F492905
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1315 | 753 | 939 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1004890|Ga0055524_10048909 |
| Length | 153 |
| Sequence | MSEAARNILLVAACALIDADGRILLAQRPEGKSLAGLWEFPGGKVEPGETPEESLVRELHEELGITTKVACLAPLTFASHTYEKFHLLMPLYVCRRYEGIPHGKEGQALKWVKPQALRDYPMPPADEPLIPMLQDTLGTSDYYPVSVEFGCGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 9 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 10 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 13 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 14 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 15 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 16 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 17 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 18 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 19 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 20 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 21 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 22 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 23 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 24 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 25 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 26 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 27 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 28 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 29 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 30 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 31 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 32 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 33 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 34 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 35 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 36 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 37 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 38 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 39 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 40 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 41 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 42 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 43 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 44 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 45 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 46 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 47 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 48 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 49 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 50 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 51 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 52 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 53 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 54 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 55 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 56 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 57 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 58 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 59 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 60 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 61 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 62 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 63 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 64 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 65 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 66 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 67 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 68 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 69 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 70 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 71 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 72 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 73 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 74 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 75 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 76 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 77 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 78 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 79 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 80 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 81 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 82 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 83 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 84 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 85 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 86 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 87 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 88 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 89 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 90 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 91 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 92 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 93 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 94 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 95 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 96 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 97 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 98 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 99 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 100 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 101 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 102 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 103 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 104 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 105 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 106 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 107 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 108 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 109 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 110 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 111 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 112 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 113 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 114 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 115 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 116 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 117 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 118 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 119 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 120 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 121 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 122 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 123 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 124 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 125 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 126 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 127 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 128 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 129 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 130 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 131 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 132 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 133 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 134 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 135 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 136 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 137 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 138 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 139 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 140 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 141 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 142 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 143 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 144 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 145 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 146 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 147 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 148 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 149 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 150 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 151 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 152 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 153 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 154 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 