F493073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1330 | 332 | 2660 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10014139|Ga0157378_100141394 |
| Length | 217 |
| Sequence | VARRRRAEHDGWARMSASPVTDAQLIARCVVGDDRHAFAELVRRHQSAVRACLRKLTTGDAALADDLAQETFVLAWRNLKSFRQDARFSTWLYRIATNCWLMHARKRKEELLGDRDDAIPDDDHDAMSHLTDTAVDHTRASTLRMYLERAMRVLSEPERAAIVQCYHNDLSHEEAAYVLGIPVGTVKTHVLRAKQKLKVAMASWNPEAASGTAEGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 252 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 255 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 256 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 257 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 258 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 259 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.92 |
| Metatranscriptomes | 0.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.74 |
| Rhizosphere | 94.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10014139 | 3300013297 | Bacteria | 6984 |
| 2 | SwRhRL2b_contig_1634644 | 2162886007 | Bacteria | 1081 |
| 3 | SwRhRL2b_contig_387844 | 2162886007 | Bacteria | 1068 |
| 4 | JGI24035J26624_1001983 | 3300002126 | Bacteria | 1906 |
| 5 | rootL2_10328949 | 3300003322 | Bacteria | 2370 |
| 6 | JGI25405J52794_10000323 | 3300003911 | Bacteria | 6609 |
| 7 | JGI25405J52794_10001843 | 3300003911 | Bacteria | 3563 |
| 8 | JGI25405J52794_10001884 | 3300003911 | Bacteria | 3537 |
| 9 | Ga0065704_10004765 | 3300005289 | Bacteria | 4798 |
| 10 | Ga0065704_10234770 | 3300005289 | Bacteria | 1032 |
| 11 | Ga0065712_10006901 | 3300005290 | Bacteria | 3276 |
| 12 | Ga0065712_10009838 | 3300005290 | Bacteria | 3430 |
| 13 | Ga0065715_10008051 | 3300005293 | Bacteria | 2745 |
| 14 | Ga0065715_10013045 | 3300005293 | Unclassified | 2152 |
| 15 | Ga0065715_10048647 | 3300005293 | Bacteria | 1093 |
| 16 | Ga0065715_10109052 | 3300005293 | Bacteria | 2668 |
| 17 | Ga0065715_10240229 | 3300005293 | Bacteria | 1202 |
| 18 | Ga0065715_10282308 | 3300005293 | Bacteria | 1083 |
| 19 | Ga0065715_10336623 | 3300005293 | Bacteria | 966 |
| 20 | Ga0065715_10425309 | 3300005293 | Bacteria | 832 |
| 21 | Ga0065707_10219050 | 3300005295 | Bacteria | 1232 |
| 22 | Ga0070658_10009067 | 3300005327 | Bacteria | 8004 |
| 23 | Ga0070676_10001268 | 3300005328 | Bacteria | 12689 |
| 24 | Ga0070676_10045600 | 3300005328 | Bacteria | 2553 |
| 25 | Ga0070676_10057250 | 3300005328 | Unclassified | 2306 |
| 26 | Ga0070676_10083387 | 3300005328 | Bacteria | 1944 |
| 27 | Ga0070683_100004758 | 3300005329 | Bacteria | 11234 |
| 28 | Ga0070683_100017515 | 3300005329 | Bacteria | 6332 |
| 29 | Ga0070683_100041501 | 3300005329 | Bacteria | 4233 |
| 30 | Ga0070683_100253871 | 3300005329 | Bacteria | 1672 |
| 31 | Ga0070683_100400758 | 3300005329 | Bacteria | 1308 |
| 32 | Ga0070690_100019100 | 3300005330 | Bacteria | 4153 |
| 33 | Ga0070690_100019262 | 3300005330 | Bacteria | 4138 |
| 34 | Ga0070690_100168997 | 3300005330 | Unclassified | 1504 |
| 35 | Ga0070670_100031216 | 3300005331 | Bacteria | 4588 |
| 36 | Ga0070670_100153032 | 3300005331 | Bacteria | 1996 |
| 37 | Ga0070670_100232408 | 3300005331 | Bacteria | 1605 |
| 38 | Ga0070670_100252135 | 3300005331 | Bacteria | 1538 |
| 39 | Ga0070677_10000242 | 3300005333 | Bacteria | 18978 |
| 40 | Ga0070677_10064647 | 3300005333 | Bacteria | 1520 |
| 41 | Ga0070677_10121982 | 3300005333 | Unclassified | 1178 |
| 42 | Ga0068869_100086683 | 3300005334 | Bacteria | 2347 |
| 43 | Ga0068869_100087886 | 3300005334 | Bacteria | 2332 |
| 44 | Ga0070666_10001424 | 3300005335 | Bacteria | 14500 |
| 45 | Ga0070666_10013532 | 3300005335 | Bacteria | 5179 |
| 46 | Ga0070666_10035493 | 3300005335 | Bacteria | 3307 |
| 47 | Ga0070666_10064321 | 3300005335 | Bacteria | 2488 |
| 48 | Ga0070666_10138075 | 3300005335 | Bacteria | 1697 |
| 49 | Ga0070666_10196339 | 3300005335 | Bacteria | 1419 |
| 50 | Ga0070666_10204638 | 3300005335 | Unclassified | 1389 |
| 51 | Ga0070680_100016424 | 3300005336 | Bacteria | 5827 |
| 52 | Ga0070680_100150489 | 3300005336 | Bacteria | 1954 |
| 53 | Ga0070680_100304887 | 3300005336 | Bacteria | 1351 |
| 54 | Ga0070682_100064400 | 3300005337 | Bacteria | 2327 |
| 55 | Ga0070682_100123707 | 3300005337 | Bacteria | 1740 |
| 56 | Ga0068868_100002750 | 3300005338 | Bacteria | 12180 |
| 57 | Ga0068868_100006774 | 3300005338 | Bacteria | 8140 |
| 58 | Ga0068868_100010675 | 3300005338 | Bacteria | 6655 |
| 59 | Ga0068868_100192419 | 3300005338 | Bacteria | 1697 |
| 60 | Ga0068868_100200598 | 3300005338 | Bacteria | 1663 |
| 61 | Ga0068868_100328946 | 3300005338 | Unclassified | 1304 |
| 62 | Ga0068868_100374611 | 3300005338 | Unclassified | 1224 |
| 63 | Ga0068868_100412726 | 3300005338 | Bacteria | 1167 |
| 64 | Ga0068868_100439175 | 3300005338 | Bacteria | 1133 |
| 65 | Ga0070660_100000551 | 3300005339 | Bacteria | 25098 |
| 66 | Ga0070660_100118693 | 3300005339 | Bacteria | 2109 |
| 67 | Ga0070660_100130753 | 3300005339 | Unclassified | 2009 |
| 68 | Ga0070660_100291947 | 3300005339 | Bacteria | 1335 |
| 69 | Ga0070660_100507930 | 3300005339 | Unclassified | 1003 |
| 70 | Ga0070689_100013944 | 3300005340 | Bacteria | 5830 |
| 71 | Ga0070689_100017987 | 3300005340 | Bacteria | 5198 |
| 72 | Ga0070689_100160610 | 3300005340 | Unclassified | 1816 |
| 73 | Ga0070689_100328318 | 3300005340 | Bacteria | 1279 |
| 74 | Ga0070689_100421195 | 3300005340 | Bacteria | 1132 |
| 75 | Ga0070687_100024597 | 3300005343 | Bacteria | 2878 |
| 76 | Ga0070687_100034776 | 3300005343 | Bacteria | 2496 |
| 77 | Ga0070661_100007142 | 3300005344 | Bacteria | 7701 |
| 78 | Ga0070661_100033026 | 3300005344 | Bacteria | 3748 |
| 79 | Ga0070661_100033465 | 3300005344 | Bacteria | 3723 |
| 80 | Ga0070661_100041563 | 3300005344 | Bacteria | 3355 |
| 81 | Ga0070661_100118517 | 3300005344 | Bacteria | 1981 |
| 82 | Ga0070692_10223773 | 3300005345 | Bacteria | 1113 |
| 83 | Ga0070668_100001406 | 3300005347 | Bacteria | 17305 |
| 84 | Ga0070668_100003165 | 3300005347 | Bacteria | 12129 |
| 85 | Ga0070668_100045194 | 3300005347 | Bacteria | 3379 |
| 86 | Ga0070668_100219615 | 3300005347 | Bacteria | 1567 |
| 87 | Ga0070668_100607428 | 3300005347 | Unclassified | 957 |
| 88 | Ga0070668_101028943 | 3300005347 | Unclassified | 741 |
| 89 | Ga0070668_101652075 | 3300005347 | Unclassified | 587 |
| 90 | Ga0070669_100002287 | 3300005353 | Bacteria | 13893 |
| 91 | Ga0070669_100104050 | 3300005353 | Bacteria | 2146 |
| 92 | Ga0070669_100161040 | 3300005353 | Bacteria | 1744 |
| 93 | Ga0070669_100187338 | 3300005353 | Bacteria | 1622 |
| 94 | Ga0070669_100220747 | 3300005353 | Bacteria | 1498 |
| 95 | Ga0070669_100264653 | 3300005353 | Unclassified | 1373 |
| 96 | Ga0070669_100377487 | 3300005353 | Bacteria | 1156 |
| 97 | Ga0070669_100822886 | 3300005353 | Bacteria | 790 |
| 98 | Ga0070675_100002082 | 3300005354 | Bacteria | 14809 |
| 99 | Ga0070675_100022317 | 3300005354 | Bacteria | 5057 |
| 100 | Ga0070675_100030145 | 3300005354 | Bacteria | 4377 |
| 101 | Ga0070675_100049890 | 3300005354 | Bacteria | 3436 |
| 102 | Ga0070675_100063086 | 3300005354 | Bacteria | 3063 |
| 103 | Ga0070675_100067503 | 3300005354 | Bacteria | 2959 |
| 104 | Ga0070675_100071808 | 3300005354 | Bacteria | 2873 |
| 105 | Ga0070675_100103054 | 3300005354 | Unclassified | 2405 |
| 106 | Ga0070675_100104988 | 3300005354 | Bacteria | 2384 |
| 107 | Ga0070675_100156590 | 3300005354 | Unclassified | 1956 |
| 108 | Ga0070675_100248840 | 3300005354 | Bacteria | 1555 |
| 109 | Ga0070675_100572457 | 3300005354 | Unclassified | 1023 |
| 110 | Ga0070675_101386494 | 3300005354 | Bacteria | 648 |
| 111 | Ga0070671_100003277 | 3300005355 | Bacteria | 12629 |
| 112 | Ga0070671_100005547 | 3300005355 | Bacteria | 10050 |
| 113 | Ga0070671_100020112 | 3300005355 | Bacteria | 5440 |
| 114 | Ga0070671_100032550 | 3300005355 | Bacteria | 4310 |
| 115 | Ga0070671_100047316 | 3300005355 | Bacteria | 3577 |
| 116 | Ga0070671_100061954 | 3300005355 | Bacteria | 3115 |
| 117 | Ga0070671_100063682 | 3300005355 | Bacteria | 3071 |
| 118 | Ga0070671_100073286 | 3300005355 | Bacteria | 2860 |
| 119 | Ga0070671_100158350 | 3300005355 | Bacteria | 1914 |
| 120 | Ga0070671_100258573 | 3300005355 | Bacteria | 1480 |
| 121 | Ga0070674_100000659 | 3300005356 | Bacteria | 17432 |
| 122 | Ga0070674_100013733 | 3300005356 | Bacteria | 5013 |
| 123 | Ga0070674_100026238 | 3300005356 | Bacteria | 3802 |
| 124 | Ga0070674_100078097 | 3300005356 | Bacteria | 2358 |
| 125 | Ga0070674_100129882 | 3300005356 | Unclassified | 1877 |
| 126 | Ga0070673_100001356 | 3300005364 | Bacteria | 14306 |
| 127 | Ga0070673_100007946 | 3300005364 | Bacteria | 7029 |
| 128 | Ga0070673_100043069 | 3300005364 | Bacteria | 3485 |
| 129 | Ga0070673_100045749 | 3300005364 | Bacteria | 3396 |
| 130 | Ga0070673_100067957 | 3300005364 | Bacteria | 2852 |
| 131 | Ga0070673_100103167 | 3300005364 | Unclassified | 2352 |
| 132 | Ga0070673_100108362 | 3300005364 | Bacteria | 2300 |
| 133 | Ga0070673_100185865 | 3300005364 | Unclassified | 1781 |
| 134 | Ga0070673_100760360 | 3300005364 | Bacteria | 893 |
| 135 | Ga0070673_101433921 | 3300005364 | Unclassified | 650 |
| 136 | Ga0070688_100001625 | 3300005365 | Bacteria | 11248 |
| 137 | Ga0070688_100019806 | 3300005365 | Bacteria | 3903 |
| 138 | Ga0070688_100019867 | 3300005365 | Bacteria | 3897 |
| 139 | Ga0070688_100039269 | 3300005365 | Bacteria | 2896 |
| 140 | Ga0070688_100127953 | 3300005365 | Bacteria | 1710 |
| 141 | Ga0070688_100128143 | 3300005365 | Bacteria | 1708 |
| 142 | Ga0070688_100174111 | 3300005365 | Bacteria | 1488 |
| 143 | Ga0070659_100000779 | 3300005366 | Bacteria | 23129 |
| 144 | Ga0070659_100015404 | 3300005366 | Bacteria | 5726 |
| 145 | Ga0070659_100169517 | 3300005366 | Unclassified | 1788 |
| 146 | Ga0070659_100263081 | 3300005366 | Bacteria | 1431 |
| 147 | Ga0070659_100395158 | 3300005366 | Unclassified | 1166 |
| 148 | Ga0070659_100562625 | 3300005366 | Bacteria | 977 |
| 149 | Ga0070667_100003532 | 3300005367 | Bacteria | 13319 |
| 150 | Ga0070667_100003566 | 3300005367 | Bacteria | 13255 |
| 151 | Ga0070667_100008508 | 3300005367 | Bacteria | 8508 |
| 152 | Ga0070667_100078143 | 3300005367 | Bacteria | 2827 |
| 153 | Ga0070667_100084490 | 3300005367 | Bacteria | 2721 |
| 154 | Ga0070667_100106801 | 3300005367 | Unclassified | 2423 |
| 155 | Ga0070667_100151596 | 3300005367 | Bacteria | 2037 |
| 156 | Ga0070667_100385570 | 3300005367 | Bacteria | 1273 |
| 157 | Ga0070667_100398153 | 3300005367 | Bacteria | 1253 |
| 158 | Ga0070667_100583168 | 3300005367 | Unclassified | 1029 |
| 159 | Ga0070667_100677736 | 3300005367 | Bacteria | 953 |
| 160 | Ga0070667_100688044 | 3300005367 | Bacteria | 946 |
| 161 | Ga0070667_101120663 | 3300005367 | Unclassified | 736 |
| 162 | Ga0070703_10307702 | 3300005406 | Unclassified | 663 |
| 163 | Ga0070709_10020181 | 3300005434 | Bacteria | 3863 |
| 164 | Ga0070709_10055060 | 3300005434 | Bacteria | 2510 |
| 165 | Ga0070709_10111182 | 3300005434 | Unclassified | 1842 |
| 166 | Ga0070709_10160059 | 3300005434 | Bacteria | 1564 |
| 167 | Ga0070709_10201156 | 3300005434 | Bacteria | 1411 |
| 168 | Ga0070709_10603542 | 3300005434 | Unclassified | 845 |
| 169 | Ga0070714_100037722 | 3300005435 | Bacteria | 4062 |
| 170 | Ga0070714_100191387 | 3300005435 | Bacteria | 1867 |
| 171 | Ga0070714_100269800 | 3300005435 | Bacteria | 1578 |
| 172 | Ga0070714_100437980 | 3300005435 | Unclassified | 1240 |
| 173 | Ga0070714_100635017 | 3300005435 | Bacteria | 1027 |
| 174 | Ga0070713_100361069 | 3300005436 | Bacteria | 1349 |
| 175 | Ga0070713_100662013 | 3300005436 | Unclassified | 995 |
| 176 | Ga0070710_10004182 | 3300005437 | Bacteria | 6843 |
| 177 | Ga0070710_10028443 | 3300005437 | Bacteria | 2990 |
| 178 | Ga0070710_10101610 | 3300005437 | Bacteria | 1713 |
| 179 | Ga0070710_10168369 | 3300005437 | Bacteria | 1364 |
| 180 | Ga0070701_10422935 | 3300005438 | Bacteria | 849 |
| 181 | Ga0070711_100024261 | 3300005439 | Bacteria | 3953 |
| 182 | Ga0070711_100147637 | 3300005439 | Unclassified | 1770 |
| 183 | Ga0070711_100211133 | 3300005439 | Bacteria | 1503 |
| 184 | Ga0070711_100218554 | 3300005439 | Unclassified | 1480 |
| 185 | Ga0070711_100296505 | 3300005439 | Bacteria | 1284 |
| 186 | Ga0070711_100380197 | 3300005439 | Bacteria | 1142 |
| 187 | Ga0070705_100004271 | 3300005440 | Bacteria | 6968 |
| 188 | Ga0070705_100059114 | 3300005440 | Bacteria | 2268 |
| 189 | Ga0070705_100272660 | 3300005440 | Bacteria | 1199 |
| 190 | Ga0070705_100367598 | 3300005440 | Bacteria | 1054 |
| 191 | Ga0070705_100473101 | 3300005440 | Bacteria | 945 |
| 192 | Ga0070705_100587744 | 3300005440 | Unclassified | 859 |
| 193 | Ga0070700_100003307 | 3300005441 | Bacteria | 8313 |
| 194 | Ga0070700_100736289 | 3300005441 | Bacteria | 787 |
| 195 | Ga0070700_100873269 | 3300005441 | Unclassified | 730 |
| 196 | Ga0070694_100016263 | 3300005444 | Bacteria | 4683 |
| 197 | Ga0070708_100007814 | 3300005445 | Bacteria | 8571 |
| 198 | Ga0070708_100019108 | 3300005445 | Bacteria | 5749 |
| 199 | Ga0070708_100043795 | 3300005445 | Unclassified | 3933 |
| 200 | Ga0070708_100064287 | 3300005445 | Unclassified | 3287 |
| 201 | Ga0070708_100071797 | 3300005445 | Unclassified | 3117 |
| 202 | Ga0070708_100247664 | 3300005445 | Unclassified | 1674 |
| 203 | Ga0070708_100333778 | 3300005445 | Bacteria | 1429 |
| 204 | Ga0070708_100375406 | 3300005445 | Bacteria | 1341 |
| 205 | Ga0070663_100044095 | 3300005455 | Bacteria | 3142 |
| 206 | Ga0070663_100103241 | 3300005455 | Bacteria | 2131 |
| 207 | Ga0070678_100001796 | 3300005456 | Bacteria | 11558 |
| 208 | Ga0070678_100009966 | 3300005456 | Bacteria | 5781 |
| 209 | Ga0070678_100027767 | 3300005456 | Bacteria | 3848 |
| 210 | Ga0070678_100212798 | 3300005456 | Bacteria | 1602 |
| 211 | Ga0070678_100266656 | 3300005456 | Bacteria | 1442 |
| 212 | Ga0070678_100280893 | 3300005456 | Unclassified | 1408 |
| 213 | Ga0070678_100630034 | 3300005456 | Unclassified | 960 |
| 214 | Ga0070662_100000211 | 3300005457 | Bacteria | 34047 |
| 215 | Ga0070662_100012527 | 3300005457 | Bacteria | 5624 |
| 216 | Ga0070662_100118359 | 3300005457 | Bacteria | 2027 |
| 217 | Ga0070662_100118367 | 3300005457 | Bacteria | 2027 |
| 218 | Ga0070662_100459618 | 3300005457 | Bacteria | 1058 |
| 219 | Ga0070662_100634167 | 3300005457 | Unclassified | 901 |
| 220 | Ga0070681_10002421 | 3300005458 | Bacteria | 17061 |
| 221 | Ga0070681_10012806 | 3300005458 | Bacteria | 8326 |
| 222 | Ga0070681_10113966 | 3300005458 | Bacteria | 2642 |
| 223 | Ga0070681_11031101 | 3300005458 | Unclassified | 743 |
| 224 | Ga0068867_100002050 | 3300005459 | Bacteria | 14116 |
| 225 | Ga0068867_100002361 | 3300005459 | Bacteria | 13277 |
| 226 | Ga0068867_100046722 | 3300005459 | Bacteria | 3181 |
| 227 | Ga0068867_100165548 | 3300005459 | Bacteria | 1747 |
| 228 | Ga0068867_100190402 | 3300005459 | Bacteria | 1636 |
| 229 | Ga0068867_100299719 | 3300005459 | Unclassified | 1325 |
| 230 | Ga0068867_100464649 | 3300005459 | Bacteria | 1081 |
| 231 | Ga0070685_10055103 | 3300005466 | Unclassified | 2310 |
| 232 | Ga0070685_10185391 | 3300005466 | Bacteria | 1342 |
| 233 | Ga0070706_100000012 | 3300005467 | Bacteria | 195040 |
| 234 | Ga0070706_100010658 | 3300005467 | Bacteria | 8533 |
| 235 | Ga0070706_100011949 | 3300005467 | Bacteria | 8059 |
| 236 | Ga0070706_100025873 | 3300005467 | Bacteria | 5401 |
| 237 | Ga0070706_100147868 | 3300005467 | Bacteria | 2194 |
| 238 | Ga0070706_100155773 | 3300005467 | Bacteria | 2133 |
| 239 | Ga0070706_100295679 | 3300005467 | Unclassified | 1511 |
| 240 | Ga0070706_100342482 | 3300005467 | Unclassified | 1394 |
| 241 | Ga0070706_100418331 | 3300005467 | Unclassified | 1247 |
| 242 | Ga0070706_100906695 | 3300005467 | Bacteria | 814 |
| 243 | Ga0070706_100956876 | 3300005467 | Bacteria | 790 |
| 244 | Ga0070707_100007671 | 3300005468 | Bacteria | 10022 |
| 245 | Ga0070707_100039755 | 3300005468 | Bacteria | 4498 |
| 246 | Ga0070707_100043177 | 3300005468 | Bacteria | 4316 |
| 247 | Ga0070707_100055855 | 3300005468 | Bacteria | 3785 |
| 248 | Ga0070707_100075664 | 3300005468 | Bacteria | 3247 |
| 249 | Ga0070707_100121445 | 3300005468 | Unclassified | 2537 |
