F493073

General Info

Members Datasets Scaffolds Average Seq Length
1330 332 2660 186

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10014139|Ga0157378_100141394
Length 217
Sequence VARRRRAEHDGWARMSASPVTDAQLIARCVVGDDRHAFAELVRRHQSAVRACLRKLTTGDAALADDLAQETFVLAWRNLKSFRQDARFSTWLYRIATNCWLMHARKRKEELLGDRDDAIPDDDHDAMSHLTDTAVDHTRASTLRMYLERAMRVLSEPERAAIVQCYHNDLSHEEAAYVLGIPVGTVKTHVLRAKQKLKVAMASWNPEAASGTAEGAA

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
251 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
252 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
255 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.74
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 24.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10014139 3300013297 Bacteria 6984
2 SwRhRL2b_contig_1634644 2162886007 Bacteria 1081
3 SwRhRL2b_contig_387844 2162886007 Bacteria 1068
4 JGI24035J26624_1001983 3300002126 Bacteria 1906
5 rootL2_10328949 3300003322 Bacteria 2370
6 JGI25405J52794_10000323 3300003911 Bacteria 6609
7 JGI25405J52794_10001843 3300003911 Bacteria 3563
8 JGI25405J52794_10001884 3300003911 Bacteria 3537
9 Ga0065704_10004765 3300005289 Bacteria 4798
10 Ga0065704_10234770 3300005289 Bacteria 1032
11 Ga0065712_10006901 3300005290 Bacteria 3276
12 Ga0065712_10009838 3300005290 Bacteria 3430
13 Ga0065715_10008051 3300005293 Bacteria 2745
14 Ga0065715_10013045 3300005293 Unclassified 2152
15 Ga0065715_10048647 3300005293 Bacteria 1093
16 Ga0065715_10109052 3300005293 Bacteria 2668
17 Ga0065715_10240229 3300005293 Bacteria 1202
18 Ga0065715_10282308 3300005293 Bacteria 1083
19 Ga0065715_10336623 3300005293 Bacteria 966
20 Ga0065715_10425309 3300005293 Bacteria 832
21 Ga0065707_10219050 3300005295 Bacteria 1232
22 Ga0070658_10009067 3300005327 Bacteria 8004
23 Ga0070676_10001268 3300005328 Bacteria 12689
24 Ga0070676_10045600 3300005328 Bacteria 2553
25 Ga0070676_10057250 3300005328 Unclassified 2306
26 Ga0070676_10083387 3300005328 Bacteria 1944
27 Ga0070683_100004758 3300005329 Bacteria 11234
28 Ga0070683_100017515 3300005329 Bacteria 6332
29 Ga0070683_100041501 3300005329 Bacteria 4233
30 Ga0070683_100253871 3300005329 Bacteria 1672
31 Ga0070683_100400758 3300005329 Bacteria 1308
32 Ga0070690_100019100 3300005330 Bacteria 4153
33 Ga0070690_100019262 3300005330 Bacteria 4138
34 Ga0070690_100168997 3300005330 Unclassified 1504
35 Ga0070670_100031216 3300005331 Bacteria 4588
36 Ga0070670_100153032 3300005331 Bacteria 1996
37 Ga0070670_100232408 3300005331 Bacteria 1605
38 Ga0070670_100252135 3300005331 Bacteria 1538
39 Ga0070677_10000242 3300005333 Bacteria 18978
40 Ga0070677_10064647 3300005333 Bacteria 1520
41 Ga0070677_10121982 3300005333 Unclassified 1178
42 Ga0068869_100086683 3300005334 Bacteria 2347
43 Ga0068869_100087886 3300005334 Bacteria 2332
44 Ga0070666_10001424 3300005335 Bacteria 14500
45 Ga0070666_10013532 3300005335 Bacteria 5179
46 Ga0070666_10035493 3300005335 Bacteria 3307
47 Ga0070666_10064321 3300005335 Bacteria 2488
48 Ga0070666_10138075 3300005335 Bacteria 1697
49 Ga0070666_10196339 3300005335 Bacteria 1419
50 Ga0070666_10204638 3300005335 Unclassified 1389
51 Ga0070680_100016424 3300005336 Bacteria 5827
52 Ga0070680_100150489 3300005336 Bacteria 1954
53 Ga0070680_100304887 3300005336 Bacteria 1351
54 Ga0070682_100064400 3300005337 Bacteria 2327
55 Ga0070682_100123707 3300005337 Bacteria 1740
56 Ga0068868_100002750 3300005338 Bacteria 12180
57 Ga0068868_100006774 3300005338 Bacteria 8140
58 Ga0068868_100010675 3300005338 Bacteria 6655
59 Ga0068868_100192419 3300005338 Bacteria 1697
60 Ga0068868_100200598 3300005338 Bacteria 1663
61 Ga0068868_100328946 3300005338 Unclassified 1304
62 Ga0068868_100374611 3300005338 Unclassified 1224
63 Ga0068868_100412726 3300005338 Bacteria 1167
64 Ga0068868_100439175 3300005338 Bacteria 1133
65 Ga0070660_100000551 3300005339 Bacteria 25098
66 Ga0070660_100118693 3300005339 Bacteria 2109
67 Ga0070660_100130753 3300005339 Unclassified 2009
68 Ga0070660_100291947 3300005339 Bacteria 1335
69 Ga0070660_100507930 3300005339 Unclassified 1003
70 Ga0070689_100013944 3300005340 Bacteria 5830
71 Ga0070689_100017987 3300005340 Bacteria 5198
72 Ga0070689_100160610 3300005340 Unclassified 1816
73 Ga0070689_100328318 3300005340 Bacteria 1279
74 Ga0070689_100421195 3300005340 Bacteria 1132
75 Ga0070687_100024597 3300005343 Bacteria 2878
76 Ga0070687_100034776 3300005343 Bacteria 2496
77 Ga0070661_100007142 3300005344 Bacteria 7701
78 Ga0070661_100033026 3300005344 Bacteria 3748
79 Ga0070661_100033465 3300005344 Bacteria 3723
80 Ga0070661_100041563 3300005344 Bacteria 3355
81 Ga0070661_100118517 3300005344 Bacteria 1981
82 Ga0070692_10223773 3300005345 Bacteria 1113
83 Ga0070668_100001406 3300005347 Bacteria 17305
84 Ga0070668_100003165 3300005347 Bacteria 12129
85 Ga0070668_100045194 3300005347 Bacteria 3379
86 Ga0070668_100219615 3300005347 Bacteria 1567
87 Ga0070668_100607428 3300005347 Unclassified 957
88 Ga0070668_101028943 3300005347 Unclassified 741
89 Ga0070668_101652075 3300005347 Unclassified 587
90 Ga0070669_100002287 3300005353 Bacteria 13893
91 Ga0070669_100104050 3300005353 Bacteria 2146
92 Ga0070669_100161040 3300005353 Bacteria 1744
93 Ga0070669_100187338 3300005353 Bacteria 1622
94 Ga0070669_100220747 3300005353 Bacteria 1498
95 Ga0070669_100264653 3300005353 Unclassified 1373
96 Ga0070669_100377487 3300005353 Bacteria 1156
97 Ga0070669_100822886 3300005353 Bacteria 790
98 Ga0070675_100002082 3300005354 Bacteria 14809
99 Ga0070675_100022317 3300005354 Bacteria 5057
100 Ga0070675_100030145 3300005354 Bacteria 4377
101 Ga0070675_100049890 3300005354 Bacteria 3436
102 Ga0070675_100063086 3300005354 Bacteria 3063
103 Ga0070675_100067503 3300005354 Bacteria 2959
104 Ga0070675_100071808 3300005354 Bacteria 2873
105 Ga0070675_100103054 3300005354 Unclassified 2405
106 Ga0070675_100104988 3300005354 Bacteria 2384
107 Ga0070675_100156590 3300005354 Unclassified 1956
108 Ga0070675_100248840 3300005354 Bacteria 1555
109 Ga0070675_100572457 3300005354 Unclassified 1023
110 Ga0070675_101386494 3300005354 Bacteria 648
111 Ga0070671_100003277 3300005355 Bacteria 12629
112 Ga0070671_100005547 3300005355 Bacteria 10050
113 Ga0070671_100020112 3300005355 Bacteria 5440
114 Ga0070671_100032550 3300005355 Bacteria 4310
115 Ga0070671_100047316 3300005355 Bacteria 3577
116 Ga0070671_100061954 3300005355 Bacteria 3115
117 Ga0070671_100063682 3300005355 Bacteria 3071
118 Ga0070671_100073286 3300005355 Bacteria 2860
119 Ga0070671_100158350 3300005355 Bacteria 1914
120 Ga0070671_100258573 3300005355 Bacteria 1480
121 Ga0070674_100000659 3300005356 Bacteria 17432
122 Ga0070674_100013733 3300005356 Bacteria 5013
123 Ga0070674_100026238 3300005356 Bacteria 3802
124 Ga0070674_100078097 3300005356 Bacteria 2358
125 Ga0070674_100129882 3300005356 Unclassified 1877
126 Ga0070673_100001356 3300005364 Bacteria 14306
127 Ga0070673_100007946 3300005364 Bacteria 7029
128 Ga0070673_100043069 3300005364 Bacteria 3485
129 Ga0070673_100045749 3300005364 Bacteria 3396
130 Ga0070673_100067957 3300005364 Bacteria 2852
131 Ga0070673_100103167 3300005364 Unclassified 2352
132 Ga0070673_100108362 3300005364 Bacteria 2300
133 Ga0070673_100185865 3300005364 Unclassified 1781
134 Ga0070673_100760360 3300005364 Bacteria 893
135 Ga0070673_101433921 3300005364 Unclassified 650
136 Ga0070688_100001625 3300005365 Bacteria 11248
137 Ga0070688_100019806 3300005365 Bacteria 3903
138 Ga0070688_100019867 3300005365 Bacteria 3897
139 Ga0070688_100039269 3300005365 Bacteria 2896
140 Ga0070688_100127953 3300005365 Bacteria 1710
141 Ga0070688_100128143 3300005365 Bacteria 1708
142 Ga0070688_100174111 3300005365 Bacteria 1488
143 Ga0070659_100000779 3300005366 Bacteria 23129
144 Ga0070659_100015404 3300005366 Bacteria 5726
145 Ga0070659_100169517 3300005366 Unclassified 1788
146 Ga0070659_100263081 3300005366 Bacteria 1431
147 Ga0070659_100395158 3300005366 Unclassified 1166
148 Ga0070659_100562625 3300005366 Bacteria 977
149 Ga0070667_100003532 3300005367 Bacteria 13319
150 Ga0070667_100003566 3300005367 Bacteria 13255
151 Ga0070667_100008508 3300005367 Bacteria 8508
152 Ga0070667_100078143 3300005367 Bacteria 2827
153 Ga0070667_100084490 3300005367 Bacteria 2721
154 Ga0070667_100106801 3300005367 Unclassified 2423
155 Ga0070667_100151596 3300005367 Bacteria 2037
156 Ga0070667_100385570 3300005367 Bacteria 1273
157 Ga0070667_100398153 3300005367 Bacteria 1253
158 Ga0070667_100583168 3300005367 Unclassified 1029
159 Ga0070667_100677736 3300005367 Bacteria 953
160 Ga0070667_100688044 3300005367 Bacteria 946
161 Ga0070667_101120663 3300005367 Unclassified 736
162 Ga0070703_10307702 3300005406 Unclassified 663
163 Ga0070709_10020181 3300005434 Bacteria 3863
164 Ga0070709_10055060 3300005434 Bacteria 2510
165 Ga0070709_10111182 3300005434 Unclassified 1842
166 Ga0070709_10160059 3300005434 Bacteria 1564
167 Ga0070709_10201156 3300005434 Bacteria 1411
168 Ga0070709_10603542 3300005434 Unclassified 845
169 Ga0070714_100037722 3300005435 Bacteria 4062
170 Ga0070714_100191387 3300005435 Bacteria 1867
171 Ga0070714_100269800 3300005435 Bacteria 1578
172 Ga0070714_100437980 3300005435 Unclassified 1240
173 Ga0070714_100635017 3300005435 Bacteria 1027
174 Ga0070713_100361069 3300005436 Bacteria 1349
175 Ga0070713_100662013 3300005436 Unclassified 995
176 Ga0070710_10004182 3300005437 Bacteria 6843
177 Ga0070710_10028443 3300005437 Bacteria 2990
178 Ga0070710_10101610 3300005437 Bacteria 1713
179 Ga0070710_10168369 3300005437 Bacteria 1364
180 Ga0070701_10422935 3300005438 Bacteria 849
181 Ga0070711_100024261 3300005439 Bacteria 3953
182 Ga0070711_100147637 3300005439 Unclassified 1770
183 Ga0070711_100211133 3300005439 Bacteria 1503
184 Ga0070711_100218554 3300005439 Unclassified 1480
185 Ga0070711_100296505 3300005439 Bacteria 1284
186 Ga0070711_100380197 3300005439 Bacteria 1142
187 Ga0070705_100004271 3300005440 Bacteria 6968
188 Ga0070705_100059114 3300005440 Bacteria 2268
189 Ga0070705_100272660 3300005440 Bacteria 1199
190 Ga0070705_100367598 3300005440 Bacteria 1054
191 Ga0070705_100473101 3300005440 Bacteria 945
192 Ga0070705_100587744 3300005440 Unclassified 859
193 Ga0070700_100003307 3300005441 Bacteria 8313
194 Ga0070700_100736289 3300005441 Bacteria 787
195 Ga0070700_100873269 3300005441 Unclassified 730
196 Ga0070694_100016263 3300005444 Bacteria 4683
197 Ga0070708_100007814 3300005445 Bacteria 8571
198 Ga0070708_100019108 3300005445 Bacteria 5749
199 Ga0070708_100043795 3300005445 Unclassified 3933
200 Ga0070708_100064287 3300005445 Unclassified 3287
201 Ga0070708_100071797 3300005445 Unclassified 3117
202 Ga0070708_100247664 3300005445 Unclassified 1674
203 Ga0070708_100333778 3300005445 Bacteria 1429
204 Ga0070708_100375406 3300005445 Bacteria 1341
205 Ga0070663_100044095 3300005455 Bacteria 3142
206 Ga0070663_100103241 3300005455 Bacteria 2131
207 Ga0070678_100001796 3300005456 Bacteria 11558
208 Ga0070678_100009966 3300005456 Bacteria 5781
209 Ga0070678_100027767 3300005456 Bacteria 3848
210 Ga0070678_100212798 3300005456 Bacteria 1602
211 Ga0070678_100266656 3300005456 Bacteria 1442
212 Ga0070678_100280893 3300005456 Unclassified 1408
213 Ga0070678_100630034 3300005456 Unclassified 960
214 Ga0070662_100000211 3300005457 Bacteria 34047
215 Ga0070662_100012527 3300005457 Bacteria 5624
216 Ga0070662_100118359 3300005457 Bacteria 2027
217 Ga0070662_100118367 3300005457 Bacteria 2027
218 Ga0070662_100459618 3300005457 Bacteria 1058
219 Ga0070662_100634167 3300005457 Unclassified 901
220 Ga0070681_10002421 3300005458 Bacteria 17061
221 Ga0070681_10012806 3300005458 Bacteria 8326
222 Ga0070681_10113966 3300005458 Bacteria 2642
223 Ga0070681_11031101 3300005458 Unclassified 743
224 Ga0068867_100002050 3300005459 Bacteria 14116
225 Ga0068867_100002361 3300005459 Bacteria 13277
226 Ga0068867_100046722 3300005459 Bacteria 3181
227 Ga0068867_100165548 3300005459 Bacteria 1747
228 Ga0068867_100190402 3300005459 Bacteria 1636
229 Ga0068867_100299719 3300005459 Unclassified 1325
230 Ga0068867_100464649 3300005459 Bacteria 1081
231 Ga0070685_10055103 3300005466 Unclassified 2310
232 Ga0070685_10185391 3300005466 Bacteria 1342
233 Ga0070706_100000012 3300005467 Bacteria 195040
234 Ga0070706_100010658 3300005467 Bacteria 8533
235 Ga0070706_100011949 3300005467 Bacteria 8059
236 Ga0070706_100025873 3300005467 Bacteria 5401
237 Ga0070706_100147868 3300005467 Bacteria 2194
238 Ga0070706_100155773 3300005467 Bacteria 2133
239 Ga0070706_100295679 3300005467 Unclassified 1511