155 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 156 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 157 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 158 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 159 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 160 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 161 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 162 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 163 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 164 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 165 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 166 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 167 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 168 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 169 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 170 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 171 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 172 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 173 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 174 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 175 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 176 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 177 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 178 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 179 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 180 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 181 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 182 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 183 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 184 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 185 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 186 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 187 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 188 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 189 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 190 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 191 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 192 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 193 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 194 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 195 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 196 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 197 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 198 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 199 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 200 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 201 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 202 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 203 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 204 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 205 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 206 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 207 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 208 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 209 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 210 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 211 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 212 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 213 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 214 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 215 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 216 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 217 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 218 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 219 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 220 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 221 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 222 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 223 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 224 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 225 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 226 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 227 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 228 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 229 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 230 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 231 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 232 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 233 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 234 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 235 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 236 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 237 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 238 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 239 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 240 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 241 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 242 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 243 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 244 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 245 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 246 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 247 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 248 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 249 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 250 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 251 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 252 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 253 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 254 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 255 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 256 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 257 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 258 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 259 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 260 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 261 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 262 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 263 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 264 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 265 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 266 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 267 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 268 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 269 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 270 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 271 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 272 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 273 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 274 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 275 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 276 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 277 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 278 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 279 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 280 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 281 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 282 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 283 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 284 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 285 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 286 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 287 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 288 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 289 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 290 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 291 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 292 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 293 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 294 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 295 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 296 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 297 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 298 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 299 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 300 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 301 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 302 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 303 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 304 