| 250 | Ga0070707_100145583 | 3300005468 | Bacteria | 2306 |
| 251 | Ga0070707_100157651 | 3300005468 | Bacteria | 2211 |
| 252 | Ga0070707_100186635 | 3300005468 | Bacteria | 2022 |
| 253 | Ga0070707_100186952 | 3300005468 | Bacteria | 2020 |
| 254 | Ga0070707_100355176 | 3300005468 | Bacteria | 1423 |
| 255 | Ga0070707_100519650 | 3300005468 | Bacteria | 1153 |
| 256 | Ga0070707_100523359 | 3300005468 | Bacteria | 1148 |
| 257 | Ga0070707_100754051 | 3300005468 | Unclassified | 937 |
| 258 | Ga0070698_100000413 | 3300005471 | Bacteria | 45525 |
| 259 | Ga0070698_100023971 | 3300005471 | Bacteria | 6371 |
| 260 | Ga0070698_100432375 | 3300005471 | Bacteria | 1251 |
| 261 | Ga0070698_100618266 | 3300005471 | Bacteria | 1024 |
| 262 | Ga0070698_100829553 | 3300005471 | Bacteria | 869 |
| 263 | Ga0070698_101270600 | 3300005471 | Unclassified | 686 |
| 264 | Ga0070699_100035199 | 3300005518 | Bacteria | 4328 |
| 265 | Ga0070699_100053333 | 3300005518 | Bacteria | 3500 |
| 266 | Ga0070699_100132618 | 3300005518 | Bacteria | 2196 |
| 267 | Ga0070699_100245561 | 3300005518 | Bacteria | 1599 |
| 268 | Ga0070699_100287557 | 3300005518 | Unclassified | 1473 |
| 269 | Ga0070699_100350897 | 3300005518 | Bacteria | 1329 |
| 270 | Ga0070699_100364612 | 3300005518 | Bacteria | 1303 |
| 271 | Ga0070699_100597462 | 3300005518 | Unclassified | 1006 |
| 272 | Ga0070699_100607951 | 3300005518 | Bacteria | 997 |
| 273 | Ga0070699_100636185 | 3300005518 | Bacteria | 973 |
| 274 | Ga0070679_100006694 | 3300005530 | Bacteria | 10750 |
| 275 | Ga0070679_100007544 | 3300005530 | Bacteria | 10171 |
| 276 | Ga0070679_100018126 | 3300005530 | Bacteria | 6825 |
| 277 | Ga0070679_100021209 | 3300005530 | Bacteria | 6339 |
| 278 | Ga0070679_100197004 | 3300005530 | Unclassified | 1981 |
| 279 | Ga0070679_100208411 | 3300005530 | Bacteria | 1919 |
| 280 | Ga0070679_100302305 | 3300005530 | Unclassified | 1550 |
| 281 | Ga0070679_100843256 | 3300005530 | Unclassified | 860 |
| 282 | Ga0070684_100001230 | 3300005535 | Bacteria | 18389 |
| 283 | Ga0070684_100002787 | 3300005535 | Bacteria | 12946 |
| 284 | Ga0070684_100003917 | 3300005535 | Bacteria | 11278 |
| 285 | Ga0070684_100024102 | 3300005535 | Bacteria | 5101 |
| 286 | Ga0070684_100391669 | 3300005535 | Bacteria | 1280 |
| 287 | Ga0070684_100491039 | 3300005535 | Unclassified | 1137 |
| 288 | Ga0070684_100908447 | 3300005535 | Bacteria | 825 |
| 289 | Ga0070697_100032665 | 3300005536 | Bacteria | 4190 |
| 290 | Ga0070697_100060466 | 3300005536 | Bacteria | 3088 |
| 291 | Ga0070697_100061365 | 3300005536 | Bacteria | 3066 |
| 292 | Ga0070697_100135666 | 3300005536 | Bacteria | 2066 |
| 293 | Ga0070697_100149013 | 3300005536 | Unclassified | 1971 |
| 294 | Ga0070697_100173513 | 3300005536 | Bacteria | 1826 |
| 295 | Ga0070697_100305561 | 3300005536 | Bacteria | 1368 |
| 296 | Ga0070697_100347575 | 3300005536 | Bacteria | 1280 |
| 297 | Ga0070697_101081682 | 3300005536 | Unclassified | 713 |
| 298 | Ga0068853_100006893 | 3300005539 | Bacteria | 9070 |
| 299 | Ga0068853_100035421 | 3300005539 | Bacteria | 4240 |
| 300 | Ga0068853_100051166 | 3300005539 | Bacteria | 3555 |
| 301 | Ga0068853_100115237 | 3300005539 | Bacteria | 2391 |
| 302 | Ga0068853_100305755 | 3300005539 | Unclassified | 1471 |
| 303 | Ga0068853_100393342 | 3300005539 | Unclassified | 1296 |
| 304 | Ga0068853_100824533 | 3300005539 | Bacteria | 889 |
| 305 | Ga0070672_100003099 | 3300005543 | Bacteria | 10725 |
| 306 | Ga0070672_100008014 | 3300005543 | Bacteria | 7216 |
| 307 | Ga0070672_100008581 | 3300005543 | Bacteria | 6999 |
| 308 | Ga0070672_100016533 | 3300005543 | Bacteria | 5284 |
| 309 | Ga0070672_100093931 | 3300005543 | Unclassified | 2423 |
| 310 | Ga0070672_100139228 | 3300005543 | Bacteria | 2000 |
| 311 | Ga0070672_100302218 | 3300005543 | Bacteria | 1357 |
| 312 | Ga0070672_100463103 | 3300005543 | Unclassified | 1093 |
| 313 | Ga0070686_100344273 | 3300005544 | Bacteria | 1118 |
| 314 | Ga0070695_100226023 | 3300005545 | Unclassified | 1351 |
| 315 | Ga0070696_100414592 | 3300005546 | Bacteria | 1056 |
| 316 | Ga0070696_100913644 | 3300005546 | Bacteria | 729 |
| 317 | Ga0070693_100046532 | 3300005547 | Bacteria | 2464 |
| 318 | Ga0070693_100215176 | 3300005547 | Unclassified | 1256 |
| 319 | Ga0070693_100273750 | 3300005547 | Unclassified | 1128 |
| 320 | Ga0070693_100381154 | 3300005547 | Bacteria | 973 |
| 321 | Ga0070665_100004484 | 3300005548 | Bacteria | 14665 |
| 322 | Ga0070665_100006553 | 3300005548 | Bacteria | 11833 |
| 323 | Ga0070665_100023261 | 3300005548 | Bacteria | 6240 |
| 324 | Ga0070665_100025375 | 3300005548 | Bacteria | 5973 |
| 325 | Ga0070665_100028552 | 3300005548 | Bacteria | 5619 |
| 326 | Ga0070665_100043800 | 3300005548 | Bacteria | 4496 |
| 327 | Ga0070665_100066411 | 3300005548 | Bacteria | 3618 |
| 328 | Ga0070665_100099856 | 3300005548 | Bacteria | 2907 |
| 329 | Ga0070665_100239396 | 3300005548 | Bacteria | 1815 |
| 330 | Ga0070665_100240408 | 3300005548 | Bacteria | 1811 |
| 331 | Ga0070665_100294444 | 3300005548 | Unclassified | 1625 |
| 332 | Ga0070665_100410794 | 3300005548 | Unclassified | 1362 |
| 333 | Ga0070665_100558675 | 3300005548 | Bacteria | 1157 |
| 334 | Ga0070665_100761500 | 3300005548 | Unclassified | 981 |
| 335 | Ga0070704_100002585 | 3300005549 | Bacteria | 10210 |
| 336 | Ga0068855_100026160 | 3300005563 | Bacteria | 6980 |
| 337 | Ga0068855_100101461 | 3300005563 | Bacteria | 3313 |
| 338 | Ga0068855_100291506 | 3300005563 | Unclassified | 1809 |
| 339 | Ga0070664_100014087 | 3300005564 | Bacteria | 6522 |
| 340 | Ga0070664_100017006 | 3300005564 | Bacteria | 5970 |
| 341 | Ga0070664_100071931 | 3300005564 | Unclassified | 2965 |
| 342 | Ga0070664_100175700 | 3300005564 | Bacteria | 1901 |
| 343 | Ga0070664_100195760 | 3300005564 | Unclassified | 1802 |
| 344 | Ga0070664_100324490 | 3300005564 | Bacteria | 1396 |
| 345 | Ga0070664_100333577 | 3300005564 | Unclassified | 1376 |
| 346 | Ga0068857_100047692 | 3300005577 | Bacteria | 3804 |
| 347 | Ga0068857_100069369 | 3300005577 | Bacteria | 3139 |
| 348 | Ga0068857_100392092 | 3300005577 | Bacteria | 1291 |
| 349 | Ga0068857_100762942 | 3300005577 | Unclassified | 922 |
| 350 | Ga0068854_100016524 | 3300005578 | Bacteria | 4921 |
| 351 | Ga0068854_100048212 | 3300005578 | Bacteria | 3039 |
| 352 | Ga0068856_100004235 | 3300005614 | Bacteria | 14328 |
| 353 | Ga0068856_100010690 | 3300005614 | Bacteria | 8917 |
| 354 | Ga0068856_100020448 | 3300005614 | Bacteria | 6429 |
| 355 | Ga0068856_100035673 | 3300005614 | Bacteria | 4874 |
| 356 | Ga0068856_100563184 | 3300005614 | Bacteria | 1161 |
| 357 | Ga0068856_100617891 | 3300005614 | Unclassified | 1105 |
| 358 | Ga0068856_100665295 | 3300005614 | Bacteria | 1062 |
| 359 | Ga0070702_100152344 | 3300005615 | Bacteria | 1486 |
| 360 | Ga0068852_100003693 | 3300005616 | Bacteria | 10727 |
| 361 | Ga0068852_100014944 | 3300005616 | Bacteria | 6000 |
| 362 | Ga0068852_100063346 | 3300005616 | Bacteria | 3219 |
| 363 | Ga0068852_100089773 | 3300005616 | Bacteria | 2747 |
| 364 | Ga0068852_100215928 | 3300005616 | Unclassified | 1822 |
| 365 | Ga0068852_100672728 | 3300005616 | Unclassified | 1044 |
| 366 | Ga0068852_100767385 | 3300005616 | Unclassified | 977 |
| 367 | Ga0068852_101338913 | 3300005616 | Bacteria | 738 |
| 368 | Ga0068859_100006056 | 3300005617 | Bacteria | 12280 |
| 369 | Ga0068859_100031329 | 3300005617 | Bacteria | 5340 |
| 370 | Ga0068859_100178962 | 3300005617 | Bacteria | 2203 |
| 371 | Ga0068859_100316119 | 3300005617 | Bacteria | 1655 |
| 372 | Ga0068859_101696572 | 3300005617 | Archaea | 698 |
| 373 | Ga0068864_100002334 | 3300005618 | Bacteria | 15682 |
| 374 | Ga0068864_100003597 | 3300005618 | Bacteria | 12816 |
| 375 | Ga0068864_100030005 | 3300005618 | Bacteria | 4609 |
| 376 | Ga0068864_100154845 | 3300005618 | Unclassified | 2079 |
| 377 | Ga0068864_100296909 | 3300005618 | Bacteria | 1512 |
| 378 | Ga0068864_101095176 | 3300005618 | Unclassified | 793 |
| 379 | Ga0068861_100122282 | 3300005719 | Bacteria | 2102 |
| 380 | Ga0068861_100209913 | 3300005719 | Bacteria | 1639 |
| 381 | Ga0068851_10001801 | 3300005834 | Bacteria | 9384 |
| 382 | Ga0068851_10008654 | 3300005834 | Bacteria | 4711 |
| 383 | Ga0068851_10009599 | 3300005834 | Bacteria | 4505 |
| 384 | Ga0068851_10192646 | 3300005834 | Bacteria | 1134 |
| 385 | Ga0068870_10014467 | 3300005840 | Bacteria | 3728 |
| 386 | Ga0068870_10062076 | 3300005840 | Unclassified | 2011 |
| 387 | Ga0068870_10237472 | 3300005840 | Bacteria | 1124 |
| 388 | Ga0068863_100003877 | 3300005841 | Bacteria | 14790 |
| 389 | Ga0068863_100013286 | 3300005841 | Bacteria | 7946 |
| 390 | Ga0068863_100014810 | 3300005841 | Bacteria | 7497 |
| 391 | Ga0068863_100068936 | 3300005841 | Bacteria | 3345 |
| 392 | Ga0068863_100124985 | 3300005841 | Bacteria | 2454 |
| 393 | Ga0068863_100220191 | 3300005841 | Bacteria | 1828 |
| 394 | Ga0068863_100271793 | 3300005841 | Bacteria | 1641 |
| 395 | Ga0068858_100003264 | 3300005842 | Bacteria | 16167 |
| 396 | Ga0068858_100012075 | 3300005842 | Bacteria | 8140 |
| 397 | Ga0068858_100018050 | 3300005842 | Bacteria | 6606 |
| 398 | Ga0068858_100037520 | 3300005842 | Bacteria | 4495 |
| 399 | Ga0068858_100054133 | 3300005842 | Bacteria | 3710 |
| 400 | Ga0068858_100286608 | 3300005842 | Bacteria | 1569 |
| 401 | Ga0068858_100376012 | 3300005842 | Unclassified | 1363 |
| 402 | Ga0068858_100465385 | 3300005842 | Bacteria | 1219 |
| 403 | Ga0068858_101600064 | 3300005842 | Unclassified | 643 |
| 404 | Ga0068860_100001042 | 3300005843 | Bacteria | 30514 |
| 405 | Ga0068860_100010043 | 3300005843 | Bacteria | 9381 |
| 406 | Ga0068860_100012302 | 3300005843 | Bacteria | 8431 |
| 407 | Ga0068860_100037702 | 3300005843 | Bacteria | 4627 |
| 408 | Ga0068860_100432754 | 3300005843 | Unclassified | 1306 |
| 409 | Ga0068860_100728245 | 3300005843 | Bacteria | 1003 |
| 410 | Ga0068862_100194594 | 3300005844 | Bacteria | 1826 |
| 411 | Ga0081455_10000547 | 3300005937 | Bacteria | 48774 |
| 412 | Ga0081455_10001583 | 3300005937 | Bacteria | 27844 |
| 413 | Ga0081455_10016102 | 3300005937 | Bacteria | 7230 |
| 414 | Ga0081455_10016757 | 3300005937 | Bacteria | 7054 |
| 415 | Ga0081455_10021993 | 3300005937 | Bacteria | 5970 |
| 416 | Ga0081455_10027093 | 3300005937 | Bacteria | 5257 |
| 417 | Ga0081455_10034863 | 3300005937 | Unclassified | 4505 |
| 418 | Ga0081455_10217933 | 3300005937 | Bacteria | 1417 |
| 419 | Ga0081540_1000016 | 3300005983 | Bacteria | 165370 |
| 420 | Ga0081540_1010941 | 3300005983 | Bacteria | 6093 |
| 421 | Ga0081540_1022397 | 3300005983 | Bacteria | 3731 |
| 422 | Ga0081539_10000052 | 3300005985 | Bacteria | 268240 |
| 423 | Ga0081539_10004458 | 3300005985 | Bacteria | 15437 |
| 424 | Ga0081539_10008307 | 3300005985 | Bacteria | 9086 |
| 425 | Ga0081539_10009998 | 3300005985 | Bacteria | 7813 |
| 426 | Ga0081539_10020681 | 3300005985 | Bacteria | 4433 |
| 427 | Ga0081539_10120493 | 3300005985 | Unclassified | 1304 |
| 428 | Ga0081539_10248129 | 3300005985 | Bacteria | 793 |
| 429 | Ga0070717_10004551 | 3300006028 | Bacteria | 10032 |
| 430 | Ga0070717_10044850 | 3300006028 | Bacteria | 3613 |
| 431 | Ga0070717_10117227 | 3300006028 | Bacteria | 2277 |
| 432 | Ga0070717_10453712 | 3300006028 | Bacteria | 1155 |
| 433 | Ga0070717_10555571 | 3300006028 | Unclassified | 1040 |
| 434 | Ga0070717_10630238 | 3300006028 | Unclassified | 973 |
| 435 | Ga0070715_10451967 | 3300006163 | Bacteria | 725 |
| 436 | Ga0070716_100685547 | 3300006173 | Unclassified | 781 |
| 437 | Ga0070716_100796948 | 3300006173 | Unclassified | 731 |
| 438 | Ga0070712_100016473 | 3300006175 | Bacteria | 4777 |
| 439 | Ga0070712_100306705 | 3300006175 | Unclassified | 1286 |
| 440 | Ga0070712_100389355 | 3300006175 | Bacteria | 1149 |
| 441 | Ga0070712_100684214 | 3300006175 | Unclassified | 873 |
| 442 | Ga0070712_100780877 | 3300006175 | Bacteria | 819 |
| 443 | Ga0070712_100865388 | 3300006175 | Unclassified | 778 |
| 444 | Ga0097621_100013578 | 3300006237 | Bacteria | 6074 |
| 445 | Ga0097621_100015740 | 3300006237 | Bacteria | 5700 |
| 446 | Ga0097621_100018761 | 3300006237 | Bacteria | 5293 |
| 447 | Ga0097621_100209356 | 3300006237 | Unclassified | 1696 |
| 448 | Ga0097621_100232393 | 3300006237 | Bacteria | 1610 |
| 449 | Ga0097621_100305203 | 3300006237 | Unclassified | 1407 |
| 450 | Ga0097621_100356486 | 3300006237 | Bacteria | 1302 |
| 451 | Ga0068871_100001817 | 3300006358 | Bacteria | 14403 |
| 452 | Ga0068871_100007616 | 3300006358 | Bacteria | 7744 |
| 453 | Ga0068871_100013929 | 3300006358 | Bacteria | 5979 |
| 454 | Ga0068871_100023033 | 3300006358 | Unclassified | 4809 |
| 455 | Ga0068871_100094475 | 3300006358 | Unclassified | 2496 |
| 456 | Ga0068871_100181031 | 3300006358 | Bacteria | 1811 |
| 457 | Ga0068871_100248979 | 3300006358 | Bacteria | 1547 |
| 458 | Ga0068871_100553898 | 3300006358 | Unclassified | 1042 |
| 459 | Ga0075428_100039310 | 3300006844 | Bacteria | 5206 |
| 460 | Ga0075428_100053933 | 3300006844 | Bacteria | 4406 |
| 461 | Ga0075428_100194783 | 3300006844 | Bacteria | 2192 |
| 462 | Ga0075428_100375263 | 3300006844 | Bacteria | 1525 |
| 463 | Ga0075433_10313300 | 3300006852 | Bacteria | 1389 |
| 464 | Ga0075434_100109023 | 3300006871 | Unclassified | 2779 |
| 465 | Ga0075434_100171781 | 3300006871 | Bacteria | 2188 |
| 466 | Ga0075434_100208283 | 3300006871 | Bacteria | 1976 |
| 467 | Ga0075434_100325667 | 3300006871 | Unclassified | 1557 |
| 468 | Ga0075434_100352892 | 3300006871 | Bacteria | 1492 |
| 469 | Ga0075434_100547521 | 3300006871 | Unclassified | 1177 |
| 470 | Ga0075434_100577073 | 3300006871 | Unclassified | 1144 |
| 471 | Ga0075434_100644291 | 3300006871 | Unclassified | 1078 |
| 472 | Ga0068865_100044190 | 3300006881 | Bacteria | 3048 |
| 473 | Ga0068865_100700892 | 3300006881 | Unclassified | 865 |
| 474 | Ga0068865_101346575 | 3300006881 | Unclassified | 636 |
| 475 | Ga0075436_100077399 | 3300006914 | Bacteria | 2304 |
| 476 | Ga0075436_100113516 | 3300006914 | Bacteria | 1892 |
| 477 | Ga0075436_100312407 | 3300006914 | Bacteria | 1128 |
| 478 | Ga0097620_100006056 | 3300006931 | Bacteria | 12280 |
| 479 | Ga0097620_100031329 | 3300006931 | Bacteria | 5340 |
| 480 | Ga0097620_100178963 | 3300006931 | Bacteria | 2203 |
| 481 | Ga0097620_100316123 | 3300006931 | Bacteria | 1655 |
| 482 | Ga0097620_101696306 | 3300006931 | Archaea | 698 |
| 483 | Ga0075435_100115740 | 3300007076 | Bacteria | 2233 |
| 484 | Ga0075435_100178395 | 3300007076 | Bacteria | 1795 |
| 485 | Ga0075435_100224640 | 3300007076 | Bacteria | 1595 |
| 486 | Ga0105240_10008953 | 3300009093 | Bacteria | 14232 |
| 487 | Ga0105240_10022687 | 3300009093 | Bacteria | 8317 |
| 488 | Ga0111539_10001299 | 3300009094 | Bacteria | 33371 |
| 489 | Ga0111539_10059036 | 3300009094 | Bacteria | 4550 |
| 490 | Ga0111539_10060050 | 3300009094 | Bacteria | 4507 |
| 491 | Ga0111539_10157405 | 3300009094 | Bacteria | 2658 |
| 492 | Ga0111539_10509289 | 3300009094 | Unclassified | 1402 |
| 493 | Ga0111539_10524735 | 3300009094 | Bacteria | 1380 |
| 494 | Ga0111539_10539640 | 3300009094 | Unclassified | 1359 |
| 495 | Ga0105245_10009797 | 3300009098 | Bacteria | 8348 |
| 496 | Ga0105245_10018826 | 3300009098 | Bacteria | 6042 |
| 497 | Ga0105245_10036661 | 3300009098 | Bacteria | 4357 |
| 498 | Ga0105245_10103156 | 3300009098 | Bacteria | 2642 |
| 499 | Ga0105245_10105036 | 3300009098 | Bacteria | 2619 |
| 500 | Ga0105245_10210221 | 3300009098 | Bacteria | 1872 |
| 501 | Ga0105245_10236535 | 3300009098 | Unclassified | 1769 |
| 502 | Ga0105245_10441700 | 3300009098 | Bacteria | 1308 |
| 503 | Ga0105247_10284676 | 3300009101 | Bacteria | 1141 |
| 504 | Ga0105247_10469103 | 3300009101 | Unclassified | 911 |
| 505 | Ga0114129_10095263 | 3300009147 | Bacteria | 4122 |
| 506 | Ga0114129_10175486 | 3300009147 | Bacteria | 2919 |
| 507 | Ga0114129_10850855 | 3300009147 | Unclassified | 1159 |
| 508 | Ga0105243_10231036 | 3300009148 | Unclassified | 1641 |
| 509 | Ga0105241_10015461 | 3300009174 | Bacteria | 5590 |
| 510 | Ga0105241_10096732 | 3300009174 | Bacteria | 2339 |
| 511 | Ga0105241_10922628 | 3300009174 | Unclassified | 812 |