240 Ga0070706_100342482 3300005467 Unclassified 1394
241 Ga0070706_100418331 3300005467 Unclassified 1247
242 Ga0070706_100906695 3300005467 Bacteria 814
243 Ga0070706_100956876 3300005467 Bacteria 790
244 Ga0070707_100007671 3300005468 Bacteria 10022
245 Ga0070707_100039755 3300005468 Bacteria 4498
246 Ga0070707_100043177 3300005468 Bacteria 4316
247 Ga0070707_100055855 3300005468 Bacteria 3785
248 Ga0070707_100075664 3300005468 Bacteria 3247
249 Ga0070707_100121445 3300005468 Unclassified 2537
250 Ga0070707_100145583 3300005468 Bacteria 2306
251 Ga0070707_100157651 3300005468 Bacteria 2211
252 Ga0070707_100186635 3300005468 Bacteria 2022
253 Ga0070707_100186952 3300005468 Bacteria 2020
254 Ga0070707_100355176 3300005468 Bacteria 1423
255 Ga0070707_100519650 3300005468 Bacteria 1153
256 Ga0070707_100523359 3300005468 Bacteria 1148
257 Ga0070707_100754051 3300005468 Unclassified 937
258 Ga0070698_100000413 3300005471 Bacteria 45525
259 Ga0070698_100023971 3300005471 Bacteria 6371
260 Ga0070698_100432375 3300005471 Bacteria 1251
261 Ga0070698_100618266 3300005471 Bacteria 1024
262 Ga0070698_100829553 3300005471 Bacteria 869
263 Ga0070698_101270600 3300005471 Unclassified 686
264 Ga0070699_100035199 3300005518 Bacteria 4328
265 Ga0070699_100053333 3300005518 Bacteria 3500
266 Ga0070699_100132618 3300005518 Bacteria 2196
267 Ga0070699_100245561 3300005518 Bacteria 1599
268 Ga0070699_100287557 3300005518 Unclassified 1473
269 Ga0070699_100350897 3300005518 Bacteria 1329
270 Ga0070699_100364612 3300005518 Bacteria 1303
271 Ga0070699_100597462 3300005518 Unclassified 1006
272 Ga0070699_100607951 3300005518 Bacteria 997
273 Ga0070699_100636185 3300005518 Bacteria 973
274 Ga0070679_100006694 3300005530 Bacteria 10750
275 Ga0070679_100007544 3300005530 Bacteria 10171
276 Ga0070679_100018126 3300005530 Bacteria 6825
277 Ga0070679_100021209 3300005530 Bacteria 6339
278 Ga0070679_100197004 3300005530 Unclassified 1981
279 Ga0070679_100208411 3300005530 Bacteria 1919
280 Ga0070679_100302305 3300005530 Unclassified 1550
281 Ga0070679_100843256 3300005530 Unclassified 860
282 Ga0070684_100001230 3300005535 Bacteria 18389
283 Ga0070684_100002787 3300005535 Bacteria 12946
284 Ga0070684_100003917 3300005535 Bacteria 11278
285 Ga0070684_100024102 3300005535 Bacteria 5101
286 Ga0070684_100391669 3300005535 Bacteria 1280
287 Ga0070684_100491039 3300005535 Unclassified 1137
288 Ga0070684_100908447 3300005535 Bacteria 825
289 Ga0070697_100032665 3300005536 Bacteria 4190
290 Ga0070697_100060466 3300005536 Bacteria 3088
291 Ga0070697_100061365 3300005536 Bacteria 3066
292 Ga0070697_100135666 3300005536 Bacteria 2066
293 Ga0070697_100149013 3300005536 Unclassified 1971
294 Ga0070697_100173513 3300005536 Bacteria 1826
295 Ga0070697_100305561 3300005536 Bacteria 1368
296 Ga0070697_100347575 3300005536 Bacteria 1280
297 Ga0070697_101081682 3300005536 Unclassified 713
298 Ga0068853_100006893 3300005539 Bacteria 9070
299 Ga0068853_100035421 3300005539 Bacteria 4240
300 Ga0068853_100051166 3300005539 Bacteria 3555
301 Ga0068853_100115237 3300005539 Bacteria 2391
302 Ga0068853_100305755 3300005539 Unclassified 1471
303 Ga0068853_100393342 3300005539 Unclassified 1296
304 Ga0068853_100824533 3300005539 Bacteria 889
305 Ga0070672_100003099 3300005543 Bacteria 10725
306 Ga0070672_100008014 3300005543 Bacteria 7216
307 Ga0070672_100008581 3300005543 Bacteria 6999
308 Ga0070672_100016533 3300005543 Bacteria 5284
309 Ga0070672_100093931 3300005543 Unclassified 2423
310 Ga0070672_100139228 3300005543 Bacteria 2000
311 Ga0070672_100302218 3300005543 Bacteria 1357
312 Ga0070672_100463103 3300005543 Unclassified 1093
313 Ga0070686_100344273 3300005544 Bacteria 1118
314 Ga0070695_100226023 3300005545 Unclassified 1351
315 Ga0070696_100414592 3300005546 Bacteria 1056
316 Ga0070696_100913644 3300005546 Bacteria 729
317 Ga0070693_100046532 3300005547 Bacteria 2464
318 Ga0070693_100215176 3300005547 Unclassified 1256
319 Ga0070693_100273750 3300005547 Unclassified 1128
320 Ga0070693_100381154 3300005547 Bacteria 973
321 Ga0070665_100004484 3300005548 Bacteria 14665
322 Ga0070665_100006553 3300005548 Bacteria 11833
323 Ga0070665_100023261 3300005548 Bacteria 6240
324 Ga0070665_100025375 3300005548 Bacteria 5973
325 Ga0070665_100028552 3300005548 Bacteria 5619
326 Ga0070665_100043800 3300005548 Bacteria 4496
327 Ga0070665_100066411 3300005548 Bacteria 3618
328 Ga0070665_100099856 3300005548 Bacteria 2907
329 Ga0070665_100239396 3300005548 Bacteria 1815
330 Ga0070665_100240408 3300005548 Bacteria 1811
331 Ga0070665_100294444 3300005548 Unclassified 1625
332 Ga0070665_100410794 3300005548 Unclassified 1362
333 Ga0070665_100558675 3300005548 Bacteria 1157
334 Ga0070665_100761500 3300005548 Unclassified 981
335 Ga0070704_100002585 3300005549 Bacteria 10210
336 Ga0068855_100026160 3300005563 Bacteria 6980
337 Ga0068855_100101461 3300005563 Bacteria 3313
338 Ga0068855_100291506 3300005563 Unclassified 1809
339 Ga0070664_100014087 3300005564 Bacteria 6522
340 Ga0070664_100017006 3300005564 Bacteria 5970
341 Ga0070664_100071931 3300005564 Unclassified 2965
342 Ga0070664_100175700 3300005564 Bacteria 1901
343 Ga0070664_100195760 3300005564 Unclassified 1802
344 Ga0070664_100324490 3300005564 Bacteria 1396
345 Ga0070664_100333577 3300005564 Unclassified 1376
346 Ga0068857_100047692 3300005577 Bacteria 3804
347 Ga0068857_100069369 3300005577 Bacteria 3139
348 Ga0068857_100392092 3300005577 Bacteria 1291
349 Ga0068857_100762942 3300005577 Unclassified 922
350 Ga0068854_100016524 3300005578 Bacteria 4921
351 Ga0068854_100048212 3300005578 Bacteria 3039
352 Ga0068856_100004235 3300005614 Bacteria 14328
353 Ga0068856_100010690 3300005614 Bacteria 8917
354 Ga0068856_100020448 3300005614 Bacteria 6429
355 Ga0068856_100035673 3300005614 Bacteria 4874
356 Ga0068856_100563184 3300005614 Bacteria 1161
357 Ga0068856_100617891 3300005614 Unclassified 1105
358 Ga0068856_100665295 3300005614 Bacteria 1062
359 Ga0070702_100152344 3300005615 Bacteria 1486
360 Ga0068852_100003693 3300005616 Bacteria 10727
361 Ga0068852_100014944 3300005616 Bacteria 6000
362 Ga0068852_100063346 3300005616 Bacteria 3219
363 Ga0068852_100089773 3300005616 Bacteria 2747
364 Ga0068852_100215928 3300005616 Unclassified 1822
365 Ga0068852_100672728 3300005616 Unclassified 1044
366 Ga0068852_100767385 3300005616 Unclassified 977
367 Ga0068852_101338913 3300005616 Bacteria 738
368 Ga0068859_100006056 3300005617 Bacteria 12280
369 Ga0068859_100031329 3300005617 Bacteria 5340
370 Ga0068859_100178962 3300005617 Bacteria 2203
371 Ga0068859_100316119 3300005617 Bacteria 1655
372 Ga0068859_101696572 3300005617 Archaea 698
373 Ga0068864_100002334 3300005618 Bacteria 15682
374 Ga0068864_100003597 3300005618 Bacteria 12816
375 Ga0068864_100030005 3300005618 Bacteria 4609
376 Ga0068864_100154845 3300005618 Unclassified 2079
377 Ga0068864_100296909 3300005618 Bacteria 1512
378 Ga0068864_101095176 3300005618 Unclassified 793
379 Ga0068861_100122282 3300005719 Bacteria 2102
380 Ga0068861_100209913 3300005719 Bacteria 1639
381 Ga0068851_10001801 3300005834 Bacteria 9384
382 Ga0068851_10008654 3300005834 Bacteria 4711
383 Ga0068851_10009599 3300005834 Bacteria 4505
384 Ga0068851_10192646 3300005834 Bacteria 1134
385 Ga0068870_10014467 3300005840 Bacteria 3728
386 Ga0068870_10062076 3300005840 Unclassified 2011
387 Ga0068870_10237472 3300005840 Bacteria 1124
388 Ga0068863_100003877 3300005841 Bacteria 14790
389 Ga0068863_100013286 3300005841 Bacteria 7946
390 Ga0068863_100014810 3300005841 Bacteria 7497
391 Ga0068863_100068936 3300005841 Bacteria 3345
392 Ga0068863_100124985 3300005841 Bacteria 2454
393 Ga0068863_100220191 3300005841 Bacteria 1828
394 Ga0068863_100271793 3300005841 Bacteria 1641
395 Ga0068858_100003264 3300005842 Bacteria 16167
396 Ga0068858_100012075 3300005842 Bacteria 8140
397 Ga0068858_100018050 3300005842 Bacteria 6606
398 Ga0068858_100037520 3300005842 Bacteria 4495
399 Ga0068858_100054133 3300005842 Bacteria 3710
400 Ga0068858_100286608 3300005842 Bacteria 1569
401 Ga0068858_100376012 3300005842 Unclassified 1363
402 Ga0068858_100465385 3300005842 Bacteria 1219
403 Ga0068858_101600064 3300005842 Unclassified 643
404 Ga0068860_100001042 3300005843 Bacteria 30514
405 Ga0068860_100010043 3300005843 Bacteria 9381
406 Ga0068860_100012302 3300005843 Bacteria 8431
407 Ga0068860_100037702 3300005843 Bacteria 4627
408 Ga0068860_100432754 3300005843 Unclassified 1306
409 Ga0068860_100728245 3300005843 Bacteria 1003
410 Ga0068862_100194594 3300005844 Bacteria 1826
411 Ga0081455_10000547 3300005937 Bacteria 48774
412 Ga0081455_10001583 3300005937 Bacteria 27844
413 Ga0081455_10016102 3300005937 Bacteria 7230
414 Ga0081455_10016757 3300005937 Bacteria 7054
415 Ga0081455_10021993 3300005937 Bacteria 5970
416 Ga0081455_10027093 3300005937 Bacteria 5257
417 Ga0081455_10034863 3300005937 Unclassified 4505
418 Ga0081455_10217933 3300005937 Bacteria 1417
419 Ga0081540_1000016 3300005983 Bacteria 165370
420 Ga0081540_1010941 3300005983 Bacteria 6093
421 Ga0081540_1022397 3300005983 Bacteria 3731
422 Ga0081539_10000052 3300005985 Bacteria 268240
423 Ga0081539_10004458 3300005985 Bacteria 15437
424 Ga0081539_10008307 3300005985 Bacteria 9086
425 Ga0081539_10009998 3300005985 Bacteria 7813
426 Ga0081539_10020681 3300005985 Bacteria 4433
427 Ga0081539_10120493 3300005985 Unclassified 1304
428 Ga0081539_10248129 3300005985 Bacteria 793
429 Ga0070717_10004551 3300006028 Bacteria 10032
430 Ga0070717_10044850 3300006028 Bacteria 3613
431 Ga0070717_10117227 3300006028 Bacteria 2277
432 Ga0070717_10453712 3300006028 Bacteria 1155
433 Ga0070717_10555571 3300006028 Unclassified 1040
434 Ga0070717_10630238 3300006028 Unclassified 973
435 Ga0070715_10451967 3300006163 Bacteria 725
436 Ga0070716_100685547 3300006173 Unclassified 781
437 Ga0070716_100796948 3300006173 Unclassified 731
438 Ga0070712_100016473 3300006175 Bacteria 4777
439 Ga0070712_100306705 3300006175 Unclassified 1286
440 Ga0070712_100389355 3300006175 Bacteria 1149
441 Ga0070712_100684214 3300006175 Unclassified 873
442 Ga0070712_100780877 3300006175 Bacteria 819
443 Ga0070712_100865388 3300006175 Unclassified 778
444 Ga0097621_100013578 3300006237 Bacteria 6074
445 Ga0097621_100015740 3300006237 Bacteria 5700
446 Ga0097621_100018761 3300006237 Bacteria 5293
447 Ga0097621_100209356 3300006237 Unclassified 1696
448 Ga0097621_100232393 3300006237 Bacteria 1610
449 Ga0097621_100305203 3300006237 Unclassified 1407
450 Ga0097621_100356486 3300006237 Bacteria 1302
451 Ga0068871_100001817 3300006358 Bacteria 14403
452 Ga0068871_100007616 3300006358 Bacteria 7744
453 Ga0068871_100013929 3300006358 Bacteria 5979
454 Ga0068871_100023033 3300006358 Unclassified 4809
455 Ga0068871_100094475 3300006358 Unclassified 2496
456 Ga0068871_100181031 3300006358 Bacteria 1811
457 Ga0068871_100248979 3300006358 Bacteria 1547
458 Ga0068871_100553898 3300006358 Unclassified 1042
459 Ga0075428_100039310 3300006844 Bacteria 5206
460 Ga0075428_100053933 3300006844 Bacteria 4406
461 Ga0075428_100194783 3300006844 Bacteria 2192
462 Ga0075428_100375263 3300006844 Bacteria 1525
463 Ga0075433_10313300 3300006852 Bacteria 1389
464 Ga0075434_100109023 3300006871 Unclassified 2779
465 Ga0075434_100171781 3300006871 Bacteria 2188
466 Ga0075434_100208283 3300006871 Bacteria 1976
467 Ga0075434_100325667 3300006871 Unclassified 1557
468 Ga0075434_100352892 3300006871 Bacteria 1492
469 Ga0075434_100547521 3300006871 Unclassified 1177
470 Ga0075434_100577073 3300006871 Unclassified 1144
471 Ga0075434_100644291 3300006871 Unclassified 1078
472 Ga0068865_100044190 3300006881 Bacteria 3048
473 Ga0068865_100700892 3300006881 Unclassified 865
474 Ga0068865_101346575 3300006881 Unclassified 636
475 Ga0075436_100077399 3300006914 Bacteria 2304
476 Ga0075436_100113516 3300006914 Bacteria 1892
477 Ga0075436_100312407 3300006914 Bacteria 1128
478 Ga0097620_100006056 3300006931 Bacteria 12280
479 Ga0097620_100031329 3300006931 Bacteria 5340
480 Ga0097620_100178963 3300006931 Bacteria 2203
481 Ga0097620_100316123 3300006931 Bacteria 1655
482 Ga0097620_101696306 3300006931 Archaea 698
483 Ga0075435_100115740 3300007076 Bacteria 2233
484 Ga0075435_100178395 3300007076 Bacteria 1795
485 Ga0075435_100224640 3300007076 Bacteria 1595
486 Ga0105240_10008953 3300009093 Bacteria 14232
487 Ga0105240_10022687 3300009093 Bacteria 8317
488 Ga0111539_10001299 3300009094 Bacteria 33371
489 Ga0111539_10059036 3300009094 Bacteria 4550
490 Ga0111539_10060050 3300009094 Bacteria 4507