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 305 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 306 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 307 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 308 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 309 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 310 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 311 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 312 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 313 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 314 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 315 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 316 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 317 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 318 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 319 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 320 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 321 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 322 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 323 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 324 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 325 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 326 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 327 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 328 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 329 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 330 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 331 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 332 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 333 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 334 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 335 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 336 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 337 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 338 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 339 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 340 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 341 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 342 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 343 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 344 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 345 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 346 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 347 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 348 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 349 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 350 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 351 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 352 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 353 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 354 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 355 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 356 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 357 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 358 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 359 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 360 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 361 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 362 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 363 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 364 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 365 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 367 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 368 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 369 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 370 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 372 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 373 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 374 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 375 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 376 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 377 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 378 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 379 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 380 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 381 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 383 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 384 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 385 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 386 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 387 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 388 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 389 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 390 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 391 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 392 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 393 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 394 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 395 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 396 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 397 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 398 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 399 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 400 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 401 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 402 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 403 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 404 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 406 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 407 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 408 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 409 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 412 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 413 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 414 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 415 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 416 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 417 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 418 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 419 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 422 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 423 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 424 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 425 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 426 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 427 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 428 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 429 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 430 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 431 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 432 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 433 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 434 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 435 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 436 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 437 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 438 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 439 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 440 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 441 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 442 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 443 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 444 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 445 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 446 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 447 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 448 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 449 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 450 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 451 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 453 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 455 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 457 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 458 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 461 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 499 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 501 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 502 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 504 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 505 