| 512 | Ga0105242_10022489 | 3300009176 | Bacteria | 4959 |
| 513 | Ga0105242_10423439 | 3300009176 | Unclassified | 1248 |
| 514 | Ga0105248_10002431 | 3300009177 | Bacteria | 20666 |
| 515 | Ga0105248_10019006 | 3300009177 | Bacteria | 7597 |
| 516 | Ga0105248_10158989 | 3300009177 | Unclassified | 2549 |
| 517 | Ga0105248_10203082 | 3300009177 | Unclassified | 2233 |
| 518 | Ga0105248_10299721 | 3300009177 | Bacteria | 1810 |
| 519 | Ga0105248_10385061 | 3300009177 | Bacteria | 1579 |
| 520 | Ga0105237_10107634 | 3300009545 | Bacteria | 2780 |
| 521 | Ga0105237_10400540 | 3300009545 | Bacteria | 1377 |
| 522 | Ga0105238_10034778 | 3300009551 | Bacteria | 5125 |
| 523 | Ga0105238_11109291 | 3300009551 | Bacteria | 814 |
| 524 | Ga0105249_10006766 | 3300009553 | Bacteria | 9990 |
| 525 | Ga0105249_10016665 | 3300009553 | Bacteria | 6522 |
| 526 | Ga0105249_10268110 | 3300009553 | Bacteria | 1700 |
| 527 | Ga0105249_10347979 | 3300009553 | Bacteria | 1501 |
| 528 | Ga0105249_10669291 | 3300009553 | Bacteria | 1097 |
| 529 | Ga0105249_10702823 | 3300009553 | Unclassified | 1071 |
| 530 | Ga0105249_10848108 | 3300009553 | Bacteria | 979 |
| 531 | Ga0105249_11041037 | 3300009553 | Unclassified | 888 |
| 532 | Ga0105249_11258577 | 3300009553 | Bacteria | 811 |
| 533 | Ga0099796_10075146 | 3300010159 | Bacteria | 1228 |
| 534 | Ga0105239_10072664 | 3300010375 | Bacteria | 3782 |
| 535 | Ga0105246_10214792 | 3300011119 | Bacteria | 1504 |
| 536 | Ga0105246_10516170 | 3300011119 | Bacteria | 1017 |
| 537 | Ga0157373_10003902 | 3300013100 | Bacteria | 11265 |
| 538 | Ga0157373_10014850 | 3300013100 | Bacteria | 5703 |
| 539 | Ga0157373_10213621 | 3300013100 | Bacteria | 1360 |
| 540 | Ga0157373_10375775 | 3300013100 | Bacteria | 1016 |
| 541 | Ga0157371_10000446 | 3300013102 | Bacteria | 50636 |
| 542 | Ga0157371_10253936 | 3300013102 | Unclassified | 1266 |
| 543 | Ga0157371_10266681 | 3300013102 | Bacteria | 1235 |
| 544 | Ga0157370_10010726 | 3300013104 | Bacteria | 9636 |
| 545 | Ga0157370_10026708 | 3300013104 | Bacteria | 5697 |
| 546 | Ga0157370_10060279 | 3300013104 | Bacteria | 3603 |
| 547 | Ga0157370_10093865 | 3300013104 | Bacteria | 2816 |
| 548 | Ga0157370_10153709 | 3300013104 | Bacteria | 2141 |
| 549 | Ga0157370_10171572 | 3300013104 | Bacteria | 2016 |
| 550 | Ga0157370_10946538 | 3300013104 | Unclassified | 781 |
| 551 | Ga0157369_10012261 | 3300013105 | Bacteria | 9734 |
| 552 | Ga0157369_10071605 | 3300013105 | Bacteria | 3721 |
| 553 | Ga0157369_10237692 | 3300013105 | Bacteria | 1903 |
| 554 | Ga0157369_10250853 | 3300013105 | Unclassified | 1847 |
| 555 | Ga0157374_10032996 | 3300013296 | Bacteria | 4720 |
| 556 | Ga0157374_10068236 | 3300013296 | Bacteria | 3345 |
| 557 | Ga0157374_10075119 | 3300013296 | Unclassified | 3193 |
| 558 | Ga0157374_10091134 | 3300013296 | Bacteria | 2907 |
| 559 | Ga0157374_10110875 | 3300013296 | Bacteria | 2639 |
| 560 | Ga0157374_10211274 | 3300013296 | Unclassified | 1903 |
| 561 | Ga0157374_10356859 | 3300013296 | Unclassified | 1453 |
| 562 | Ga0157374_10451880 | 3300013296 | Bacteria | 1286 |
| 563 | Ga0157374_10538630 | 3300013296 | Unclassified | 1174 |
| 564 | Ga0157374_11684549 | 3300013296 | Unclassified | 659 |
| 565 | Ga0157378_10054529 | 3300013297 | Bacteria | 3559 |
| 566 | Ga0157378_10056068 | 3300013297 | Bacteria | 3510 |
| 567 | Ga0157378_10124616 | 3300013297 | Bacteria | 2379 |
| 568 | Ga0157378_10144606 | 3300013297 | Bacteria | 2211 |
| 569 | Ga0157378_10480705 | 3300013297 | Bacteria | 1238 |
| 570 | Ga0157378_10528490 | 3300013297 | Unclassified | 1182 |
| 571 | Ga0157378_11272604 | 3300013297 | Bacteria | 776 |
| 572 | Ga0163162_10006343 | 3300013306 | Bacteria | 11451 |
| 573 | Ga0163162_10006529 | 3300013306 | Bacteria | 11298 |
| 574 | Ga0163162_10039123 | 3300013306 | Bacteria | 4737 |
| 575 | Ga0163162_10082361 | 3300013306 | Bacteria | 3290 |
| 576 | Ga0163162_10118321 | 3300013306 | Bacteria | 2751 |
| 577 | Ga0163162_10250502 | 3300013306 | Bacteria | 1903 |
| 578 | Ga0163162_10281768 | 3300013306 | Bacteria | 1794 |
| 579 | Ga0163162_10544817 | 3300013306 | Bacteria | 1289 |
| 580 | Ga0163162_10558796 | 3300013306 | Unclassified | 1272 |
| 581 | Ga0163162_10737186 | 3300013306 | Bacteria | 1105 |
| 582 | Ga0163162_11391334 | 3300013306 | Bacteria | 798 |
| 583 | Ga0163162_11551637 | 3300013306 | Bacteria | 755 |
| 584 | Ga0157372_10000523 | 3300013307 | Bacteria | 42408 |
| 585 | Ga0157372_10030913 | 3300013307 | Bacteria | 5860 |
| 586 | Ga0157372_10032821 | 3300013307 | Bacteria | 5696 |
| 587 | Ga0157372_10085120 | 3300013307 | Bacteria | 3585 |
| 588 | Ga0157372_10293916 | 3300013307 | Bacteria | 1889 |
| 589 | Ga0157372_10410409 | 3300013307 | Bacteria | 1578 |
| 590 | Ga0157372_11614732 | 3300013307 | Bacteria | 746 |
| 591 | Ga0157375_10002572 | 3300013308 | Bacteria | 15765 |
| 592 | Ga0157375_10007572 | 3300013308 | Bacteria | 9494 |
| 593 | Ga0157375_10031682 | 3300013308 | Bacteria | 5004 |
| 594 | Ga0157375_10033665 | 3300013308 | Bacteria | 4872 |
| 595 | Ga0157375_10035443 | 3300013308 | Bacteria | 4763 |
| 596 | Ga0157375_10047793 | 3300013308 | Bacteria | 4181 |
| 597 | Ga0157375_10064141 | 3300013308 | Bacteria | 3657 |
| 598 | Ga0157375_10090221 | 3300013308 | Bacteria | 3123 |
| 599 | Ga0157375_10107775 | 3300013308 | Bacteria | 2880 |
| 600 | Ga0157375_10356617 | 3300013308 | Bacteria | 1628 |
| 601 | Ga0157375_10602273 | 3300013308 | Bacteria | 1258 |
| 602 | Ga0157375_10610839 | 3300013308 | Unclassified | 1249 |
| 603 | Ga0157375_11861375 | 3300013308 | Bacteria | 714 |
| 604 | Ga0157375_12170491 | 3300013308 | Unclassified | 661 |
| 605 | Ga0163163_10004811 | 3300014325 | Bacteria | 11598 |
| 606 | Ga0163163_10042847 | 3300014325 | Bacteria | 4435 |
| 607 | Ga0163163_10060433 | 3300014325 | Bacteria | 3753 |
| 608 | Ga0163163_10169102 | 3300014325 | Bacteria | 2232 |
| 609 | Ga0163163_10387662 | 3300014325 | Unclassified | 1455 |
| 610 | Ga0163163_10435869 | 3300014325 | Unclassified | 1370 |
| 611 | Ga0157380_10178920 | 3300014326 | Bacteria | 1861 |
| 612 | Ga0157380_10373587 | 3300014326 | Bacteria | 1343 |
| 613 | Ga0157380_10664872 | 3300014326 | Bacteria | 1041 |
| 614 | Ga0157380_10789231 | 3300014326 | Unclassified | 965 |
| 615 | Ga0182008_10085522 | 3300014497 | Bacteria | 1553 |
| 616 | Ga0157377_10008931 | 3300014745 | Bacteria | 4903 |
| 617 | Ga0157377_10058811 | 3300014745 | Bacteria | 2189 |
| 618 | Ga0157377_10127614 | 3300014745 | Bacteria | 1549 |
| 619 | Ga0157377_10250451 | 3300014745 | Bacteria | 1148 |
| 620 | Ga0157377_10507869 | 3300014745 | Bacteria | 844 |
| 621 | Ga0157379_10015087 | 3300014968 | Bacteria | 6777 |
| 622 | Ga0157379_10031752 | 3300014968 | Bacteria | 4705 |
| 623 | Ga0157379_10055151 | 3300014968 | Bacteria | 3551 |
| 624 | Ga0157379_10073195 | 3300014968 | Bacteria | 3066 |
| 625 | Ga0157379_10278286 | 3300014968 | Unclassified | 1523 |
| 626 | Ga0157376_10003007 | 3300014969 | Bacteria | 11569 |
| 627 | Ga0157376_10025775 | 3300014969 | Bacteria | 4635 |
| 628 | Ga0157376_10039684 | 3300014969 | Bacteria | 3842 |
| 629 | Ga0157376_10076929 | 3300014969 | Bacteria | 2853 |
| 630 | Ga0157376_10119817 | 3300014969 | Bacteria | 2330 |
| 631 | Ga0157376_10140091 | 3300014969 | Bacteria | 2169 |
| 632 | Ga0157376_10198257 | 3300014969 | Bacteria | 1845 |
| 633 | Ga0157376_10230271 | 3300014969 | Unclassified | 1721 |
| 634 | Ga0157376_10341720 | 3300014969 | Bacteria | 1430 |
| 635 | Ga0157376_10517553 | 3300014969 | Bacteria | 1175 |
| 636 | Ga0157376_11043366 | 3300014969 | Unclassified | 841 |
| 637 | Ga0182005_1008598 | 3300015265 | Bacteria | 3003 |
| 638 | Ga0163161_10015702 | 3300017792 | Bacteria | 5281 |
| 639 | Ga0163161_10042182 | 3300017792 | Bacteria | 3281 |
| 640 | Ga0163161_10073086 | 3300017792 | Unclassified | 2512 |
| 641 | Ga0163161_10107910 | 3300017792 | Bacteria | 2078 |
| 642 | Ga0163161_10140947 | 3300017792 | Bacteria | 1826 |
| 643 | Ga0163161_10868114 | 3300017792 | Unclassified | 762 |
| 644 | Ga0206356_11720413 | 3300020070 | Bacteria | 1975 |
| 645 | Ga0207666_1000261 | 3300025271 | Bacteria | 7724 |
| 646 | Ga0207666_1041271 | 3300025271 | Unclassified | 722 |
| 647 | Ga0207673_1000951 | 3300025290 | Bacteria | 3120 |
| 648 | Ga0207673_1002395 | 3300025290 | Bacteria | 2136 |
| 649 | Ga0207697_10003309 | 3300025315 | Bacteria | 8017 |
| 650 | Ga0207697_10004477 | 3300025315 | Bacteria | 6669 |
| 651 | Ga0207697_10007175 | 3300025315 | Bacteria | 4982 |
| 652 | Ga0207697_10012709 | 3300025315 | Bacteria | 3526 |
| 653 | Ga0207697_10013913 | 3300025315 | Bacteria | 3349 |
| 654 | Ga0207697_10025802 | 3300025315 | Bacteria | 2403 |
| 655 | Ga0207656_10007104 | 3300025321 | Bacteria | 4068 |
| 656 | Ga0207656_10015301 | 3300025321 | Bacteria | 2967 |
| 657 | Ga0207653_10121569 | 3300025885 | Bacteria | 940 |
| 658 | Ga0207653_10145502 | 3300025885 | Unclassified | 869 |
| 659 | Ga0207682_10000146 | 3300025893 | Bacteria | 31872 |
| 660 | Ga0207682_10079736 | 3300025893 | Unclassified | 1401 |
| 661 | Ga0207692_10062561 | 3300025898 | Bacteria | 1932 |
| 662 | Ga0207692_10094161 | 3300025898 | Bacteria | 1631 |
| 663 | Ga0207692_10140107 | 3300025898 | Bacteria | 1375 |
| 664 | Ga0207692_10393356 | 3300025898 | Bacteria | 863 |
| 665 | Ga0207688_10027364 | 3300025901 | Bacteria | 3137 |
| 666 | Ga0207688_10056548 | 3300025901 | Bacteria | 2204 |
| 667 | Ga0207688_10105407 | 3300025901 | Unclassified | 1632 |
| 668 | Ga0207688_10130638 | 3300025901 | Bacteria | 1472 |
| 669 | Ga0207688_10241235 | 3300025901 | Bacteria | 1093 |
| 670 | Ga0207680_10001915 | 3300025903 | Bacteria | 9760 |
| 671 | Ga0207680_10010912 | 3300025903 | Bacteria | 4567 |
| 672 | Ga0207680_10015333 | 3300025903 | Bacteria | 3998 |
| 673 | Ga0207680_10034549 | 3300025903 | Bacteria | 2894 |
| 674 | Ga0207680_10047288 | 3300025903 | Bacteria | 2549 |
| 675 | Ga0207680_10057513 | 3300025903 | Unclassified | 2353 |
| 676 | Ga0207680_10277385 | 3300025903 | Bacteria | 1164 |
| 677 | Ga0207680_10634288 | 3300025903 | Unclassified | 765 |
| 678 | Ga0207647_10015769 | 3300025904 | Bacteria | 5172 |
| 679 | Ga0207699_10019067 | 3300025906 | Bacteria | 3649 |
| 680 | Ga0207699_10439333 | 3300025906 | Bacteria | 934 |
| 681 | Ga0207645_10000519 | 3300025907 | Bacteria | 31964 |
| 682 | Ga0207645_10008023 | 3300025907 | Bacteria | 7406 |
| 683 | Ga0207645_10036131 | 3300025907 | Bacteria | 3172 |
| 684 | Ga0207645_10052932 | 3300025907 | Bacteria | 2594 |
| 685 | Ga0207645_10061657 | 3300025907 | Bacteria | 2396 |
| 686 | Ga0207645_10083026 | 3300025907 | Unclassified | 2054 |
| 687 | Ga0207645_10270838 | 3300025907 | Bacteria | 1126 |
| 688 | Ga0207643_10027427 | 3300025908 | Bacteria | 3158 |
| 689 | Ga0207643_10032649 | 3300025908 | Bacteria | 2908 |
| 690 | Ga0207643_10114043 | 3300025908 | Unclassified | 1594 |
| 691 | Ga0207643_10257111 | 3300025908 | Bacteria | 1077 |
| 692 | Ga0207705_10052596 | 3300025909 | Bacteria | 2932 |
| 693 | Ga0207705_10128757 | 3300025909 | Bacteria | 1882 |
| 694 | Ga0207705_10348839 | 3300025909 | Bacteria | 1140 |
| 695 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 696 | Ga0207684_10003281 | 3300025910 | Bacteria | 15868 |
| 697 | Ga0207684_10032606 | 3300025910 | Unclassified | 4428 |
| 698 | Ga0207684_10051288 | 3300025910 | Bacteria | 3500 |
| 699 | Ga0207684_10174093 | 3300025910 | Bacteria | 1855 |
| 700 | Ga0207684_10284500 | 3300025910 | Bacteria | 1426 |
| 701 | Ga0207684_10329193 | 3300025910 | Bacteria | 1316 |
| 702 | Ga0207684_10649754 | 3300025910 | Unclassified | 899 |
| 703 | Ga0207684_10667024 | 3300025910 | Unclassified | 885 |
| 704 | Ga0207707_10005207 | 3300025912 | Bacteria | 11396 |
| 705 | Ga0207707_10015254 | 3300025912 | Bacteria | 6691 |
| 706 | Ga0207707_10015315 | 3300025912 | Bacteria | 6676 |
| 707 | Ga0207707_10058830 | 3300025912 | Bacteria | 3344 |
| 708 | Ga0207695_10116325 | 3300025913 | Bacteria | 2648 |
| 709 | Ga0207693_10002925 | 3300025915 | Bacteria | 14779 |
| 710 | Ga0207693_10022585 | 3300025915 | Bacteria | 4999 |
| 711 | Ga0207693_10066800 | 3300025915 | Bacteria | 2815 |
| 712 | Ga0207693_10096529 | 3300025915 | Bacteria | 2317 |
| 713 | Ga0207693_10105081 | 3300025915 | Bacteria | 2214 |
| 714 | Ga0207693_10111091 | 3300025915 | Unclassified | 2149 |
| 715 | Ga0207693_10137672 | 3300025915 | Bacteria | 1920 |
| 716 | Ga0207693_10151897 | 3300025915 | Bacteria | 1821 |
| 717 | Ga0207693_10193311 | 3300025915 | Bacteria | 1601 |
| 718 | Ga0207693_10923041 | 3300025915 | Unclassified | 669 |
| 719 | Ga0207663_10093753 | 3300025916 | Bacteria | 1999 |
| 720 | Ga0207663_10126778 | 3300025916 | Bacteria | 1757 |
| 721 | Ga0207663_10269406 | 3300025916 | Bacteria | 1261 |
| 722 | Ga0207663_10282004 | 3300025916 | Bacteria | 1234 |
| 723 | Ga0207663_10303054 | 3300025916 | Bacteria | 1194 |
| 724 | Ga0207663_10415773 | 3300025916 | Bacteria | 1031 |
| 725 | Ga0207660_10012654 | 3300025917 | Bacteria | 5526 |
| 726 | Ga0207660_10040236 | 3300025917 | Bacteria | 3272 |
| 727 | Ga0207660_10185491 | 3300025917 | Bacteria | 1618 |
| 728 | Ga0207660_10349121 | 3300025917 | Bacteria | 1185 |
| 729 | Ga0207662_10050548 | 3300025918 | Bacteria | 2470 |
| 730 | Ga0207662_10060963 | 3300025918 | Bacteria | 2264 |
| 731 | Ga0207657_10000229 | 3300025919 | Bacteria | 58709 |
| 732 | Ga0207657_10008077 | 3300025919 | Bacteria | 10730 |
| 733 | Ga0207657_10024320 | 3300025919 | Bacteria | 5614 |
| 734 | Ga0207657_10061470 | 3300025919 | Bacteria | 3220 |
| 735 | Ga0207657_10118344 | 3300025919 | Bacteria | 2181 |
| 736 | Ga0207657_10129942 | 3300025919 | Unclassified | 2065 |
| 737 | Ga0207649_10002277 | 3300025920 | Bacteria | 10798 |
| 738 | Ga0207649_10012421 | 3300025920 | Bacteria | 4725 |
| 739 | Ga0207649_10019167 | 3300025920 | Bacteria | 3907 |
| 740 | Ga0207649_10029744 | 3300025920 | Bacteria | 3228 |
| 741 | Ga0207649_10055680 | 3300025920 | Bacteria | 2466 |
| 742 | Ga0207649_10065890 | 3300025920 | Bacteria | 2294 |
| 743 | Ga0207652_10003991 | 3300025921 | Bacteria | 12060 |
| 744 | Ga0207652_10007247 | 3300025921 | Bacteria | 8934 |
| 745 | Ga0207652_10064470 | 3300025921 | Bacteria | 3170 |
| 746 | Ga0207652_10074201 | 3300025921 | Bacteria | 2961 |
| 747 | Ga0207652_10168764 | 3300025921 | Bacteria | 1963 |
| 748 | Ga0207646_10000734 | 3300025922 | Bacteria | 42601 |
| 749 | Ga0207646_10002142 | 3300025922 | Bacteria | 23602 |
| 750 | Ga0207646_10006254 | 3300025922 | Bacteria | 12357 |
| 751 | Ga0207646_10006743 | 3300025922 | Bacteria | 11822 |
| 752 | Ga0207646_10026769 | 3300025922 | Bacteria | 5261 |
| 753 | Ga0207646_10102036 | 3300025922 | Unclassified | 2572 |
| 754 | Ga0207646_10134306 | 3300025922 | Bacteria | 2228 |
| 755 | Ga0207646_10134948 | 3300025922 | Bacteria | 2222 |
| 756 | Ga0207646_10167702 | 3300025922 | Bacteria | 1982 |
| 757 | Ga0207646_10325683 | 3300025922 | Unclassified | 1388 |
| 758 | Ga0207646_10329032 | 3300025922 | Bacteria | 1380 |
| 759 | Ga0207646_10565005 | 3300025922 | Bacteria | 1022 |
| 760 | Ga0207646_10631358 | 3300025922 | Unclassified | 960 |
| 761 | Ga0207646_10738601 | 3300025922 | Unclassified | 879 |
| 762 | Ga0207681_10002527 | 3300025923 | Bacteria | 11626 |
| 763 | Ga0207681_10024176 | 3300025923 | Bacteria | 3897 |
| 764 | Ga0207681_10046095 | 3300025923 | Bacteria | 2931 |
| 765 | Ga0207681_10063647 | 3300025923 | Bacteria | 2544 |
| 766 | Ga0207681_10112293 | 3300025923 | Bacteria | 1984 |
| 767 | Ga0207681_10142153 | 3300025923 | Bacteria | 1789 |
| 768 | Ga0207694_10299767 | 3300025924 | Bacteria | 1323 |
| 769 | Ga0207694_10607278 | 3300025924 | Unclassified | 920 |
| 770 | Ga0207650_10002534 | 3300025925 | Bacteria | 12678 |
| 771 | Ga0207650_10016498 | 3300025925 | Bacteria | 5164 |
| 772 | Ga0207650_10035787 | 3300025925 | Bacteria | 3608 |
| 773 | Ga0207650_10067227 | 3300025925 | Bacteria | 2689 |
| 774 | Ga0207650_10088138 | 3300025925 | Bacteria | 2366 |
| 775 | Ga0207650_10093562 | 3300025925 | Bacteria | 2301 |
| 776 | Ga0207650_10102856 | 3300025925 | Bacteria | 2202 |
| 777 | Ga0207650_10113894 | 3300025925 | Unclassified | 2097 |
| 778 | Ga0207650_10301029 | 3300025925 | Bacteria | 1310 |
| 779 | Ga0207650_10365468 | 3300025925 | Bacteria | 1189 |