491 Ga0111539_10157405 3300009094 Bacteria 2658
492 Ga0111539_10509289 3300009094 Unclassified 1402
493 Ga0111539_10524735 3300009094 Bacteria 1380
494 Ga0111539_10539640 3300009094 Unclassified 1359
495 Ga0105245_10009797 3300009098 Bacteria 8348
496 Ga0105245_10018826 3300009098 Bacteria 6042
497 Ga0105245_10036661 3300009098 Bacteria 4357
498 Ga0105245_10103156 3300009098 Bacteria 2642
499 Ga0105245_10105036 3300009098 Bacteria 2619
500 Ga0105245_10210221 3300009098 Bacteria 1872
501 Ga0105245_10236535 3300009098 Unclassified 1769
502 Ga0105245_10441700 3300009098 Bacteria 1308
503 Ga0105247_10284676 3300009101 Bacteria 1141
504 Ga0105247_10469103 3300009101 Unclassified 911
505 Ga0114129_10095263 3300009147 Bacteria 4122
506 Ga0114129_10175486 3300009147 Bacteria 2919
507 Ga0114129_10850855 3300009147 Unclassified 1159
508 Ga0105243_10231036 3300009148 Unclassified 1641
509 Ga0105241_10015461 3300009174 Bacteria 5590
510 Ga0105241_10096732 3300009174 Bacteria 2339
511 Ga0105241_10922628 3300009174 Unclassified 812
512 Ga0105242_10022489 3300009176 Bacteria 4959
513 Ga0105242_10423439 3300009176 Unclassified 1248
514 Ga0105248_10002431 3300009177 Bacteria 20666
515 Ga0105248_10019006 3300009177 Bacteria 7597
516 Ga0105248_10158989 3300009177 Unclassified 2549
517 Ga0105248_10203082 3300009177 Unclassified 2233
518 Ga0105248_10299721 3300009177 Bacteria 1810
519 Ga0105248_10385061 3300009177 Bacteria 1579
520 Ga0105237_10107634 3300009545 Bacteria 2780
521 Ga0105237_10400540 3300009545 Bacteria 1377
522 Ga0105238_10034778 3300009551 Bacteria 5125
523 Ga0105238_11109291 3300009551 Bacteria 814
524 Ga0105249_10006766 3300009553 Bacteria 9990
525 Ga0105249_10016665 3300009553 Bacteria 6522
526 Ga0105249_10268110 3300009553 Bacteria 1700
527 Ga0105249_10347979 3300009553 Bacteria 1501
528 Ga0105249_10669291 3300009553 Bacteria 1097
529 Ga0105249_10702823 3300009553 Unclassified 1071
530 Ga0105249_10848108 3300009553 Bacteria 979
531 Ga0105249_11041037 3300009553 Unclassified 888
532 Ga0105249_11258577 3300009553 Bacteria 811
533 Ga0099796_10075146 3300010159 Bacteria 1228
534 Ga0105239_10072664 3300010375 Bacteria 3782
535 Ga0105246_10214792 3300011119 Bacteria 1504
536 Ga0105246_10516170 3300011119 Bacteria 1017
537 Ga0157373_10003902 3300013100 Bacteria 11265
538 Ga0157373_10014850 3300013100 Bacteria 5703
539 Ga0157373_10213621 3300013100 Bacteria 1360
540 Ga0157373_10375775 3300013100 Bacteria 1016
541 Ga0157371_10000446 3300013102 Bacteria 50636
542 Ga0157371_10253936 3300013102 Unclassified 1266
543 Ga0157371_10266681 3300013102 Bacteria 1235
544 Ga0157370_10010726 3300013104 Bacteria 9636
545 Ga0157370_10026708 3300013104 Bacteria 5697
546 Ga0157370_10060279 3300013104 Bacteria 3603
547 Ga0157370_10093865 3300013104 Bacteria 2816
548 Ga0157370_10153709 3300013104 Bacteria 2141
549 Ga0157370_10171572 3300013104 Bacteria 2016
550 Ga0157370_10946538 3300013104 Unclassified 781
551 Ga0157369_10012261 3300013105 Bacteria 9734
552 Ga0157369_10071605 3300013105 Bacteria 3721
553 Ga0157369_10237692 3300013105 Bacteria 1903
554 Ga0157369_10250853 3300013105 Unclassified 1847
555 Ga0157374_10032996 3300013296 Bacteria 4720
556 Ga0157374_10068236 3300013296 Bacteria 3345
557 Ga0157374_10075119 3300013296 Unclassified 3193
558 Ga0157374_10091134 3300013296 Bacteria 2907
559 Ga0157374_10110875 3300013296 Bacteria 2639
560 Ga0157374_10211274 3300013296 Unclassified 1903
561 Ga0157374_10356859 3300013296 Unclassified 1453
562 Ga0157374_10451880 3300013296 Bacteria 1286
563 Ga0157374_10538630 3300013296 Unclassified 1174
564 Ga0157374_11684549 3300013296 Unclassified 659
565 Ga0157378_10054529 3300013297 Bacteria 3559
566 Ga0157378_10056068 3300013297 Bacteria 3510
567 Ga0157378_10124616 3300013297 Bacteria 2379
568 Ga0157378_10144606 3300013297 Bacteria 2211
569 Ga0157378_10480705 3300013297 Bacteria 1238
570 Ga0157378_10528490 3300013297 Unclassified 1182
571 Ga0157378_11272604 3300013297 Bacteria 776
572 Ga0163162_10006343 3300013306 Bacteria 11451
573 Ga0163162_10006529 3300013306 Bacteria 11298
574 Ga0163162_10039123 3300013306 Bacteria 4737
575 Ga0163162_10082361 3300013306 Bacteria 3290
576 Ga0163162_10118321 3300013306 Bacteria 2751
577 Ga0163162_10250502 3300013306 Bacteria 1903
578 Ga0163162_10281768 3300013306 Bacteria 1794
579 Ga0163162_10544817 3300013306 Bacteria 1289
580 Ga0163162_10558796 3300013306 Unclassified 1272
581 Ga0163162_10737186 3300013306 Bacteria 1105
582 Ga0163162_11391334 3300013306 Bacteria 798
583 Ga0163162_11551637 3300013306 Bacteria 755
584 Ga0157372_10000523 3300013307 Bacteria 42408
585 Ga0157372_10030913 3300013307 Bacteria 5860
586 Ga0157372_10032821 3300013307 Bacteria 5696
587 Ga0157372_10085120 3300013307 Bacteria 3585
588 Ga0157372_10293916 3300013307 Bacteria 1889
589 Ga0157372_10410409 3300013307 Bacteria 1578
590 Ga0157372_11614732 3300013307 Bacteria 746
591 Ga0157375_10002572 3300013308 Bacteria 15765
592 Ga0157375_10007572 3300013308 Bacteria 9494
593 Ga0157375_10031682 3300013308 Bacteria 5004
594 Ga0157375_10033665 3300013308 Bacteria 4872
595 Ga0157375_10035443 3300013308 Bacteria 4763
596 Ga0157375_10047793 3300013308 Bacteria 4181
597 Ga0157375_10064141 3300013308 Bacteria 3657
598 Ga0157375_10090221 3300013308 Bacteria 3123
599 Ga0157375_10107775 3300013308 Bacteria 2880
600 Ga0157375_10356617 3300013308 Bacteria 1628
601 Ga0157375_10602273 3300013308 Bacteria 1258
602 Ga0157375_10610839 3300013308 Unclassified 1249
603 Ga0157375_11861375 3300013308 Bacteria 714
604 Ga0157375_12170491 3300013308 Unclassified 661
605 Ga0163163_10004811 3300014325 Bacteria 11598
606 Ga0163163_10042847 3300014325 Bacteria 4435
607 Ga0163163_10060433 3300014325 Bacteria 3753
608 Ga0163163_10169102 3300014325 Bacteria 2232
609 Ga0163163_10387662 3300014325 Unclassified 1455
610 Ga0163163_10435869 3300014325 Unclassified 1370
611 Ga0157380_10178920 3300014326 Bacteria 1861
612 Ga0157380_10373587 3300014326 Bacteria 1343
613 Ga0157380_10664872 3300014326 Bacteria 1041
614 Ga0157380_10789231 3300014326 Unclassified 965
615 Ga0182008_10085522 3300014497 Bacteria 1553
616 Ga0157377_10008931 3300014745 Bacteria 4903
617 Ga0157377_10058811 3300014745 Bacteria 2189
618 Ga0157377_10127614 3300014745 Bacteria 1549
619 Ga0157377_10250451 3300014745 Bacteria 1148
620 Ga0157377_10507869 3300014745 Bacteria 844
621 Ga0157379_10015087 3300014968 Bacteria 6777
622 Ga0157379_10031752 3300014968 Bacteria 4705
623 Ga0157379_10055151 3300014968 Bacteria 3551
624 Ga0157379_10073195 3300014968 Bacteria 3066
625 Ga0157379_10278286 3300014968 Unclassified 1523
626 Ga0157376_10003007 3300014969 Bacteria 11569
627 Ga0157376_10025775 3300014969 Bacteria 4635
628 Ga0157376_10039684 3300014969 Bacteria 3842
629 Ga0157376_10076929 3300014969 Bacteria 2853
630 Ga0157376_10119817 3300014969 Bacteria 2330
631 Ga0157376_10140091 3300014969 Bacteria 2169
632 Ga0157376_10198257 3300014969 Bacteria 1845
633 Ga0157376_10230271 3300014969 Unclassified 1721
634 Ga0157376_10341720 3300014969 Bacteria 1430
635 Ga0157376_10517553 3300014969 Bacteria 1175
636 Ga0157376_11043366 3300014969 Unclassified 841
637 Ga0182005_1008598 3300015265 Bacteria 3003
638 Ga0163161_10015702 3300017792 Bacteria 5281
639 Ga0163161_10042182 3300017792 Bacteria 3281
640 Ga0163161_10073086 3300017792 Unclassified 2512
641 Ga0163161_10107910 3300017792 Bacteria 2078
642 Ga0163161_10140947 3300017792 Bacteria 1826
643 Ga0163161_10868114 3300017792 Unclassified 762
644 Ga0206356_11720413 3300020070 Bacteria 1975
645 Ga0207666_1000261 3300025271 Bacteria 7724
646 Ga0207666_1041271 3300025271 Unclassified 722
647 Ga0207673_1000951 3300025290 Bacteria 3120
648 Ga0207673_1002395 3300025290 Bacteria 2136
649 Ga0207697_10003309 3300025315 Bacteria 8017
650 Ga0207697_10004477 3300025315 Bacteria 6669
651 Ga0207697_10007175 3300025315 Bacteria 4982
652 Ga0207697_10012709 3300025315 Bacteria 3526
653 Ga0207697_10013913 3300025315 Bacteria 3349
654 Ga0207697_10025802 3300025315 Bacteria 2403
655 Ga0207656_10007104 3300025321 Bacteria 4068
656 Ga0207656_10015301 3300025321 Bacteria 2967
657 Ga0207653_10121569 3300025885 Bacteria 940
658 Ga0207653_10145502 3300025885 Unclassified 869
659 Ga0207682_10000146 3300025893 Bacteria 31872
660 Ga0207682_10079736 3300025893 Unclassified 1401
661 Ga0207692_10062561 3300025898 Bacteria 1932
662 Ga0207692_10094161 3300025898 Bacteria 1631
663 Ga0207692_10140107 3300025898 Bacteria 1375
664 Ga0207692_10393356 3300025898 Bacteria 863
665 Ga0207688_10027364 3300025901 Bacteria 3137
666 Ga0207688_10056548 3300025901 Bacteria 2204
667 Ga0207688_10105407 3300025901 Unclassified 1632
668 Ga0207688_10130638 3300025901 Bacteria 1472
669 Ga0207688_10241235 3300025901 Bacteria 1093
670 Ga0207680_10001915 3300025903 Bacteria 9760
671 Ga0207680_10010912 3300025903 Bacteria 4567
672 Ga0207680_10015333 3300025903 Bacteria 3998
673 Ga0207680_10034549 3300025903 Bacteria 2894
674 Ga0207680_10047288 3300025903 Bacteria 2549
675 Ga0207680_10057513 3300025903 Unclassified 2353
676 Ga0207680_10277385 3300025903 Bacteria 1164
677 Ga0207680_10634288 3300025903 Unclassified 765
678 Ga0207647_10015769 3300025904 Bacteria 5172
679 Ga0207699_10019067 3300025906 Bacteria 3649
680 Ga0207699_10439333 3300025906 Bacteria 934
681 Ga0207645_10000519 3300025907 Bacteria 31964
682 Ga0207645_10008023 3300025907 Bacteria 7406
683 Ga0207645_10036131 3300025907 Bacteria 3172
684 Ga0207645_10052932 3300025907 Bacteria 2594
685 Ga0207645_10061657 3300025907 Bacteria 2396
686 Ga0207645_10083026 3300025907 Unclassified 2054
687 Ga0207645_10270838 3300025907 Bacteria 1126
688 Ga0207643_10027427 3300025908 Bacteria 3158
689 Ga0207643_10032649 3300025908 Bacteria 2908
690 Ga0207643_10114043 3300025908 Unclassified 1594
691 Ga0207643_10257111 3300025908 Bacteria 1077
692 Ga0207705_10052596 3300025909 Bacteria 2932
693 Ga0207705_10128757 3300025909 Bacteria 1882
694 Ga0207705_10348839 3300025909 Bacteria 1140
695 Ga0207684_10000028 3300025910 Bacteria 306450
696 Ga0207684_10003281 3300025910 Bacteria 15868
697 Ga0207684_10032606 3300025910 Unclassified 4428
698 Ga0207684_10051288 3300025910 Bacteria 3500
699 Ga0207684_10174093 3300025910 Bacteria 1855
700 Ga0207684_10284500 3300025910 Bacteria 1426
701 Ga0207684_10329193 3300025910 Bacteria 1316
702 Ga0207684_10649754 3300025910 Unclassified 899
703 Ga0207684_10667024 3300025910 Unclassified 885
704 Ga0207707_10005207 3300025912 Bacteria 11396
705 Ga0207707_10015254 3300025912 Bacteria 6691
706 Ga0207707_10015315 3300025912 Bacteria 6676
707 Ga0207707_10058830 3300025912 Bacteria 3344
708 Ga0207695_10116325 3300025913 Bacteria 2648
709 Ga0207693_10002925 3300025915 Bacteria 14779
710 Ga0207693_10022585 3300025915 Bacteria 4999
711 Ga0207693_10066800 3300025915 Bacteria 2815
712 Ga0207693_10096529 3300025915 Bacteria 2317
713 Ga0207693_10105081 3300025915 Bacteria 2214
714 Ga0207693_10111091 3300025915 Unclassified 2149
715 Ga0207693_10137672 3300025915 Bacteria 1920
716 Ga0207693_10151897 3300025915 Bacteria 1821
717 Ga0207693_10193311 3300025915 Bacteria 1601
718 Ga0207693_10923041 3300025915 Unclassified 669
719 Ga0207663_10093753 3300025916 Bacteria 1999
720 Ga0207663_10126778 3300025916 Bacteria 1757
721 Ga0207663_10269406 3300025916 Bacteria 1261
722 Ga0207663_10282004 3300025916 Bacteria 1234
723 Ga0207663_10303054 3300025916 Bacteria 1194
724 Ga0207663_10415773 3300025916 Bacteria 1031
725 Ga0207660_10012654 3300025917 Bacteria 5526
726 Ga0207660_10040236 3300025917 Bacteria 3272
727 Ga0207660_10185491 3300025917 Bacteria 1618
728 Ga0207660_10349121 3300025917 Bacteria 1185
729 Ga0207662_10050548 3300025918 Bacteria 2470
730 Ga0207662_10060963 3300025918 Bacteria 2264
731 Ga0207657_10000229 3300025919 Bacteria 58709
732 Ga0207657_10008077 3300025919 Bacteria 10730
733 Ga0207657_10024320 3300025919 Bacteria 5614
734 Ga0207657_10061470 3300025919 Bacteria 3220
735 Ga0207657_10118344 3300025919 Bacteria 2181
736 Ga0207657_10129942 3300025919 Unclassified 2065
737 Ga0207649_10002277 3300025920 Bacteria 10798
738 Ga0207649_10012421 3300025920 Bacteria 4725
739 Ga0207649_10019167 3300025920 Bacteria 3907
740 Ga0207649_10029744 3300025920 Bacteria 3228
741 Ga0207649_10055680 3300025920 Bacteria 2466
742 Ga0207649_10065890 3300025920 Bacteria 2294
743 Ga0207652_10003991 3300025921 Bacteria 12060
744 Ga0207652_10007247 3300025921 Bacteria 8934
745 Ga0207652_10064470 3300025921 Bacteria 3170
746 Ga0207652_10074201 3300025921 Bacteria 2961
747 Ga0207652_10168764 3300025921 Bacteria 1963
