_0339565
2506 Ga0496112_0378110
2507 Ga0496112_0540549
2508 Ga0496112_0635487
2509 Ga0496112_0943085
2510 Ga0496112_1052825
2511 Ga0496113_0000365
2512 Ga0496113_0011892
2513 Ga0496113_0025896
2514 Ga0496113_0062165
2515 Ga0496113_0108695
2516 Ga0496113_0342515
2517 Ga0496113_0422676
2518 Ga0496113_0494573
2519 Ga0496113_0680796
2520 Ga0496114_0000875
2521 Ga0496114_0003727
2522 Ga0496114_0003888
2523 Ga0496114_0006300
2524 Ga0496114_0071477
2525 Ga0496114_0081498
2526 Ga0496114_0085145
2527 Ga0496115_0015946
2528 Ga0496115_0021221
2529 Ga0496115_0026457
2530 Ga0496115_0038292
2531 Ga0496115_0152250
2532 Ga0496115_0255717
2533 Ga0496115_0263124
2534 Ga0496115_0388021
2535 Ga0501031_0015574
2536 Ga0501031_0249094
2537 Ga0501032_0041691
2538 Ga0501033_0003478
2539 Ga0501036_0120170
2540 Ga0501036_0228234
2541 Ga0501036_0253053
2542 Ga0501036_0613279
2543 Ga0501037_0429802
2544 Ga0501038_0007188
2545 Ga0501039_0006217
2546 Ga0501040_0006556
2547 Ga0501040_0056858
2548 Ga0501041_0051932
2549 Ga0501041_0112294
2550 Ga0501041_0253714
2551 Ga0501041_0388813
2552 Ga0501042_0108718
2553 Ga0501042_0134720
2554 Ga0501042_0193588
2555 Ga0501046_0088158
2556 Ga0501046_0253414
2557 Ga0501047_0065789
2558 Ga0501047_0334410
2559 Ga0501047_0508346
2560 Ga0501048_0004133
2561 Ga0501048_0043247
2562 Ga0501048_0290927
2563 Ga0501067_0009283
2564 Ga0501067_0011107
2565 Ga0501067_0062842
2566 Ga0501067_0097317
2567 Ga0501067_0147539
2568 Ga0501068_0014707
2569 Ga0501068_0177369
2570 Ga0501069_0005135
2571 Ga0501069_0010254
2572 Ga0501069_0011091
2573 Ga0501069_0285999
2574 Ga0501069_0553666
2575 Ga0501070_0001687
2576 Ga0501070_0020705
2577 Ga0501070_0065141
2578 Ga0501070_0115152
2579 Ga0501070_0172154
2580 Ga0501070_0197781
2581 Ga0501071_0030185
2582 Ga0501071_0035802
2583 Ga0501071_0133404
2584 Ga0501071_0305393
2585 Ga0501071_0475411
2586 Ga0501072_0025169
2587 Ga0501072_0338490
2588 Ga0501072_0349252
2589 Ga0501073_0021069
2590 Ga0501073_0194205
2591 Ga0501074_0033377
2592 Ga0501074_0050163
2593 Ga0501075_0021220
2594 Ga0501075_0215136
2595 Ga0501075_0339142
2596 Ga0501076_0074317
2597 Ga0501077_0010555
2598 Ga0501077_0393909
2599 Ga0501079_0043846
2600 Ga0501079_0125266
2601 Ga0501079_0158570
2602 Ga0501079_0179968
2603 Ga0501079_0336072
2604 Ga0501080_0002220
2605 Ga0501080_0020012
2606 Ga0501080_0103637
2607 Ga0501080_0645064
2608 Ga0501035_0270052
2609 Ga0501044_0330937
2610 Ga0501045_0074232
2611 Ga0501045_0140853
2612 Ga0501045_0141827
2613 nmdc:mga03683_351791_c1
2614 nmdc:mga0yw44_209626_c1
2615 nmdc:mga0yw44_87322_c1
2616 nmdc:mga05p37_107311_c1
2617 nmdc:mga05p37_127566_c1
2618 nmdc:mga05p37_542042_c1
2619 nmdc:mga05p37_553118_c1
2620 nmdc:mga05p37_91702_c1
2621 nmdc:mga06r32_184713_c1
2622 nmdc:mga06r32_972358_c1
2623 nmdc:mga08y16_484210_c1
2624 nmdc:mga08y16_903218_c1
2625 nmdc:mga0n895_212756_c1
2626 nmdc:mga0n895_61794_c1
2627 nmdc:mga0n895_736325_c1
2628 nmdc:mga0n895_94422_c1
2629 nmdc:mga0rr50_1104_c1
2630 nmdc:mga0rr50_12626_c1
2631 nmdc:mga0rr50_2852_c1
2632 nmdc:mga0rr50_436527_c1
2633 nmdc:mga08x19_142283_c1
2634 nmdc:mga08x19_19984_c1
2635 nmdc:mga08x19_24515_c1
2636 nmdc:mga08x19_343034_c1
2637 nmdc:mga08x19_63446_c1
2638 nmdc:mga0a205_112190_c1
2639 nmdc:mga0a205_277764_c1
2640 nmdc:mga0a205_515_c1
2641 nmdc:mga0a205_9751_c1
2642 Ga0495601_0014598
2643 Ga0495601_0076650
2644 Ga0495601_0087702
2645 Ga0495612_0011591
2646 Ga0495612_0106127
2647 Ga0495655_0023757
2648 Ga0495595_0023425
2649 Ga0495595_0023655
2650 Ga0495595_0136298
2651 Ga0495619_0001634
2652 Ga0495619_0001785
2653 Ga0495619_0026394
2654 Ga0495619_0047443
2655 Ga0495619_0143491
2656 Ga0495619_0412282
2657 Ga0501084_0058435
2658 Ga0501084_0083864
2659 Ga0501084_0193152
2660 Ga0590071_039404
2661 Ga0587080_026740
2662 Ga0587069_030973
2663 Ga0501082_0022132
2664 Ga0501082_0119272
2665 Ga0501082_0358301
2666 Ga0466962_0001433
2667 Ga0466962_0004216
2668 Ga0466962_0004975
2669 Ga0466962_0023407
2670 Ga0466962_0062581
2671 Ga0530510_0024738
2672 Ga0530510_0026118
2673 Ga0530510_0031504
2674 Ga0530510_0287929