| 780 | Ga0207650_10498298 | 3300025925 | Bacteria | 1018 |
| 781 | Ga0207659_10002707 | 3300025926 | Bacteria | 10560 |
| 782 | Ga0207659_10004071 | 3300025926 | Bacteria | 8822 |
| 783 | Ga0207659_10004632 | 3300025926 | Bacteria | 8325 |
| 784 | Ga0207659_10007428 | 3300025926 | Bacteria | 6736 |
| 785 | Ga0207659_10021504 | 3300025926 | Bacteria | 4283 |
| 786 | Ga0207659_10073946 | 3300025926 | Bacteria | 2497 |
| 787 | Ga0207659_10080899 | 3300025926 | Bacteria | 2401 |
| 788 | Ga0207659_10107969 | 3300025926 | Bacteria | 2110 |
| 789 | Ga0207659_10221815 | 3300025926 | Bacteria | 1521 |
| 790 | Ga0207659_10247305 | 3300025926 | Unclassified | 1445 |
| 791 | Ga0207659_10300714 | 3300025926 | Unclassified | 1318 |
| 792 | Ga0207659_10557799 | 3300025926 | Unclassified | 974 |
| 793 | Ga0207659_10840634 | 3300025926 | Bacteria | 789 |
| 794 | Ga0207687_10067295 | 3300025927 | Unclassified | 2548 |
| 795 | Ga0207687_10111634 | 3300025927 | Bacteria | 2030 |
| 796 | Ga0207687_10354175 | 3300025927 | Unclassified | 1197 |
| 797 | Ga0207687_10413551 | 3300025927 | Bacteria | 1112 |
| 798 | Ga0207687_10436830 | 3300025927 | Bacteria | 1083 |
| 799 | Ga0207687_10514625 | 3300025927 | Bacteria | 1000 |
| 800 | Ga0207700_10046468 | 3300025928 | Bacteria | 3211 |
| 801 | Ga0207700_10064817 | 3300025928 | Unclassified | 2785 |
| 802 | Ga0207700_10164458 | 3300025928 | Bacteria | 1845 |
| 803 | Ga0207700_10694708 | 3300025928 | Bacteria | 908 |
| 804 | Ga0207664_10003067 | 3300025929 | Bacteria | 11098 |
| 805 | Ga0207664_10006738 | 3300025929 | Bacteria | 7934 |
| 806 | Ga0207664_10068190 | 3300025929 | Bacteria | 2857 |
| 807 | Ga0207664_10089089 | 3300025929 | Unclassified | 2526 |
| 808 | Ga0207664_10184931 | 3300025929 | Unclassified | 1791 |
| 809 | Ga0207664_10214414 | 3300025929 | Bacteria | 1667 |
| 810 | Ga0207664_10273045 | 3300025929 | Bacteria | 1481 |
| 811 | Ga0207664_10554166 | 3300025929 | Unclassified | 1031 |
| 812 | Ga0207644_10000405 | 3300025931 | Bacteria | 28099 |
| 813 | Ga0207644_10008476 | 3300025931 | Bacteria | 6730 |
| 814 | Ga0207644_10012225 | 3300025931 | Bacteria | 5698 |
| 815 | Ga0207644_10045397 | 3300025931 | Bacteria | 3126 |
| 816 | Ga0207644_10091346 | 3300025931 | Bacteria | 2270 |
| 817 | Ga0207644_10095598 | 3300025931 | Bacteria | 2222 |
| 818 | Ga0207644_10112928 | 3300025931 | Bacteria | 2057 |
| 819 | Ga0207644_10147015 | 3300025931 | Unclassified | 1820 |
| 820 | Ga0207644_10169498 | 3300025931 | Bacteria | 1703 |
| 821 | Ga0207644_10224422 | 3300025931 | Unclassified | 1491 |
| 822 | Ga0207644_10328019 | 3300025931 | Unclassified | 1239 |
| 823 | Ga0207644_10498472 | 3300025931 | Bacteria | 1004 |
| 824 | Ga0207690_10000348 | 3300025932 | Bacteria | 30788 |
| 825 | Ga0207690_10006051 | 3300025932 | Bacteria | 7165 |
| 826 | Ga0207690_10021602 | 3300025932 | Bacteria | 3993 |
| 827 | Ga0207690_10035029 | 3300025932 | Bacteria | 3238 |
| 828 | Ga0207690_10171351 | 3300025932 | Unclassified | 1626 |
| 829 | Ga0207690_10453579 | 3300025932 | Bacteria | 1031 |
| 830 | Ga0207706_10000045 | 3300025933 | Bacteria | 120758 |
| 831 | Ga0207706_10092757 | 3300025933 | Bacteria | 2655 |
| 832 | Ga0207706_10186955 | 3300025933 | Bacteria | 1819 |
| 833 | Ga0207706_10203631 | 3300025933 | Bacteria | 1735 |
| 834 | Ga0207706_10214358 | 3300025933 | Unclassified | 1687 |
| 835 | Ga0207706_10266083 | 3300025933 | Unclassified | 1496 |
| 836 | Ga0207706_10671301 | 3300025933 | Unclassified | 887 |
| 837 | Ga0207709_10024389 | 3300025935 | Bacteria | 3454 |
| 838 | Ga0207709_10143527 | 3300025935 | Bacteria | 1644 |
| 839 | Ga0207709_10215953 | 3300025935 | Bacteria | 1380 |
| 840 | Ga0207670_10011155 | 3300025936 | Bacteria | 5205 |
| 841 | Ga0207670_10017407 | 3300025936 | Bacteria | 4344 |
| 842 | Ga0207670_10021344 | 3300025936 | Bacteria | 3993 |
| 843 | Ga0207670_10032817 | 3300025936 | Bacteria | 3341 |
| 844 | Ga0207670_10293109 | 3300025936 | Bacteria | 1271 |
| 845 | Ga0207669_10010707 | 3300025937 | Bacteria | 4427 |
| 846 | Ga0207669_10082682 | 3300025937 | Unclassified | 2062 |
| 847 | Ga0207669_10124455 | 3300025937 | Bacteria | 1758 |
| 848 | Ga0207669_10166393 | 3300025937 | Bacteria | 1564 |
| 849 | Ga0207669_10330980 | 3300025937 | Bacteria | 1169 |
| 850 | Ga0207704_10525997 | 3300025938 | Bacteria | 957 |
| 851 | Ga0207704_11006500 | 3300025938 | Unclassified | 705 |
| 852 | Ga0207665_10035723 | 3300025939 | Bacteria | 3301 |
| 853 | Ga0207665_10069200 | 3300025939 | Bacteria | 2406 |
| 854 | Ga0207665_10541113 | 3300025939 | Unclassified | 904 |
| 855 | Ga0207665_10587753 | 3300025939 | Unclassified | 868 |
| 856 | Ga0207691_10000310 | 3300025940 | Bacteria | 48478 |
| 857 | Ga0207691_10000629 | 3300025940 | Bacteria | 34886 |
| 858 | Ga0207691_10004119 | 3300025940 | Bacteria | 14122 |
| 859 | Ga0207691_10025264 | 3300025940 | Bacteria | 5578 |
| 860 | Ga0207691_10029499 | 3300025940 | Bacteria | 5131 |
| 861 | Ga0207691_10050625 | 3300025940 | Bacteria | 3802 |
| 862 | Ga0207691_10097269 | 3300025940 | Bacteria | 2631 |
| 863 | Ga0207691_10174393 | 3300025940 | Bacteria | 1881 |
| 864 | Ga0207691_10182382 | 3300025940 | Bacteria | 1834 |
| 865 | Ga0207691_10220893 | 3300025940 | Bacteria | 1643 |
| 866 | Ga0207691_10227923 | 3300025940 | Bacteria | 1614 |
| 867 | Ga0207691_10258771 | 3300025940 | Unclassified | 1500 |
| 868 | Ga0207711_10011574 | 3300025941 | Bacteria | 7334 |
| 869 | Ga0207711_10019828 | 3300025941 | Bacteria | 5604 |
| 870 | Ga0207711_10086395 | 3300025941 | Bacteria | 2750 |
| 871 | Ga0207711_10126282 | 3300025941 | Unclassified | 2288 |
| 872 | Ga0207711_10157887 | 3300025941 | Bacteria | 2051 |
| 873 | Ga0207711_10171143 | 3300025941 | Bacteria | 1971 |
| 874 | Ga0207711_10281258 | 3300025941 | Bacteria | 1532 |
| 875 | Ga0207689_10013147 | 3300025942 | Bacteria | 7063 |
| 876 | Ga0207689_10096085 | 3300025942 | Bacteria | 2434 |
| 877 | Ga0207661_10009915 | 3300025944 | Bacteria | 6840 |
| 878 | Ga0207661_10074070 | 3300025944 | Bacteria | 2790 |
| 879 | Ga0207661_10141705 | 3300025944 | Bacteria | 2069 |
| 880 | Ga0207661_10163180 | 3300025944 | Bacteria | 1934 |
| 881 | Ga0207661_11025791 | 3300025944 | Unclassified | 760 |
| 882 | Ga0207661_11113666 | 3300025944 | Unclassified | 727 |
| 883 | Ga0207679_10003526 | 3300025945 | Bacteria | 9684 |
| 884 | Ga0207679_10011829 | 3300025945 | Bacteria | 5671 |
| 885 | Ga0207679_10059635 | 3300025945 | Bacteria | 2832 |
| 886 | Ga0207679_10126044 | 3300025945 | Bacteria | 2046 |
| 887 | Ga0207679_10164325 | 3300025945 | Unclassified | 1821 |
| 888 | Ga0207679_10206445 | 3300025945 | Bacteria | 1645 |
| 889 | Ga0207679_10496401 | 3300025945 | Unclassified | 1088 |
| 890 | Ga0207679_10613889 | 3300025945 | Bacteria | 981 |
| 891 | Ga0207667_10002826 | 3300025949 | Bacteria | 21544 |
| 892 | Ga0207667_10003469 | 3300025949 | Bacteria | 19459 |
| 893 | Ga0207667_10171767 | 3300025949 | Unclassified | 2228 |
| 894 | Ga0207667_10214858 | 3300025949 | Unclassified | 1971 |
| 895 | Ga0207667_10738763 | 3300025949 | Bacteria | 984 |
| 896 | Ga0207667_10856780 | 3300025949 | Unclassified | 903 |
| 897 | Ga0207667_11143784 | 3300025949 | Bacteria | 760 |
| 898 | Ga0207651_10025782 | 3300025960 | Bacteria | 3660 |
| 899 | Ga0207651_10059712 | 3300025960 | Unclassified | 2643 |
| 900 | Ga0207651_10165509 | 3300025960 | Bacteria | 1738 |
| 901 | Ga0207651_10171949 | 3300025960 | Unclassified | 1709 |
| 902 | Ga0207651_10212322 | 3300025960 | Bacteria | 1559 |
| 903 | Ga0207651_10228386 | 3300025960 | Unclassified | 1509 |
| 904 | Ga0207651_10414992 | 3300025960 | Bacteria | 1148 |
| 905 | Ga0207651_10459188 | 3300025960 | Bacteria | 1094 |
| 906 | Ga0207651_10553609 | 3300025960 | Bacteria | 1000 |
| 907 | Ga0207712_10302566 | 3300025961 | Bacteria | 1313 |
| 908 | Ga0207712_10903992 | 3300025961 | Unclassified | 780 |
| 909 | Ga0207712_11070034 | 3300025961 | Bacteria | 717 |
| 910 | Ga0207712_11165510 | 3300025961 | Unclassified | 687 |
| 911 | Ga0207668_10003264 | 3300025972 | Bacteria | 9507 |
| 912 | Ga0207668_10005981 | 3300025972 | Bacteria | 7173 |
| 913 | Ga0207668_10018149 | 3300025972 | Bacteria | 4420 |
| 914 | Ga0207668_10029476 | 3300025972 | Bacteria | 3597 |
| 915 | Ga0207668_10128930 | 3300025972 | Bacteria | 1928 |
| 916 | Ga0207668_10146554 | 3300025972 | Unclassified | 1822 |
| 917 | Ga0207668_10167562 | 3300025972 | Unclassified | 1719 |
| 918 | Ga0207668_10313168 | 3300025972 | Bacteria | 1300 |
| 919 | Ga0207668_11005799 | 3300025972 | Unclassified | 745 |
| 920 | Ga0207640_10109298 | 3300025981 | Bacteria | 1956 |
| 921 | Ga0207640_10244709 | 3300025981 | Bacteria | 1388 |
| 922 | Ga0207640_10306082 | 3300025981 | Bacteria | 1259 |
| 923 | Ga0207640_10644912 | 3300025981 | Bacteria | 902 |
| 924 | Ga0207640_11185715 | 3300025981 | Bacteria | 678 |
| 925 | Ga0207658_10008951 | 3300025986 | Bacteria | 6790 |
| 926 | Ga0207658_10076428 | 3300025986 | Bacteria | 2551 |
| 927 | Ga0207658_10112751 | 3300025986 | Unclassified | 2153 |
| 928 | Ga0207658_10129696 | 3300025986 | Bacteria | 2024 |
| 929 | Ga0207658_10443746 | 3300025986 | Unclassified | 1148 |
| 930 | Ga0207658_10884370 | 3300025986 | Unclassified | 813 |
| 931 | Ga0207677_10011855 | 3300026023 | Bacteria | 4988 |
| 932 | Ga0207677_10089514 | 3300026023 | Bacteria | 2234 |
| 933 | Ga0207677_10098606 | 3300026023 | Bacteria | 2144 |
| 934 | Ga0207677_10146418 | 3300026023 | Bacteria | 1816 |
| 935 | Ga0207677_10187502 | 3300026023 | Bacteria | 1633 |
| 936 | Ga0207677_10252945 | 3300026023 | Unclassified | 1432 |
| 937 | Ga0207677_10379498 | 3300026023 | Unclassified | 1193 |
| 938 | Ga0207677_10738246 | 3300026023 | Bacteria | 876 |
| 939 | Ga0207677_10863564 | 3300026023 | Bacteria | 814 |
| 940 | Ga0207703_10005921 | 3300026035 | Bacteria | 9800 |
| 941 | Ga0207703_10007291 | 3300026035 | Bacteria | 8791 |
| 942 | Ga0207703_10059886 | 3300026035 | Bacteria | 3111 |
| 943 | Ga0207703_10119091 | 3300026035 | Bacteria | 2264 |
| 944 | Ga0207703_10198221 | 3300026035 | Bacteria | 1783 |
| 945 | Ga0207703_10282430 | 3300026035 | Unclassified | 1508 |
| 946 | Ga0207639_10008842 | 3300026041 | Bacteria | 6925 |
| 947 | Ga0207639_10030631 | 3300026041 | Bacteria | 3947 |
| 948 | Ga0207639_10353982 | 3300026041 | Bacteria | 1312 |
| 949 | Ga0207639_10401021 | 3300026041 | Bacteria | 1235 |
| 950 | Ga0207678_10004526 | 3300026067 | Bacteria | 12499 |
| 951 | Ga0207678_10010760 | 3300026067 | Bacteria | 8038 |
| 952 | Ga0207678_10014233 | 3300026067 | Bacteria | 6993 |
| 953 | Ga0207678_10154353 | 3300026067 | Unclassified | 1960 |
| 954 | Ga0207678_10187032 | 3300026067 | Unclassified | 1769 |
| 955 | Ga0207678_10483728 | 3300026067 | Unclassified | 1078 |
| 956 | Ga0207708_10008199 | 3300026075 | Bacteria | 7740 |
| 957 | Ga0207708_10473231 | 3300026075 | Unclassified | 1047 |
| 958 | Ga0207708_10578467 | 3300026075 | Bacteria | 949 |
| 959 | Ga0207708_10767764 | 3300026075 | Bacteria | 828 |
| 960 | Ga0207702_10000715 | 3300026078 | Bacteria | 35679 |
| 961 | Ga0207702_10017719 | 3300026078 | Bacteria | 5895 |
| 962 | Ga0207702_10027561 | 3300026078 | Bacteria | 4718 |
| 963 | Ga0207702_10056652 | 3300026078 | Bacteria | 3328 |
| 964 | Ga0207641_10001932 | 3300026088 | Bacteria | 19887 |
| 965 | Ga0207641_10002486 | 3300026088 | Bacteria | 17012 |
| 966 | Ga0207641_10048312 | 3300026088 | Bacteria | 3591 |
| 967 | Ga0207641_10068310 | 3300026088 | Bacteria | 3047 |
| 968 | Ga0207641_10696297 | 3300026088 | Unclassified | 1000 |
| 969 | Ga0207648_10000364 | 3300026089 | Bacteria | 49697 |
| 970 | Ga0207648_10002046 | 3300026089 | Bacteria | 21988 |
| 971 | Ga0207648_10003344 | 3300026089 | Bacteria | 16855 |
| 972 | Ga0207648_10014214 | 3300026089 | Bacteria | 7363 |
| 973 | Ga0207648_10035274 | 3300026089 | Bacteria | 4407 |
| 974 | Ga0207648_10114825 | 3300026089 | Bacteria | 2366 |
| 975 | Ga0207648_10173623 | 3300026089 | Unclassified | 1906 |
| 976 | Ga0207648_10907644 | 3300026089 | Bacteria | 823 |
| 977 | Ga0207676_10000633 | 3300026095 | Bacteria | 28376 |
| 978 | Ga0207676_10003751 | 3300026095 | Bacteria | 10735 |
| 979 | Ga0207676_10014659 | 3300026095 | Bacteria | 5645 |
| 980 | Ga0207676_10126705 | 3300026095 | Unclassified | 2164 |
| 981 | Ga0207676_10151572 | 3300026095 | Unclassified | 1997 |
| 982 | Ga0207674_10000225 | 3300026116 | Bacteria | 70648 |
| 983 | Ga0207674_10030050 | 3300026116 | Bacteria | 5716 |
| 984 | Ga0207674_10108322 | 3300026116 | Bacteria | 2755 |
| 985 | Ga0207674_10281679 | 3300026116 | Bacteria | 1610 |
| 986 | Ga0207675_100000658 | 3300026118 | Bacteria | 33969 |
| 987 | Ga0207675_100048450 | 3300026118 | Bacteria | 3966 |
| 988 | Ga0207675_100054380 | 3300026118 | Bacteria | 3734 |
| 989 | Ga0207675_100133367 | 3300026118 | Bacteria | 2355 |
| 990 | Ga0207675_100211783 | 3300026118 | Unclassified | 1864 |
| 991 | Ga0207675_100243445 | 3300026118 | Bacteria | 1738 |
| 992 | Ga0207675_101089251 | 3300026118 | Unclassified | 819 |
| 993 | Ga0207683_10000076 | 3300026121 | Bacteria | 77762 |
| 994 | Ga0207683_10000121 | 3300026121 | Bacteria | 64376 |
| 995 | Ga0207683_10005699 | 3300026121 | Bacteria | 10686 |
| 996 | Ga0207683_10013281 | 3300026121 | Bacteria | 7022 |
| 997 | Ga0207683_10083217 | 3300026121 | Bacteria | 2844 |
| 998 | Ga0207683_10225139 | 3300026121 | Bacteria | 1710 |
| 999 | Ga0207683_10311584 | 3300026121 | Bacteria | 1441 |
| 1000 | Ga0207698_10007229 | 3300026142 | Bacteria | 6957 |
| 1001 | Ga0207698_10007522 | 3300026142 | Bacteria | 6827 |
| 1002 | Ga0207698_10015072 | 3300026142 | Bacteria | 5165 |
| 1003 | Ga0207698_10083517 | 3300026142 | Bacteria | 2585 |
| 1004 | Ga0207698_10161096 | 3300026142 | Bacteria | 1962 |
| 1005 | Ga0207698_10366647 | 3300026142 | Unclassified | 1366 |
| 1006 | Ga0207698_10400033 | 3300026142 | Unclassified | 1312 |
| 1007 | Ga0207698_10426621 | 3300026142 | Bacteria | 1274 |
| 1008 | Ga0209995_1007841 | 3300027471 | Bacteria | 1722 |
| 1009 | Ga0209968_1022046 | 3300027526 | Bacteria | 1037 |
| 1010 | Ga0209982_1041769 | 3300027552 | Bacteria | 732 |
| 1011 | Ga0210002_1007025 | 3300027617 | Bacteria | 1703 |
| 1012 | Ga0210002_1026552 | 3300027617 | Bacteria | 950 |
| 1013 | Ga0209983_1003112 | 3300027665 | Bacteria | 3564 |
| 1014 | Ga0209971_1001091 | 3300027682 | Bacteria | 6889 |
| 1015 | Ga0209974_10000048 | 3300027876 | Bacteria | 30134 |
| 1016 | Ga0209974_10049320 | 3300027876 | Bacteria | 1412 |
| 1017 | Ga0207428_10354896 | 3300027907 | Bacteria | 1078 |
| 1018 | Ga0268266_10028455 | 3300028379 | Bacteria | 4750 |
| 1019 | Ga0268266_10046833 | 3300028379 | Bacteria | 3702 |
| 1020 | Ga0268266_10066893 | 3300028379 | Bacteria | 3109 |
| 1021 | Ga0268266_10101921 | 3300028379 | Bacteria | 2531 |
| 1022 | Ga0268266_10181768 | 3300028379 | Bacteria | 1915 |
| 1023 | Ga0268266_10324459 | 3300028379 | Unclassified | 1442 |
| 1024 | Ga0268266_10494484 | 3300028379 | Bacteria | 1167 |
| 1025 | Ga0268266_10725778 | 3300028379 | Bacteria | 958 |
| 1026 | Ga0268266_10781206 | 3300028379 | Unclassified | 922 |
| 1027 | Ga0268265_10049098 | 3300028380 | Unclassified | 3172 |
| 1028 | Ga0268265_10104731 | 3300028380 | Bacteria | 2294 |
| 1029 | Ga0268265_10174509 | 3300028380 | Bacteria | 1841 |
| 1030 | Ga0268265_10361016 | 3300028380 | Bacteria | 1330 |
| 1031 | Ga0268265_10599475 | 3300028380 | Bacteria | 1053 |
| 1032 | Ga0268264_10007545 | 3300028381 | Bacteria | 9076 |
| 1033 | Ga0268264_10010492 | 3300028381 | Bacteria | 7658 |
| 1034 | Ga0268264_10024971 | 3300028381 | Bacteria | 4884 |
| 1035 | Ga0268264_10067969 | 3300028381 | Bacteria | 3009 |
| 1036 | Ga0268264_10084520 | 3300028381 | Bacteria | 2721 |
| 1037 | Ga0268264_10280500 | 3300028381 | Unclassified | 1560 |
| 1038 | Ga0268264_10328401 | 3300028381 | Bacteria | 1449 |
| 1039 | Ga0268264_10330570 | 3300028381 | Bacteria | 1444 |
| 1040 | Ga0268264_10640838 | 3300028381 | Bacteria | 1051 |
| 1041 | Ga0307513_10045324 | 3300031456 | Bacteria | 4807 |
| 1042 | Ga0307408_100557049 | 3300031548 | Bacteria | 1012 |
| 1043 | Ga0307408_100827325 | 3300031548 | Bacteria | 842 |
| 1044 | Ga0307405_10369740 | 3300031731 | Bacteria | 1112 |