748 Ga0207646_10000734 3300025922 Bacteria 42601
749 Ga0207646_10002142 3300025922 Bacteria 23602
750 Ga0207646_10006254 3300025922 Bacteria 12357
751 Ga0207646_10006743 3300025922 Bacteria 11822
752 Ga0207646_10026769 3300025922 Bacteria 5261
753 Ga0207646_10102036 3300025922 Unclassified 2572
754 Ga0207646_10134306 3300025922 Bacteria 2228
755 Ga0207646_10134948 3300025922 Bacteria 2222
756 Ga0207646_10167702 3300025922 Bacteria 1982
757 Ga0207646_10325683 3300025922 Unclassified 1388
758 Ga0207646_10329032 3300025922 Bacteria 1380
759 Ga0207646_10565005 3300025922 Bacteria 1022
760 Ga0207646_10631358 3300025922 Unclassified 960
761 Ga0207646_10738601 3300025922 Unclassified 879
762 Ga0207681_10002527 3300025923 Bacteria 11626
763 Ga0207681_10024176 3300025923 Bacteria 3897
764 Ga0207681_10046095 3300025923 Bacteria 2931
765 Ga0207681_10063647 3300025923 Bacteria 2544
766 Ga0207681_10112293 3300025923 Bacteria 1984
767 Ga0207681_10142153 3300025923 Bacteria 1789
768 Ga0207694_10299767 3300025924 Bacteria 1323
769 Ga0207694_10607278 3300025924 Unclassified 920
770 Ga0207650_10002534 3300025925 Bacteria 12678
771 Ga0207650_10016498 3300025925 Bacteria 5164
772 Ga0207650_10035787 3300025925 Bacteria 3608
773 Ga0207650_10067227 3300025925 Bacteria 2689
774 Ga0207650_10088138 3300025925 Bacteria 2366
775 Ga0207650_10093562 3300025925 Bacteria 2301
776 Ga0207650_10102856 3300025925 Bacteria 2202
777 Ga0207650_10113894 3300025925 Unclassified 2097
778 Ga0207650_10301029 3300025925 Bacteria 1310
779 Ga0207650_10365468 3300025925 Bacteria 1189
780 Ga0207650_10498298 3300025925 Bacteria 1018
781 Ga0207659_10002707 3300025926 Bacteria 10560
782 Ga0207659_10004071 3300025926 Bacteria 8822
783 Ga0207659_10004632 3300025926 Bacteria 8325
784 Ga0207659_10007428 3300025926 Bacteria 6736
785 Ga0207659_10021504 3300025926 Bacteria 4283
786 Ga0207659_10073946 3300025926 Bacteria 2497
787 Ga0207659_10080899 3300025926 Bacteria 2401
788 Ga0207659_10107969 3300025926 Bacteria 2110
789 Ga0207659_10221815 3300025926 Bacteria 1521
790 Ga0207659_10247305 3300025926 Unclassified 1445
791 Ga0207659_10300714 3300025926 Unclassified 1318
792 Ga0207659_10557799 3300025926 Unclassified 974
793 Ga0207659_10840634 3300025926 Bacteria 789
794 Ga0207687_10067295 3300025927 Unclassified 2548
795 Ga0207687_10111634 3300025927 Bacteria 2030
796 Ga0207687_10354175 3300025927 Unclassified 1197
797 Ga0207687_10413551 3300025927 Bacteria 1112
798 Ga0207687_10436830 3300025927 Bacteria 1083
799 Ga0207687_10514625 3300025927 Bacteria 1000
800 Ga0207700_10046468 3300025928 Bacteria 3211
801 Ga0207700_10064817 3300025928 Unclassified 2785
802 Ga0207700_10164458 3300025928 Bacteria 1845
803 Ga0207700_10694708 3300025928 Bacteria 908
804 Ga0207664_10003067 3300025929 Bacteria 11098
805 Ga0207664_10006738 3300025929 Bacteria 7934
806 Ga0207664_10068190 3300025929 Bacteria 2857
807 Ga0207664_10089089 3300025929 Unclassified 2526
808 Ga0207664_10184931 3300025929 Unclassified 1791
809 Ga0207664_10214414 3300025929 Bacteria 1667
810 Ga0207664_10273045 3300025929 Bacteria 1481
811 Ga0207664_10554166 3300025929 Unclassified 1031
812 Ga0207644_10000405 3300025931 Bacteria 28099
813 Ga0207644_10008476 3300025931 Bacteria 6730
814 Ga0207644_10012225 3300025931 Bacteria 5698
815 Ga0207644_10045397 3300025931 Bacteria 3126
816 Ga0207644_10091346 3300025931 Bacteria 2270
817 Ga0207644_10095598 3300025931 Bacteria 2222
818 Ga0207644_10112928 3300025931 Bacteria 2057
819 Ga0207644_10147015 3300025931 Unclassified 1820
820 Ga0207644_10169498 3300025931 Bacteria 1703
821 Ga0207644_10224422 3300025931 Unclassified 1491
822 Ga0207644_10328019 3300025931 Unclassified 1239
823 Ga0207644_10498472 3300025931 Bacteria 1004
824 Ga0207690_10000348 3300025932 Bacteria 30788
825 Ga0207690_10006051 3300025932 Bacteria 7165
826 Ga0207690_10021602 3300025932 Bacteria 3993
827 Ga0207690_10035029 3300025932 Bacteria 3238
828 Ga0207690_10171351 3300025932 Unclassified 1626
829 Ga0207690_10453579 3300025932 Bacteria 1031
830 Ga0207706_10000045 3300025933 Bacteria 120758
831 Ga0207706_10092757 3300025933 Bacteria 2655
832 Ga0207706_10186955 3300025933 Bacteria 1819
833 Ga0207706_10203631 3300025933 Bacteria 1735
834 Ga0207706_10214358 3300025933 Unclassified 1687
835 Ga0207706_10266083 3300025933 Unclassified 1496
836 Ga0207706_10671301 3300025933 Unclassified 887
837 Ga0207709_10024389 3300025935 Bacteria 3454
838 Ga0207709_10143527 3300025935 Bacteria 1644
839 Ga0207709_10215953 3300025935 Bacteria 1380
840 Ga0207670_10011155 3300025936 Bacteria 5205
841 Ga0207670_10017407 3300025936 Bacteria 4344
842 Ga0207670_10021344 3300025936 Bacteria 3993
843 Ga0207670_10032817 3300025936 Bacteria 3341
844 Ga0207670_10293109 3300025936 Bacteria 1271
845 Ga0207669_10010707 3300025937 Bacteria 4427
846 Ga0207669_10082682 3300025937 Unclassified 2062
847 Ga0207669_10124455 3300025937 Bacteria 1758
848 Ga0207669_10166393 3300025937 Bacteria 1564
849 Ga0207669_10330980 3300025937 Bacteria 1169
850 Ga0207704_10525997 3300025938 Bacteria 957
851 Ga0207704_11006500 3300025938 Unclassified 705
852 Ga0207665_10035723 3300025939 Bacteria 3301
853 Ga0207665_10069200 3300025939 Bacteria 2406
854 Ga0207665_10541113 3300025939 Unclassified 904
855 Ga0207665_10587753 3300025939 Unclassified 868
856 Ga0207691_10000310 3300025940 Bacteria 48478
857 Ga0207691_10000629 3300025940 Bacteria 34886
858 Ga0207691_10004119 3300025940 Bacteria 14122
859 Ga0207691_10025264 3300025940 Bacteria 5578
860 Ga0207691_10029499 3300025940 Bacteria 5131
861 Ga0207691_10050625 3300025940 Bacteria 3802
862 Ga0207691_10097269 3300025940 Bacteria 2631
863 Ga0207691_10174393 3300025940 Bacteria 1881
864 Ga0207691_10182382 3300025940 Bacteria 1834
865 Ga0207691_10220893 3300025940 Bacteria 1643
866 Ga0207691_10227923 3300025940 Bacteria 1614
867 Ga0207691_10258771 3300025940 Unclassified 1500
868 Ga0207711_10011574 3300025941 Bacteria 7334
869 Ga0207711_10019828 3300025941 Bacteria 5604
870 Ga0207711_10086395 3300025941 Bacteria 2750
871 Ga0207711_10126282 3300025941 Unclassified 2288
872 Ga0207711_10157887 3300025941 Bacteria 2051
873 Ga0207711_10171143 3300025941 Bacteria 1971
874 Ga0207711_10281258 3300025941 Bacteria 1532
875 Ga0207689_10013147 3300025942 Bacteria 7063
876 Ga0207689_10096085 3300025942 Bacteria 2434
877 Ga0207661_10009915 3300025944 Bacteria 6840
878 Ga0207661_10074070 3300025944 Bacteria 2790
879 Ga0207661_10141705 3300025944 Bacteria 2069
880 Ga0207661_10163180 3300025944 Bacteria 1934
881 Ga0207661_11025791 3300025944 Unclassified 760
882 Ga0207661_11113666 3300025944 Unclassified 727
883 Ga0207679_10003526 3300025945 Bacteria 9684
884 Ga0207679_10011829 3300025945 Bacteria 5671
885 Ga0207679_10059635 3300025945 Bacteria 2832
886 Ga0207679_10126044 3300025945 Bacteria 2046
887 Ga0207679_10164325 3300025945 Unclassified 1821
888 Ga0207679_10206445 3300025945 Bacteria 1645
889 Ga0207679_10496401 3300025945 Unclassified 1088
890 Ga0207679_10613889 3300025945 Bacteria 981
891 Ga0207667_10002826 3300025949 Bacteria 21544
892 Ga0207667_10003469 3300025949 Bacteria 19459
893 Ga0207667_10171767 3300025949 Unclassified 2228
894 Ga0207667_10214858 3300025949 Unclassified 1971
895 Ga0207667_10738763 3300025949 Bacteria 984
896 Ga0207667_10856780 3300025949 Unclassified 903
897 Ga0207667_11143784 3300025949 Bacteria 760
898 Ga0207651_10025782 3300025960 Bacteria 3660
899 Ga0207651_10059712 3300025960 Unclassified 2643
900 Ga0207651_10165509 3300025960 Bacteria 1738
901 Ga0207651_10171949 3300025960 Unclassified 1709
902 Ga0207651_10212322 3300025960 Bacteria 1559
903 Ga0207651_10228386 3300025960 Unclassified 1509
904 Ga0207651_10414992 3300025960 Bacteria 1148
905 Ga0207651_10459188 3300025960 Bacteria 1094
906 Ga0207651_10553609 3300025960 Bacteria 1000
907 Ga0207712_10302566 3300025961 Bacteria 1313
908 Ga0207712_10903992 3300025961 Unclassified 780
909 Ga0207712_11070034 3300025961 Bacteria 717
910 Ga0207712_11165510 3300025961 Unclassified 687
911 Ga0207668_10003264 3300025972 Bacteria 9507
912 Ga0207668_10005981 3300025972 Bacteria 7173
913 Ga0207668_10018149 3300025972 Bacteria 4420
914 Ga0207668_10029476 3300025972 Bacteria 3597
915 Ga0207668_10128930 3300025972 Bacteria 1928
916 Ga0207668_10146554 3300025972 Unclassified 1822
917 Ga0207668_10167562 3300025972 Unclassified 1719
918 Ga0207668_10313168 3300025972 Bacteria 1300
919 Ga0207668_11005799 3300025972 Unclassified 745
920 Ga0207640_10109298 3300025981 Bacteria 1956
921 Ga0207640_10244709 3300025981 Bacteria 1388
922 Ga0207640_10306082 3300025981 Bacteria 1259
923 Ga0207640_10644912 3300025981 Bacteria 902
924 Ga0207640_11185715 3300025981 Bacteria 678
925 Ga0207658_10008951 3300025986 Bacteria 6790
926 Ga0207658_10076428 3300025986 Bacteria 2551
927 Ga0207658_10112751 3300025986 Unclassified 2153
928 Ga0207658_10129696 3300025986 Bacteria 2024
929 Ga0207658_10443746 3300025986 Unclassified 1148
930 Ga0207658_10884370 3300025986 Unclassified 813
931 Ga0207677_10011855 3300026023 Bacteria 4988
932 Ga0207677_10089514 3300026023 Bacteria 2234
933 Ga0207677_10098606 3300026023 Bacteria 2144
934 Ga0207677_10146418 3300026023 Bacteria 1816
935 Ga0207677_10187502 3300026023 Bacteria 1633
936 Ga0207677_10252945 3300026023 Unclassified 1432
937 Ga0207677_10379498 3300026023 Unclassified 1193
938 Ga0207677_10738246 3300026023 Bacteria 876
939 Ga0207677_10863564 3300026023 Bacteria 814
940 Ga0207703_10005921 3300026035 Bacteria 9800
941 Ga0207703_10007291 3300026035 Bacteria 8791
942 Ga0207703_10059886 3300026035 Bacteria 3111
943 Ga0207703_10119091 3300026035 Bacteria 2264
944 Ga0207703_10198221 3300026035 Bacteria 1783
945 Ga0207703_10282430 3300026035 Unclassified 1508
946 Ga0207639_10008842 3300026041 Bacteria 6925
947 Ga0207639_10030631 3300026041 Bacteria 3947
948 Ga0207639_10353982 3300026041 Bacteria 1312
949 Ga0207639_10401021 3300026041 Bacteria 1235
950 Ga0207678_10004526 3300026067 Bacteria 12499
951 Ga0207678_10010760 3300026067 Bacteria 8038
952 Ga0207678_10014233 3300026067 Bacteria 6993
953 Ga0207678_10154353 3300026067 Unclassified 1960
954 Ga0207678_10187032 3300026067 Unclassified 1769
955 Ga0207678_10483728 3300026067 Unclassified 1078
956 Ga0207708_10008199 3300026075 Bacteria 7740
957 Ga0207708_10473231 3300026075 Unclassified 1047
958 Ga0207708_10578467 3300026075 Bacteria 949
959 Ga0207708_10767764 3300026075 Bacteria 828
960 Ga0207702_10000715 3300026078 Bacteria 35679
961 Ga0207702_10017719 3300026078 Bacteria 5895
962 Ga0207702_10027561 3300026078 Bacteria 4718
963 Ga0207702_10056652 3300026078 Bacteria 3328
964 Ga0207641_10001932 3300026088 Bacteria 19887
965 Ga0207641_10002486 3300026088 Bacteria 17012
966 Ga0207641_10048312 3300026088 Bacteria 3591
967 Ga0207641_10068310 3300026088 Bacteria 3047
968 Ga0207641_10696297 3300026088 Unclassified 1000
969 Ga0207648_10000364 3300026089 Bacteria 49697
970 Ga0207648_10002046 3300026089 Bacteria 21988
971 Ga0207648_10003344 3300026089 Bacteria 16855
972 Ga0207648_10014214 3300026089 Bacteria 7363
973 Ga0207648_10035274 3300026089 Bacteria 4407
974 Ga0207648_10114825 3300026089 Bacteria 2366
975 Ga0207648_10173623 3300026089 Unclassified 1906
976 Ga0207648_10907644 3300026089 Bacteria 823
977 Ga0207676_10000633 3300026095 Bacteria 28376
978 Ga0207676_10003751 3300026095 Bacteria 10735
979 Ga0207676_10014659 3300026095 Bacteria 5645
980 Ga0207676_10126705 3300026095 Unclassified 2164
981 Ga0207676_10151572 3300026095 Unclassified 1997
982 Ga0207674_10000225 3300026116 Bacteria 70648
983 Ga0207674_10030050 3300026116 Bacteria 5716
984 Ga0207674_10108322 3300026116 Bacteria 2755
985 Ga0207674_10281679 3300026116 Bacteria 1610
986 Ga0207675_100000658 3300026118 Bacteria 33969
987 Ga0207675_100048450 3300026118 Bacteria 3966
988 Ga0207675_100054380 3300026118 Bacteria 3734
989 Ga0207675_100133367 3300026118 Bacteria 2355
990 Ga0207675_100211783 3300026118 Unclassified 1864
991 Ga0207675_100243445 3300026118 Bacteria 1738
992 Ga0207675_101089251 3300026118 Unclassified 819
993 Ga0207683_10000076 3300026121 Bacteria 77762
994 Ga0207683_10000121 3300026121 Bacteria 64376
995 Ga0207683_10005699 3300026121 Bacteria 10686
996 Ga0207683_10013281 3300026121 Bacteria 7022
997 Ga0207683_10083217 3300026121 Bacteria 2844
998 Ga0207683_10225139 3300026121 Bacteria 1710
999 Ga0207683_10311584 3300026121 Bacteria 1441
1000 Ga0207698_10007229 3300026142 Bacteria 6957
1001 Ga0207698_10007522 3300026142 Bacteria 6827
1002 Ga0207698_10015072 3300026142 Bacteria 5165