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 506 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 507 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 508 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 509 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 510 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 511 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 512 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 513 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 514 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 515 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 516 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 517 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 518 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 519 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 520 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 521 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 522 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 523 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 524 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 525 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 526 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 527 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 528 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 529 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 530 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 531 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 532 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 533 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 534 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 535 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 536 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 537 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 538 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 539 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 540 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 541 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 542 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 543 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 544 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 545 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 546 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 547 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 548 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 549 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 550 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 551 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 552 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 553 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 554 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 618 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 619 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 620 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 621 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 622 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 623 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 624 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 625 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 626 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 627 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 628 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 629 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 630 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 631 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 632 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 633 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 634 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 635 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 636 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 637 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 638 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 639 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 640 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 641 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 642 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 645 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 653 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 655 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 656 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 659 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 660 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 662 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 663 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 664 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 667 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 669 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 670 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 671 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 672 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 673 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 674 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 675 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 676 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 677 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 678 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 679 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 681 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 683 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 684 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 685 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 686 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 687 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 688 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 689 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 690 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 691 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 692 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 693 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 694 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 695 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 696 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 697 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 698 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 699 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 700 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 701 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 702 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 703 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 704 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 705 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 706 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 707 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 708 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 709 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 710 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 711 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 712 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 713 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 714 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 715 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 716 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 717 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 718 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 719 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 720 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 721 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 722 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 723 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 724 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 725 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 726 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 727 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 728 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 729 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 730 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 731 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 732 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 733 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 734 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 735 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 736 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 737 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 738 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 739 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 740 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 741 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 742 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 743 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 744 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 745 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 746 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 747 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 748 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 749 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 750 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 751 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 752 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 753 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.33 |