| 1045 | Ga0307405_10514766 | 3300031731 | Bacteria | 962 |
| 1046 | Ga0307405_10572863 | 3300031731 | Bacteria | 917 |
| 1047 | Ga0307413_10080155 | 3300031824 | Unclassified | 2089 |
| 1048 | Ga0307410_10098627 | 3300031852 | Bacteria | 2090 |
| 1049 | Ga0307410_10178627 | 3300031852 | Unclassified | 1605 |
| 1050 | Ga0307410_10449410 | 3300031852 | Bacteria | 1051 |
| 1051 | Ga0307406_10072396 | 3300031901 | Unclassified | 2262 |
| 1052 | Ga0307407_10001541 | 3300031903 | Bacteria | 8458 |
| 1053 | Ga0307407_10600723 | 3300031903 | Bacteria | 819 |
| 1054 | Ga0307412_10048394 | 3300031911 | Bacteria | 2796 |
| 1055 | Ga0307409_100005712 | 3300031995 | Bacteria | 7211 |
| 1056 | Ga0307409_100009446 | 3300031995 | Bacteria | 5992 |
| 1057 | Ga0307409_100024574 | 3300031995 | Bacteria | 4205 |
| 1058 | Ga0307409_101149512 | 3300031995 | Bacteria | 799 |
| 1059 | Ga0307416_100005475 | 3300032002 | Bacteria | 7798 |
| 1060 | Ga0307416_100385011 | 3300032002 | Bacteria | 1434 |
| 1061 | Ga0307416_100503129 | 3300032002 | Unclassified | 1276 |
| 1062 | Ga0307414_10021464 | 3300032004 | Bacteria | 4053 |
| 1063 | Ga0307414_10365959 | 3300032004 | Unclassified | 1242 |
| 1064 | Ga0307411_10027198 | 3300032005 | Bacteria | 3456 |
| 1065 | Ga0307411_10043391 | 3300032005 | Bacteria | 2877 |
| 1066 | Ga0307415_100019074 | 3300032126 | Bacteria | 4157 |
| 1067 | Ga0307415_100267275 | 3300032126 | Bacteria | 1399 |
| 1068 | Ga0373959_0091406 | 3300034820 | Unclassified | 714 |
| 1069 | Ga0373929_0090138 | 3300035085 | Unclassified | 760 |
| 1070 | Ga0373934_0055451 | 3300035086 | Unclassified | 1575 |
| 1071 | Ga0373944_0051313 | 3300035089 | Bacteria | 1301 |
| 1072 | Ga0373949_0043851 | 3300035090 | Bacteria | 1108 |
| 1073 | Ga0373951_0055773 | 3300035091 | Unclassified | 981 |
| 1074 | Ga0373923_0221649 | 3300035111 | Bacteria | 879 |
| 1075 | Ga0373945_0035016 | 3300035116 | Bacteria | 1793 |
| 1076 | Ga0373953_0018370 | 3300035117 | Unclassified | 2586 |
| 1077 | Ga0373953_0127717 | 3300035117 | Bacteria | 1083 |
| 1078 | Ga0373954_0134456 | 3300035118 | Unclassified | 1205 |
| 1079 | Ga0373954_0383179 | 3300035118 | Bacteria | 695 |
| 1080 | Ga0373957_0056436 | 3300035120 | Unclassified | 1512 |
| 1081 | Ga0373957_0140634 | 3300035120 | Bacteria | 987 |
| 1082 | Ga0373943_0013149 | 3300035170 | Bacteria | 3735 |
| 1083 | Ga0373943_0042386 | 3300035170 | Unclassified | 2206 |
| 1084 | Ga0373943_0108319 | 3300035170 | Unclassified | 1462 |
| 1085 | Ga0373943_0164482 | 3300035170 | Bacteria | 1210 |
| 1086 | Ga0373943_0187626 | 3300035170 | Unclassified | 1139 |
| 1087 | Ga0373943_0295284 | 3300035170 | Bacteria | 919 |
| 1088 | Ga0373943_0296106 | 3300035170 | Unclassified | 918 |
| 1089 | Ga0373946_0053581 | 3300035171 | Bacteria | 1695 |
| 1090 | Ga0373955_0031790 | 3300035172 | Unclassified | 2766 |
| 1091 | Ga0373955_0123356 | 3300035172 | Unclassified | 1507 |
| 1092 | Ga0373955_0207398 | 3300035172 | Bacteria | 1168 |
| 1093 | Ga0373955_0431393 | 3300035172 | Bacteria | 802 |
| 1094 | Ga0373942_0174660 | 3300035207 | Unclassified | 701 |
| 1095 | Ga0373942_0233011 | 3300035207 | Unclassified | 621 |
| 1096 | Ga0373961_0055934 | 3300035241 | Unclassified | 1184 |
| 1097 | Ga0373961_0141227 | 3300035241 | Unclassified | 814 |
| 1098 | Ga0373961_0231975 | 3300035241 | Bacteria | 662 |
| 1099 | Ga0373924_0168041 | 3300035410 | Bacteria | 963 |
| 1100 | Ga0373924_0193320 | 3300035410 | Unclassified | 897 |
| 1101 | Ga0373924_0272505 | 3300035410 | Unclassified | 750 |
| 1102 | Ga0373931_0065836 | 3300035691 | Bacteria | 1965 |
| 1103 | Ga0373931_0093401 | 3300035691 | Bacteria | 1680 |
| 1104 | Ga0373931_0162623 | 3300035691 | Bacteria | 1310 |
| 1105 | Ga0373931_0285613 | 3300035691 | Unclassified | 1014 |
| 1106 | Ga0373931_0532831 | 3300035691 | Unclassified | 761 |
| 1107 | Ga0373935_0048456 | 3300035692 | Bacteria | 2690 |
| 1108 | Ga0373935_0049597 | 3300035692 | Bacteria | 2661 |
| 1109 | Ga0373935_0128571 | 3300035692 | Unclassified | 1700 |
| 1110 | Ga0373935_0353488 | 3300035692 | Unclassified | 1048 |
| 1111 | Ga0373935_0554699 | 3300035692 | Unclassified | 838 |
| 1112 | Ga0373927_0086834 | 3300035695 | Bacteria | 2031 |
| 1113 | Ga0373927_0157181 | 3300035695 | Bacteria | 1489 |
| 1114 | Ga0373927_0160628 | 3300035695 | Unclassified | 1472 |
| 1115 | Ga0373933_0078009 | 3300035724 | Bacteria | 2026 |
| 1116 | Ga0373933_0434664 | 3300035724 | Unclassified | 858 |
| 1117 | Ga0373933_0751308 | 3300035724 | Unclassified | 642 |
| 1118 | Ga0373947_0153234 | 3300035725 | Unclassified | 1486 |
| 1119 | Ga0373947_0156153 | 3300035725 | Unclassified | 1473 |
| 1120 | Ga0373937_0004100 | 3300036401 | Bacteria | 12359 |
| 1121 | Ga0373937_0020917 | 3300036401 | Bacteria | 5869 |
| 1122 | Ga0373937_0084311 | 3300036401 | Bacteria | 2940 |
| 1123 | Ga0373937_0086762 | 3300036401 | Bacteria | 2896 |
| 1124 | Ga0373937_0454968 | 3300036401 | Unclassified | 1216 |
| 1125 | Ga0373937_0719962 | 3300036401 | Bacteria | 945 |
| 1126 | Ga0373925_0014302 | 3300037068 | Bacteria | 5741 |
| 1127 | Ga0373925_0051602 | 3300037068 | Bacteria | 3071 |
| 1128 | Ga0373925_0175884 | 3300037068 | Bacteria | 1692 |
| 1129 | Ga0373925_0212371 | 3300037068 | Bacteria | 1542 |
| 1130 | Ga0373925_0656339 | 3300037068 | Unclassified | 864 |
| 1131 | Ga0395900_0002016 | 3300037418 | Bacteria | 22869 |
| 1132 | Ga0395900_0035910 | 3300037418 | Bacteria | 5107 |
| 1133 | Ga0395900_0203491 | 3300037418 | Unclassified | 2002 |
| 1134 | Ga0395900_0217548 | 3300037418 | Bacteria | 1927 |
| 1135 | Ga0395900_0767025 | 3300037418 | Unclassified | 894 |
| 1136 | Ga0395898_0012264 | 3300037466 | Bacteria | 8863 |
| 1137 | Ga0395898_0118427 | 3300037466 | Bacteria | 2537 |
| 1138 | Ga0395898_0293100 | 3300037466 | Bacteria | 1552 |
| 1139 | Ga0395905_0034576 | 3300037471 | Bacteria | 4746 |
| 1140 | Ga0395905_0158105 | 3300037471 | Bacteria | 2131 |
| 1141 | Ga0395905_0517289 | 3300037471 | Bacteria | 1094 |
| 1142 | Ga0395901_0034534 | 3300038443 | Bacteria | 5222 |
| 1143 | Ga0395901_0056833 | 3300038443 | Bacteria | 4071 |
| 1144 | Ga0395901_0367164 | 3300038443 | Unclassified | 1483 |
| 1145 | Ga0395901_1110382 | 3300038443 | Unclassified | 761 |
| 1146 | Ga0436363_0788885 | 3300039450 | Unclassified | 1095 |
| 1147 | Ga0436362_0735304 | 3300039453 | Unclassified | 1533 |
| 1148 | Ga0451791_0486903 | 3300041451 | Unclassified | 907 |
| 1149 | Ga0451807_0453940 | 3300041486 | Unclassified | 1519 |
| 1150 | Ga0451807_0845975 | 3300041486 | Bacteria | 2570 |
| 1151 | Ga0451807_1843067 | 3300041486 | Unclassified | 1225 |
| 1152 | Ga0451807_2078124 | 3300041486 | Unclassified | 631 |
| 1153 | Ga0451835_0936074 | 3300041492 | Unclassified | 1086 |
| 1154 | Ga0451839_0036848 | 3300041496 | Bacteria | 825 |
| 1155 | Ga0439448_0090790 | 3300042005 | Unclassified | 1032 |
| 1156 | Ga0439451_003915 | 3300042009 | Bacteria | 3028 |
| 1157 | Ga0439454_004180 | 3300042011 | Bacteria | 1648 |
| 1158 | Ga0439454_038878 | 3300042011 | Unclassified | 772 |
| 1159 | Ga0439455_0017390 | 3300042012 | Unclassified | 1675 |
| 1160 | Ga0439434_0225377 | 3300042435 | Bacteria | 637 |
| 1161 | Ga0439435_0107671 | 3300042436 | Bacteria | 862 |
| 1162 | Ga0439459_0056536 | 3300042438 | Unclassified | 876 |
| 1163 | Ga0451577_0672392 | 3300042876 | Unclassified | 938 |
| 1164 | Ga0466965_0363010 | 3300044683 | Unclassified | 795 |
| 1165 | Ga0466964_0063166 | 3300044706 | Unclassified | 1546 |
| 1166 | Ga0451576_0000443 | 3300045051 | Bacteria | 94447 |
| 1167 | Ga0451576_0005126 | 3300045051 | Bacteria | 16602 |
| 1168 | Ga0451576_0062976 | 3300045051 | Bacteria | 3866 |
| 1169 | Ga0466967_0580341 | 3300045976 | Bacteria | 1105 |
| 1170 | Ga0495592_0077861 | 3300046454 | Bacteria | 2402 |
| 1171 | Ga0495603_0499316 | 3300046455 | Bacteria | 697 |
| 1172 | Ga0495603_0542386 | 3300046455 | Unclassified | 666 |
| 1173 | Ga0495651_0002069 | 3300046462 | Bacteria | 15476 |
| 1174 | Ga0495651_0119451 | 3300046462 | Bacteria | 1939 |
| 1175 | Ga0495651_0167256 | 3300046462 | Unclassified | 1569 |
| 1176 | Ga0495651_0489282 | 3300046462 | Unclassified | 789 |
| 1177 | Ga0495653_0131853 | 3300046463 | Unclassified | 1768 |
| 1178 | Ga0495653_0379707 | 3300046463 | Bacteria | 903 |
| 1179 | Ga0495580_0288511 | 3300046472 | Bacteria | 1119 |
| 1180 | Ga0495605_0252741 | 3300046474 | Unclassified | 754 |
| 1181 | Ga0495662_0133205 | 3300046476 | Bacteria | 1222 |
| 1182 | Ga0495662_0315612 | 3300046476 | Unclassified | 769 |
| 1183 | Ga0495585_0261865 | 3300046492 | Unclassified | 860 |
| 1184 | Ga0495608_0059603 | 3300046511 | Bacteria | 2514 |
| 1185 | Ga0495608_0104512 | 3300046511 | Unclassified | 1824 |
| 1186 | Ga0495608_0135699 | 3300046511 | Unclassified | 1573 |
| 1187 | Ga0495608_0419992 | 3300046511 | Unclassified | 816 |
| 1188 | Ga0495618_0106238 | 3300046514 | Bacteria | 1797 |
| 1189 | Ga0495628_0161951 | 3300046516 | Unclassified | 1700 |
| 1190 | Ga0495628_0398602 | 3300046516 | Bacteria | 1005 |
| 1191 | Ga0495630_0017716 | 3300046517 | Bacteria | 5222 |
| 1192 | Ga0495630_0122358 | 3300046517 | Bacteria | 1974 |
| 1193 | Ga0495630_0659161 | 3300046517 | Unclassified | 801 |
| 1194 | Ga0495652_0002382 | 3300046529 | Bacteria | 19460 |
| 1195 | Ga0495652_0018444 | 3300046529 | Bacteria | 6220 |
| 1196 | Ga0495652_0097537 | 3300046529 | Bacteria | 2391 |
| 1197 | Ga0495665_0080554 | 3300046531 | Bacteria | 1713 |
| 1198 | Ga0495587_0099795 | 3300046536 | Bacteria | 1673 |
| 1199 | Ga0495598_0065706 | 3300046537 | Bacteria | 1130 |
| 1200 | Ga0495621_0067420 | 3300046539 | Bacteria | 1311 |
| 1201 | Ga0495645_0001349 | 3300046543 | Bacteria | 16596 |
| 1202 | Ga0495645_0076108 | 3300046543 | Bacteria | 2415 |
| 1203 | Ga0495645_0098755 | 3300046543 | Bacteria | 2078 |
| 1204 | Ga0495645_0223375 | 3300046543 | Bacteria | 1266 |
| 1205 | Ga0495667_0015938 | 3300046559 | Bacteria | 5080 |
| 1206 | Ga0495667_0035700 | 3300046559 | Unclassified | 3321 |
| 1207 | Ga0495667_0467394 | 3300046559 | Bacteria | 792 |
| 1208 | Ga0495656_0354571 | 3300046615 | Unclassified | 761 |
| 1209 | Ga0495635_0703429 | 3300046663 | Unclassified | 655 |
| 1210 | Ga0495635_0727494 | 3300046663 | Bacteria | 642 |
| 1211 | Ga0495659_0105214 | 3300046664 | Unclassified | 1097 |
| 1212 | Ga0495659_0201372 | 3300046664 | Unclassified | 817 |
| 1213 | Ga0495657_0024000 | 3300046675 | Unclassified | 4350 |
| 1214 | Ga0495599_0083130 | 3300046678 | Unclassified | 2000 |
| 1215 | Ga0495599_0169053 | 3300046678 | Bacteria | 1349 |
| 1216 | Ga0495599_0609517 | 3300046678 | Bacteria | 635 |
| 1217 | Ga0495623_0018902 | 3300046679 | Bacteria | 4449 |
| 1218 | Ga0495623_0065191 | 3300046679 | Bacteria | 2278 |
| 1219 | Ga0495646_0022094 | 3300046680 | Bacteria | 4015 |
| 1220 | Ga0495658_0066607 | 3300046683 | Bacteria | 2081 |
| 1221 | Ga0495658_0183254 | 3300046683 | Unclassified | 1300 |
| 1222 | Ga0495669_0168597 | 3300046684 | Bacteria | 1041 |
| 1223 | Ga0495669_0237917 | 3300046684 | Unclassified | 874 |
| 1224 | Ga0495600_0052803 | 3300046809 | Unclassified | 2654 |
| 1225 | Ga0495600_0112176 | 3300046809 | Bacteria | 1776 |
| 1226 | Ga0495604_0480204 | 3300047317 | Bacteria | 808 |
| 1227 | Ga0495674_0201867 | 3300047319 | Bacteria | 1649 |
| 1228 | Ga0495676_0184902 | 3300047321 | Bacteria | 1458 |
| 1229 | Ga0495680_0218080 | 3300047322 | Bacteria | 1363 |
| 1230 | Ga0495680_0572295 | 3300047322 | Bacteria | 759 |
| 1231 | Ga0495680_0776973 | 3300047322 | Bacteria | 627 |
| 1232 | Ga0495675_0020921 | 3300047444 | Unclassified | 4164 |
| 1233 | Ga0495675_0106698 | 3300047444 | Bacteria | 1750 |
| 1234 | Ga0495684_0018401 | 3300047471 | Bacteria | 5382 |
| 1235 | Ga0495684_0244313 | 3300047471 | Unclassified | 1308 |
| 1236 | Ga0495593_0099700 | 3300047673 | Bacteria | 1491 |
| 1237 | Ga0495602_0092945 | 3300048088 | Bacteria | 2497 |
| 1238 | Ga0495602_0485795 | 3300048088 | Unclassified | 866 |
| 1239 | Ga0496100_0029379 | 3300048903 | Unclassified | 3400 |
| 1240 | Ga0496100_0363946 | 3300048903 | Bacteria | 1095 |
| 1241 | Ga0496100_0367823 | 3300048903 | Bacteria | 1089 |
| 1242 | Ga0496100_0603440 | 3300048903 | Unclassified | 852 |
| 1243 | Ga0496101_0030711 | 3300048904 | Bacteria | 3771 |
| 1244 | Ga0496101_0057350 | 3300048904 | Bacteria | 2817 |
| 1245 | Ga0496101_0191061 | 3300048904 | Unclassified | 1580 |
| 1246 | Ga0496101_0255690 | 3300048904 | Unclassified | 1365 |
| 1247 | Ga0496101_0390007 | 3300048904 | Bacteria | 1096 |
| 1248 | Ga0496102_0060713 | 3300048905 | Unclassified | 3458 |
| 1249 | Ga0496102_0098397 | 3300048905 | Bacteria | 2714 |
| 1250 | Ga0496102_0248196 | 3300048905 | Bacteria | 1678 |
| 1251 | Ga0496102_0557253 | 3300048905 | Unclassified | 1069 |
| 1252 | Ga0496102_1183070 | 3300048905 | Bacteria | 684 |
| 1253 | Ga0496103_0048618 | 3300048906 | Bacteria | 2621 |
| 1254 | Ga0496103_0074371 | 3300048906 | Bacteria | 2130 |
| 1255 | Ga0496103_0099912 | 3300048906 | Bacteria | 1836 |
| 1256 | Ga0496104_0242492 | 3300048907 | Bacteria | 1715 |
| 1257 | Ga0496104_0267729 | 3300048907 | Unclassified | 1621 |
| 1258 | Ga0496104_0292550 | 3300048907 | Unclassified | 1541 |
| 1259 | Ga0496104_0369501 | 3300048907 | Unclassified | 1347 |
| 1260 | Ga0496104_0406503 | 3300048907 | Unclassified | 1274 |
| 1261 | Ga0496105_0015917 | 3300048908 | Bacteria | 5999 |
| 1262 | Ga0496105_0171980 | 3300048908 | Unclassified | 1776 |
| 1263 | Ga0496106_0000931 | 3300048909 | Bacteria | 21318 |
| 1264 | Ga0496106_0089107 | 3300048909 | Bacteria | 2379 |
| 1265 | Ga0496106_0302521 | 3300048909 | Unclassified | 1283 |
| 1266 | Ga0496106_0441091 | 3300048909 | Bacteria | 1046 |
| 1267 | Ga0496107_0004980 | 3300048910 | Bacteria | 9042 |
| 1268 | Ga0496107_0114221 | 3300048910 | Unclassified | 1987 |
| 1269 | Ga0496108_0228481 | 3300048911 | Unclassified | 1618 |
| 1270 | Ga0496108_0275170 | 3300048911 | Unclassified | 1466 |
| 1271 | Ga0496108_0358646 | 3300048911 | Bacteria | 1272 |
| 1272 | Ga0496108_0529651 | 3300048911 | Bacteria | 1028 |
| 1273 | Ga0496108_0702327 | 3300048911 | Unclassified | 877 |
| 1274 | Ga0496109_0003295 | 3300048912 | Bacteria | 13486 |
| 1275 | Ga0496109_0267962 | 3300048912 | Unclassified | 1609 |
| 1276 | Ga0496109_0628543 | 3300048912 | Unclassified | 1010 |
| 1277 | Ga0496109_0727887 | 3300048912 | Bacteria | 930 |
| 1278 | Ga0496110_0005169 | 3300048913 | Bacteria | 10205 |
| 1279 | Ga0496110_0186176 | 3300048913 | Bacteria | 1885 |
| 1280 | Ga0496110_0730324 | 3300048913 | Bacteria | 893 |
| 1281 | Ga0496110_0748007 | 3300048913 | Bacteria | 881 |
| 1282 | Ga0496110_0983568 | 3300048913 | Bacteria | 751 |
| 1283 | Ga0496111_0071833 | 3300048914 | Bacteria | 2519 |
| 1284 | Ga0496111_0294540 | 3300048914 | Unclassified | 1203 |
| 1285 | Ga0496112_0012037 | 3300048915 | Bacteria | 7937 |
| 1286 | Ga0496112_0697637 | 3300048915 | Unclassified | 943 |
| 1287 | Ga0496112_0927724 | 3300048915 | Bacteria | 792 |
| 1288 | Ga0496113_0514411 | 3300048916 | Unclassified | 961 |
| 1289 | Ga0496114_0006008 | 3300048917 | Bacteria | 9553 |
| 1290 | Ga0496114_0386386 | 3300048917 | Unclassified | 1239 |
| 1291 | Ga0496115_0002245 | 3300048918 | Bacteria | 13825 |
| 1292 | Ga0496115_0011572 | 3300048918 | Bacteria | 6615 |
| 1293 | Ga0496115_0041385 | 3300048918 | Bacteria | 3667 |
| 1294 | Ga0496115_0361349 | 3300048918 | Bacteria | 1183 |
| 1295 | Ga0496115_0364171 | 3300048918 | Bacteria | 1178 |
| 1296 | Ga0496115_0779278 | 3300048918 | Unclassified | 746 |
| 1297 | Ga0501040_0268614 | 3300049576 | Unclassified | 1218 |
| 1298 | Ga0501067_0130946 | 3300049583 | Unclassified | 1396 |
| 1299 | Ga0501072_0837507 | 3300049588 | Bacteria | 719 |
| 1300 | Ga0501075_0244207 | 3300049591 | Bacteria | 1369 |
| 1301 | Ga0501243_001814 | 3300049675 | Bacteria | 3092 |
| 1302 | Ga0501081_0166412 | 3300049743 | Bacteria | 1591 |
| 1303 | Ga0501045_0359695 | 3300049824 | Bacteria | 1083 |
| 1304 | nmdc:mga05p37_230926_c1 | 3300050507 | Bacteria | 2229 |
| 1305 | nmdc:mga05p37_508068_c1 | 3300050507 | Unclassified | 1381 |
| 1306 | nmdc:mga05p37_624008_c1 | 3300050507 | Unclassified | 1212 |
| 1307 | nmdc:mga05p37_626317_c1 | 3300050507 | Unclassified | 1210 |