1003 Ga0207698_10083517 3300026142 Bacteria 2585
1004 Ga0207698_10161096 3300026142 Bacteria 1962
1005 Ga0207698_10366647 3300026142 Unclassified 1366
1006 Ga0207698_10400033 3300026142 Unclassified 1312
1007 Ga0207698_10426621 3300026142 Bacteria 1274
1008 Ga0209995_1007841 3300027471 Bacteria 1722
1009 Ga0209968_1022046 3300027526 Bacteria 1037
1010 Ga0209982_1041769 3300027552 Bacteria 732
1011 Ga0210002_1007025 3300027617 Bacteria 1703
1012 Ga0210002_1026552 3300027617 Bacteria 950
1013 Ga0209983_1003112 3300027665 Bacteria 3564
1014 Ga0209971_1001091 3300027682 Bacteria 6889
1015 Ga0209974_10000048 3300027876 Bacteria 30134
1016 Ga0209974_10049320 3300027876 Bacteria 1412
1017 Ga0207428_10354896 3300027907 Bacteria 1078
1018 Ga0268266_10028455 3300028379 Bacteria 4750
1019 Ga0268266_10046833 3300028379 Bacteria 3702
1020 Ga0268266_10066893 3300028379 Bacteria 3109
1021 Ga0268266_10101921 3300028379 Bacteria 2531
1022 Ga0268266_10181768 3300028379 Bacteria 1915
1023 Ga0268266_10324459 3300028379 Unclassified 1442
1024 Ga0268266_10494484 3300028379 Bacteria 1167
1025 Ga0268266_10725778 3300028379 Bacteria 958
1026 Ga0268266_10781206 3300028379 Unclassified 922
1027 Ga0268265_10049098 3300028380 Unclassified 3172
1028 Ga0268265_10104731 3300028380 Bacteria 2294
1029 Ga0268265_10174509 3300028380 Bacteria 1841
1030 Ga0268265_10361016 3300028380 Bacteria 1330
1031 Ga0268265_10599475 3300028380 Bacteria 1053
1032 Ga0268264_10007545 3300028381 Bacteria 9076
1033 Ga0268264_10010492 3300028381 Bacteria 7658
1034 Ga0268264_10024971 3300028381 Bacteria 4884
1035 Ga0268264_10067969 3300028381 Bacteria 3009
1036 Ga0268264_10084520 3300028381 Bacteria 2721
1037 Ga0268264_10280500 3300028381 Unclassified 1560
1038 Ga0268264_10328401 3300028381 Bacteria 1449
1039 Ga0268264_10330570 3300028381 Bacteria 1444
1040 Ga0268264_10640838 3300028381 Bacteria 1051
1041 Ga0307513_10045324 3300031456 Bacteria 4807
1042 Ga0307408_100557049 3300031548 Bacteria 1012
1043 Ga0307408_100827325 3300031548 Bacteria 842
1044 Ga0307405_10369740 3300031731 Bacteria 1112
1045 Ga0307405_10514766 3300031731 Bacteria 962
1046 Ga0307405_10572863 3300031731 Bacteria 917
1047 Ga0307413_10080155 3300031824 Unclassified 2089
1048 Ga0307410_10098627 3300031852 Bacteria 2090
1049 Ga0307410_10178627 3300031852 Unclassified 1605
1050 Ga0307410_10449410 3300031852 Bacteria 1051
1051 Ga0307406_10072396 3300031901 Unclassified 2262
1052 Ga0307407_10001541 3300031903 Bacteria 8458
1053 Ga0307407_10600723 3300031903 Bacteria 819
1054 Ga0307412_10048394 3300031911 Bacteria 2796
1055 Ga0307409_100005712 3300031995 Bacteria 7211
1056 Ga0307409_100009446 3300031995 Bacteria 5992
1057 Ga0307409_100024574 3300031995 Bacteria 4205
1058 Ga0307409_101149512 3300031995 Bacteria 799
1059 Ga0307416_100005475 3300032002 Bacteria 7798
1060 Ga0307416_100385011 3300032002 Bacteria 1434
1061 Ga0307416_100503129 3300032002 Unclassified 1276
1062 Ga0307414_10021464 3300032004 Bacteria 4053
1063 Ga0307414_10365959 3300032004 Unclassified 1242
1064 Ga0307411_10027198 3300032005 Bacteria 3456
1065 Ga0307411_10043391 3300032005 Bacteria 2877
1066 Ga0307415_100019074 3300032126 Bacteria 4157
1067 Ga0307415_100267275 3300032126 Bacteria 1399
1068 Ga0373959_0091406 3300034820 Unclassified 714
1069 Ga0373929_0090138 3300035085 Unclassified 760
1070 Ga0373934_0055451 3300035086 Unclassified 1575
1071 Ga0373944_0051313 3300035089 Bacteria 1301
1072 Ga0373949_0043851 3300035090 Bacteria 1108
1073 Ga0373951_0055773 3300035091 Unclassified 981
1074 Ga0373923_0221649 3300035111 Bacteria 879
1075 Ga0373945_0035016 3300035116 Bacteria 1793
1076 Ga0373953_0018370 3300035117 Unclassified 2586
1077 Ga0373953_0127717 3300035117 Bacteria 1083
1078 Ga0373954_0134456 3300035118 Unclassified 1205
1079 Ga0373954_0383179 3300035118 Bacteria 695
1080 Ga0373957_0056436 3300035120 Unclassified 1512
1081 Ga0373957_0140634 3300035120 Bacteria 987
1082 Ga0373943_0013149 3300035170 Bacteria 3735
1083 Ga0373943_0042386 3300035170 Unclassified 2206
1084 Ga0373943_0108319 3300035170 Unclassified 1462
1085 Ga0373943_0164482 3300035170 Bacteria 1210
1086 Ga0373943_0187626 3300035170 Unclassified 1139
1087 Ga0373943_0295284 3300035170 Bacteria 919
1088 Ga0373943_0296106 3300035170 Unclassified 918
1089 Ga0373946_0053581 3300035171 Bacteria 1695
1090 Ga0373955_0031790 3300035172 Unclassified 2766
1091 Ga0373955_0123356 3300035172 Unclassified 1507
1092 Ga0373955_0207398 3300035172 Bacteria 1168
1093 Ga0373955_0431393 3300035172 Bacteria 802
1094 Ga0373942_0174660 3300035207 Unclassified 701
1095 Ga0373942_0233011 3300035207 Unclassified 621
1096 Ga0373961_0055934 3300035241 Unclassified 1184
1097 Ga0373961_0141227 3300035241 Unclassified 814
1098 Ga0373961_0231975 3300035241 Bacteria 662
1099 Ga0373924_0168041 3300035410 Bacteria 963
1100 Ga0373924_0193320 3300035410 Unclassified 897
1101 Ga0373924_0272505 3300035410 Unclassified 750
1102 Ga0373931_0065836 3300035691 Bacteria 1965
1103 Ga0373931_0093401 3300035691 Bacteria 1680
1104 Ga0373931_0162623 3300035691 Bacteria 1310
1105 Ga0373931_0285613 3300035691 Unclassified 1014
1106 Ga0373931_0532831 3300035691 Unclassified 761
1107 Ga0373935_0048456 3300035692 Bacteria 2690
1108 Ga0373935_0049597 3300035692 Bacteria 2661
1109 Ga0373935_0128571 3300035692 Unclassified 1700
1110 Ga0373935_0353488 3300035692 Unclassified 1048
1111 Ga0373935_0554699 3300035692 Unclassified 838
1112 Ga0373927_0086834 3300035695 Bacteria 2031
1113 Ga0373927_0157181 3300035695 Bacteria 1489
1114 Ga0373927_0160628 3300035695 Unclassified 1472
1115 Ga0373933_0078009 3300035724 Bacteria 2026
1116 Ga0373933_0434664 3300035724 Unclassified 858
1117 Ga0373933_0751308 3300035724 Unclassified 642
1118 Ga0373947_0153234 3300035725 Unclassified 1486
1119 Ga0373947_0156153 3300035725 Unclassified 1473
1120 Ga0373937_0004100 3300036401 Bacteria 12359
1121 Ga0373937_0020917 3300036401 Bacteria 5869
1122 Ga0373937_0084311 3300036401 Bacteria 2940
1123 Ga0373937_0086762 3300036401 Bacteria 2896
1124 Ga0373937_0454968 3300036401 Unclassified 1216
1125 Ga0373937_0719962 3300036401 Bacteria 945
1126 Ga0373925_0014302 3300037068 Bacteria 5741
1127 Ga0373925_0051602 3300037068 Bacteria 3071
1128 Ga0373925_0175884 3300037068 Bacteria 1692
1129 Ga0373925_0212371 3300037068 Bacteria 1542
1130 Ga0373925_0656339 3300037068 Unclassified 864
1131 Ga0395900_0002016 3300037418 Bacteria 22869
1132 Ga0395900_0035910 3300037418 Bacteria 5107
1133 Ga0395900_0203491 3300037418 Unclassified 2002
1134 Ga0395900_0217548 3300037418 Bacteria 1927
1135 Ga0395900_0767025 3300037418 Unclassified 894
1136 Ga0395898_0012264 3300037466 Bacteria 8863
1137 Ga0395898_0118427 3300037466 Bacteria 2537
1138 Ga0395898_0293100 3300037466 Bacteria 1552
1139 Ga0395905_0034576 3300037471 Bacteria 4746
1140 Ga0395905_0158105 3300037471 Bacteria 2131
1141 Ga0395905_0517289 3300037471 Bacteria 1094
1142 Ga0395901_0034534 3300038443 Bacteria 5222
1143 Ga0395901_0056833 3300038443 Bacteria 4071
1144 Ga0395901_0367164 3300038443 Unclassified 1483
1145 Ga0395901_1110382 3300038443 Unclassified 761
1146 Ga0436363_0788885 3300039450 Unclassified 1095
1147 Ga0436362_0735304 3300039453 Unclassified 1533
1148 Ga0451791_0486903 3300041451 Unclassified 907
1149 Ga0451807_0453940 3300041486 Unclassified 1519
1150 Ga0451807_0845975 3300041486 Bacteria 2570
1151 Ga0451807_1843067 3300041486 Unclassified 1225
1152 Ga0451807_2078124 3300041486 Unclassified 631
1153 Ga0451835_0936074 3300041492 Unclassified 1086
1154 Ga0451839_0036848 3300041496 Bacteria 825
1155 Ga0439448_0090790 3300042005 Unclassified 1032
1156 Ga0439451_003915 3300042009 Bacteria 3028
1157 Ga0439454_004180 3300042011 Bacteria 1648
1158 Ga0439454_038878 3300042011 Unclassified 772
1159 Ga0439455_0017390 3300042012 Unclassified 1675
1160 Ga0439434_0225377 3300042435 Bacteria 637
1161 Ga0439435_0107671 3300042436 Bacteria 862
1162 Ga0439459_0056536 3300042438 Unclassified 876
1163 Ga0451577_0672392 3300042876 Unclassified 938
1164 Ga0466965_0363010 3300044683 Unclassified 795
1165 Ga0466964_0063166 3300044706 Unclassified 1546
1166 Ga0451576_0000443 3300045051 Bacteria 94447
1167 Ga0451576_0005126 3300045051 Bacteria 16602
1168 Ga0451576_0062976 3300045051 Bacteria 3866
1169 Ga0466967_0580341 3300045976 Bacteria 1105
1170 Ga0495592_0077861 3300046454 Bacteria 2402
1171 Ga0495603_0499316 3300046455 Bacteria 697
1172 Ga0495603_0542386 3300046455 Unclassified 666
1173 Ga0495651_0002069 3300046462 Bacteria 15476
1174 Ga0495651_0119451 3300046462 Bacteria 1939
1175 Ga0495651_0167256 3300046462 Unclassified 1569
1176 Ga0495651_0489282 3300046462 Unclassified 789
1177 Ga0495653_0131853 3300046463 Unclassified 1768
1178 Ga0495653_0379707 3300046463 Bacteria 903
1179 Ga0495580_0288511 3300046472 Bacteria 1119
1180 Ga0495605_0252741 3300046474 Unclassified 754
1181 Ga0495662_0133205 3300046476 Bacteria 1222
1182 Ga0495662_0315612 3300046476 Unclassified 769
1183 Ga0495585_0261865 3300046492 Unclassified 860
1184 Ga0495608_0059603 3300046511 Bacteria 2514
1185 Ga0495608_0104512 3300046511 Unclassified 1824
1186 Ga0495608_0135699 3300046511 Unclassified 1573
1187 Ga0495608_0419992 3300046511 Unclassified 816
1188 Ga0495618_0106238 3300046514 Bacteria 1797
1189 Ga0495628_0161951 3300046516 Unclassified 1700
1190 Ga0495628_0398602 3300046516 Bacteria 1005
1191 Ga0495630_0017716 3300046517 Bacteria 5222
1192 Ga0495630_0122358 3300046517 Bacteria 1974
1193 Ga0495630_0659161 3300046517 Unclassified 801
1194 Ga0495652_0002382 3300046529 Bacteria 19460
1195 Ga0495652_0018444 3300046529 Bacteria 6220
1196 Ga0495652_0097537 3300046529 Bacteria 2391
1197 Ga0495665_0080554 3300046531 Bacteria 1713
1198 Ga0495587_0099795 3300046536 Bacteria 1673
1199 Ga0495598_0065706 3300046537 Bacteria 1130
1200 Ga0495621_0067420 3300046539 Bacteria 1311
1201 Ga0495645_0001349 3300046543 Bacteria 16596
1202 Ga0495645_0076108 3300046543 Bacteria 2415
1203 Ga0495645_0098755 3300046543 Bacteria 2078
1204 Ga0495645_0223375 3300046543 Bacteria 1266
1205 Ga0495667_0015938 3300046559 Bacteria 5080
1206 Ga0495667_0035700 3300046559 Unclassified 3321
1207 Ga0495667_0467394 3300046559 Bacteria 792
1208 Ga0495656_0354571 3300046615 Unclassified 761
1209 Ga0495635_0703429 3300046663 Unclassified 655
1210 Ga0495635_0727494 3300046663 Bacteria 642
1211 Ga0495659_0105214 3300046664 Unclassified 1097
1212 Ga0495659_0201372 3300046664 Unclassified 817
1213 Ga0495657_0024000 3300046675 Unclassified 4350
1214 Ga0495599_0083130 3300046678 Unclassified 2000
1215 Ga0495599_0169053 3300046678 Bacteria 1349
1216 Ga0495599_0609517 3300046678 Bacteria 635
1217 Ga0495623_0018902 3300046679 Bacteria 4449
1218 Ga0495623_0065191 3300046679 Bacteria 2278
1219 Ga0495646_0022094 3300046680 Bacteria 4015
1220 Ga0495658_0066607 3300046683 Bacteria 2081
1221 Ga0495658_0183254 3300046683 Unclassified 1300
1222 Ga0495669_0168597 3300046684 Bacteria 1041
1223 Ga0495669_0237917 3300046684 Unclassified 874
1224 Ga0495600_0052803 3300046809 Unclassified 2654
1225 Ga0495600_0112176 3300046809 Bacteria 1776
1226 Ga0495604_0480204 3300047317 Bacteria 808
1227 Ga0495674_0201867 3300047319 Bacteria 1649
1228 Ga0495676_0184902 3300047321 Bacteria 1458
1229 Ga0495680_0218080 3300047322 Bacteria 1363
1230 Ga0495680_0572295 3300047322 Bacteria 759
1231 Ga0495680_0776973 3300047322 Bacteria 627
1232 Ga0495675_0020921 3300047444 Unclassified 4164
1233 Ga0495675_0106698 3300047444 Bacteria 1750
1234 Ga0495684_0018401 3300047471 Bacteria 5382
1235 Ga0495684_0244313 3300047471 Unclassified 1308
1236 Ga0495593_0099700 3300047673 Bacteria 1491
1237 Ga0495602_0092945 3300048088 Bacteria 2497
1238 Ga0495602_0485795 3300048088 Unclassified 866
1239 Ga0496100_0029379 3300048903 Unclassified 3400
1240 Ga0496100_0363946 3300048903 Bacteria 1095
1241 Ga0496100_0367823 3300048903 Bacteria 1089
1242 Ga0496100_0603440 3300048903 Unclassified 852
1243 Ga0496101_0030711 3300048904 Bacteria 3771
1244 Ga0496101_0057350 3300048904 Bacteria 2817
1245 Ga0496101_0191061 3300048904 Unclassified 1580
1246 Ga0496101_0255690 3300048904 Unclassified 1365
1247 Ga0496101_0390007 3300048904 Bacteria 1096
1248 Ga0496102_0060713 3300048905 Unclassified 3458
1249 Ga0496102_0098397 3300048905 Bacteria 2714
1250 Ga0496102_0248196 3300048905 Bacteria 1678
1251 Ga0496102_0557253 3300048905 Unclassified 1069
1252 Ga0496102_1183070 3300048905 Bacteria 684
1253 Ga0496103_0048618 3300048906 Bacteria 2621
1254 Ga0496103_0074371 3300048906 Bacteria 2130