| Metatranscriptomes | 0.15 |
| Isolates | 28.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 21.67 |
| Nodule | 20.46 |
| Rhizoplane | 3.8 |
| Rhizosphere | 35.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000006 | 3300001979 | Bacteria | 86112 |
| 2 | JGI24739J22299_10267310 | 3300001989 | Bacteria | 501 |
| 3 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 4 | JGI25156J39149_1000186 | 3300002705 | Bacteria | 45132 |
| 5 | JGI25162J39368_1001145 | 3300002737 | Bacteria | 15877 |
| 6 | JGI25162J39368_1001856 | 3300002737 | Bacteria | 9773 |
| 7 | JGI25154J39366_1000187 | 3300002738 | Bacteria | 46590 |
| 8 | JGI25158J39367_1000078 | 3300002739 | Bacteria | 22361 |
| 9 | JGI25158J39367_1001106 | 3300002739 | Bacteria | 4890 |
| 10 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 11 | JGI25152J39213_1001233 | 3300002773 | Bacteria | 11688 |
| 12 | JGI25152J39213_1005065 | 3300002773 | Bacteria | 3965 |
| 13 | JGI25152J39213_1007357 | 3300002773 | Bacteria | 2858 |
| 14 | JGI25152J39213_1014180 | 3300002773 | Bacteria | 1627 |
| 15 | JGI25150J39212_1000061 | 3300002774 | Bacteria | 64691 |
| 16 | JGI25150J39212_1001592 | 3300002774 | Bacteria | 6185 |
| 17 | JGI25159J45721_1000705 | 3300002987 | Bacteria | 14596 |
| 18 | JGI25159J45721_1006597 | 3300002987 | Bacteria | 3453 |
| 19 | JGI25151J46595_10000081 | 3300003187 | Bacteria | 131317 |
| 20 | JGI25151J46595_10001107 | 3300003187 | Bacteria | 19786 |
| 21 | JGI25151J46595_10010445 | 3300003187 | Bacteria | 4315 |
| 22 | JGI25151J46595_10015280 | 3300003187 | Bacteria | 3389 |
| 23 | JGI25151J46595_10043100 | 3300003187 | Bacteria | 1618 |
| 24 | JGI25151J46595_10131101 | 3300003187 | Bacteria | 624 |
| 25 | JGI25165J46597_1000931 | 3300003214 | Bacteria | 20259 |
| 26 | JGI25165J46597_1001497 | 3300003214 | Bacteria | 11934 |
| 27 | JGI25153J46596_10012416 | 3300003215 | Bacteria | 3676 |
| 28 | JGI25153J46596_10012547 | 3300003215 | Bacteria | 3646 |
| 29 | JGI25153J46596_10018618 | 3300003215 | Bacteria | 2691 |
| 30 | rootH1_10152258 | 3300003316 | Bacteria | 1061 |
| 31 | rootH2_10031031 | 3300003320 | Bacteria | 6868 |
| 32 | rootH2_10083047 | 3300003320 | Bacteria | 2188 |
| 33 | rootL2_10071739 | 3300003322 | Bacteria | 9200 |
| 34 | rootL2_10087378 | 3300003322 | Bacteria | 1296 |
| 35 | rootL2_10230007 | 3300003322 | Bacteria | 1326 |
| 36 | rootH1_10049284 | 3300003323 | Bacteria | 3663 |
| 37 | JGI25160J50197_1000085 | 3300003354 | Bacteria | 96359 |
| 38 | JGI25160J50197_1000247 | 3300003354 | Bacteria | 41848 |
| 39 | JGI25160J50197_1000573 | 3300003354 | Bacteria | 20785 |
| 40 | JGI25160J50197_1015877 | 3300003354 | Bacteria | 2452 |
| 41 | JGI25161J50226_1000065 | 3300003374 | Bacteria | 96359 |
| 42 | JGI25161J50226_1000136 | 3300003374 | Bacteria | 50681 |
| 43 | JGI25161J50226_1000620 | 3300003374 | Bacteria | 14553 |
| 44 | JGI25161J50226_1001517 | 3300003374 | Bacteria | 6860 |
| 45 | Ga0055526_1001073 | 3300003771 | Bacteria | 19979 |
| 46 | Ga0055526_1001171 | 3300003771 | Bacteria | 19013 |
| 47 | Ga0055526_1011715 | 3300003771 | Bacteria | 3912 |
| 48 | Ga0055526_1011819 | 3300003771 | Bacteria | 3878 |
| 49 | Ga0055526_1017122 | 3300003771 | Bacteria | 2791 |
| 50 | Ga0055526_1017528 | 3300003771 | Bacteria | 2730 |
| 51 | Ga0055524_1001593 | 3300003775 | Bacteria | 12729 |
| 52 | Ga0055524_1001808 | 3300003775 | Bacteria | 11711 |
| 53 | Ga0055524_1003160 | 3300003775 | Bacteria | 8112 |
| 54 | Ga0055524_1004890 | 3300003775 | Bacteria | 6083 |
| 55 | Ga0055524_1013856 | 3300003775 | Bacteria | 3016 |
| 56 | Ga0055524_1018215 | 3300003775 | Bacteria | 2446 |
| 57 | Ga0055524_1040205 | 3300003775 | Bacteria | 1196 |
| 58 | Ga0055524_1056699 | 3300003775 | Bacteria | 842 |
| 59 | Ga0055536_1001369 | 3300003781 | Bacteria | 14820 |
| 60 | Ga0055528_1000998 | 3300003790 | Bacteria | 18796 |
| 61 | Ga0055528_1001541 | 3300003790 | Bacteria | 13875 |
| 62 | Ga0055528_1004794 | 3300003790 | Bacteria | 6438 |
| 63 | Ga0055528_1008492 | 3300003790 | Bacteria | 4393 |
| 64 | Ga0055528_1009155 | 3300003790 | Bacteria | 4169 |
| 65 | Ga0055528_1014264 | 3300003790 | Bacteria | 2950 |
| 66 | Ga0055528_1022360 | 3300003790 | Bacteria | 1973 |
| 67 | Ga0055528_1036936 | 3300003790 | Bacteria | 1157 |
| 68 | Ga0055530_10008430 | 3300003791 | Bacteria | 4131 |
| 69 | Ga0055540_1004170 | 3300003792 | Bacteria | 6662 |
| 70 | Ga0055540_1008152 | 3300003792 | Bacteria | 3816 |
| 71 | Ga0055540_1009578 | 3300003792 | Bacteria | 3330 |
| 72 | Ga0055540_1025029 | 3300003792 | Bacteria | 1469 |
| 73 | Ga0055540_1027739 | 3300003792 | Bacteria | 1349 |
| 74 | Ga0055531_10007968 | 3300003794 | Bacteria | 5672 |
| 75 | Ga0055531_10055202 | 3300003794 | Bacteria | 1012 |
| 76 | Ga0058692_1000999 | 3300003856 | Bacteria | 11113 |
| 77 | Ga0058692_1001038 | 3300003856 | Bacteria | 10898 |
| 78 | Ga0058692_1004538 | 3300003856 | Bacteria | 4097 |
| 79 | Ga0055543_1000067 | 3300004625 | Bacteria | 96039 |
| 80 | Ga0055543_1000228 | 3300004625 | Bacteria | 44611 |
| 81 | Ga0055543_1000461 | 3300004625 | Bacteria | 24023 |
| 82 | Ga0055543_1000496 | 3300004625 | Bacteria | 22765 |
| 83 | Ga0065165_1000237 | 3300005262 | Bacteria | 96039 |
| 84 | Ga0065165_1000804 | 3300005262 | Bacteria | 41886 |
| 85 | Ga0065165_1013013 | 3300005262 | Bacteria | 3339 |
| 86 | Ga0065165_1017307 | 3300005262 | Bacteria | 2660 |
| 87 | Ga0065165_1060064 | 3300005262 | Bacteria | 1045 |
| 88 | Ga0065165_1066922 | 3300005262 | Bacteria | 965 |
| 89 | Ga0065704_10288861 | 3300005289 | Bacteria | 907 |
| 90 | Ga0070658_10017272 | 3300005327 | Bacteria | 5775 |
| 91 | Ga0070683_100044090 | 3300005329 | Bacteria | 4112 |
| 92 | Ga0070670_100000117 | 3300005331 | Bacteria | 74455 |
| 93 | Ga0070670_100117569 | 3300005331 | Bacteria | 2293 |
| 94 | Ga0070670_101012134 | 3300005331 | Bacteria | 756 |
| 95 | Ga0070666_10475267 | 3300005335 | Bacteria | 904 |
| 96 | Ga0070682_100489930 | 3300005337 | Bacteria | 950 |
| 97 | Ga0068868_100045047 | 3300005338 | Bacteria | 3450 |
| 98 | Ga0070660_100385585 | 3300005339 | Bacteria | 1157 |
| 99 | Ga0070661_100001446 | 3300005344 | Bacteria | 16504 |
| 100 | Ga0070668_100177326 | 3300005347 | Bacteria | 1739 |
| 101 | Ga0070668_100337499 | 3300005347 | Bacteria | 1272 |
| 102 | Ga0070668_100389022 | 3300005347 | Bacteria | 1188 |
| 103 | Ga0070668_101196096 | 3300005347 | Bacteria | 688 |
| 104 | Ga0070669_100076983 | 3300005353 | Bacteria | 2477 |
| 105 | Ga0070669_100493471 | 3300005353 | Bacteria | 1015 |
| 106 | Ga0070671_100043577 | 3300005355 | Bacteria | 3728 |
| 107 | Ga0070659_100007639 | 3300005366 | Bacteria | 7860 |
| 108 | Ga0070659_100589014 | 3300005366 | Bacteria | 955 |
| 109 | Ga0070667_100538785 | 3300005367 | Bacteria | 1072 |
| 110 | Ga0070667_100927078 | 3300005367 | Bacteria | 811 |
| 111 | Ga0070663_100172605 | 3300005455 | Bacteria | 1672 |
| 112 | Ga0070663_100456881 | 3300005455 | Bacteria | 1054 |
| 113 | Ga0070678_100525214 | 3300005456 | Bacteria | 1048 |
| 114 | Ga0068867_100147252 | 3300005459 | Bacteria | 1847 |
| 115 | Ga0070684_100073206 | 3300005535 | Bacteria | 3019 |
| 116 | Ga0068853_100031644 | 3300005539 | Bacteria | 4476 |
| 117 | Ga0068853_100133323 | 3300005539 | Bacteria | 2225 |
| 118 | Ga0068853_100719345 | 3300005539 | Bacteria | 953 |
| 119 | Ga0070693_100124673 | 3300005547 | Bacteria | 1602 |
| 120 | Ga0070665_100009302 | 3300005548 | Bacteria | 9945 |
| 121 | Ga0070665_100102624 | 3300005548 | Bacteria | 2863 |
| 122 | Ga0070665_100159944 | 3300005548 | Bacteria | 2254 |
| 123 | Ga0070665_100263451 | 3300005548 | Bacteria | 1725 |