| 1308 | nmdc:mga08y16_1060237_c1 | 3300050511 | Unclassified | 787 |
| 1309 | nmdc:mga08y16_123955_c1 | 3300050511 | Unclassified | 2688 |
| 1310 | nmdc:mga08y16_140210_c1 | 3300050511 | Bacteria | 2513 |
| 1311 | nmdc:mga08y16_250812_c1 | 3300050511 | Bacteria | 1829 |
| 1312 | nmdc:mga08y16_4473_c1 | 3300050511 | Bacteria | 14606 |
| 1313 | nmdc:mga0n895_1016870_c1 | 3300050512 | Bacteria | 809 |
| 1314 | nmdc:mga0n895_120848_c1 | 3300050512 | Bacteria | 2640 |
| 1315 | nmdc:mga0n895_264144_c1 | 3300050512 | Bacteria | 1746 |
| 1316 | nmdc:mga0n895_325208_c1 | 3300050512 | Bacteria | 1558 |
| 1317 | nmdc:mga0n895_383427_c1 | 3300050512 | Bacteria | 1422 |
| 1318 | nmdc:mga0n895_979579_c1 | 3300050512 | Unclassified | 828 |
| 1319 | nmdc:mga08x19_258084_c1 | 3300050514 | Bacteria | 1204 |
| 1320 | nmdc:mga08x19_398716_c1 | 3300050514 | Bacteria | 965 |
| 1321 | nmdc:mga08x19_528808_c1 | 3300050514 | Bacteria | 834 |
| 1322 | nmdc:mga0a205_738712_c1 | 3300050515 | Bacteria | 833 |
| 1323 | nmdc:mga0a205_75661_c1 | 3300050515 | Bacteria | 3253 |
| 1324 | Ga0495601_0031806 | 3300053077 | Bacteria | 3281 |
| 1325 | Ga0495601_0122844 | 3300053077 | Bacteria | 1687 |
| 1326 | Ga0495595_0112475 | 3300053084 | Bacteria | 1321 |
| 1327 | Ga0495595_0139857 | 3300053084 | Bacteria | 1187 |
| 1328 | Ga0495619_0055978 | 3300053085 | Bacteria | 2614 |
| 1329 | Ga0495619_0429277 | 3300053085 | Bacteria | 911 |
| 1330 | Ga0495619_0528656 | 3300053085 | Bacteria | 810 |
| 1331 | Ga0157378_10014139 | |||
| 1332 | SwRhRL2b_contig_1634644 | |||
| 1333 | SwRhRL2b_contig_387844 | |||
| 1334 | JGI24035J26624_1001983 | |||
| 1335 | rootL2_10328949 | |||
| 1336 | JGI25405J52794_10000323 | |||
| 1337 | JGI25405J52794_10001843 | |||
| 1338 | JGI25405J52794_10001884 | |||
| 1339 | Ga0065704_10004765 | |||
| 1340 | Ga0065704_10234770 | |||
| 1341 | Ga0065712_10006901 | |||
| 1342 | Ga0065712_10009838 | |||
| 1343 | Ga0065715_10008051 | |||
| 1344 | Ga0065715_10013045 | |||
| 1345 | Ga0065715_10048647 | |||
| 1346 | Ga0065715_10109052 | |||
| 1347 | Ga0065715_10240229 | |||
| 1348 | Ga0065715_10282308 | |||
| 1349 | Ga0065715_10336623 | |||
| 1350 | Ga0065715_10425309 | |||
| 1351 | Ga0065707_10219050 | |||
| 1352 | Ga0070658_10009067 | |||
| 1353 | Ga0070676_10001268 | |||
| 1354 | Ga0070676_10045600 | |||
| 1355 | Ga0070676_10057250 | |||
| 1356 | Ga0070676_10083387 | |||
| 1357 | Ga0070683_100004758 | |||
| 1358 | Ga0070683_100017515 | |||
| 1359 | Ga0070683_100041501 | |||
| 1360 | Ga0070683_100253871 | |||
| 1361 | Ga0070683_100400758 | |||
| 1362 | Ga0070690_100019100 | |||
| 1363 | Ga0070690_100019262 | |||
| 1364 | Ga0070690_100168997 | |||
| 1365 | Ga0070670_100031216 | |||
| 1366 | Ga0070670_100153032 | |||
| 1367 | Ga0070670_100232408 | |||
| 1368 | Ga0070670_100252135 | |||
| 1369 | Ga0070677_10000242 | |||
| 1370 | Ga0070677_10064647 | |||
| 1371 | Ga0070677_10121982 | |||
| 1372 | Ga0068869_100086683 | |||
| 1373 | Ga0068869_100087886 | |||
| 1374 | Ga0070666_10001424 | |||
| 1375 | Ga0070666_10013532 | |||
| 1376 | Ga0070666_10035493 | |||
| 1377 | Ga0070666_10064321 | |||
| 1378 | Ga0070666_10138075 | |||
| 1379 | Ga0070666_10196339 | |||
| 1380 | Ga0070666_10204638 | |||
| 1381 | Ga0070680_100016424 | |||
| 1382 | Ga0070680_100150489 | |||
| 1383 | Ga0070680_100304887 | |||
| 1384 | Ga0070682_100064400 | |||
| 1385 | Ga0070682_100123707 | |||
| 1386 | Ga0068868_100002750 | |||
| 1387 | Ga0068868_100006774 | |||
| 1388 | Ga0068868_100010675 | |||
| 1389 | Ga0068868_100192419 | |||
| 1390 | Ga0068868_100200598 | |||
| 1391 | Ga0068868_100328946 | |||
| 1392 | Ga0068868_100374611 | |||
| 1393 | Ga0068868_100412726 | |||
| 1394 | Ga0068868_100439175 | |||
| 1395 | Ga0070660_100000551 | |||
| 1396 | Ga0070660_100118693 | |||
| 1397 | Ga0070660_100130753 | |||
| 1398 | Ga0070660_100291947 | |||
| 1399 | Ga0070660_100507930 | |||
| 1400 | Ga0070689_100013944 | |||
| 1401 | Ga0070689_100017987 | |||
| 1402 | Ga0070689_100160610 | |||
| 1403 | Ga0070689_100328318 | |||
| 1404 | Ga0070689_100421195 | |||
| 1405 | Ga0070687_100024597 | |||
| 1406 | Ga0070687_100034776 | |||
| 1407 | Ga0070661_100007142 | |||
| 1408 | Ga0070661_100033026 | |||
| 1409 | Ga0070661_100033465 | |||
| 1410 | Ga0070661_100041563 | |||
| 1411 | Ga0070661_100118517 | |||
| 1412 | Ga0070692_10223773 | |||
| 1413 | Ga0070668_100001406 | |||
| 1414 | Ga0070668_100003165 | |||
| 1415 | Ga0070668_100045194 | |||
| 1416 | Ga0070668_100219615 | |||
| 1417 | Ga0070668_100607428 | |||
| 1418 | Ga0070668_101028943 | |||
| 1419 | Ga0070668_101652075 | |||
| 1420 | Ga0070669_100002287 | |||
| 1421 | Ga0070669_100104050 | |||
| 1422 | Ga0070669_100161040 | |||
| 1423 | Ga0070669_100187338 | |||
| 1424 | Ga0070669_100220747 | |||
| 1425 | Ga0070669_100264653 | |||
| 1426 | Ga0070669_100377487 | |||
| 1427 | Ga0070669_100822886 | |||
| 1428 | Ga0070675_100002082 | |||
| 1429 | Ga0070675_100022317 | |||
| 1430 | Ga0070675_100030145 | |||
| 1431 | Ga0070675_100049890 | |||
| 1432 | Ga0070675_100063086 | |||
| 1433 | Ga0070675_100067503 | |||
| 1434 | Ga0070675_100071808 | |||
| 1435 | Ga0070675_100103054 | |||
| 1436 | Ga0070675_100104988 | |||
| 1437 | Ga0070675_100156590 | |||
| 1438 | Ga0070675_100248840 | |||
| 1439 | Ga0070675_100572457 | |||
| 1440 | Ga0070675_101386494 | |||
| 1441 | Ga0070671_100003277 | |||
| 1442 | Ga0070671_100005547 | |||
| 1443 | Ga0070671_100020112 | |||
| 1444 | Ga0070671_100032550 | |||
| 1445 | Ga0070671_100047316 | |||
| 1446 | Ga0070671_100061954 | |||
| 1447 | Ga0070671_100063682 | |||
| 1448 | Ga0070671_100073286 | |||
| 1449 | Ga0070671_100158350 | |||
| 1450 | Ga0070671_100258573 | |||
| 1451 | Ga0070674_100000659 | |||
| 1452 | Ga0070674_100013733 | |||
| 1453 | Ga0070674_100026238 | |||
| 1454 | Ga0070674_100078097 | |||
| 1455 | Ga0070674_100129882 | |||
| 1456 | Ga0070673_100001356 | |||
| 1457 | Ga0070673_100007946 | |||
| 1458 | Ga0070673_100043069 | |||
| 1459 | Ga0070673_100045749 | |||
| 1460 | Ga0070673_100067957 | |||
| 1461 | Ga0070673_100103167 | |||
| 1462 | Ga0070673_100108362 | |||
| 1463 | Ga0070673_100185865 | |||
| 1464 | Ga0070673_100760360 | |||
| 1465 | Ga0070673_101433921 | |||
| 1466 | Ga0070688_100001625 | |||
| 1467 | Ga0070688_100019806 | |||
| 1468 | Ga0070688_100019867 | |||
| 1469 | Ga0070688_100039269 | |||
| 1470 | Ga0070688_100127953 | |||
| 1471 | Ga0070688_100128143 | |||
| 1472 | Ga0070688_100174111 | |||
| 1473 | Ga0070659_100000779 | |||
| 1474 | Ga0070659_100015404 | |||
| 1475 | Ga0070659_100169517 | |||
| 1476 | Ga0070659_100263081 | |||
| 1477 | Ga0070659_100395158 | |||
| 1478 | Ga0070659_100562625 | |||
| 1479 | Ga0070667_100003532 | |||
| 1480 | Ga0070667_100003566 | |||
| 1481 | Ga0070667_100008508 | |||
| 1482 | Ga0070667_100078143 | |||
| 1483 | Ga0070667_100084490 | |||
| 1484 | Ga0070667_100106801 | |||
| 1485 | Ga0070667_100151596 | |||
| 1486 | Ga0070667_100385570 | |||
| 1487 | Ga0070667_100398153 | |||
| 1488 | Ga0070667_100583168 | |||
| 1489 | Ga0070667_100677736 | |||
| 1490 | Ga0070667_100688044 | |||
| 1491 | Ga0070667_101120663 | |||
| 1492 | Ga0070703_10307702 | |||
| 1493 | Ga0070709_10020181 | |||
| 1494 | Ga0070709_10055060 | |||
| 1495 | Ga0070709_10111182 | |||
| 1496 | Ga0070709_10160059 | |||
| 1497 | Ga0070709_10201156 | |||
| 1498 | Ga0070709_10603542 | |||
| 1499 | Ga0070714_100037722 | |||
| 1500 | Ga0070714_100191387 | |||
| 1501 | Ga0070714_100269800 | |||
| 1502 | Ga0070714_100437980 | |||
| 1503 | Ga0070714_100635017 | |||
| 1504 | Ga0070713_100361069 | |||
| 1505 | Ga0070713_100662013 | |||
| 1506 | Ga0070710_10004182 | |||
| 1507 | Ga0070710_10028443 | |||
| 1508 | Ga0070710_10101610 | |||
| 1509 | Ga0070710_10168369 | |||
| 1510 | Ga0070701_10422935 | |||
| 1511 | Ga0070711_100024261 | |||
| 1512 | Ga0070711_100147637 | |||
| 1513 | Ga0070711_100211133 | |||
| 1514 | Ga0070711_100218554 | |||
| 1515 | Ga0070711_100296505 | |||
| 1516 | Ga0070711_100380197 | |||
| 1517 | Ga0070705_100004271 | |||
| 1518 | Ga0070705_100059114 | |||
| 1519 | Ga0070705_100272660 | |||
| 1520 | Ga0070705_100367598 | |||
| 1521 | Ga0070705_100473101 | |||
| 1522 | Ga0070705_100587744 | |||
| 1523 | Ga0070700_100003307 | |||
| 1524 | Ga0070700_100736289 | |||
| 1525 | Ga0070700_100873269 | |||
| 1526 | Ga0070694_100016263 | |||
| 1527 | Ga0070708_100007814 | |||
| 1528 | Ga0070708_100019108 | |||
| 1529 | Ga0070708_100043795 | |||
| 1530 | Ga0070708_100064287 | |||
| 1531 | Ga0070708_100071797 | |||
| 1532 | Ga0070708_100247664 | |||
| 1533 | Ga0070708_100333778 | |||
| 1534 | Ga0070708_100375406 | |||
| 1535 | Ga0070663_100044095 | |||
| 1536 | Ga0070663_100103241 | |||
| 1537 | Ga0070678_100001796 | |||
| 1538 | Ga0070678_100009966 | |||
| 1539 | Ga0070678_100027767 | |||
| 1540 | Ga0070678_100212798 | |||
| 1541 | Ga0070678_100266656 | |||
| 1542 | Ga0070678_100280893 | |||
| 1543 | Ga0070678_100630034 | |||
| 1544 | Ga0070662_100000211 | |||
| 1545 | Ga0070662_100012527 | |||
| 1546 | Ga0070662_100118359 | |||
| 1547 | Ga0070662_100118367 | |||
| 1548 | Ga0070662_100459618 | |||
| 1549 | Ga0070662_100634167 | |||
| 1550 | Ga0070681_10002421 | |||
| 1551 | Ga0070681_10012806 | |||
| 1552 | Ga0070681_10113966 | |||
| 1553 | Ga0070681_11031101 | |||
| 1554 | Ga0068867_100002050 | |||
| 1555 | Ga0068867_100002361 | |||
| 1556 | Ga0068867_100046722 | |||
| 1557 | Ga0068867_100165548 | |||
| 1558 | Ga0068867_100190402 | |||
| 1559 | Ga0068867_100299719 | |||
| 1560 | Ga0068867_100464649 | |||
| 1561 | Ga0070685_10055103 | |||
| 1562 | Ga0070685_10185391 | |||
| 1563 | Ga0070706_100000012 | |||
| 1564 | Ga0070706_100010658 | |||
| 1565 | Ga0070706_100011949 | |||
| 1566 | Ga0070706_100025873 | |||
| 1567 | Ga0070706_100147868 | |||
| 1568 | Ga0070706_100155773 | |||
| 1569 | Ga0070706_100295679 | |||
| 1570 | Ga0070706_100342482 | |||
| 1571 | Ga0070706_100418331 | |||
| 1572 | Ga0070706_100906695 | |||
| 1573 | Ga0070706_100956876 | |||
| 1574 | Ga0070707_100007671 | |||
| 1575 | Ga0070707_100039755 | |||
| 1576 | Ga0070707_100043177 | |||
| 1577 | Ga0070707_100055855 | |||
| 1578 | Ga0070707_100075664 | |||
| 1579 | Ga0070707_100121445 | |||
| 1580 | Ga0070707_100145583 | |||
| 1581 | Ga0070707_100157651 | |||
| 1582 | Ga0070707_100186635 | |||
| 1583 | Ga0070707_100186952 | |||
| 1584 | Ga0070707_100355176 | |||
| 1585 | Ga0070707_100519650 | |||
| 1586 | Ga0070707_100523359 | |||
| 1587 | Ga0070707_100754051 | |||
| 1588 | Ga0070698_100000413 | |||
| 1589 | Ga0070698_100023971 | |||
| 1590 | Ga0070698_100432375 | |||
| 1591 | Ga0070698_100618266 | |||
| 1592 | Ga0070698_100829553 | |||
| 1593 | Ga0070698_101270600 | |||
| 1594 | Ga0070699_100035199 | |||
| 1595 | Ga0070699_100053333 | |||
| 1596 | Ga0070699_100132618 | |||
| 1597 | Ga0070699_100245561 | |||
| 1598 | Ga0070699_100287557 | |||
| 1599 | Ga0070699_100350897 | |||
| 1600 | Ga0070699_100364612 | |||
| 1601 | Ga0070699_100597462 | |||
| 1602 | Ga0070699_100607951 | |||
| 1603 | Ga0070699_100636185 | |||
| 1604 | Ga0070679_100006694 | |||
| 1605 | Ga0070679_100007544 | |||
| 1606 | Ga0070679_100018126 | |||
| 1607 | Ga0070679_100021209 | |||
| 1608 | Ga0070679_100197004 | |||
| 1609 | Ga0070679_100208411 | |||
| 1610 | Ga0070679_100302305 | |||
| 1611 | Ga0070679_100843256 | |||
| 1612 | Ga0070684_100001230 | |||
| 1613 | Ga0070684_100002787 | |||
| 1614 | Ga0070684_100003917 | |||
| 1615 | Ga0070684_100024102 | |||
| 1616 | Ga0070684_100391669 | |||
| 1617 | Ga0070684_100491039 | |||
| 1618 | Ga0070684_100908447 | |||
| 1619 | Ga0070697_100032665 | |||
| 1620 | Ga0070697_100060466 | |||
| 1621 | Ga0070697_100061365 | |||
| 1622 | Ga0070697_100135666 | |||
| 1623 | Ga0070697_100149013 | |||
| 1624 | Ga0070697_100173513 | |||
| 1625 | Ga0070697_100305561 | |||
| 1626 | Ga0070697_100347575 | |||
| 1627 | Ga0070697_101081682 | |||
| 1628 | Ga0068853_100006893 | |||
| 1629 | Ga0068853_100035421 | |||
| 1630 | Ga0068853_100051166 | |||
| 1631 | Ga0068853_100115237 | |||
| 1632 | Ga0068853_100305755 | |||
| 1633 | Ga0068853_100393342 | |||
| 1634 | Ga0068853_100824533 | |||
| 1635 | Ga0070672_100003099 | |||
| 1636 | Ga0070672_100008014 | |||
| 1637 | Ga0070672_100008581 | |||
| 1638 | Ga0070672_100016533 | |||
| 1639 | Ga0070672_100093931 | |||
| 1640 | Ga0070672_100139228 | |||
| 1641 | Ga0070672_100302218 | |||
| 1642 | Ga0070672_100463103 | |||
| 1643 | Ga0070686_100344273 | |||
| 1644 | Ga0070695_100226023 | |||
| 1645 | Ga0070696_100414592 | |||
| 1646 | Ga0070696_100913644 | |||
| 1647 | Ga0070693_100046532 | |||
| 1648 | Ga0070693_100215176 | |||
| 1649 | Ga0070693_100273750 | |||
| 1650 | Ga0070693_100381154 | |||
| 1651 | Ga0070665_100004484 | |||
| 1652 | Ga0070665_100006553 | |||
| 1653 | Ga0070665_100023261 | |||
| 1654 | Ga0070665_100025375 | |||
| 1655 | Ga0070665_100028552 | |||
| 1656 | Ga0070665_100043800 | |||
| 1657 | Ga0070665_100066411 | |||
| 1658 | Ga0070665_100099856 | |||
| 1659 | Ga0070665_100239396 | |||
| 1660 | Ga0070665_100240408 | |||
| 1661 | Ga0070665_100294444 | |||
| 1662 | Ga0070665_100410794 | |||
| 1663 | Ga0070665_100558675 | |||
| 1664 | Ga0070665_100761500 | |||
| 1665 | Ga0070704_100002585 | |||
| 1666 | Ga0068855_100026160 | |||
| 1667 | Ga0068855_100101461 | |||
| 1668 | Ga0068855_100291506 | |||
| 1669 | Ga0070664_100014087 | |||
| 1670 | Ga0070664_100017006 | |||
| 1671 | Ga0070664_100071931 | |||
| 1672 | Ga0070664_100175700 | |||
| 1673 | Ga0070664_100195760 | |||
| 1674 | Ga0070664_100324490 | |||
| 1675 | Ga0070664_100333577 | |||
| 1676 | Ga0068857_100047692 | |||
| 1677 | Ga0068857_100069369 | |||
| 1678 | Ga0068857_100392092 | |||
| 1679 | Ga0068857_100762942 | |||
| 1680 | Ga0068854_100016524 | |||
| 1681 | Ga0068854_100048212 | |||
| 1682 | Ga0068856_100004235 | |||
| 1683 | Ga0068856_100010690 | |||
| 1684 | Ga0068856_100020448 | |||
| 1685 | Ga0068856_100035673 | |||
| 1686 | Ga0068856_100563184 | |||
| 1687 | Ga0068856_100617891 | |||
| 1688 | Ga0068856_100665295 | |||
| 1689 | Ga0070702_100152344 | |||
| 1690 | Ga0068852_100003693 | |||
| 1691 | Ga0068852_100014944 | |||
| 1692 | Ga0068852_100063346 | |||
| 1693 | Ga0068852_100089773 | |||
| 1694 | Ga0068852_100215928 | |||
| 1695 | Ga0068852_100672728 | |||
| 1696 | Ga0068852_100767385 | |||
| 1697 | Ga0068852_101338913 | |||
| 1698 | Ga0068859_100006056 | |||
| 1699 | Ga0068859_100031329 | |||
| 1700 | Ga0068859_100178962 | |||
| 1701 | Ga0068859_100316119 | |||
| 1702 | Ga0068859_101696572 | |||
| 1703 | Ga0068864_100002334 | |||
| 1704 | Ga0068864_100003597 | |||
| 1705 | Ga0068864_100030005 | |||
| 1706 | Ga0068864_100154845 | |||
| 1707 | Ga0068864_100296909 | |||
| 1708 | Ga0068864_101095176 | |||
| 1709 | Ga0068861_100122282 | |||
| 1710 | Ga0068861_100209913 | |||
| 1711 | Ga0068851_10001801 | |||
| 1712 | Ga0068851_10008654 | |||
| 1713 | Ga0068851_10009599 | |||
| 1714 | Ga0068851_10192646 | |||
| 1715 | Ga0068870_10014467 | |||
| 1716 | Ga0068870_10062076 | |||
| 1717 | Ga0068870_10237472 | |||
| 1718 | Ga0068863_100003877 | |||
| 1719 | Ga0068863_100013286 | |||
| 1720 | Ga0068863_100014810 | |||
| 1721 | Ga0068863_100068936 | |||
| 1722 | Ga0068863_100124985 | |||
| 1723 | Ga0068863_100220191 | |||
| 1724 | Ga0068863_100271793 | |||
| 1725 | Ga0068858_100003264 | |||
| 1726 | Ga0068858_100012075 | |||
| 1727 | Ga0068858_100018050 | |||
| 1728 | Ga0068858_100037520 | |||
| 1729 | Ga0068858_100054133 | |||
| 1730 | Ga0068858_100286608 | |||
| 1731 | Ga0068858_100376012 | |||
| 1732 | Ga0068858_100465385 | |||
| 1733 | Ga0068858_101600064 | |||
| 1734 | Ga0068860_100001042 | |||
| 1735 | Ga0068860_100010043 | |||
| 1736 | Ga0068860_100012302 | |||
| 1737 | Ga0068860_100037702 | |||
| 1738 | Ga0068860_100432754 | |||
| 1739 | Ga0068860_100728245 | |||
| 1740 | Ga0068862_100194594 | |||
| 1741 | Ga0081455_10000547 | |||
| 1742 | Ga0081455_10001583 | |||
| 1743 | Ga0081455_10016102 | |||
| 1744 | Ga0081455_10016757 | |||
| 1745 | Ga0081455_10021993 | |||
| 1746 | Ga0081455_10027093 | |||
| 1747 | Ga0081455_10034863 | |||
| 1748 | Ga0081455_10217933 | |||
| 1749 | Ga0081540_1000016 | |||
| 1750 | Ga0081540_1010941 | |||
| 1751 | Ga0081540_1022397 | |||
| 1752 | Ga0081539_10000052 | |||