1255 Ga0496103_0099912 3300048906 Bacteria 1836
1256 Ga0496104_0242492 3300048907 Bacteria 1715
1257 Ga0496104_0267729 3300048907 Unclassified 1621
1258 Ga0496104_0292550 3300048907 Unclassified 1541
1259 Ga0496104_0369501 3300048907 Unclassified 1347
1260 Ga0496104_0406503 3300048907 Unclassified 1274
1261 Ga0496105_0015917 3300048908 Bacteria 5999
1262 Ga0496105_0171980 3300048908 Unclassified 1776
1263 Ga0496106_0000931 3300048909 Bacteria 21318
1264 Ga0496106_0089107 3300048909 Bacteria 2379
1265 Ga0496106_0302521 3300048909 Unclassified 1283
1266 Ga0496106_0441091 3300048909 Bacteria 1046
1267 Ga0496107_0004980 3300048910 Bacteria 9042
1268 Ga0496107_0114221 3300048910 Unclassified 1987
1269 Ga0496108_0228481 3300048911 Unclassified 1618
1270 Ga0496108_0275170 3300048911 Unclassified 1466
1271 Ga0496108_0358646 3300048911 Bacteria 1272
1272 Ga0496108_0529651 3300048911 Bacteria 1028
1273 Ga0496108_0702327 3300048911 Unclassified 877
1274 Ga0496109_0003295 3300048912 Bacteria 13486
1275 Ga0496109_0267962 3300048912 Unclassified 1609
1276 Ga0496109_0628543 3300048912 Unclassified 1010
1277 Ga0496109_0727887 3300048912 Bacteria 930
1278 Ga0496110_0005169 3300048913 Bacteria 10205
1279 Ga0496110_0186176 3300048913 Bacteria 1885
1280 Ga0496110_0730324 3300048913 Bacteria 893
1281 Ga0496110_0748007 3300048913 Bacteria 881
1282 Ga0496110_0983568 3300048913 Bacteria 751
1283 Ga0496111_0071833 3300048914 Bacteria 2519
1284 Ga0496111_0294540 3300048914 Unclassified 1203
1285 Ga0496112_0012037 3300048915 Bacteria 7937
1286 Ga0496112_0697637 3300048915 Unclassified 943
1287 Ga0496112_0927724 3300048915 Bacteria 792
1288 Ga0496113_0514411 3300048916 Unclassified 961
1289 Ga0496114_0006008 3300048917 Bacteria 9553
1290 Ga0496114_0386386 3300048917 Unclassified 1239
1291 Ga0496115_0002245 3300048918 Bacteria 13825
1292 Ga0496115_0011572 3300048918 Bacteria 6615
1293 Ga0496115_0041385 3300048918 Bacteria 3667
1294 Ga0496115_0361349 3300048918 Bacteria 1183
1295 Ga0496115_0364171 3300048918 Bacteria 1178
1296 Ga0496115_0779278 3300048918 Unclassified 746
1297 Ga0501040_0268614 3300049576 Unclassified 1218
1298 Ga0501067_0130946 3300049583 Unclassified 1396
1299 Ga0501072_0837507 3300049588 Bacteria 719
1300 Ga0501075_0244207 3300049591 Bacteria 1369
1301 Ga0501243_001814 3300049675 Bacteria 3092
1302 Ga0501081_0166412 3300049743 Bacteria 1591
1303 Ga0501045_0359695 3300049824 Bacteria 1083
1304 nmdc:mga05p37_230926_c1 3300050507 Bacteria 2229
1305 nmdc:mga05p37_508068_c1 3300050507 Unclassified 1381
1306 nmdc:mga05p37_624008_c1 3300050507 Unclassified 1212
1307 nmdc:mga05p37_626317_c1 3300050507 Unclassified 1210
1308 nmdc:mga08y16_1060237_c1 3300050511 Unclassified 787
1309 nmdc:mga08y16_123955_c1 3300050511 Unclassified 2688
1310 nmdc:mga08y16_140210_c1 3300050511 Bacteria 2513
1311 nmdc:mga08y16_250812_c1 3300050511 Bacteria 1829
1312 nmdc:mga08y16_4473_c1 3300050511 Bacteria 14606
1313 nmdc:mga0n895_1016870_c1 3300050512 Bacteria 809
1314 nmdc:mga0n895_120848_c1 3300050512 Bacteria 2640
1315 nmdc:mga0n895_264144_c1 3300050512 Bacteria 1746
1316 nmdc:mga0n895_325208_c1 3300050512 Bacteria 1558
1317 nmdc:mga0n895_383427_c1 3300050512 Bacteria 1422
1318 nmdc:mga0n895_979579_c1 3300050512 Unclassified 828
1319 nmdc:mga08x19_258084_c1 3300050514 Bacteria 1204
1320 nmdc:mga08x19_398716_c1 3300050514 Bacteria 965
1321 nmdc:mga08x19_528808_c1 3300050514 Bacteria 834
1322 nmdc:mga0a205_738712_c1 3300050515 Bacteria 833
1323 nmdc:mga0a205_75661_c1 3300050515 Bacteria 3253
1324 Ga0495601_0031806 3300053077 Bacteria 3281
1325 Ga0495601_0122844 3300053077 Bacteria 1687
1326 Ga0495595_0112475 3300053084 Bacteria 1321
1327 Ga0495595_0139857 3300053084 Bacteria 1187
1328 Ga0495619_0055978 3300053085 Bacteria 2614
1329 Ga0495619_0429277 3300053085 Bacteria 911
1330 Ga0495619_0528656 3300053085 Bacteria 810
1331 Ga0157378_10014139
1332 SwRhRL2b_contig_1634644
1333 SwRhRL2b_contig_387844
1334 JGI24035J26624_1001983
1335 rootL2_10328949
1336 JGI25405J52794_10000323
1337 JGI25405J52794_10001843
1338 JGI25405J52794_10001884
1339 Ga0065704_10004765
1340 Ga0065704_10234770
1341 Ga0065712_10006901
1342 Ga0065712_10009838
1343 Ga0065715_10008051
1344 Ga0065715_10013045
1345 Ga0065715_10048647
1346 Ga0065715_10109052
1347 Ga0065715_10240229
1348 Ga0065715_10282308
1349 Ga0065715_10336623
1350 Ga0065715_10425309
1351 Ga0065707_10219050
1352 Ga0070658_10009067
1353 Ga0070676_10001268
1354 Ga0070676_10045600
1355 Ga0070676_10057250
1356 Ga0070676_10083387
1357 Ga0070683_100004758
1358 Ga0070683_100017515
1359 Ga0070683_100041501
1360 Ga0070683_100253871
1361 Ga0070683_100400758
1362 Ga0070690_100019100
1363 Ga0070690_100019262
1364 Ga0070690_100168997
1365 Ga0070670_100031216
1366 Ga0070670_100153032
1367 Ga0070670_100232408
1368 Ga0070670_100252135
1369 Ga0070677_10000242
1370 Ga0070677_10064647
1371 Ga0070677_10121982
1372 Ga0068869_100086683
1373 Ga0068869_100087886
1374 Ga0070666_10001424
1375 Ga0070666_10013532
1376 Ga0070666_10035493
1377 Ga0070666_10064321
1378 Ga0070666_10138075
1379 Ga0070666_10196339
1380 Ga0070666_10204638
1381 Ga0070680_100016424
1382 Ga0070680_100150489
1383 Ga0070680_100304887
1384 Ga0070682_100064400
1385 Ga0070682_100123707
1386 Ga0068868_100002750
1387 Ga0068868_100006774
1388 Ga0068868_100010675
1389 Ga0068868_100192419
1390 Ga0068868_100200598
1391 Ga0068868_100328946
1392 Ga0068868_100374611
1393 Ga0068868_100412726
1394 Ga0068868_100439175
1395 Ga0070660_100000551
1396 Ga0070660_100118693
1397 Ga0070660_100130753
1398 Ga0070660_100291947
1399 Ga0070660_100507930
1400 Ga0070689_100013944
1401 Ga0070689_100017987
1402 Ga0070689_100160610
1403 Ga0070689_100328318
1404 Ga0070689_100421195
1405 Ga0070687_100024597
1406 Ga0070687_100034776
1407 Ga0070661_100007142
1408 Ga0070661_100033026
1409 Ga0070661_100033465
1410 Ga0070661_100041563
1411 Ga0070661_100118517
1412 Ga0070692_10223773
1413 Ga0070668_100001406
1414 Ga0070668_100003165
1415 Ga0070668_100045194
1416 Ga0070668_100219615
1417 Ga0070668_100607428
1418 Ga0070668_101028943
1419 Ga0070668_101652075
1420 Ga0070669_100002287
1421 Ga0070669_100104050
1422 Ga0070669_100161040
1423 Ga0070669_100187338
1424 Ga0070669_100220747
1425 Ga0070669_100264653
1426 Ga0070669_100377487
1427 Ga0070669_100822886
1428 Ga0070675_100002082
1429 Ga0070675_100022317
1430 Ga0070675_100030145
1431 Ga0070675_100049890
1432 Ga0070675_100063086
1433 Ga0070675_100067503
1434 Ga0070675_100071808
1435 Ga0070675_100103054
1436 Ga0070675_100104988
1437 Ga0070675_100156590
1438 Ga0070675_100248840
1439 Ga0070675_100572457
1440 Ga0070675_101386494
1441 Ga0070671_100003277
1442 Ga0070671_100005547
1443 Ga0070671_100020112
1444 Ga0070671_100032550
1445 Ga0070671_100047316
1446 Ga0070671_100061954
1447 Ga0070671_100063682
1448 Ga0070671_100073286
1449 Ga0070671_100158350
1450 Ga0070671_100258573
1451 Ga0070674_100000659
1452 Ga0070674_100013733
1453 Ga0070674_100026238
1454 Ga0070674_100078097
1455 Ga0070674_100129882
1456 Ga0070673_100001356
1457 Ga0070673_100007946
1458 Ga0070673_100043069
1459 Ga0070673_100045749
1460 Ga0070673_100067957
1461 Ga0070673_100103167
1462 Ga0070673_100108362
1463 Ga0070673_100185865
1464 Ga0070673_100760360
1465 Ga0070673_101433921
1466 Ga0070688_100001625
1467 Ga0070688_100019806
1468 Ga0070688_100019867
1469 Ga0070688_100039269
1470 Ga0070688_100127953
1471 Ga0070688_100128143
1472 Ga0070688_100174111
1473 Ga0070659_100000779
1474 Ga0070659_100015404
1475 Ga0070659_100169517
1476 Ga0070659_100263081
1477 Ga0070659_100395158
1478 Ga0070659_100562625
1479 Ga0070667_100003532
1480 Ga0070667_100003566
1481 Ga0070667_100008508
1482 Ga0070667_100078143
1483 Ga0070667_100084490
1484 Ga0070667_100106801
1485 Ga0070667_100151596
1486 Ga0070667_100385570
1487 Ga0070667_100398153
1488 Ga0070667_100583168
1489 Ga0070667_100677736
1490 Ga0070667_100688044
1491 Ga0070667_101120663
1492 Ga0070703_10307702
1493 Ga0070709_10020181
1494 Ga0070709_10055060
1495 Ga0070709_10111182
1496 Ga0070709_10160059
1497 Ga0070709_10201156
1498 Ga0070709_10603542
1499 Ga0070714_100037722
1500 Ga0070714_100191387
1501 Ga0070714_100269800
1502 Ga0070714_100437980
1503 Ga0070714_100635017
1504 Ga0070713_100361069
1505 Ga0070713_100662013
1506 Ga0070710_10004182
1507 Ga0070710_10028443
1508 Ga0070710_10101610
1509 Ga0070710_10168369
1510 Ga0070701_10422935
1511 Ga0070711_100024261
1512 Ga0070711_100147637
1513 Ga0070711_100211133
1514 Ga0070711_100218554
1515 Ga0070711_100296505
1516 Ga0070711_100380197
1517 Ga0070705_100004271
1518 Ga0070705_100059114
1519 Ga0070705_100272660
1520 Ga0070705_100367598
1521 Ga0070705_100473101
1522 Ga0070705_100587744
1523 Ga0070700_100003307
1524 Ga0070700_100736289
1525 Ga0070700_100873269
1526 Ga0070694_100016263
1527 Ga0070708_100007814
1528 Ga0070708_100019108
1529 Ga0070708_100043795
1530 Ga0070708_100064287
1531 Ga0070708_100071797
1532 Ga0070708_100247664
1533 Ga0070708_100333778
1534 Ga0070708_100375406
1535 Ga0070663_100044095
1536 Ga0070663_100103241
1537 Ga0070678_100001796
1538 Ga0070678_100009966
1539 Ga0070678_100027767
1540 Ga0070678_100212798
1541 Ga0070678_100266656
1542 Ga0070678_100280893
1543 Ga0070678_100630034
1544 Ga0070662_100000211
1545 Ga0070662_100012527
1546 Ga0070662_100118359
1547 Ga0070662_100118367
1548 Ga0070662_100459618
1549 Ga0070662_100634167
1550 Ga0070681_10002421
1551 Ga0070681_10012806
1552 Ga0070681_10113966
1553 Ga0070681_11031101
1554 Ga0068867_100002050
1555 Ga0068867_100002361
1556 Ga0068867_100046722
1557 Ga0068867_100165548
1558 Ga0068867_100190402
1559 Ga0068867_100299719
1560 Ga0068867_100464649
1561 Ga0070685_10055103
1562 Ga0070685_10185391
1563 Ga0070706_100000012
1564 Ga0070706_100010658
1565 Ga0070706_100011949
1566 Ga0070706_100025873
1567 Ga0070706_100147868
1568 Ga0070706_100155773
1569 Ga0070706_100295679
1570 Ga0070706_100342482
1571 Ga0070706_100418331
1572 Ga0070706_100906695
1573 Ga0070706_100956876
1574 Ga0070707_100007671
1575 Ga0070707_100039755
1576 Ga0070707_100043177
1577 Ga0070707_100055855
1578 Ga0070707_100075664
1579 Ga0070707_100121445
1580 Ga0070707_100145583
1581 Ga0070707_100157651
1582 Ga0070707_100186635
1583 Ga0070707_100186952
1584 Ga0070707_100355176
1585 Ga0070707_100519650
1586 Ga0070707_100523359
1587 Ga0070707_100754051
1588 Ga0070698_100000413
1589 Ga0070698_100023971
1590 Ga0070698_100432375
1591 Ga0070698_100618266
1592 Ga0070698_100829553
1593 Ga0070698_101270600
1594 Ga0070699_100035199
1595 Ga0070699_100053333
1596 Ga0070699_100132618
1597 Ga0070699_100245561
1598 Ga0070699_100287557
1599 Ga0070699_100350897
1600 Ga0070699_100364612
1601 Ga0070699_100597462
1602 Ga0070699_100607951
1603 Ga0070699_100636185
1604 Ga0070679_100006694
1605 Ga0070679_100007544
1606 Ga0070679_100018126
1607 Ga0070679_100021209
1608 Ga0070679_100197004
1609 Ga0070679_100208411
1610 Ga0070679_100302305
1611 Ga0070679_100843256
1612 Ga0070684_100001230
1613 Ga0070684_100002787
1614 Ga0070684_100003917
1615 Ga0070684_100024102
1616 Ga0070684_100391669
1617 Ga0070684_100491039
1618 Ga0070684_100908447
1619 Ga0070697_100032665
1620 Ga0070697_100060466
1621 Ga0070697_100061365
1622 Ga0070697_100135666
1623 Ga0070697_100149013
1624 Ga0070697_100173513
1625 Ga0070697_100305561
1626 Ga0070697_100347575
1627 Ga0070697_101081682
1628 Ga0068853_100006893
1629 Ga0068853_100035421
1630 Ga0068853_100051166
1631 Ga0068853_100115237
1632 Ga0068853_100305755
1633 Ga0068853_100393342
1634 Ga0068853_100824533
1635 Ga0070672_100003099
1636 Ga0070672_100008014
1637 Ga0070672_100008581
1638 Ga0070672_100016533
1639 Ga0070672_100093931
1640 Ga0070672_100139228
1641 Ga0070672_100302218
1642 Ga0070672_100463103
1643 Ga0070686_100344273
1644 Ga0070695_100226023
1645 Ga0070696_100414592
1646 Ga0070696_100913644
1647 Ga0070693_100046532
1648 Ga0070693_100215176
1649 Ga0070693_100273750
1650 Ga0070693_100381154
1651 Ga0070665_100004484
1652 Ga0070665_100006553
1653 Ga0070665_100023261
1654 Ga0070665_100025375
1655 Ga0070665_100028552
1656 Ga0070665_100043800
1657 Ga0070665_100066411
1658 Ga0070665_100099856
1659 Ga0070665_100239396
1660 Ga0070665_100240408
1661 Ga0070665_100294444
1662 Ga0070665_100410794
1663 Ga0070665_100558675
1664 Ga0070665_100761500
1665 Ga0070704_100002585
1666 Ga0068855_100026160
1667 Ga0068855_100101461
1668 Ga0068855_100291506
1669 Ga0070664_100014087
1670 Ga0070664_100017006
1671 Ga0070664_100071931
1672 Ga0070664_100175700
1673 Ga0070664_100195760
1674 Ga0070664_100324490
1675 Ga0070664_100333577
1676 Ga0068857_100047692
1677 Ga0068857_100069369