| 124 | Ga0070665_100351786 | 3300005548 | Bacteria | 1479 |
| 125 | Ga0070665_101001956 | 3300005548 | Bacteria | 848 |
| 126 | Ga0070665_101249323 | 3300005548 | Bacteria | 753 |
| 127 | Ga0068855_100099528 | 3300005563 | Bacteria | 3348 |
| 128 | Ga0068855_100152322 | 3300005563 | Bacteria | 2629 |
| 129 | Ga0068855_100946216 | 3300005563 | Bacteria | 908 |
| 130 | Ga0068855_101367829 | 3300005563 | Bacteria | 731 |
| 131 | Ga0068857_100019717 | 3300005577 | Bacteria | 5923 |
| 132 | Ga0068857_100085044 | 3300005577 | Bacteria | 2827 |
| 133 | Ga0068854_100002452 | 3300005578 | Bacteria | 11478 |
| 134 | Ga0068854_100105200 | 3300005578 | Bacteria | 2121 |
| 135 | Ga0068852_100002904 | 3300005616 | Bacteria | 11896 |
| 136 | Ga0068852_100270712 | 3300005616 | Bacteria | 1634 |
| 137 | Ga0068852_100563181 | 3300005616 | Bacteria | 1141 |
| 138 | Ga0068852_100713165 | 3300005616 | Bacteria | 1014 |
| 139 | Ga0068861_102410655 | 3300005719 | Bacteria | 529 |
| 140 | Ga0068851_10028883 | 3300005834 | Bacteria | 2742 |
| 141 | Ga0068862_102512770 | 3300005844 | Bacteria | 527 |
| 142 | Ga0075365_10003552 | 3300006038 | Bacteria | 8066 |
| 143 | Ga0075365_10076293 | 3300006038 | Bacteria | 2263 |
| 144 | Ga0075365_10479402 | 3300006038 | Bacteria | 879 |
| 145 | Ga0075368_10033372 | 3300006042 | Bacteria | 2002 |
| 146 | Ga0075368_10040883 | 3300006042 | Bacteria | 1821 |
| 147 | Ga0075368_10080740 | 3300006042 | Bacteria | 1323 |
| 148 | Ga0075368_10309975 | 3300006042 | Bacteria | 682 |
| 149 | Ga0075368_10475228 | 3300006042 | Bacteria | 556 |
| 150 | Ga0075363_100025004 | 3300006048 | Bacteria | 3041 |
| 151 | Ga0075363_100060344 | 3300006048 | Bacteria | 2042 |
| 152 | Ga0075363_100100368 | 3300006048 | Bacteria | 1601 |
| 153 | Ga0075363_100167443 | 3300006048 | Bacteria | 1246 |
| 154 | Ga0075364_10006976 | 3300006051 | Bacteria | 6674 |
| 155 | Ga0075364_10090776 | 3300006051 | Bacteria | 2026 |
| 156 | Ga0075364_10172507 | 3300006051 | Bacteria | 1462 |
| 157 | Ga0075364_10259139 | 3300006051 | Bacteria | 1182 |
| 158 | Ga0075362_10010373 | 3300006177 | Bacteria | 3636 |
| 159 | Ga0075362_10214920 | 3300006177 | Bacteria | 938 |
| 160 | Ga0075362_10231919 | 3300006177 | Bacteria | 904 |
| 161 | Ga0075367_10002378 | 3300006178 | Bacteria | 8563 |
| 162 | Ga0075367_10020524 | 3300006178 | Bacteria | 3681 |
| 163 | Ga0075367_10044316 | 3300006178 | Bacteria | 2607 |
| 164 | Ga0075367_10351943 | 3300006178 | Bacteria | 930 |
| 165 | Ga0075367_10403665 | 3300006178 | Bacteria | 864 |
| 166 | Ga0075369_10000556 | 3300006186 | Bacteria | 11754 |
| 167 | Ga0075369_10001596 | 3300006186 | Bacteria | 7792 |
| 168 | Ga0075369_10011871 | 3300006186 | Bacteria | 3432 |
| 169 | Ga0075369_10018986 | 3300006186 | Bacteria | 2803 |
| 170 | Ga0075369_10026625 | 3300006186 | Bacteria | 2412 |
| 171 | Ga0075369_10166395 | 3300006186 | Bacteria | 1011 |
| 172 | Ga0075366_10003442 | 3300006195 | Bacteria | 8348 |
| 173 | Ga0075366_10058667 | 3300006195 | Bacteria | 2286 |
| 174 | Ga0075366_10112785 | 3300006195 | Bacteria | 1636 |
| 175 | Ga0075370_10012653 | 3300006353 | Bacteria | 4467 |
| 176 | Ga0075370_10025702 | 3300006353 | Bacteria | 3258 |
| 177 | Ga0075370_10028427 | 3300006353 | Bacteria | 3108 |
| 178 | Ga0075370_10150675 | 3300006353 | Bacteria | 1363 |
| 179 | Ga0075370_10194611 | 3300006353 | Bacteria | 1195 |
| 180 | Ga0068871_100624372 | 3300006358 | Bacteria | 982 |
| 181 | Ga0075428_100528715 | 3300006844 | Bacteria | 1261 |
| 182 | Ga0079104_1000101 | 3300006946 | Bacteria | 125456 |
| 183 | Ga0079104_1013490 | 3300006946 | Bacteria | 2513 |
| 184 | Ga0099826_10000590 | 3300006948 | Bacteria | 18363 |
| 185 | Ga0099826_10032648 | 3300006948 | Bacteria | 3750 |
| 186 | Ga0099826_10109008 | 3300006948 | Bacteria | 1653 |
| 187 | Ga0105251_10015497 | 3300009011 | Bacteria | 4164 |
| 188 | Ga0105244_10103397 | 3300009036 | Bacteria | 1391 |
| 189 | Ga0105250_10032609 | 3300009092 | Bacteria | 2092 |
| 190 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 191 | Ga0105240_10116139 | 3300009093 | Bacteria | 3229 |
| 192 | Ga0105240_12217276 | 3300009093 | Bacteria | 569 |
| 193 | Ga0105243_10268497 | 3300009148 | Bacteria | 1531 |
| 194 | Ga0105243_10855822 | 3300009148 | Bacteria | 901 |
| 195 | Ga0105243_11255511 | 3300009148 | Bacteria | 756 |
| 196 | Ga0105241_10218315 | 3300009174 | Bacteria | 1601 |
| 197 | Ga0105248_10090815 | 3300009177 | Bacteria | 3439 |
| 198 | Ga0105237_10001167 | 3300009545 | Bacteria | 35083 |
| 199 | Ga0105237_10190489 | 3300009545 | Bacteria | 2051 |
| 200 | Ga0105237_10801268 | 3300009545 | Bacteria | 949 |
| 201 | Ga0105238_10018169 | 3300009551 | Bacteria | 7150 |
| 202 | Ga0105238_10819002 | 3300009551 | Bacteria | 947 |
| 203 | Ga0105249_10639932 | 3300009553 | Bacteria | 1120 |
| 204 | Ga0123340_1042431 | 3300009763 | Bacteria | 2033 |
| 205 | Ga0123341_1000187 | 3300009765 | Bacteria | 31482 |
| 206 | Ga0123341_1079145 | 3300009765 | Bacteria | 1312 |
| 207 | Ga0123342_1016630 | 3300009766 | Bacteria | 6347 |
| 208 | Ga0123342_1024950 | 3300009766 | Bacteria | 3669 |
| 209 | Ga0105239_10093668 | 3300010375 | Bacteria | 3317 |
| 210 | Ga0105239_10210486 | 3300010375 | Bacteria | 2179 |
| 211 | Ga0105239_10498833 | 3300010375 | Bacteria | 1384 |
| 212 | Ga0105239_11908473 | 3300010375 | Bacteria | 689 |
| 213 | Ga0105239_12364335 | 3300010375 | Bacteria | 619 |
| 214 | Ga0157373_10025106 | 3300013100 | Bacteria | 4314 |
| 215 | Ga0157373_10037599 | 3300013100 | Bacteria | 3470 |
| 216 | Ga0157373_10048623 | 3300013100 | Bacteria | 3024 |
| 217 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 218 | Ga0157371_10007550 | 3300013102 | Bacteria | 8786 |
| 219 | Ga0157371_10163292 | 3300013102 | Bacteria | 1591 |
| 220 | Ga0157371_10226699 | 3300013102 | Bacteria | 1342 |
| 221 | Ga0157370_10000143 | 3300013104 | Bacteria | 87289 |
| 222 | Ga0157370_10006960 | 3300013104 | Bacteria | 12353 |
| 223 | Ga0157370_10237336 | 3300013104 | Bacteria | 1687 |
| 224 | Ga0157370_11213204 | 3300013104 | Bacteria | 680 |
| 225 | Ga0157369_10219048 | 3300013105 | Bacteria | 1993 |
| 226 | Ga0157369_11600983 | 3300013105 | Bacteria | 662 |
| 227 | Ga0171463_1006 | 3300013249 | Bacteria | 336402 |
| 228 | Ga0157374_10503729 | 3300013296 | Bacteria | 1215 |
| 229 | Ga0157378_10191660 | 3300013297 | Bacteria | 1928 |
| 230 | Ga0157372_10012923 | 3300013307 | Bacteria | 8900 |
| 231 | Ga0157372_10455409 | 3300013307 | Bacteria | 1491 |
| 232 | Ga0157372_11896665 | 3300013307 | Bacteria | 685 |
| 233 | Ga0157375_10303902 | 3300013308 | Bacteria | 1759 |
| 234 | Ga0157375_11230542 | 3300013308 | Bacteria | 879 |
| 235 | Ga0163163_11341135 | 3300014325 | Bacteria | 777 |
| 236 | Ga0163163_11822364 | 3300014325 | Bacteria | 669 |
| 237 | Ga0182008_10122763 | 3300014497 | Bacteria | 1291 |
| 238 | Ga0157376_11872238 | 3300014969 | Bacteria | 637 |
| 239 | Ga0182007_10001582 | 3300015262 | Bacteria | 12131 |
| 240 | Ga0182005_1007805 | 3300015265 | Bacteria | 3186 |
| 241 | Ga0183363_1095 | 3300015690 | Bacteria | 25674 |
| 242 | Ga0163161_10374982 | 3300017792 | Bacteria | 1136 |
| 243 | Ga0163161_10921347 | 3300017792 | Bacteria | 742 |
| 244 | Ga0214544_1000132 | 3300021320 | Bacteria | 108681 |
| 245 | Ga0214542_1004982 | 3300021321 | Bacteria | 25735 |
| 246 | Ga0214542_1034961 | 3300021321 | Bacteria | 1588 |
| 247 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 248 | Ga0214543_1000102 | 3300021327 | Bacteria | 108906 |
| 249 | Ga0213876_10110405 | 3300021384 | Bacteria | 1460 |
| 250 | Ga0228711_1000022 | 3300022739 | Bacteria | 107483 |
| 251 | Ga0228710_1000028 | 3300022740 | Bacteria | 102538 |
| 252 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 253 | Ga0209436_100089 | 3300025208 | Bacteria | 45843 |
| 254 | Ga0209436_100790 | 3300025208 | Bacteria | 13076 |
| 255 | Ga0209672_101912 | 3300025228 | Bacteria | 5960 |
| 256 | Ga0207427_111005 | 3300025231 | Bacteria | 929 |
| 257 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 258 | Ga0209437_100452 | 3300025233 | Bacteria | 33764 |
| 259 | Ga0209437_103994 | 3300025233 | Bacteria | 2621 |
| 260 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 261 | Ga0207425_1004151 | 3300025245 | Bacteria | 4419 |
| 262 | Ga0207425_1004943 | 3300025245 | Bacteria | 3892 |
| 263 | Ga0207425_1020525 | 3300025245 | Bacteria | 1411 |
| 264 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 265 | Ga0209646_1026581 | 3300025246 | Bacteria | 802 |
| 266 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 267 | Ga0209677_101882 | 3300025253 | Bacteria | 8509 |