| 1753 | Ga0081539_10004458 | |||
| 1754 | Ga0081539_10008307 | |||
| 1755 | Ga0081539_10009998 | |||
| 1756 | Ga0081539_10020681 | |||
| 1757 | Ga0081539_10120493 | |||
| 1758 | Ga0081539_10248129 | |||
| 1759 | Ga0070717_10004551 | |||
| 1760 | Ga0070717_10044850 | |||
| 1761 | Ga0070717_10117227 | |||
| 1762 | Ga0070717_10453712 | |||
| 1763 | Ga0070717_10555571 | |||
| 1764 | Ga0070717_10630238 | |||
| 1765 | Ga0070715_10451967 | |||
| 1766 | Ga0070716_100685547 | |||
| 1767 | Ga0070716_100796948 | |||
| 1768 | Ga0070712_100016473 | |||
| 1769 | Ga0070712_100306705 | |||
| 1770 | Ga0070712_100389355 | |||
| 1771 | Ga0070712_100684214 | |||
| 1772 | Ga0070712_100780877 | |||
| 1773 | Ga0070712_100865388 | |||
| 1774 | Ga0097621_100013578 | |||
| 1775 | Ga0097621_100015740 | |||
| 1776 | Ga0097621_100018761 | |||
| 1777 | Ga0097621_100209356 | |||
| 1778 | Ga0097621_100232393 | |||
| 1779 | Ga0097621_100305203 | |||
| 1780 | Ga0097621_100356486 | |||
| 1781 | Ga0068871_100001817 | |||
| 1782 | Ga0068871_100007616 | |||
| 1783 | Ga0068871_100013929 | |||
| 1784 | Ga0068871_100023033 | |||
| 1785 | Ga0068871_100094475 | |||
| 1786 | Ga0068871_100181031 | |||
| 1787 | Ga0068871_100248979 | |||
| 1788 | Ga0068871_100553898 | |||
| 1789 | Ga0075428_100039310 | |||
| 1790 | Ga0075428_100053933 | |||
| 1791 | Ga0075428_100194783 | |||
| 1792 | Ga0075428_100375263 | |||
| 1793 | Ga0075433_10313300 | |||
| 1794 | Ga0075434_100109023 | |||
| 1795 | Ga0075434_100171781 | |||
| 1796 | Ga0075434_100208283 | |||
| 1797 | Ga0075434_100325667 | |||
| 1798 | Ga0075434_100352892 | |||
| 1799 | Ga0075434_100547521 | |||
| 1800 | Ga0075434_100577073 | |||
| 1801 | Ga0075434_100644291 | |||
| 1802 | Ga0068865_100044190 | |||
| 1803 | Ga0068865_100700892 | |||
| 1804 | Ga0068865_101346575 | |||
| 1805 | Ga0075436_100077399 | |||
| 1806 | Ga0075436_100113516 | |||
| 1807 | Ga0075436_100312407 | |||
| 1808 | Ga0097620_100006056 | |||
| 1809 | Ga0097620_100031329 | |||
| 1810 | Ga0097620_100178963 | |||
| 1811 | Ga0097620_100316123 | |||
| 1812 | Ga0097620_101696306 | |||
| 1813 | Ga0075435_100115740 | |||
| 1814 | Ga0075435_100178395 | |||
| 1815 | Ga0075435_100224640 | |||
| 1816 | Ga0105240_10008953 | |||
| 1817 | Ga0105240_10022687 | |||
| 1818 | Ga0111539_10001299 | |||
| 1819 | Ga0111539_10059036 | |||
| 1820 | Ga0111539_10060050 | |||
| 1821 | Ga0111539_10157405 | |||
| 1822 | Ga0111539_10509289 | |||
| 1823 | Ga0111539_10524735 | |||
| 1824 | Ga0111539_10539640 | |||
| 1825 | Ga0105245_10009797 | |||
| 1826 | Ga0105245_10018826 | |||
| 1827 | Ga0105245_10036661 | |||
| 1828 | Ga0105245_10103156 | |||
| 1829 | Ga0105245_10105036 | |||
| 1830 | Ga0105245_10210221 | |||
| 1831 | Ga0105245_10236535 | |||
| 1832 | Ga0105245_10441700 | |||
| 1833 | Ga0105247_10284676 | |||
| 1834 | Ga0105247_10469103 | |||
| 1835 | Ga0114129_10095263 | |||
| 1836 | Ga0114129_10175486 | |||
| 1837 | Ga0114129_10850855 | |||
| 1838 | Ga0105243_10231036 | |||
| 1839 | Ga0105241_10015461 | |||
| 1840 | Ga0105241_10096732 | |||
| 1841 | Ga0105241_10922628 | |||
| 1842 | Ga0105242_10022489 | |||
| 1843 | Ga0105242_10423439 | |||
| 1844 | Ga0105248_10002431 | |||
| 1845 | Ga0105248_10019006 | |||
| 1846 | Ga0105248_10158989 | |||
| 1847 | Ga0105248_10203082 | |||
| 1848 | Ga0105248_10299721 | |||
| 1849 | Ga0105248_10385061 | |||
| 1850 | Ga0105237_10107634 | |||
| 1851 | Ga0105237_10400540 | |||
| 1852 | Ga0105238_10034778 | |||
| 1853 | Ga0105238_11109291 | |||
| 1854 | Ga0105249_10006766 | |||
| 1855 | Ga0105249_10016665 | |||
| 1856 | Ga0105249_10268110 | |||
| 1857 | Ga0105249_10347979 | |||
| 1858 | Ga0105249_10669291 | |||
| 1859 | Ga0105249_10702823 | |||
| 1860 | Ga0105249_10848108 | |||
| 1861 | Ga0105249_11041037 | |||
| 1862 | Ga0105249_11258577 | |||
| 1863 | Ga0099796_10075146 | |||
| 1864 | Ga0105239_10072664 | |||
| 1865 | Ga0105246_10214792 | |||
| 1866 | Ga0105246_10516170 | |||
| 1867 | Ga0157373_10003902 | |||
| 1868 | Ga0157373_10014850 | |||
| 1869 | Ga0157373_10213621 | |||
| 1870 | Ga0157373_10375775 | |||
| 1871 | Ga0157371_10000446 | |||
| 1872 | Ga0157371_10253936 | |||
| 1873 | Ga0157371_10266681 | |||
| 1874 | Ga0157370_10010726 | |||
| 1875 | Ga0157370_10026708 | |||
| 1876 | Ga0157370_10060279 | |||
| 1877 | Ga0157370_10093865 | |||
| 1878 | Ga0157370_10153709 | |||
| 1879 | Ga0157370_10171572 | |||
| 1880 | Ga0157370_10946538 | |||
| 1881 | Ga0157369_10012261 | |||
| 1882 | Ga0157369_10071605 | |||
| 1883 | Ga0157369_10237692 | |||
| 1884 | Ga0157369_10250853 | |||
| 1885 | Ga0157374_10032996 | |||
| 1886 | Ga0157374_10068236 | |||
| 1887 | Ga0157374_10075119 | |||
| 1888 | Ga0157374_10091134 | |||
| 1889 | Ga0157374_10110875 | |||
| 1890 | Ga0157374_10211274 | |||
| 1891 | Ga0157374_10356859 | |||
| 1892 | Ga0157374_10451880 | |||
| 1893 | Ga0157374_10538630 | |||
| 1894 | Ga0157374_11684549 | |||
| 1895 | Ga0157378_10054529 | |||
| 1896 | Ga0157378_10056068 | |||
| 1897 | Ga0157378_10124616 | |||
| 1898 | Ga0157378_10144606 | |||
| 1899 | Ga0157378_10480705 | |||
| 1900 | Ga0157378_10528490 | |||
| 1901 | Ga0157378_11272604 | |||
| 1902 | Ga0163162_10006343 | |||
| 1903 | Ga0163162_10006529 | |||
| 1904 | Ga0163162_10039123 | |||
| 1905 | Ga0163162_10082361 | |||
| 1906 | Ga0163162_10118321 | |||
| 1907 | Ga0163162_10250502 | |||
| 1908 | Ga0163162_10281768 | |||
| 1909 | Ga0163162_10544817 | |||
| 1910 | Ga0163162_10558796 | |||
| 1911 | Ga0163162_10737186 | |||
| 1912 | Ga0163162_11391334 | |||
| 1913 | Ga0163162_11551637 | |||
| 1914 | Ga0157372_10000523 | |||
| 1915 | Ga0157372_10030913 | |||
| 1916 | Ga0157372_10032821 | |||
| 1917 | Ga0157372_10085120 | |||
| 1918 | Ga0157372_10293916 | |||
| 1919 | Ga0157372_10410409 | |||
| 1920 | Ga0157372_11614732 | |||
| 1921 | Ga0157375_10002572 | |||
| 1922 | Ga0157375_10007572 | |||
| 1923 | Ga0157375_10031682 | |||
| 1924 | Ga0157375_10033665 | |||
| 1925 | Ga0157375_10035443 | |||
| 1926 | Ga0157375_10047793 | |||
| 1927 | Ga0157375_10064141 | |||
| 1928 | Ga0157375_10090221 | |||
| 1929 | Ga0157375_10107775 | |||
| 1930 | Ga0157375_10356617 | |||
| 1931 | Ga0157375_10602273 | |||
| 1932 | Ga0157375_10610839 | |||
| 1933 | Ga0157375_11861375 | |||
| 1934 | Ga0157375_12170491 | |||
| 1935 | Ga0163163_10004811 | |||
| 1936 | Ga0163163_10042847 | |||
| 1937 | Ga0163163_10060433 | |||
| 1938 | Ga0163163_10169102 | |||
| 1939 | Ga0163163_10387662 | |||
| 1940 | Ga0163163_10435869 | |||
| 1941 | Ga0157380_10178920 | |||
| 1942 | Ga0157380_10373587 | |||
| 1943 | Ga0157380_10664872 | |||
| 1944 | Ga0157380_10789231 | |||
| 1945 | Ga0182008_10085522 | |||
| 1946 | Ga0157377_10008931 | |||
| 1947 | Ga0157377_10058811 | |||
| 1948 | Ga0157377_10127614 | |||
| 1949 | Ga0157377_10250451 | |||
| 1950 | Ga0157377_10507869 | |||
| 1951 | Ga0157379_10015087 | |||
| 1952 | Ga0157379_10031752 | |||
| 1953 | Ga0157379_10055151 | |||
| 1954 | Ga0157379_10073195 | |||
| 1955 | Ga0157379_10278286 | |||
| 1956 | Ga0157376_10003007 | |||
| 1957 | Ga0157376_10025775 | |||
| 1958 | Ga0157376_10039684 | |||
| 1959 | Ga0157376_10076929 | |||
| 1960 | Ga0157376_10119817 | |||
| 1961 | Ga0157376_10140091 | |||
| 1962 | Ga0157376_10198257 | |||
| 1963 | Ga0157376_10230271 | |||
| 1964 | Ga0157376_10341720 | |||
| 1965 | Ga0157376_10517553 | |||
| 1966 | Ga0157376_11043366 | |||
| 1967 | Ga0182005_1008598 | |||
| 1968 | Ga0163161_10015702 | |||
| 1969 | Ga0163161_10042182 | |||
| 1970 | Ga0163161_10073086 | |||
| 1971 | Ga0163161_10107910 | |||
| 1972 | Ga0163161_10140947 | |||
| 1973 | Ga0163161_10868114 | |||
| 1974 | Ga0206356_11720413 | |||
| 1975 | Ga0207666_1000261 | |||
| 1976 | Ga0207666_1041271 | |||
| 1977 | Ga0207673_1000951 | |||
| 1978 | Ga0207673_1002395 | |||
| 1979 | Ga0207697_10003309 | |||
| 1980 | Ga0207697_10004477 | |||
| 1981 | Ga0207697_10007175 | |||
| 1982 | Ga0207697_10012709 | |||
| 1983 | Ga0207697_10013913 | |||
| 1984 | Ga0207697_10025802 | |||
| 1985 | Ga0207656_10007104 | |||
| 1986 | Ga0207656_10015301 | |||
| 1987 | Ga0207653_10121569 | |||
| 1988 | Ga0207653_10145502 | |||
| 1989 | Ga0207682_10000146 | |||
| 1990 | Ga0207682_10079736 | |||
| 1991 | Ga0207692_10062561 | |||
| 1992 | Ga0207692_10094161 | |||
| 1993 | Ga0207692_10140107 | |||
| 1994 | Ga0207692_10393356 | |||
| 1995 | Ga0207688_10027364 | |||
| 1996 | Ga0207688_10056548 | |||
| 1997 | Ga0207688_10105407 | |||
| 1998 | Ga0207688_10130638 | |||
| 1999 | Ga0207688_10241235 | |||
| 2000 | Ga0207680_10001915 | |||
| 2001 | Ga0207680_10010912 | |||
| 2002 | Ga0207680_10015333 | |||
| 2003 | Ga0207680_10034549 | |||
| 2004 | Ga0207680_10047288 | |||
| 2005 | Ga0207680_10057513 | |||
| 2006 | Ga0207680_10277385 | |||
| 2007 | Ga0207680_10634288 | |||
| 2008 | Ga0207647_10015769 | |||
| 2009 | Ga0207699_10019067 | |||
| 2010 | Ga0207699_10439333 | |||
| 2011 | Ga0207645_10000519 | |||
| 2012 | Ga0207645_10008023 | |||
| 2013 | Ga0207645_10036131 | |||
| 2014 | Ga0207645_10052932 | |||
| 2015 | Ga0207645_10061657 | |||
| 2016 | Ga0207645_10083026 | |||
| 2017 | Ga0207645_10270838 | |||
| 2018 | Ga0207643_10027427 | |||
| 2019 | Ga0207643_10032649 | |||
| 2020 | Ga0207643_10114043 | |||
| 2021 | Ga0207643_10257111 | |||
| 2022 | Ga0207705_10052596 | |||
| 2023 | Ga0207705_10128757 | |||
| 2024 | Ga0207705_10348839 | |||
| 2025 | Ga0207684_10000028 | |||
| 2026 | Ga0207684_10003281 | |||
| 2027 | Ga0207684_10032606 | |||
| 2028 | Ga0207684_10051288 | |||
| 2029 | Ga0207684_10174093 | |||
| 2030 | Ga0207684_10284500 | |||
| 2031 | Ga0207684_10329193 | |||
| 2032 | Ga0207684_10649754 | |||
| 2033 | Ga0207684_10667024 | |||
| 2034 | Ga0207707_10005207 | |||
| 2035 | Ga0207707_10015254 | |||
| 2036 | Ga0207707_10015315 | |||
| 2037 | Ga0207707_10058830 | |||
| 2038 | Ga0207695_10116325 | |||
| 2039 | Ga0207693_10002925 | |||
| 2040 | Ga0207693_10022585 | |||
| 2041 | Ga0207693_10066800 | |||
| 2042 | Ga0207693_10096529 | |||
| 2043 | Ga0207693_10105081 | |||
| 2044 | Ga0207693_10111091 | |||
| 2045 | Ga0207693_10137672 | |||
| 2046 | Ga0207693_10151897 | |||
| 2047 | Ga0207693_10193311 | |||
| 2048 | Ga0207693_10923041 | |||
| 2049 | Ga0207663_10093753 | |||
| 2050 | Ga0207663_10126778 | |||
| 2051 | Ga0207663_10269406 | |||
| 2052 | Ga0207663_10282004 | |||
| 2053 | Ga0207663_10303054 | |||
| 2054 | Ga0207663_10415773 | |||
| 2055 | Ga0207660_10012654 | |||
| 2056 | Ga0207660_10040236 | |||
| 2057 | Ga0207660_10185491 | |||
| 2058 | Ga0207660_10349121 | |||
| 2059 | Ga0207662_10050548 | |||
| 2060 | Ga0207662_10060963 | |||
| 2061 | Ga0207657_10000229 | |||
| 2062 | Ga0207657_10008077 | |||
| 2063 | Ga0207657_10024320 | |||
| 2064 | Ga0207657_10061470 | |||
| 2065 | Ga0207657_10118344 | |||
| 2066 | Ga0207657_10129942 | |||
| 2067 | Ga0207649_10002277 | |||
| 2068 | Ga0207649_10012421 | |||
| 2069 | Ga0207649_10019167 | |||
| 2070 | Ga0207649_10029744 | |||
| 2071 | Ga0207649_10055680 | |||
| 2072 | Ga0207649_10065890 | |||
| 2073 | Ga0207652_10003991 | |||
| 2074 | Ga0207652_10007247 | |||
| 2075 | Ga0207652_10064470 | |||
| 2076 | Ga0207652_10074201 | |||
| 2077 | Ga0207652_10168764 | |||
| 2078 | Ga0207646_10000734 | |||
| 2079 | Ga0207646_10002142 | |||
| 2080 | Ga0207646_10006254 | |||
| 2081 | Ga0207646_10006743 | |||
| 2082 | Ga0207646_10026769 | |||
| 2083 | Ga0207646_10102036 | |||
| 2084 | Ga0207646_10134306 | |||
| 2085 | Ga0207646_10134948 | |||
| 2086 | Ga0207646_10167702 | |||
| 2087 | Ga0207646_10325683 | |||
| 2088 | Ga0207646_10329032 | |||
| 2089 | Ga0207646_10565005 | |||
| 2090 | Ga0207646_10631358 | |||
| 2091 | Ga0207646_10738601 | |||
| 2092 | Ga0207681_10002527 | |||
| 2093 | Ga0207681_10024176 | |||
| 2094 | Ga0207681_10046095 | |||
| 2095 | Ga0207681_10063647 | |||
| 2096 | Ga0207681_10112293 | |||
| 2097 | Ga0207681_10142153 | |||
| 2098 | Ga0207694_10299767 | |||
| 2099 | Ga0207694_10607278 | |||
| 2100 | Ga0207650_10002534 | |||
| 2101 | Ga0207650_10016498 | |||
| 2102 | Ga0207650_10035787 | |||
| 2103 | Ga0207650_10067227 | |||
| 2104 | Ga0207650_10088138 | |||
| 2105 | Ga0207650_10093562 | |||
| 2106 | Ga0207650_10102856 | |||
| 2107 | Ga0207650_10113894 | |||
| 2108 | Ga0207650_10301029 | |||
| 2109 | Ga0207650_10365468 | |||
| 2110 | Ga0207650_10498298 | |||
| 2111 | Ga0207659_10002707 | |||
| 2112 | Ga0207659_10004071 | |||
| 2113 | Ga0207659_10004632 | |||
| 2114 | Ga0207659_10007428 | |||
| 2115 | Ga0207659_10021504 | |||
| 2116 | Ga0207659_10073946 | |||
| 2117 | Ga0207659_10080899 | |||
| 2118 | Ga0207659_10107969 | |||
| 2119 | Ga0207659_10221815 | |||
| 2120 | Ga0207659_10247305 | |||
| 2121 | Ga0207659_10300714 | |||
| 2122 | Ga0207659_10557799 | |||
| 2123 | Ga0207659_10840634 | |||
| 2124 | Ga0207687_10067295 | |||
| 2125 | Ga0207687_10111634 | |||
| 2126 | Ga0207687_10354175 | |||
| 2127 | Ga0207687_10413551 | |||
| 2128 | Ga0207687_10436830 | |||
| 2129 | Ga0207687_10514625 | |||
| 2130 | Ga0207700_10046468 | |||
| 2131 | Ga0207700_10064817 | |||
| 2132 | Ga0207700_10164458 | |||
| 2133 | Ga0207700_10694708 | |||
| 2134 | Ga0207664_10003067 | |||
| 2135 | Ga0207664_10006738 | |||
| 2136 | Ga0207664_10068190 | |||
| 2137 | Ga0207664_10089089 | |||
| 2138 | Ga0207664_10184931 | |||
| 2139 | Ga0207664_10214414 | |||
| 2140 | Ga0207664_10273045 | |||
| 2141 | Ga0207664_10554166 | |||
| 2142 | Ga0207644_10000405 | |||
| 2143 | Ga0207644_10008476 | |||
| 2144 | Ga0207644_10012225 | |||
| 2145 | Ga0207644_10045397 | |||
| 2146 | Ga0207644_10091346 | |||
| 2147 | Ga0207644_10095598 | |||
| 2148 | Ga0207644_10112928 | |||
| 2149 | Ga0207644_10147015 | |||
| 2150 | Ga0207644_10169498 | |||
| 2151 | Ga0207644_10224422 | |||
| 2152 | Ga0207644_10328019 | |||
| 2153 | Ga0207644_10498472 | |||
| 2154 | Ga0207690_10000348 | |||
| 2155 | Ga0207690_10006051 | |||
| 2156 | Ga0207690_10021602 | |||
| 2157 | Ga0207690_10035029 | |||
| 2158 | Ga0207690_10171351 | |||
| 2159 | Ga0207690_10453579 | |||
| 2160 | Ga0207706_10000045 | |||
| 2161 | Ga0207706_10092757 | |||
| 2162 | Ga0207706_10186955 | |||
| 2163 | Ga0207706_10203631 | |||
| 2164 | Ga0207706_10214358 | |||
| 2165 | Ga0207706_10266083 | |||
| 2166 | Ga0207706_10671301 | |||
| 2167 | Ga0207709_10024389 | |||
| 2168 | Ga0207709_10143527 | |||
| 2169 | Ga0207709_10215953 | |||
| 2170 | Ga0207670_10011155 | |||
| 2171 | Ga0207670_10017407 | |||
| 2172 | Ga0207670_10021344 | |||
| 2173 | Ga0207670_10032817 | |||
| 2174 | Ga0207670_10293109 | |||
| 2175 | Ga0207669_10010707 | |||
| 2176 | Ga0207669_10082682 | |||
| 2177 | Ga0207669_10124455 | |||
| 2178 | Ga0207669_10166393 | |||
| 2179 | Ga0207669_10330980 | |||
| 2180 | Ga0207704_10525997 | |||
| 2181 | Ga0207704_11006500 | |||
| 2182 | Ga0207665_10035723 | |||
| 2183 | Ga0207665_10069200 | |||
| 2184 | Ga0207665_10541113 | |||
| 2185 | Ga0207665_10587753 | |||
| 2186 | Ga0207691_10000310 | |||
| 2187 | Ga0207691_10000629 | |||
| 2188 | Ga0207691_10004119 | |||
| 2189 | Ga0207691_10025264 | |||
| 2190 | Ga0207691_10029499 | |||
| 2191 | Ga0207691_10050625 | |||
| 2192 | Ga0207691_10097269 | |||
| 2193 | Ga0207691_10174393 | |||
| 2194 | Ga0207691_10182382 | |||
| 2195 | Ga0207691_10220893 | |||
| 2196 | Ga0207691_10227923 | |||
| 2197 | Ga0207691_10258771 | |||
| 2198 | Ga0207711_10011574 | |||
| 2199 | Ga0207711_10019828 | |||
| 2200 | Ga0207711_10086395 | |||
| 2201 | Ga0207711_10126282 | |||
| 2202 | Ga0207711_10157887 | |||
| 2203 | Ga0207711_10171143 | |||
| 2204 | Ga0207711_10281258 | |||
| 2205 | Ga0207689_10013147 | |||
| 2206 | Ga0207689_10096085 | |||
| 2207 | Ga0207661_10009915 | |||
| 2208 | Ga0207661_10074070 | |||
| 2209 | Ga0207661_10141705 | |||
| 2210 | Ga0207661_10163180 | |||
| 2211 | Ga0207661_11025791 | |||
| 2212 | Ga0207661_11113666 | |||
| 2213 | Ga0207679_10003526 | |||
| 2214 | Ga0207679_10011829 | |||
| 2215 | Ga0207679_10059635 | |||
| 2216 | Ga0207679_10126044 | |||
| 2217 | Ga0207679_10164325 | |||
| 2218 | Ga0207679_10206445 | |||
| 2219 | Ga0207679_10496401 | |||
| 2220 | Ga0207679_10613889 | |||
| 2221 | Ga0207667_10002826 | |||
| 2222 | Ga0207667_10003469 | |||
| 2223 | Ga0207667_10171767 | |||
| 2224 | Ga0207667_10214858 | |||
| 2225 | Ga0207667_10738763 | |||
| 2226 | Ga0207667_10856780 | |||
| 2227 | Ga0207667_11143784 | |||