1678 Ga0068857_100392092
1679 Ga0068857_100762942
1680 Ga0068854_100016524
1681 Ga0068854_100048212
1682 Ga0068856_100004235
1683 Ga0068856_100010690
1684 Ga0068856_100020448
1685 Ga0068856_100035673
1686 Ga0068856_100563184
1687 Ga0068856_100617891
1688 Ga0068856_100665295
1689 Ga0070702_100152344
1690 Ga0068852_100003693
1691 Ga0068852_100014944
1692 Ga0068852_100063346
1693 Ga0068852_100089773
1694 Ga0068852_100215928
1695 Ga0068852_100672728
1696 Ga0068852_100767385
1697 Ga0068852_101338913
1698 Ga0068859_100006056
1699 Ga0068859_100031329
1700 Ga0068859_100178962
1701 Ga0068859_100316119
1702 Ga0068859_101696572
1703 Ga0068864_100002334
1704 Ga0068864_100003597
1705 Ga0068864_100030005
1706 Ga0068864_100154845
1707 Ga0068864_100296909
1708 Ga0068864_101095176
1709 Ga0068861_100122282
1710 Ga0068861_100209913
1711 Ga0068851_10001801
1712 Ga0068851_10008654
1713 Ga0068851_10009599
1714 Ga0068851_10192646
1715 Ga0068870_10014467
1716 Ga0068870_10062076
1717 Ga0068870_10237472
1718 Ga0068863_100003877
1719 Ga0068863_100013286
1720 Ga0068863_100014810
1721 Ga0068863_100068936
1722 Ga0068863_100124985
1723 Ga0068863_100220191
1724 Ga0068863_100271793
1725 Ga0068858_100003264
1726 Ga0068858_100012075
1727 Ga0068858_100018050
1728 Ga0068858_100037520
1729 Ga0068858_100054133
1730 Ga0068858_100286608
1731 Ga0068858_100376012
1732 Ga0068858_100465385
1733 Ga0068858_101600064
1734 Ga0068860_100001042
1735 Ga0068860_100010043
1736 Ga0068860_100012302
1737 Ga0068860_100037702
1738 Ga0068860_100432754
1739 Ga0068860_100728245
1740 Ga0068862_100194594
1741 Ga0081455_10000547
1742 Ga0081455_10001583
1743 Ga0081455_10016102
1744 Ga0081455_10016757
1745 Ga0081455_10021993
1746 Ga0081455_10027093
1747 Ga0081455_10034863
1748 Ga0081455_10217933
1749 Ga0081540_1000016
1750 Ga0081540_1010941
1751 Ga0081540_1022397
1752 Ga0081539_10000052
1753 Ga0081539_10004458
1754 Ga0081539_10008307
1755 Ga0081539_10009998
1756 Ga0081539_10020681
1757 Ga0081539_10120493
1758 Ga0081539_10248129
1759 Ga0070717_10004551
1760 Ga0070717_10044850
1761 Ga0070717_10117227
1762 Ga0070717_10453712
1763 Ga0070717_10555571
1764 Ga0070717_10630238
1765 Ga0070715_10451967
1766 Ga0070716_100685547
1767 Ga0070716_100796948
1768 Ga0070712_100016473
1769 Ga0070712_100306705
1770 Ga0070712_100389355
1771 Ga0070712_100684214
1772 Ga0070712_100780877
1773 Ga0070712_100865388
1774 Ga0097621_100013578
1775 Ga0097621_100015740
1776 Ga0097621_100018761
1777 Ga0097621_100209356
1778 Ga0097621_100232393
1779 Ga0097621_100305203
1780 Ga0097621_100356486
1781 Ga0068871_100001817
1782 Ga0068871_100007616
1783 Ga0068871_100013929
1784 Ga0068871_100023033
1785 Ga0068871_100094475
1786 Ga0068871_100181031
1787 Ga0068871_100248979
1788 Ga0068871_100553898
1789 Ga0075428_100039310
1790 Ga0075428_100053933
1791 Ga0075428_100194783
1792 Ga0075428_100375263
1793 Ga0075433_10313300
1794 Ga0075434_100109023
1795 Ga0075434_100171781
1796 Ga0075434_100208283
1797 Ga0075434_100325667
1798 Ga0075434_100352892
1799 Ga0075434_100547521
1800 Ga0075434_100577073
1801 Ga0075434_100644291
1802 Ga0068865_100044190
1803 Ga0068865_100700892
1804 Ga0068865_101346575
1805 Ga0075436_100077399
1806 Ga0075436_100113516
1807 Ga0075436_100312407
1808 Ga0097620_100006056
1809 Ga0097620_100031329
1810 Ga0097620_100178963
1811 Ga0097620_100316123
1812 Ga0097620_101696306
1813 Ga0075435_100115740
1814 Ga0075435_100178395
1815 Ga0075435_100224640
1816 Ga0105240_10008953
1817 Ga0105240_10022687
1818 Ga0111539_10001299
1819 Ga0111539_10059036
1820 Ga0111539_10060050
1821 Ga0111539_10157405
1822 Ga0111539_10509289
1823 Ga0111539_10524735
1824 Ga0111539_10539640
1825 Ga0105245_10009797
1826 Ga0105245_10018826
1827 Ga0105245_10036661
1828 Ga0105245_10103156
1829 Ga0105245_10105036
1830 Ga0105245_10210221
1831 Ga0105245_10236535
1832 Ga0105245_10441700
1833 Ga0105247_10284676
1834 Ga0105247_10469103
1835 Ga0114129_10095263
1836 Ga0114129_10175486
1837 Ga0114129_10850855
1838 Ga0105243_10231036
1839 Ga0105241_10015461
1840 Ga0105241_10096732
1841 Ga0105241_10922628
1842 Ga0105242_10022489
1843 Ga0105242_10423439
1844 Ga0105248_10002431
1845 Ga0105248_10019006
1846 Ga0105248_10158989
1847 Ga0105248_10203082
1848 Ga0105248_10299721
1849 Ga0105248_10385061
1850 Ga0105237_10107634
1851 Ga0105237_10400540
1852 Ga0105238_10034778
1853 Ga0105238_11109291
1854 Ga0105249_10006766
1855 Ga0105249_10016665
1856 Ga0105249_10268110
1857 Ga0105249_10347979
1858 Ga0105249_10669291
1859 Ga0105249_10702823
1860 Ga0105249_10848108
1861 Ga0105249_11041037
1862 Ga0105249_11258577
1863 Ga0099796_10075146
1864 Ga0105239_10072664
1865 Ga0105246_10214792
1866 Ga0105246_10516170
1867 Ga0157373_10003902
1868 Ga0157373_10014850
1869 Ga0157373_10213621
1870 Ga0157373_10375775
1871 Ga0157371_10000446
1872 Ga0157371_10253936
1873 Ga0157371_10266681
1874 Ga0157370_10010726
1875 Ga0157370_10026708
1876 Ga0157370_10060279
1877 Ga0157370_10093865
1878 Ga0157370_10153709
1879 Ga0157370_10171572
1880 Ga0157370_10946538
1881 Ga0157369_10012261
1882 Ga0157369_10071605
1883 Ga0157369_10237692
1884 Ga0157369_10250853
1885 Ga0157374_10032996
1886 Ga0157374_10068236
1887 Ga0157374_10075119
1888 Ga0157374_10091134
1889 Ga0157374_10110875
1890 Ga0157374_10211274
1891 Ga0157374_10356859
1892 Ga0157374_10451880
1893 Ga0157374_10538630
1894 Ga0157374_11684549
1895 Ga0157378_10054529
1896 Ga0157378_10056068
1897 Ga0157378_10124616
1898 Ga0157378_10144606
1899 Ga0157378_10480705
1900 Ga0157378_10528490
1901 Ga0157378_11272604
1902 Ga0163162_10006343
1903 Ga0163162_10006529
1904 Ga0163162_10039123
1905 Ga0163162_10082361
1906 Ga0163162_10118321
1907 Ga0163162_10250502
1908 Ga0163162_10281768
1909 Ga0163162_10544817
1910 Ga0163162_10558796
1911 Ga0163162_10737186
1912 Ga0163162_11391334
1913 Ga0163162_11551637
1914 Ga0157372_10000523
1915 Ga0157372_10030913
1916 Ga0157372_10032821
1917 Ga0157372_10085120
1918 Ga0157372_10293916
1919 Ga0157372_10410409
1920 Ga0157372_11614732
1921 Ga0157375_10002572
1922 Ga0157375_10007572
1923 Ga0157375_10031682
1924 Ga0157375_10033665
1925 Ga0157375_10035443
1926 Ga0157375_10047793
1927 Ga0157375_10064141
1928 Ga0157375_10090221
1929 Ga0157375_10107775
1930 Ga0157375_10356617
1931 Ga0157375_10602273
1932 Ga0157375_10610839
1933 Ga0157375_11861375
1934 Ga0157375_12170491
1935 Ga0163163_10004811
1936 Ga0163163_10042847
1937 Ga0163163_10060433
1938 Ga0163163_10169102
1939 Ga0163163_10387662
1940 Ga0163163_10435869
1941 Ga0157380_10178920
1942 Ga0157380_10373587
1943 Ga0157380_10664872
1944 Ga0157380_10789231
1945 Ga0182008_10085522
1946 Ga0157377_10008931
1947 Ga0157377_10058811
1948 Ga0157377_10127614
1949 Ga0157377_10250451
1950 Ga0157377_10507869
1951 Ga0157379_10015087
1952 Ga0157379_10031752
1953 Ga0157379_10055151
1954 Ga0157379_10073195
1955 Ga0157379_10278286
1956 Ga0157376_10003007
1957 Ga0157376_10025775
1958 Ga0157376_10039684
1959 Ga0157376_10076929
1960 Ga0157376_10119817
1961 Ga0157376_10140091
1962 Ga0157376_10198257
1963 Ga0157376_10230271
1964 Ga0157376_10341720
1965 Ga0157376_10517553
1966 Ga0157376_11043366
1967 Ga0182005_1008598
1968 Ga0163161_10015702
1969 Ga0163161_10042182
1970 Ga0163161_10073086
1971 Ga0163161_10107910
1972 Ga0163161_10140947
1973 Ga0163161_10868114
1974 Ga0206356_11720413
1975 Ga0207666_1000261
1976 Ga0207666_1041271
1977 Ga0207673_1000951
1978 Ga0207673_1002395
1979 Ga0207697_10003309
1980 Ga0207697_10004477
1981 Ga0207697_10007175
1982 Ga0207697_10012709
1983 Ga0207697_10013913
1984 Ga0207697_10025802
1985 Ga0207656_10007104
1986 Ga0207656_10015301
1987 Ga0207653_10121569
1988 Ga0207653_10145502
1989 Ga0207682_10000146
1990 Ga0207682_10079736
1991 Ga0207692_10062561
1992 Ga0207692_10094161
1993 Ga0207692_10140107
1994 Ga0207692_10393356
1995 Ga0207688_10027364
1996 Ga0207688_10056548
1997 Ga0207688_10105407
1998 Ga0207688_10130638
1999 Ga0207688_10241235
2000 Ga0207680_10001915
2001 Ga0207680_10010912
2002 Ga0207680_10015333
2003 Ga0207680_10034549
2004 Ga0207680_10047288
2005 Ga0207680_10057513
2006 Ga0207680_10277385
2007 Ga0207680_10634288
2008 Ga0207647_10015769
2009 Ga0207699_10019067
2010 Ga0207699_10439333
2011 Ga0207645_10000519
2012 Ga0207645_10008023
2013 Ga0207645_10036131
2014 Ga0207645_10052932
2015 Ga0207645_10061657
2016 Ga0207645_10083026
2017 Ga0207645_10270838
2018 Ga0207643_10027427
2019 Ga0207643_10032649
2020 Ga0207643_10114043
2021 Ga0207643_10257111
2022 Ga0207705_10052596
2023 Ga0207705_10128757
2024 Ga0207705_10348839
2025 Ga0207684_10000028
2026 Ga0207684_10003281
2027 Ga0207684_10032606
2028 Ga0207684_10051288
2029 Ga0207684_10174093
2030 Ga0207684_10284500
2031 Ga0207684_10329193
2032 Ga0207684_10649754
2033 Ga0207684_10667024
2034 Ga0207707_10005207
2035 Ga0207707_10015254
2036 Ga0207707_10015315
2037 Ga0207707_10058830
2038 Ga0207695_10116325
2039 Ga0207693_10002925
2040 Ga0207693_10022585
2041 Ga0207693_10066800
2042 Ga0207693_10096529
2043 Ga0207693_10105081
2044 Ga0207693_10111091
2045 Ga0207693_10137672
2046 Ga0207693_10151897
2047 Ga0207693_10193311
2048 Ga0207693_10923041
2049 Ga0207663_10093753
2050 Ga0207663_10126778
2051 Ga0207663_10269406
2052 Ga0207663_10282004
2053 Ga0207663_10303054
2054 Ga0207663_10415773
2055 Ga0207660_10012654
2056 Ga0207660_10040236
2057 Ga0207660_10185491
2058 Ga0207660_10349121
2059 Ga0207662_10050548
2060 Ga0207662_10060963
2061 Ga0207657_10000229
2062 Ga0207657_10008077
2063 Ga0207657_10024320
2064 Ga0207657_10061470
2065 Ga0207657_10118344
2066 Ga0207657_10129942
2067 Ga0207649_10002277
2068 Ga0207649_10012421
2069 Ga0207649_10019167
2070 Ga0207649_10029744
2071 Ga0207649_10055680
2072 Ga0207649_10065890
2073 Ga0207652_10003991
2074 Ga0207652_10007247
2075 Ga0207652_10064470
2076 Ga0207652_10074201
2077 Ga0207652_10168764
2078 Ga0207646_10000734
2079 Ga0207646_10002142
2080 Ga0207646_10006254
2081 Ga0207646_10006743
2082 Ga0207646_10026769
2083 Ga0207646_10102036
2084 Ga0207646_10134306
2085 Ga0207646_10134948
2086 Ga0207646_10167702
2087 Ga0207646_10325683
2088 Ga0207646_10329032
2089 Ga0207646_10565005
2090 Ga0207646_10631358
2091 Ga0207646_10738601
2092 Ga0207681_10002527
2093 Ga0207681_10024176
2094 Ga0207681_10046095
2095 Ga0207681_10063647
2096 Ga0207681_10112293
2097 Ga0207681_10142153
2098 Ga0207694_10299767
2099 Ga0207694_10607278
2100 Ga0207650_10002534
2101 Ga0207650_10016498
2102 Ga0207650_10035787
2103 Ga0207650_10067227
2104 Ga0207650_10088138
2105 Ga0207650_10093562
2106 Ga0207650_10102856
2107 Ga0207650_10113894
2108 Ga0207650_10301029
2109 Ga0207650_10365468
2110 Ga0207650_10498298
2111 Ga0207659_10002707
2112 Ga0207659_10004071
2113 Ga0207659_10004632
2114 Ga0207659_10007428
2115 Ga0207659_10021504
2116 Ga0207659_10073946
2117 Ga0207659_10080899
2118 Ga0207659_10107969
2119 Ga0207659_10221815
2120 Ga0207659_10247305
2121 Ga0207659_10300714
2122 Ga0207659_10557799
2123 Ga0207659_10840634
2124 Ga0207687_10067295
2125 Ga0207687_10111634
2126 Ga0207687_10354175
2127 Ga0207687_10413551
2128 Ga0207687_10436830
2129 Ga0207687_10514625
2130 Ga0207700_10046468
2131 Ga0207700_10064817
2132 Ga0207700_10164458
2133 Ga0207700_10694708
2134 Ga0207664_10003067
2135 Ga0207664_10006738
2136 Ga0207664_10068190
2137 Ga0207664_10089089
2138 Ga0207664_10184931
2139 Ga0207664_10214414
2140 Ga0207664_10273045
2141 Ga0207664_10554166
2142 Ga0207644_10000405
2143 Ga0207644_10008476
2144 Ga0207644_10012225
2145 Ga0207644_10045397
2146 Ga0207644_10091346
2147 Ga0207644_10095598
2148 Ga0207644_10112928
2149 Ga0207644_10147015
2150 Ga0207644_10169498
2151 Ga0207644_10224422
2152 Ga0207644_10328019
2153 Ga0207644_10498472
2154 Ga0207690_10000348
2155 Ga0207690_10006051
2156 Ga0207690_10021602
2157 Ga0207690_10035029
2158 Ga0207690_10171351
2159 Ga0207690_10453579
2160 Ga0207706_10000045
2161 Ga0207706_10092757
2162 Ga0207706_10186955
2163 Ga0207706_10203631
2164 Ga0207706_10214358
2165 Ga0207706_10266083
2166 Ga0207706_10671301
2167 Ga0207709_10024389
2168 Ga0207709_10143527
2169 Ga0207709_10215953
2170 Ga0207670_10011155
2171 Ga0207670_10017407
2172 Ga0207670_10021344
2173 Ga0207670_10032817
2174 Ga0207670_10293109
2175 Ga0207669_10010707
2176 Ga0207669_10082682
2177 Ga0207669_10124455
2178 Ga0207669_10166393
2179 Ga0207669_10330980
2180 Ga0207704_10525997
2181 Ga0207704_11006500
2182 Ga0207665_10035723
2183 Ga0207665_10069200
2184 Ga0207665_10541113
2185 Ga0207665_10587753
2186 Ga0207691_10000310
2187 Ga0207691_10000629
2188 Ga0207691_10004119
2189 Ga0207691_10025264
2190 Ga0207691_10029499
2191 Ga0207691_10050625
2192 Ga0207691_10097269
2193 Ga0207691_10174393