| 268 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 269 | Ga0209129_1000094 | 3300025258 | Bacteria | 172051 |
| 270 | Ga0209129_1000290 | 3300025258 | Bacteria | 47943 |
| 271 | Ga0209129_1000519 | 3300025258 | Bacteria | 27449 |
| 272 | Ga0209129_1001202 | 3300025258 | Bacteria | 14902 |
| 273 | Ga0209129_1001250 | 3300025258 | Bacteria | 14582 |
| 274 | Ga0209129_1009271 | 3300025258 | Bacteria | 2617 |
| 275 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 276 | Ga0209233_1000343 | 3300025261 | Bacteria | 45433 |
| 277 | Ga0209233_1000367 | 3300025261 | Bacteria | 40782 |
| 278 | Ga0209455_1009867 | 3300025272 | Bacteria | 2471 |
| 279 | Ga0209673_1000158 | 3300025273 | Bacteria | 143067 |
| 280 | Ga0209673_1000283 | 3300025273 | Bacteria | 94995 |
| 281 | Ga0209673_1000771 | 3300025273 | Bacteria | 43169 |
| 282 | Ga0209673_1002843 | 3300025273 | Bacteria | 11093 |
| 283 | Ga0209673_1010655 | 3300025273 | Bacteria | 3856 |
| 284 | Ga0209673_1016456 | 3300025273 | Bacteria | 2764 |
| 285 | Ga0209673_1025562 | 3300025273 | Bacteria | 1960 |
| 286 | Ga0209673_1076855 | 3300025273 | Bacteria | 776 |
| 287 | Ga0209673_1076873 | 3300025273 | Bacteria | 776 |
| 288 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 289 | Ga0209130_1000265 | 3300025284 | Bacteria | 65775 |
| 290 | Ga0209130_1000465 | 3300025284 | Bacteria | 41986 |
| 291 | Ga0209130_1009861 | 3300025284 | Bacteria | 2679 |
| 292 | Ga0209130_1036575 | 3300025284 | Bacteria | 974 |
| 293 | Ga0209675_1025119 | 3300025291 | Bacteria | 1508 |
| 294 | Ga0209676_1003840 | 3300025292 | Bacteria | 8817 |
| 295 | Ga0209676_1040802 | 3300025292 | Bacteria | 1303 |
| 296 | Ga0209676_1057007 | 3300025292 | Bacteria | 992 |
| 297 | Ga0209025_1000184 | 3300025294 | Bacteria | 155611 |
| 298 | Ga0209025_1000245 | 3300025294 | Bacteria | 127801 |
| 299 | Ga0209025_1000725 | 3300025294 | Bacteria | 55900 |
| 300 | Ga0209025_1001475 | 3300025294 | Bacteria | 30611 |
| 301 | Ga0209025_1001628 | 3300025294 | Bacteria | 28018 |
| 302 | Ga0209025_1002008 | 3300025294 | Bacteria | 23288 |
| 303 | Ga0209025_1003091 | 3300025294 | Bacteria | 16331 |
| 304 | Ga0209025_1016825 | 3300025294 | Bacteria | 4274 |
| 305 | Ga0209025_1019068 | 3300025294 | Bacteria | 3838 |
| 306 | Ga0209025_1019090 | 3300025294 | Bacteria | 3833 |
| 307 | Ga0209025_1065561 | 3300025294 | Bacteria | 1325 |
| 308 | Ga0209564_1000381 | 3300025295 | Bacteria | 81150 |
| 309 | Ga0209564_1000960 | 3300025295 | Bacteria | 36623 |
| 310 | Ga0209564_1001128 | 3300025295 | Bacteria | 31421 |
| 311 | Ga0209564_1001662 | 3300025295 | Bacteria | 21363 |
| 312 | Ga0209564_1007822 | 3300025295 | Bacteria | 5424 |
| 313 | Ga0209564_1028109 | 3300025295 | Bacteria | 1807 |
| 314 | Ga0209564_1053257 | 3300025295 | Bacteria | 965 |
| 315 | Ga0209758_1000159 | 3300025297 | Bacteria | 155588 |
| 316 | Ga0209758_1001526 | 3300025297 | Bacteria | 26781 |
| 317 | Ga0209758_1002004 | 3300025297 | Bacteria | 21909 |
| 318 | Ga0209758_1004118 | 3300025297 | Bacteria | 12457 |
| 319 | Ga0209758_1006869 | 3300025297 | Bacteria | 7953 |
| 320 | Ga0209758_1015934 | 3300025297 | Bacteria | 3854 |
| 321 | Ga0209050_1001980 | 3300025298 | Bacteria | 19226 |
| 322 | Ga0209050_1016935 | 3300025298 | Bacteria | 2943 |
| 323 | Ga0209050_1019171 | 3300025298 | Bacteria | 2615 |
| 324 | Ga0209256_1000440 | 3300025299 | Bacteria | 63735 |
| 325 | Ga0209256_1000892 | 3300025299 | Bacteria | 36721 |
| 326 | Ga0209256_1001107 | 3300025299 | Bacteria | 30848 |
| 327 | Ga0209256_1002685 | 3300025299 | Bacteria | 13917 |
| 328 | Ga0209256_1003593 | 3300025299 | Bacteria | 10682 |
| 329 | Ga0209256_1007542 | 3300025299 | Bacteria | 5324 |
| 330 | Ga0209256_1010198 | 3300025299 | Bacteria | 3976 |
| 331 | Ga0209256_1016042 | 3300025299 | Bacteria | 2578 |
| 332 | Ga0209256_1027473 | 3300025299 | Bacteria | 1621 |
| 333 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 334 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 335 | Ga0207426_1000309 | 3300025302 | Bacteria | 96053 |
| 336 | Ga0207426_1000646 | 3300025302 | Bacteria | 43187 |
| 337 | Ga0207426_1003037 | 3300025302 | Bacteria | 9705 |
| 338 | Ga0209051_1001583 | 3300025303 | Bacteria | 18715 |
| 339 | Ga0209051_1001638 | 3300025303 | Bacteria | 18164 |
| 340 | Ga0209051_1008054 | 3300025303 | Bacteria | 5642 |
| 341 | Ga0209051_1008858 | 3300025303 | Bacteria | 5266 |
| 342 | Ga0209051_1013569 | 3300025303 | Bacteria | 3868 |
| 343 | Ga0209051_1022857 | 3300025303 | Bacteria | 2618 |
| 344 | Ga0209257_1002473 | 3300025304 | Bacteria | 18276 |
| 345 | Ga0209257_1007098 | 3300025304 | Bacteria | 6908 |
| 346 | Ga0207656_10010673 | 3300025321 | Bacteria | 3447 |
| 347 | Ga0207713_1045049 | 3300025735 | Bacteria | 1805 |
| 348 | Ga0207642_10819594 | 3300025899 | Bacteria | 593 |
| 349 | Ga0207710_10412015 | 3300025900 | Bacteria | 694 |
| 350 | Ga0207705_10021220 | 3300025909 | Bacteria | 4632 |
| 351 | Ga0207654_10302413 | 3300025911 | Bacteria | 1088 |
| 352 | Ga0207695_10001286 | 3300025913 | Bacteria | 42649 |
| 353 | Ga0207671_10001380 | 3300025914 | Bacteria | 28264 |
| 354 | Ga0207671_10103478 | 3300025914 | Bacteria | 2159 |
| 355 | Ga0207671_10422014 | 3300025914 | Bacteria | 1061 |
| 356 | Ga0207671_10770117 | 3300025914 | Bacteria | 764 |
| 357 | Ga0207657_10003807 | 3300025919 | Bacteria | 16038 |
| 358 | Ga0207657_10225922 | 3300025919 | Bacteria | 1498 |
| 359 | Ga0207649_10003241 | 3300025920 | Bacteria | 8900 |
| 360 | Ga0207681_10058022 | 3300025923 | Bacteria | 2649 |
| 361 | Ga0207694_10365970 | 3300025924 | Bacteria | 1195 |
| 362 | Ga0207650_10001181 | 3300025925 | Bacteria | 19172 |
| 363 | Ga0207650_10883583 | 3300025925 | Bacteria | 759 |
| 364 | Ga0207687_10900942 | 3300025927 | Bacteria | 757 |
| 365 | Ga0207644_10033903 | 3300025931 | Bacteria | 3571 |
| 366 | Ga0207690_10355277 | 3300025932 | Bacteria | 1160 |
| 367 | Ga0207706_10382385 | 3300025933 | Bacteria | 1221 |
| 368 | Ga0207709_10145751 | 3300025935 | Bacteria | 1633 |
| 369 | Ga0207709_10296112 | 3300025935 | Bacteria | 1201 |
| 370 | Ga0207711_10147161 | 3300025941 | Bacteria | 2123 |
| 371 | Ga0207679_10370569 | 3300025945 | Bacteria | 1253 |
| 372 | Ga0207667_10390283 | 3300025949 | Bacteria | 1418 |
| 373 | Ga0207667_10920614 | 3300025949 | Bacteria | 865 |
| 374 | Ga0207651_10177865 | 3300025960 | Bacteria | 1685 |
| 375 | Ga0207668_10095809 | 3300025972 | Bacteria | 2191 |
| 376 | Ga0207668_10243747 | 3300025972 | Bacteria | 1456 |
| 377 | Ga0207668_10831945 | 3300025972 | Bacteria | 819 |
| 378 | Ga0207668_10998019 | 3300025972 | Bacteria | 748 |
| 379 | Ga0207668_11092490 | 3300025972 | Bacteria | 715 |
| 380 | Ga0207668_11278734 | 3300025972 | Bacteria | 660 |
| 381 | Ga0207668_11555671 | 3300025972 | Bacteria | 597 |
| 382 | Ga0207640_10335462 | 3300025981 | Bacteria | 1209 |
| 383 | Ga0207658_10840713 | 3300025986 | Bacteria | 834 |
| 384 | Ga0207658_11088068 | 3300025986 | Bacteria | 730 |
| 385 | Ga0207658_11160804 | 3300025986 | Bacteria | 706 |
| 386 | Ga0207677_10960035 | 3300026023 | Bacteria | 773 |
| 387 | Ga0207639_10001619 | 3300026041 | Bacteria | 15145 |
| 388 | Ga0207639_10088854 | 3300026041 | Bacteria | 2467 |
| 389 | Ga0207639_10673352 | 3300026041 | Bacteria | 958 |
| 390 | Ga0207678_10974322 | 3300026067 | Bacteria | 750 |
| 391 | Ga0207678_11122235 | 3300026067 | Bacteria | 696 |
| 392 | Ga0207702_10142586 | 3300026078 | Bacteria | 2170 |
| 393 | Ga0207702_10188122 | 3300026078 | Bacteria | 1905 |
| 394 | Ga0207702_10516068 | 3300026078 | Bacteria | 1166 |
| 395 | Ga0207702_11469956 | 3300026078 | Bacteria | 675 |
| 396 | Ga0207641_10615884 | 3300026088 | Bacteria | 1064 |
| 397 | Ga0207648_10191456 | 3300026089 | Bacteria | 1813 |
| 398 | Ga0207674_10012034 | 3300026116 | Bacteria | 9692 |
| 399 | Ga0207674_10079019 | 3300026116 | Bacteria | 3295 |
| 400 | Ga0207683_10127259 | 3300026121 | Bacteria | 2290 |
| 401 | Ga0207698_10013047 | 3300026142 | Bacteria | 5467 |
| 402 | Ga0207698_10037678 | 3300026142 | Bacteria | 3564 |
| 403 | Ga0207698_10612754 | 3300026142 | Bacteria | 1074 |
| 404 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 405 | Ga0209281_1000247 | 3300027111 | Bacteria | 107495 |
| 406 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 407 | Ga0209371_1001357 | 3300027312 | Bacteria | 16945 |
| 408 | Ga0209371_1001699 | 3300027312 | Bacteria | 13954 |
| 409 | Ga0209371_1001789 | 3300027312 | Bacteria | 13450 |
| 410 | Ga0209282_1000037 | 3300027666 | Bacteria | 130160 |
| 411 | Ga0209282_1000342 | 3300027666 | Bacteria | 23118 |
| 412 | Ga0209282_1017049 | 3300027666 | Bacteria | 4619 |
| 413 | Ga0209813_10056995 | 3300027866 | Bacteria | 1238 |