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

90

190

0.94

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

18

92

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f6e-assembly1.cif.gz_B crystal structure of the k182r, a183p mutant manganese superoxide dismutase from sacchromyces cerevisiae 0.9177 34 224
3lsu-assembly1.cif.gz_B crystal structure of sod2 from saccharomyces cerevisiae 0.9171 34 224
4e4e-assembly1.cif.gz_A crystal structure of the y34f mutant of saccharomyces cerevisiae manganese superoxide dismutase 0.916 34 225
1b06-assembly1.cif.gz_A superoxide dismutase from sulfolobus acidocaldarius 0.9006 31 225
1var-assembly1.cif.gz_A mitochondrial manganese superoxide dismutase variant with ile 58 replaced by thr 0.899 34 224
ID Description Score Start End Superfamily
af_P41980_114_231_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9009 121 224 3.55.40.20
af_I1LCI3_113_243_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8923 116 225 3.55.40.20
af_Q5VRL3_214_359_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8917 118 226 3.55.40.20
1xuqA02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8899 118 224 3.55.40.20
af_B6TW42_23_136_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8782 55 104 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7W0SYJ9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.952 107 230 GO:0004784
GO:0046872
AF-A0A7W0NJF7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9446 30 230 GO:0004784
GO:0046872
AF-A0A7W0SYJ9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9446 107 230 GO:0004784
GO:0046872
AF-A0A7V6DDK2-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9421 101 226 GO:0004784
GO:0046872
AF-A0A2M7EKS5-F1-model_v4 Manganese/iron superoxide dismutase C-terminal domain-containing protein 0.9373 98 226 GO:0004784
GO:0005737
GO:0046872

Map