2194 Ga0207691_10182382
2195 Ga0207691_10220893
2196 Ga0207691_10227923
2197 Ga0207691_10258771
2198 Ga0207711_10011574
2199 Ga0207711_10019828
2200 Ga0207711_10086395
2201 Ga0207711_10126282
2202 Ga0207711_10157887
2203 Ga0207711_10171143
2204 Ga0207711_10281258
2205 Ga0207689_10013147
2206 Ga0207689_10096085
2207 Ga0207661_10009915
2208 Ga0207661_10074070
2209 Ga0207661_10141705
2210 Ga0207661_10163180
2211 Ga0207661_11025791
2212 Ga0207661_11113666
2213 Ga0207679_10003526
2214 Ga0207679_10011829
2215 Ga0207679_10059635
2216 Ga0207679_10126044
2217 Ga0207679_10164325
2218 Ga0207679_10206445
2219 Ga0207679_10496401
2220 Ga0207679_10613889
2221 Ga0207667_10002826
2222 Ga0207667_10003469
2223 Ga0207667_10171767
2224 Ga0207667_10214858
2225 Ga0207667_10738763
2226 Ga0207667_10856780
2227 Ga0207667_11143784
2228 Ga0207651_10025782
2229 Ga0207651_10059712
2230 Ga0207651_10165509
2231 Ga0207651_10171949
2232 Ga0207651_10212322
2233 Ga0207651_10228386
2234 Ga0207651_10414992
2235 Ga0207651_10459188
2236 Ga0207651_10553609
2237 Ga0207712_10302566
2238 Ga0207712_10903992
2239 Ga0207712_11070034
2240 Ga0207712_11165510
2241 Ga0207668_10003264
2242 Ga0207668_10005981
2243 Ga0207668_10018149
2244 Ga0207668_10029476
2245 Ga0207668_10128930
2246 Ga0207668_10146554
2247 Ga0207668_10167562
2248 Ga0207668_10313168
2249 Ga0207668_11005799
2250 Ga0207640_10109298
2251 Ga0207640_10244709
2252 Ga0207640_10306082
2253 Ga0207640_10644912
2254 Ga0207640_11185715
2255 Ga0207658_10008951
2256 Ga0207658_10076428
2257 Ga0207658_10112751
2258 Ga0207658_10129696
2259 Ga0207658_10443746
2260 Ga0207658_10884370
2261 Ga0207677_10011855
2262 Ga0207677_10089514
2263 Ga0207677_10098606
2264 Ga0207677_10146418
2265 Ga0207677_10187502
2266 Ga0207677_10252945
2267 Ga0207677_10379498
2268 Ga0207677_10738246
2269 Ga0207677_10863564
2270 Ga0207703_10005921
2271 Ga0207703_10007291
2272 Ga0207703_10059886
2273 Ga0207703_10119091
2274 Ga0207703_10198221
2275 Ga0207703_10282430
2276 Ga0207639_10008842
2277 Ga0207639_10030631
2278 Ga0207639_10353982
2279 Ga0207639_10401021
2280 Ga0207678_10004526
2281 Ga0207678_10010760
2282 Ga0207678_10014233
2283 Ga0207678_10154353
2284 Ga0207678_10187032
2285 Ga0207678_10483728
2286 Ga0207708_10008199
2287 Ga0207708_10473231
2288 Ga0207708_10578467
2289 Ga0207708_10767764
2290 Ga0207702_10000715
2291 Ga0207702_10017719
2292 Ga0207702_10027561
2293 Ga0207702_10056652
2294 Ga0207641_10001932
2295 Ga0207641_10002486
2296 Ga0207641_10048312
2297 Ga0207641_10068310
2298 Ga0207641_10696297
2299 Ga0207648_10000364
2300 Ga0207648_10002046
2301 Ga0207648_10003344
2302 Ga0207648_10014214
2303 Ga0207648_10035274
2304 Ga0207648_10114825
2305 Ga0207648_10173623
2306 Ga0207648_10907644
2307 Ga0207676_10000633
2308 Ga0207676_10003751
2309 Ga0207676_10014659
2310 Ga0207676_10126705
2311 Ga0207676_10151572
2312 Ga0207674_10000225
2313 Ga0207674_10030050
2314 Ga0207674_10108322
2315 Ga0207674_10281679
2316 Ga0207675_100000658
2317 Ga0207675_100048450
2318 Ga0207675_100054380
2319 Ga0207675_100133367
2320 Ga0207675_100211783
2321 Ga0207675_100243445
2322 Ga0207675_101089251
2323 Ga0207683_10000076
2324 Ga0207683_10000121
2325 Ga0207683_10005699
2326 Ga0207683_10013281
2327 Ga0207683_10083217
2328 Ga0207683_10225139
2329 Ga0207683_10311584
2330 Ga0207698_10007229
2331 Ga0207698_10007522
2332 Ga0207698_10015072
2333 Ga0207698_10083517
2334 Ga0207698_10161096
2335 Ga0207698_10366647
2336 Ga0207698_10400033
2337 Ga0207698_10426621
2338 Ga0209995_1007841
2339 Ga0209968_1022046
2340 Ga0209982_1041769
2341 Ga0210002_1007025
2342 Ga0210002_1026552
2343 Ga0209983_1003112
2344 Ga0209971_1001091
2345 Ga0209974_10000048
2346 Ga0209974_10049320
2347 Ga0207428_10354896
2348 Ga0268266_10028455
2349 Ga0268266_10046833
2350 Ga0268266_10066893
2351 Ga0268266_10101921
2352 Ga0268266_10181768
2353 Ga0268266_10324459
2354 Ga0268266_10494484
2355 Ga0268266_10725778
2356 Ga0268266_10781206
2357 Ga0268265_10049098
2358 Ga0268265_10104731
2359 Ga0268265_10174509
2360 Ga0268265_10361016
2361 Ga0268265_10599475
2362 Ga0268264_10007545
2363 Ga0268264_10010492
2364 Ga0268264_10024971
2365 Ga0268264_10067969
2366 Ga0268264_10084520
2367 Ga0268264_10280500
2368 Ga0268264_10328401
2369 Ga0268264_10330570
2370 Ga0268264_10640838
2371 Ga0307513_10045324
2372 Ga0307408_100557049
2373 Ga0307408_100827325
2374 Ga0307405_10369740
2375 Ga0307405_10514766
2376 Ga0307405_10572863
2377 Ga0307413_10080155
2378 Ga0307410_10098627
2379 Ga0307410_10178627
2380 Ga0307410_10449410
2381 Ga0307406_10072396
2382 Ga0307407_10001541
2383 Ga0307407_10600723
2384 Ga0307412_10048394
2385 Ga0307409_100005712
2386 Ga0307409_100009446
2387 Ga0307409_100024574
2388 Ga0307409_101149512
2389 Ga0307416_100005475
2390 Ga0307416_100385011
2391 Ga0307416_100503129
2392 Ga0307414_10021464
2393 Ga0307414_10365959
2394 Ga0307411_10027198
2395 Ga0307411_10043391
2396 Ga0307415_100019074
2397 Ga0307415_100267275
2398 Ga0373959_0091406
2399 Ga0373929_0090138
2400 Ga0373934_0055451
2401 Ga0373944_0051313
2402 Ga0373949_0043851
2403 Ga0373951_0055773
2404 Ga0373923_0221649
2405 Ga0373945_0035016
2406 Ga0373953_0018370
2407 Ga0373953_0127717
2408 Ga0373954_0134456
2409 Ga0373954_0383179
2410 Ga0373957_0056436
2411 Ga0373957_0140634
2412 Ga0373943_0013149
2413 Ga0373943_0042386
2414 Ga0373943_0108319
2415 Ga0373943_0164482
2416 Ga0373943_0187626
2417 Ga0373943_0295284
2418 Ga0373943_0296106
2419 Ga0373946_0053581
2420 Ga0373955_0031790
2421 Ga0373955_0123356
2422 Ga0373955_0207398
2423 Ga0373955_0431393
2424 Ga0373942_0174660
2425 Ga0373942_0233011
2426 Ga0373961_0055934
2427 Ga0373961_0141227
2428 Ga0373961_0231975
2429 Ga0373924_0168041
2430 Ga0373924_0193320
2431 Ga0373924_0272505
2432 Ga0373931_0065836
2433 Ga0373931_0093401
2434 Ga0373931_0162623
2435 Ga0373931_0285613
2436 Ga0373931_0532831
2437 Ga0373935_0048456
2438 Ga0373935_0049597
2439 Ga0373935_0128571
2440 Ga0373935_0353488
2441 Ga0373935_0554699
2442 Ga0373927_0086834
2443 Ga0373927_0157181
2444 Ga0373927_0160628
2445 Ga0373933_0078009
2446 Ga0373933_0434664
2447 Ga0373933_0751308
2448 Ga0373947_0153234
2449 Ga0373947_0156153
2450 Ga0373937_0004100
2451 Ga0373937_0020917
2452 Ga0373937_0084311
2453 Ga0373937_0086762
2454 Ga0373937_0454968
2455 Ga0373937_0719962
2456 Ga0373925_0014302
2457 Ga0373925_0051602
2458 Ga0373925_0175884
2459 Ga0373925_0212371
2460 Ga0373925_0656339
2461 Ga0395900_0002016
2462 Ga0395900_0035910
2463 Ga0395900_0203491
2464 Ga0395900_0217548
2465 Ga0395900_0767025
2466 Ga0395898_0012264
2467 Ga0395898_0118427
2468 Ga0395898_0293100
2469 Ga0395905_0034576
2470 Ga0395905_0158105
2471 Ga0395905_0517289
2472 Ga0395901_0034534
2473 Ga0395901_0056833
2474 Ga0395901_0367164
2475 Ga0395901_1110382
2476 Ga0436363_0788885
2477 Ga0436362_0735304
2478 Ga0451791_0486903
2479 Ga0451807_0453940
2480 Ga0451807_0845975
2481 Ga0451807_1843067
2482 Ga0451807_2078124
2483 Ga0451835_0936074
2484 Ga0451839_0036848
2485 Ga0439448_0090790
2486 Ga0439451_003915
2487 Ga0439454_004180
2488 Ga0439454_038878
2489 Ga0439455_0017390
2490 Ga0439434_0225377
2491 Ga0439435_0107671
2492 Ga0439459_0056536
2493 Ga0451577_0672392
2494 Ga0466965_0363010
2495 Ga0466964_0063166
2496 Ga0451576_0000443
2497 Ga0451576_0005126
2498 Ga0451576_0062976
2499 Ga0466967_0580341
2500 Ga0495592_0077861
2501 Ga0495603_0499316
2502 Ga0495603_0542386
2503 Ga0495651_0002069
2504 Ga0495651_0119451
2505 Ga0495651_0167256
2506 Ga0495651_0489282
2507 Ga0495653_0131853
2508 Ga0495653_0379707
2509 Ga0495580_0288511
2510 Ga0495605_0252741
2511 Ga0495662_0133205
2512 Ga0495662_0315612
2513 Ga0495585_0261865
2514 Ga0495608_0059603
2515 Ga0495608_0104512
2516 Ga0495608_0135699
2517 Ga0495608_0419992
2518 Ga0495618_0106238
2519 Ga0495628_0161951
2520 Ga0495628_0398602
2521 Ga0495630_0017716
2522 Ga0495630_0122358
2523 Ga0495630_0659161
2524 Ga0495652_0002382
2525 Ga0495652_0018444
2526 Ga0495652_0097537
2527 Ga0495665_0080554
2528 Ga0495587_0099795
2529 Ga0495598_0065706
2530 Ga0495621_0067420
2531 Ga0495645_0001349
2532 Ga0495645_0076108
2533 Ga0495645_0098755
2534 Ga0495645_0223375
2535 Ga0495667_0015938
2536 Ga0495667_0035700
2537 Ga0495667_0467394
2538 Ga0495656_0354571
2539 Ga0495635_0703429
2540 Ga0495635_0727494
2541 Ga0495659_0105214
2542 Ga0495659_0201372
2543 Ga0495657_0024000
2544 Ga0495599_0083130
2545 Ga0495599_0169053
2546 Ga0495599_0609517
2547 Ga0495623_0018902
2548 Ga0495623_0065191
2549 Ga0495646_0022094
2550 Ga0495658_0066607
2551 Ga0495658_0183254
2552 Ga0495669_0168597
2553 Ga0495669_0237917
2554 Ga0495600_0052803
2555 Ga0495600_0112176
2556 Ga0495604_0480204
2557 Ga0495674_0201867
2558 Ga0495676_0184902
2559 Ga0495680_0218080
2560 Ga0495680_0572295
2561 Ga0495680_0776973
2562 Ga0495675_0020921
2563 Ga0495675_0106698
2564 Ga0495684_0018401
2565 Ga0495684_0244313
2566 Ga0495593_0099700
2567 Ga0495602_0092945
2568 Ga0495602_0485795
2569 Ga0496100_0029379
2570 Ga0496100_0363946
2571 Ga0496100_0367823
2572 Ga0496100_0603440
2573 Ga0496101_0030711
2574 Ga0496101_0057350
2575 Ga0496101_0191061
2576 Ga0496101_0255690
2577 Ga0496101_0390007
2578 Ga0496102_0060713
2579 Ga0496102_0098397
2580 Ga0496102_0248196
2581 Ga0496102_0557253
2582 Ga0496102_1183070
2583 Ga0496103_0048618
2584 Ga0496103_0074371
2585 Ga0496103_0099912
2586 Ga0496104_0242492
2587 Ga0496104_0267729
2588 Ga0496104_0292550
2589 Ga0496104_0369501
2590 Ga0496104_0406503
2591 Ga0496105_0015917
2592 Ga0496105_0171980
2593 Ga0496106_0000931
2594 Ga0496106_0089107
2595 Ga0496106_0302521
2596 Ga0496106_0441091
2597 Ga0496107_0004980
2598 Ga0496107_0114221
2599 Ga0496108_0228481
2600 Ga0496108_0275170
2601 Ga0496108_0358646
2602 Ga0496108_0529651
2603 Ga0496108_0702327
2604 Ga0496109_0003295
2605 Ga0496109_0267962
2606 Ga0496109_0628543
2607 Ga0496109_0727887
2608 Ga0496110_0005169
2609 Ga0496110_0186176
2610 Ga0496110_0730324
2611 Ga0496110_0748007
2612 Ga0496110_0983568
2613 Ga0496111_0071833
2614 Ga0496111_0294540
2615 Ga0496112_0012037
2616 Ga0496112_0697637
2617 Ga0496112_0927724
2618 Ga0496113_0514411
2619 Ga0496114_0006008
2620 Ga0496114_0386386
2621 Ga0496115_0002245
2622 Ga0496115_0011572
2623 Ga0496115_0041385
2624 Ga0496115_0361349
2625 Ga0496115_0364171
2626 Ga0496115_0779278
2627 Ga0501040_0268614
2628 Ga0501067_0130946
2629 Ga0501072_0837507
2630 Ga0501075_0244207
2631 Ga0501243_001814
2632 Ga0501081_0166412
2633 Ga0501045_0359695
2634 nmdc:mga05p37_230926_c1
2635 nmdc:mga05p37_508068_c1
2636 nmdc:mga05p37_624008_c1
2637 nmdc:mga05p37_626317_c1
2638 nmdc:mga08y16_1060237_c1
2639 nmdc:mga08y16_123955_c1
2640 nmdc:mga08y16_140210_c1
2641 nmdc:mga08y16_250812_c1
2642 nmdc:mga08y16_4473_c1
2643 nmdc:mga0n895_1016870_c1
2644 nmdc:mga0n895_120848_c1
2645 nmdc:mga0n895_264144_c1
2646 nmdc:mga0n895_325208_c1
2647 nmdc:mga0n895_383427_c1
2648 nmdc:mga0n895_979579_c1
2649 nmdc:mga08x19_258084_c1
2650 nmdc:mga08x19_398716_c1
2651 nmdc:mga08x19_528808_c1
2652 nmdc:mga0a205_738712_c1
2653 nmdc:mga0a205_75661_c1
2654 Ga0495601_0031806
2655 Ga0495601_0122844
2656 Ga0495595_0112475
2657 Ga0495595_0139857
2658 Ga0495619_0055978
2659 Ga0495619_0429277
2660 Ga0495619_0528656

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

150

199

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

144

197

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

41

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9661 118 168
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9593 118 168
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9553 125 169
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9494 1 95
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9443 118 173
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9661 118 168 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 118 168 1.10.10.10
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9528 5 87 1.10.1740.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 118 168 1.10.10.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9493 1 95 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A536ZWP5-F1-model_v4 RNA polymerase sigma factor 1.002 1 92 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q2XYZ5-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9256 1 89 GO:0006352
GO:0016987
AF-A0A2W4RZU8-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.8989 1 101 GO:0006352
GO:0016987
AF-A0A2V6MJR0-F1-model_v4 RNA polymerase sigma factor 0.8598 1 113 GO:0003677
GO:0006352
GO:0016987
AF-A0A2V6MJR0-F1-model_v4 RNA polymerase sigma factor 0.8406 1 113 GO:0003677
GO:0006352
GO:0016987

Map