| 2228 | Ga0207651_10025782 | |||
| 2229 | Ga0207651_10059712 | |||
| 2230 | Ga0207651_10165509 | |||
| 2231 | Ga0207651_10171949 | |||
| 2232 | Ga0207651_10212322 | |||
| 2233 | Ga0207651_10228386 | |||
| 2234 | Ga0207651_10414992 | |||
| 2235 | Ga0207651_10459188 | |||
| 2236 | Ga0207651_10553609 | |||
| 2237 | Ga0207712_10302566 | |||
| 2238 | Ga0207712_10903992 | |||
| 2239 | Ga0207712_11070034 | |||
| 2240 | Ga0207712_11165510 | |||
| 2241 | Ga0207668_10003264 | |||
| 2242 | Ga0207668_10005981 | |||
| 2243 | Ga0207668_10018149 | |||
| 2244 | Ga0207668_10029476 | |||
| 2245 | Ga0207668_10128930 | |||
| 2246 | Ga0207668_10146554 | |||
| 2247 | Ga0207668_10167562 | |||
| 2248 | Ga0207668_10313168 | |||
| 2249 | Ga0207668_11005799 | |||
| 2250 | Ga0207640_10109298 | |||
| 2251 | Ga0207640_10244709 | |||
| 2252 | Ga0207640_10306082 | |||
| 2253 | Ga0207640_10644912 | |||
| 2254 | Ga0207640_11185715 | |||
| 2255 | Ga0207658_10008951 | |||
| 2256 | Ga0207658_10076428 | |||
| 2257 | Ga0207658_10112751 | |||
| 2258 | Ga0207658_10129696 | |||
| 2259 | Ga0207658_10443746 | |||
| 2260 | Ga0207658_10884370 | |||
| 2261 | Ga0207677_10011855 | |||
| 2262 | Ga0207677_10089514 | |||
| 2263 | Ga0207677_10098606 | |||
| 2264 | Ga0207677_10146418 | |||
| 2265 | Ga0207677_10187502 | |||
| 2266 | Ga0207677_10252945 | |||
| 2267 | Ga0207677_10379498 | |||
| 2268 | Ga0207677_10738246 | |||
| 2269 | Ga0207677_10863564 | |||
| 2270 | Ga0207703_10005921 | |||
| 2271 | Ga0207703_10007291 | |||
| 2272 | Ga0207703_10059886 | |||
| 2273 | Ga0207703_10119091 | |||
| 2274 | Ga0207703_10198221 | |||
| 2275 | Ga0207703_10282430 | |||
| 2276 | Ga0207639_10008842 | |||
| 2277 | Ga0207639_10030631 | |||
| 2278 | Ga0207639_10353982 | |||
| 2279 | Ga0207639_10401021 | |||
| 2280 | Ga0207678_10004526 | |||
| 2281 | Ga0207678_10010760 | |||
| 2282 | Ga0207678_10014233 | |||
| 2283 | Ga0207678_10154353 | |||
| 2284 | Ga0207678_10187032 | |||
| 2285 | Ga0207678_10483728 | |||
| 2286 | Ga0207708_10008199 | |||
| 2287 | Ga0207708_10473231 | |||
| 2288 | Ga0207708_10578467 | |||
| 2289 | Ga0207708_10767764 | |||
| 2290 | Ga0207702_10000715 | |||
| 2291 | Ga0207702_10017719 | |||
| 2292 | Ga0207702_10027561 | |||
| 2293 | Ga0207702_10056652 | |||
| 2294 | Ga0207641_10001932 | |||
| 2295 | Ga0207641_10002486 | |||
| 2296 | Ga0207641_10048312 | |||
| 2297 | Ga0207641_10068310 | |||
| 2298 | Ga0207641_10696297 | |||
| 2299 | Ga0207648_10000364 | |||
| 2300 | Ga0207648_10002046 | |||
| 2301 | Ga0207648_10003344 | |||
| 2302 | Ga0207648_10014214 | |||
| 2303 | Ga0207648_10035274 | |||
| 2304 | Ga0207648_10114825 | |||
| 2305 | Ga0207648_10173623 | |||
| 2306 | Ga0207648_10907644 | |||
| 2307 | Ga0207676_10000633 | |||
| 2308 | Ga0207676_10003751 | |||
| 2309 | Ga0207676_10014659 | |||
| 2310 | Ga0207676_10126705 | |||
| 2311 | Ga0207676_10151572 | |||
| 2312 | Ga0207674_10000225 | |||
| 2313 | Ga0207674_10030050 | |||
| 2314 | Ga0207674_10108322 | |||
| 2315 | Ga0207674_10281679 | |||
| 2316 | Ga0207675_100000658 | |||
| 2317 | Ga0207675_100048450 | |||
| 2318 | Ga0207675_100054380 | |||
| 2319 | Ga0207675_100133367 | |||
| 2320 | Ga0207675_100211783 | |||
| 2321 | Ga0207675_100243445 | |||
| 2322 | Ga0207675_101089251 | |||
| 2323 | Ga0207683_10000076 | |||
| 2324 | Ga0207683_10000121 | |||
| 2325 | Ga0207683_10005699 | |||
| 2326 | Ga0207683_10013281 | |||
| 2327 | Ga0207683_10083217 | |||
| 2328 | Ga0207683_10225139 | |||
| 2329 | Ga0207683_10311584 | |||
| 2330 | Ga0207698_10007229 | |||
| 2331 | Ga0207698_10007522 | |||
| 2332 | Ga0207698_10015072 | |||
| 2333 | Ga0207698_10083517 | |||
| 2334 | Ga0207698_10161096 | |||
| 2335 | Ga0207698_10366647 | |||
| 2336 | Ga0207698_10400033 | |||
| 2337 | Ga0207698_10426621 | |||
| 2338 | Ga0209995_1007841 | |||
| 2339 | Ga0209968_1022046 | |||
| 2340 | Ga0209982_1041769 | |||
| 2341 | Ga0210002_1007025 | |||
| 2342 | Ga0210002_1026552 | |||
| 2343 | Ga0209983_1003112 | |||
| 2344 | Ga0209971_1001091 | |||
| 2345 | Ga0209974_10000048 | |||
| 2346 | Ga0209974_10049320 | |||
| 2347 | Ga0207428_10354896 | |||
| 2348 | Ga0268266_10028455 | |||
| 2349 | Ga0268266_10046833 | |||
| 2350 | Ga0268266_10066893 | |||
| 2351 | Ga0268266_10101921 | |||
| 2352 | Ga0268266_10181768 | |||
| 2353 | Ga0268266_10324459 | |||
| 2354 | Ga0268266_10494484 | |||
| 2355 | Ga0268266_10725778 | |||
| 2356 | Ga0268266_10781206 | |||
| 2357 | Ga0268265_10049098 | |||
| 2358 | Ga0268265_10104731 | |||
| 2359 | Ga0268265_10174509 | |||
| 2360 | Ga0268265_10361016 | |||
| 2361 | Ga0268265_10599475 | |||
| 2362 | Ga0268264_10007545 | |||
| 2363 | Ga0268264_10010492 | |||
| 2364 | Ga0268264_10024971 | |||
| 2365 | Ga0268264_10067969 | |||
| 2366 | Ga0268264_10084520 | |||
| 2367 | Ga0268264_10280500 | |||
| 2368 | Ga0268264_10328401 | |||
| 2369 | Ga0268264_10330570 | |||
| 2370 | Ga0268264_10640838 | |||
| 2371 | Ga0307513_10045324 | |||
| 2372 | Ga0307408_100557049 | |||
| 2373 | Ga0307408_100827325 | |||
| 2374 | Ga0307405_10369740 | |||
| 2375 | Ga0307405_10514766 | |||
| 2376 | Ga0307405_10572863 | |||
| 2377 | Ga0307413_10080155 | |||
| 2378 | Ga0307410_10098627 | |||
| 2379 | Ga0307410_10178627 | |||
| 2380 | Ga0307410_10449410 | |||
| 2381 | Ga0307406_10072396 | |||
| 2382 | Ga0307407_10001541 | |||
| 2383 | Ga0307407_10600723 | |||
| 2384 | Ga0307412_10048394 | |||
| 2385 | Ga0307409_100005712 | |||
| 2386 | Ga0307409_100009446 | |||
| 2387 | Ga0307409_100024574 | |||
| 2388 | Ga0307409_101149512 | |||
| 2389 | Ga0307416_100005475 | |||
| 2390 | Ga0307416_100385011 | |||
| 2391 | Ga0307416_100503129 | |||
| 2392 | Ga0307414_10021464 | |||
| 2393 | Ga0307414_10365959 | |||
| 2394 | Ga0307411_10027198 | |||
| 2395 | Ga0307411_10043391 | |||
| 2396 | Ga0307415_100019074 | |||
| 2397 | Ga0307415_100267275 | |||
| 2398 | Ga0373959_0091406 | |||
| 2399 | Ga0373929_0090138 | |||
| 2400 | Ga0373934_0055451 | |||
| 2401 | Ga0373944_0051313 | |||
| 2402 | Ga0373949_0043851 | |||
| 2403 | Ga0373951_0055773 | |||
| 2404 | Ga0373923_0221649 | |||
| 2405 | Ga0373945_0035016 | |||
| 2406 | Ga0373953_0018370 | |||
| 2407 | Ga0373953_0127717 | |||
| 2408 | Ga0373954_0134456 | |||
| 2409 | Ga0373954_0383179 | |||
| 2410 | Ga0373957_0056436 | |||
| 2411 | Ga0373957_0140634 | |||
| 2412 | Ga0373943_0013149 | |||
| 2413 | Ga0373943_0042386 | |||
| 2414 | Ga0373943_0108319 | |||
| 2415 | Ga0373943_0164482 | |||
| 2416 | Ga0373943_0187626 | |||
| 2417 | Ga0373943_0295284 | |||
| 2418 | Ga0373943_0296106 | |||
| 2419 | Ga0373946_0053581 | |||
| 2420 | Ga0373955_0031790 | |||
| 2421 | Ga0373955_0123356 | |||
| 2422 | Ga0373955_0207398 | |||
| 2423 | Ga0373955_0431393 | |||
| 2424 | Ga0373942_0174660 | |||
| 2425 | Ga0373942_0233011 | |||
| 2426 | Ga0373961_0055934 | |||
| 2427 | Ga0373961_0141227 | |||
| 2428 | Ga0373961_0231975 | |||
| 2429 | Ga0373924_0168041 | |||
| 2430 | Ga0373924_0193320 | |||
| 2431 | Ga0373924_0272505 | |||
| 2432 | Ga0373931_0065836 | |||
| 2433 | Ga0373931_0093401 | |||
| 2434 | Ga0373931_0162623 | |||
| 2435 | Ga0373931_0285613 | |||
| 2436 | Ga0373931_0532831 | |||
| 2437 | Ga0373935_0048456 | |||
| 2438 | Ga0373935_0049597 | |||
| 2439 | Ga0373935_0128571 | |||
| 2440 | Ga0373935_0353488 | |||
| 2441 | Ga0373935_0554699 | |||
| 2442 | Ga0373927_0086834 | |||
| 2443 | Ga0373927_0157181 | |||
| 2444 | Ga0373927_0160628 | |||
| 2445 | Ga0373933_0078009 | |||
| 2446 | Ga0373933_0434664 | |||
| 2447 | Ga0373933_0751308 | |||
| 2448 | Ga0373947_0153234 | |||
| 2449 | Ga0373947_0156153 | |||
| 2450 | Ga0373937_0004100 | |||
| 2451 | Ga0373937_0020917 | |||
| 2452 | Ga0373937_0084311 | |||
| 2453 | Ga0373937_0086762 | |||
| 2454 | Ga0373937_0454968 | |||
| 2455 | Ga0373937_0719962 | |||
| 2456 | Ga0373925_0014302 | |||
| 2457 | Ga0373925_0051602 | |||
| 2458 | Ga0373925_0175884 | |||
| 2459 | Ga0373925_0212371 | |||
| 2460 | Ga0373925_0656339 | |||
| 2461 | Ga0395900_0002016 | |||
| 2462 | Ga0395900_0035910 | |||
| 2463 | Ga0395900_0203491 | |||
| 2464 | Ga0395900_0217548 | |||
| 2465 | Ga0395900_0767025 | |||
| 2466 | Ga0395898_0012264 | |||
| 2467 | Ga0395898_0118427 | |||
| 2468 | Ga0395898_0293100 | |||
| 2469 | Ga0395905_0034576 | |||
| 2470 | Ga0395905_0158105 | |||
| 2471 | Ga0395905_0517289 | |||
| 2472 | Ga0395901_0034534 | |||
| 2473 | Ga0395901_0056833 | |||
| 2474 | Ga0395901_0367164 | |||
| 2475 | Ga0395901_1110382 | |||
| 2476 | Ga0436363_0788885 | |||
| 2477 | Ga0436362_0735304 | |||
| 2478 | Ga0451791_0486903 | |||
| 2479 | Ga0451807_0453940 | |||
| 2480 | Ga0451807_0845975 | |||
| 2481 | Ga0451807_1843067 | |||
| 2482 | Ga0451807_2078124 | |||
| 2483 | Ga0451835_0936074 | |||
| 2484 | Ga0451839_0036848 | |||
| 2485 | Ga0439448_0090790 | |||
| 2486 | Ga0439451_003915 | |||
| 2487 | Ga0439454_004180 | |||
| 2488 | Ga0439454_038878 | |||
| 2489 | Ga0439455_0017390 | |||
| 2490 | Ga0439434_0225377 | |||
| 2491 | Ga0439435_0107671 | |||
| 2492 | Ga0439459_0056536 | |||
| 2493 | Ga0451577_0672392 | |||
| 2494 | Ga0466965_0363010 | |||
| 2495 | Ga0466964_0063166 | |||
| 2496 | Ga0451576_0000443 | |||
| 2497 | Ga0451576_0005126 | |||
| 2498 | Ga0451576_0062976 | |||
| 2499 | Ga0466967_0580341 | |||
| 2500 | Ga0495592_0077861 | |||
| 2501 | Ga0495603_0499316 | |||
| 2502 | Ga0495603_0542386 | |||
| 2503 | Ga0495651_0002069 | |||
| 2504 | Ga0495651_0119451 | |||
| 2505 | Ga0495651_0167256 | |||
| 2506 | Ga0495651_0489282 | |||
| 2507 | Ga0495653_0131853 | |||
| 2508 | Ga0495653_0379707 | |||
| 2509 | Ga0495580_0288511 | |||
| 2510 | Ga0495605_0252741 | |||
| 2511 | Ga0495662_0133205 | |||
| 2512 | Ga0495662_0315612 | |||
| 2513 | Ga0495585_0261865 | |||
| 2514 | Ga0495608_0059603 | |||
| 2515 | Ga0495608_0104512 | |||
| 2516 | Ga0495608_0135699 | |||
| 2517 | Ga0495608_0419992 | |||
| 2518 | Ga0495618_0106238 | |||
| 2519 | Ga0495628_0161951 | |||
| 2520 | Ga0495628_0398602 | |||
| 2521 | Ga0495630_0017716 | |||
| 2522 | Ga0495630_0122358 | |||
| 2523 | Ga0495630_0659161 | |||
| 2524 | Ga0495652_0002382 | |||
| 2525 | Ga0495652_0018444 | |||
| 2526 | Ga0495652_0097537 | |||
| 2527 | Ga0495665_0080554 | |||
| 2528 | Ga0495587_0099795 | |||
| 2529 | Ga0495598_0065706 | |||
| 2530 | Ga0495621_0067420 | |||
| 2531 | Ga0495645_0001349 | |||
| 2532 | Ga0495645_0076108 | |||
| 2533 | Ga0495645_0098755 | |||
| 2534 | Ga0495645_0223375 | |||
| 2535 | Ga0495667_0015938 | |||
| 2536 | Ga0495667_0035700 | |||
| 2537 | Ga0495667_0467394 | |||
| 2538 | Ga0495656_0354571 | |||
| 2539 | Ga0495635_0703429 | |||
| 2540 | Ga0495635_0727494 | |||
| 2541 | Ga0495659_0105214 | |||
| 2542 | Ga0495659_0201372 | |||
| 2543 | Ga0495657_0024000 | |||
| 2544 | Ga0495599_0083130 | |||
| 2545 | Ga0495599_0169053 | |||
| 2546 | Ga0495599_0609517 | |||
| 2547 | Ga0495623_0018902 | |||
| 2548 | Ga0495623_0065191 | |||
| 2549 | Ga0495646_0022094 | |||
| 2550 | Ga0495658_0066607 | |||
| 2551 | Ga0495658_0183254 | |||
| 2552 | Ga0495669_0168597 | |||
| 2553 | Ga0495669_0237917 | |||
| 2554 | Ga0495600_0052803 | |||
| 2555 | Ga0495600_0112176 | |||
| 2556 | Ga0495604_0480204 | |||
| 2557 | Ga0495674_0201867 | |||
| 2558 | Ga0495676_0184902 | |||
| 2559 | Ga0495680_0218080 | |||
| 2560 | Ga0495680_0572295 | |||
| 2561 | Ga0495680_0776973 | |||
| 2562 | Ga0495675_0020921 | |||
| 2563 | Ga0495675_0106698 | |||
| 2564 | Ga0495684_0018401 | |||
| 2565 | Ga0495684_0244313 | |||
| 2566 | Ga0495593_0099700 | |||
| 2567 | Ga0495602_0092945 | |||
| 2568 | Ga0495602_0485795 | |||
| 2569 | Ga0496100_0029379 | |||
| 2570 | Ga0496100_0363946 | |||
| 2571 | Ga0496100_0367823 | |||
| 2572 | Ga0496100_0603440 | |||
| 2573 | Ga0496101_0030711 | |||
| 2574 | Ga0496101_0057350 | |||
| 2575 | Ga0496101_0191061 | |||
| 2576 | Ga0496101_0255690 | |||
| 2577 | Ga0496101_0390007 | |||
| 2578 | Ga0496102_0060713 | |||
| 2579 | Ga0496102_0098397 | |||
| 2580 | Ga0496102_0248196 | |||
| 2581 | Ga0496102_0557253 | |||
| 2582 | Ga0496102_1183070 | |||
| 2583 | Ga0496103_0048618 | |||
| 2584 | Ga0496103_0074371 | |||
| 2585 | Ga0496103_0099912 | |||
| 2586 | Ga0496104_0242492 | |||
| 2587 | Ga0496104_0267729 | |||
| 2588 | Ga0496104_0292550 | |||
| 2589 | Ga0496104_0369501 | |||
| 2590 | Ga0496104_0406503 | |||
| 2591 | Ga0496105_0015917 | |||
| 2592 | Ga0496105_0171980 | |||
| 2593 | Ga0496106_0000931 | |||
| 2594 | Ga0496106_0089107 | |||
| 2595 | Ga0496106_0302521 | |||
| 2596 | Ga0496106_0441091 | |||
| 2597 | Ga0496107_0004980 | |||
| 2598 | Ga0496107_0114221 | |||
| 2599 | Ga0496108_0228481 | |||
| 2600 | Ga0496108_0275170 | |||
| 2601 | Ga0496108_0358646 | |||
| 2602 | Ga0496108_0529651 | |||
| 2603 | Ga0496108_0702327 | |||
| 2604 | Ga0496109_0003295 | |||
| 2605 | Ga0496109_0267962 | |||
| 2606 | Ga0496109_0628543 | |||
| 2607 | Ga0496109_0727887 | |||
| 2608 | Ga0496110_0005169 | |||
| 2609 | Ga0496110_0186176 | |||
| 2610 | Ga0496110_0730324 | |||
| 2611 | Ga0496110_0748007 | |||
| 2612 | Ga0496110_0983568 | |||
| 2613 | Ga0496111_0071833 | |||
| 2614 | Ga0496111_0294540 | |||
| 2615 | Ga0496112_0012037 | |||
| 2616 | Ga0496112_0697637 | |||
| 2617 | Ga0496112_0927724 | |||
| 2618 | Ga0496113_0514411 | |||
| 2619 | Ga0496114_0006008 | |||
| 2620 | Ga0496114_0386386 | |||
| 2621 | Ga0496115_0002245 | |||
| 2622 | Ga0496115_0011572 | |||
| 2623 | Ga0496115_0041385 | |||
| 2624 | Ga0496115_0361349 | |||
| 2625 | Ga0496115_0364171 | |||
| 2626 | Ga0496115_0779278 | |||
| 2627 | Ga0501040_0268614 | |||
| 2628 | Ga0501067_0130946 | |||
| 2629 | Ga0501072_0837507 | |||
| 2630 | Ga0501075_0244207 | |||
| 2631 | Ga0501243_001814 | |||
| 2632 | Ga0501081_0166412 | |||
| 2633 | Ga0501045_0359695 | |||
| 2634 | nmdc:mga05p37_230926_c1 | |||
| 2635 | nmdc:mga05p37_508068_c1 | |||
| 2636 | nmdc:mga05p37_624008_c1 | |||
| 2637 | nmdc:mga05p37_626317_c1 | |||
| 2638 | nmdc:mga08y16_1060237_c1 | |||
| 2639 | nmdc:mga08y16_123955_c1 | |||
| 2640 | nmdc:mga08y16_140210_c1 | |||
| 2641 | nmdc:mga08y16_250812_c1 | |||
| 2642 | nmdc:mga08y16_4473_c1 | |||
| 2643 | nmdc:mga0n895_1016870_c1 | |||
| 2644 | nmdc:mga0n895_120848_c1 | |||
| 2645 | nmdc:mga0n895_264144_c1 | |||
| 2646 | nmdc:mga0n895_325208_c1 | |||
| 2647 | nmdc:mga0n895_383427_c1 | |||
| 2648 | nmdc:mga0n895_979579_c1 | |||
| 2649 | nmdc:mga08x19_258084_c1 | |||
| 2650 | nmdc:mga08x19_398716_c1 | |||
| 2651 | nmdc:mga08x19_528808_c1 | |||
| 2652 | nmdc:mga0a205_738712_c1 | |||
| 2653 | nmdc:mga0a205_75661_c1 | |||
| 2654 | Ga0495601_0031806 | |||
| 2655 | Ga0495601_0122844 | |||
| 2656 | Ga0495595_0112475 | |||
| 2657 | Ga0495595_0139857 | |||
| 2658 | Ga0495619_0055978 | |||
| 2659 | Ga0495619_0429277 | |||
| 2660 | Ga0495619_0528656 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9661 | 118 | 168 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9593 | 118 | 168 |
| 6eo2-assembly1.cif.gz_A | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed | 0.9553 | 125 | 169 |
| 4lup-assembly2.cif.gz_C | crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand | 0.9494 | 1 | 95 |
| 3vfz-assembly3.cif.gz_A | crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis | 0.9443 | 118 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o8xA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9661 | 118 | 168 | 1.10.10.10 |
| 2o8xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9593 | 118 | 168 | 1.10.10.10 |
| 1or7B01 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9528 | 5 | 87 | 1.10.1740.10 |
| 2o8xC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9515 | 118 | 168 | 1.10.10.10 |
| 4lupC00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9493 | 1 | 95 | 1.10.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZWP5-F1-model_v4 | RNA polymerase sigma factor | 1.002 | 1 | 92 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A4Q2XYZ5-F1-model_v4 | RNA polymerase sigma-70 region 2 domain-containing protein | 0.9256 | 1 | 89 |
GO:0006352
GO:0016987 |
| AF-A0A2W4RZU8-F1-model_v4 | RNA polymerase sigma-70 region 2 domain-containing protein | 0.8989 | 1 | 101 |
GO:0006352
GO:0016987 |
| AF-A0A2V6MJR0-F1-model_v4 | RNA polymerase sigma factor | 0.8598 | 1 | 113 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A2V6MJR0-F1-model_v4 | RNA polymerase sigma factor | 0.8406 | 1 | 113 |
GO:0003677
GO:0006352 GO:0016987 |