| 414 | Ga0209813_10092699 | 3300027866 | Bacteria | 1017 |
| 415 | Ga0209813_10094142 | 3300027866 | Bacteria | 1010 |
| 416 | Ga0209813_10120981 | 3300027866 | Bacteria | 911 |
| 417 | Ga0268266_10007330 | 3300028379 | Bacteria | 9966 |
| 418 | Ga0268266_10011023 | 3300028379 | Bacteria | 7871 |
| 419 | Ga0268266_10287215 | 3300028379 | Bacteria | 1531 |
| 420 | Ga0307515_10000860 | 3300028794 | Bacteria | 69854 |
| 421 | Ga0307515_10016242 | 3300028794 | Bacteria | 13644 |
| 422 | Ga0307515_10068193 | 3300028794 | Bacteria | 4891 |
| 423 | Ga0307515_10870572 | 3300028794 | Bacteria | 529 |
| 424 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 425 | Ga0268256_1000728 | 3300030500 | Bacteria | 24256 |
| 426 | Ga0268256_1003113 | 3300030500 | Bacteria | 7733 |
| 427 | Ga0316181_1122127 | 3300030744 | Bacteria | 2312 |
| 428 | Ga0265316_10038608 | 3300031344 | Bacteria | 3845 |
| 429 | Ga0307513_10002143 | 3300031456 | Bacteria | 27633 |
| 430 | Ga0307513_10042417 | 3300031456 | Bacteria | 5010 |
| 431 | Ga0307513_10618257 | 3300031456 | Bacteria | 792 |
| 432 | Ga0307408_100618930 | 3300031548 | Bacteria | 964 |
| 433 | Ga0307405_10000088 | 3300031731 | Bacteria | 39053 |
| 434 | Ga0307405_10876135 | 3300031731 | Bacteria | 758 |
| 435 | Ga0307405_10979039 | 3300031731 | Bacteria | 720 |
| 436 | Ga0307405_11807209 | 3300031731 | Bacteria | 543 |
| 437 | Ga0307410_10364385 | 3300031852 | Bacteria | 1158 |
| 438 | Ga0307406_10052070 | 3300031901 | Bacteria | 2602 |
| 439 | Ga0307406_10123869 | 3300031901 | Bacteria | 1802 |
| 440 | Ga0307412_10004000 | 3300031911 | Bacteria | 8216 |
| 441 | Ga0307412_10027402 | 3300031911 | Bacteria | 3552 |
| 442 | Ga0307412_10062068 | 3300031911 | Bacteria | 2515 |
| 443 | Ga0307412_10850240 | 3300031911 | Bacteria | 796 |
| 444 | Ga0307412_11335103 | 3300031911 | Bacteria | 647 |
| 445 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 446 | Ga0307409_100071381 | 3300031995 | Bacteria | 2761 |
| 447 | Ga0307414_10031302 | 3300032004 | Bacteria | 3488 |
| 448 | Ga0307414_11158943 | 3300032004 | Bacteria | 715 |
| 449 | Ga0307510_10366289 | 3300033180 | Bacteria | 888 |
| 450 | Ga0315913_1000018 | 3300033430 | Bacteria | 102535 |
| 451 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 452 | Ga0373948_0050325 | 3300034817 | Bacteria | 894 |
| 453 | Ga0373931_0096189 | 3300035691 | Bacteria | 1658 |
| 454 | Ga0395900_0758731 | 3300037418 | Bacteria | 900 |
| 455 | Ga0395898_0186187 | 3300037466 | Bacteria | 1984 |
| 456 | Ga0436364_0583757 | 3300037853 | Bacteria | 1476 |
| 457 | Ga0436365_1509750 | 3300039437 | Bacteria | 2905 |
| 458 | Ga0439436_0037077 | 3300041404 | Bacteria | 1405 |
| 459 | Ga0439436_0094264 | 3300041404 | Bacteria | 834 |
| 460 | Ga0439439_0069703 | 3300041406 | Bacteria | 941 |
| 461 | Ga0439466_0223540 | 3300041411 | Bacteria | 571 |
| 462 | Ga0439465_0000679 | 3300041413 | Bacteria | 10418 |
| 463 | Ga0439465_0022502 | 3300041413 | Bacteria | 1980 |
| 464 | Ga0451787_114555 | 3300041441 | Bacteria | 2487 |
| 465 | Ga0451789_0796484 | 3300041443 | Bacteria | 1679 |
| 466 | Ga0451791_0471423 | 3300041451 | Bacteria | 1164 |
| 467 | Ga0451791_0616845 | 3300041451 | Bacteria | 2096 |
| 468 | Ga0451791_1264307 | 3300041451 | Bacteria | 555 |
| 469 | Ga0451798_0339288 | 3300041458 | Bacteria | 1603 |
| 470 | Ga0451800_0984752 | 3300041459 | Bacteria | 765 |
| 471 | Ga0451802_0288055 | 3300041460 | Bacteria | 1524 |
| 472 | Ga0451802_0399050 | 3300041460 | Bacteria | 677 |
| 473 | Ga0451807_0447172 | 3300041486 | Bacteria | 941 |
| 474 | Ga0451807_1709282 | 3300041486 | Bacteria | 865 |
| 475 | Ga0451833_1324270 | 3300041491 | Bacteria | 1410 |
| 476 | Ga0451835_0708937 | 3300041492 | Bacteria | 580 |
| 477 | Ga0451835_0853460 | 3300041492 | Bacteria | 652 |
| 478 | Ga0451837_1678452 | 3300041494 | Bacteria | 640 |
| 479 | Ga0451841_0304265 | 3300041498 | Bacteria | 912 |
| 480 | Ga0451841_1215396 | 3300041498 | Bacteria | 594 |
| 481 | Ga0451846_32342 | 3300041502 | Bacteria | 1089 |
| 482 | Ga0451847_0501180 | 3300041503 | Bacteria | 4369 |
| 483 | Ga0451847_0600248 | 3300041503 | Bacteria | 1144 |
| 484 | Ga0451850_13365 | 3300041506 | Bacteria | 544 |
| 485 | Ga0451851_0365326 | 3300041507 | Bacteria | 518 |
| 486 | Ga0451843_0027106 | 3300041509 | Bacteria | 1428 |
| 487 | Ga0451843_0336235 | 3300041509 | Bacteria | 652 |
| 488 | Ga0451853_0199191 | 3300041512 | Bacteria | 837 |
| 489 | Ga0451853_0628529 | 3300041512 | Bacteria | 1862 |
| 490 | Ga0439431_0269340 | 3300041997 | Bacteria | 508 |
| 491 | Ga0439449_0017515 | 3300042007 | Bacteria | 2691 |
| 492 | Ga0439462_0016669 | 3300042015 | Bacteria | 1900 |
| 493 | Ga0450920_065072 | 3300042122 | Bacteria | 739 |
| 494 | Ga0439434_0218895 | 3300042435 | Bacteria | 646 |
| 495 | Ga0439435_0103648 | 3300042436 | Bacteria | 877 |
| 496 | Ga0466965_0099069 | 3300044683 | Bacteria | 1489 |
| 497 | Ga0466958_0231814 | 3300045836 | Bacteria | 1179 |
| 498 | Ga0495617_086930 | 3300046452 | Bacteria | 1022 |
| 499 | Ga0495592_0093162 | 3300046454 | Bacteria | 2158 |
| 500 | Ga0495629_0062325 | 3300046459 | Bacteria | 2605 |
| 501 | Ga0495638_0000397 | 3300046460 | Bacteria | 53684 |
| 502 | Ga0495638_0111977 | 3300046460 | Bacteria | 1620 |
| 503 | Ga0495638_0333994 | 3300046460 | Bacteria | 805 |
| 504 | Ga0495651_0373218 | 3300046462 | Bacteria | 937 |
| 505 | Ga0495650_0067763 | 3300046471 | Bacteria | 1409 |
| 506 | Ga0495582_0217814 | 3300046473 | Bacteria | 1092 |
| 507 | Ga0495605_0000412 | 3300046474 | Bacteria | 39061 |
| 508 | Ga0495605_0104059 | 3300046474 | Bacteria | 1301 |
| 509 | Ga0495605_0345296 | 3300046474 | Bacteria | 625 |
| 510 | Ga0495662_0191803 | 3300046476 | Bacteria | 1007 |
| 511 | Ga0495664_0086510 | 3300046477 | Bacteria | 1883 |
| 512 | Ga0495585_0003057 | 3300046492 | Bacteria | 11511 |
| 513 | Ga0495585_0013116 | 3300046492 | Bacteria | 4859 |
| 514 | Ga0495585_0032443 | 3300046492 | Bacteria | 2959 |
| 515 | Ga0495585_0035698 | 3300046492 | Bacteria | 2808 |
| 516 | Ga0495596_0172013 | 3300046500 | Bacteria | 842 |
| 517 | Ga0495607_0022128 | 3300046501 | Bacteria | 3996 |
| 518 | Ga0495607_0097617 | 3300046501 | Bacteria | 1579 |
| 519 | Ga0495607_0205452 | 3300046501 | Bacteria | 972 |
| 520 | Ga0495583_0005093 | 3300046506 | Bacteria | 9061 |
| 521 | Ga0495583_0095810 | 3300046506 | Bacteria | 1272 |
| 522 | Ga0495583_0097278 | 3300046506 | Bacteria | 1260 |
| 523 | Ga0495583_0136398 | 3300046506 | Bacteria | 1024 |
| 524 | Ga0495606_0013838 | 3300046507 | Bacteria | 6336 |
| 525 | Ga0495606_0071714 | 3300046507 | Bacteria | 2179 |
| 526 | Ga0495606_0119006 | 3300046507 | Bacteria | 1583 |
| 527 | Ga0495608_0818567 | 3300046511 | Bacteria | 549 |
| 528 | Ga0495610_0002097 | 3300046512 | Bacteria | 17024 |
| 529 | Ga0495610_0009996 | 3300046512 | Bacteria | 5930 |
| 530 | Ga0495610_0038247 | 3300046512 | Bacteria | 2437 |
| 531 | Ga0495616_0011491 | 3300046513 | Bacteria | 5069 |
| 532 | Ga0495616_0053272 | 3300046513 | Bacteria | 2011 |
| 533 | Ga0495616_0108638 | 3300046513 | Bacteria | 1291 |
| 534 | Ga0495618_0355812 | 3300046514 | Bacteria | 902 |
| 535 | Ga0495620_0005619 | 3300046515 | Bacteria | 6979 |
| 536 | Ga0495620_0006922 | 3300046515 | Bacteria | 6197 |
| 537 | Ga0495620_0067683 | 3300046515 | Bacteria | 1469 |
| 538 | Ga0495620_0115832 | 3300046515 | Bacteria | 1059 |
| 539 | Ga0495628_0448498 | 3300046516 | Bacteria | 937 |
| 540 | Ga0495631_0003390 | 3300046518 | Bacteria | 8726 |
| 541 | Ga0495631_0016450 | 3300046518 | Bacteria | 3525 |
| 542 | Ga0495632_0025192 | 3300046519 | Bacteria | 3149 |
| 543 | Ga0495632_0029566 | 3300046519 | Bacteria | 2851 |
| 544 | Ga0495632_0075092 | 3300046519 | Bacteria | 1618 |
| 545 | Ga0495643_0004851 | 3300046522 | Bacteria | 9265 |
| 546 | Ga0495643_0042014 | 3300046522 | Bacteria | 2491 |
| 547 | Ga0495643_0067836 | 3300046522 | Bacteria | 1878 |
| 548 | Ga0495643_0084432 | 3300046522 | Bacteria | 1648 |
| 549 | Ga0495643_0256186 | 3300046522 | Bacteria | 814 |
| 550 | Ga0495644_0108959 | 3300046523 | Bacteria | 1050 |
| 551 | Ga0495644_0239706 | 3300046523 | Bacteria | 703 |
| 552 | Ga0495648_0264200 | 3300046524 | Bacteria | 824 |
| 553 | Ga0495652_0397826 | 3300046529 | Bacteria | 976 |
| 554 | Ga0495654_0000571 | 3300046530 | Bacteria | 29572 |
| 555 | Ga0495654_0049687 | 3300046530 | Bacteria | 2053 |
| 556 | Ga0495654_0079587 | 3300046530 | Bacteria | 1539 |
| 557 | Ga0495640_0535023 | 3300046533 | Bacteria | 711 |
| 558 | Ga0495609_0014093 | 3300046538 | Bacteria | 3763 |
| 559 | Ga0495609_0018014 | 3300046538 | Bacteria | 3276 |
| 560 | Ga0495597_0018985 | 3300046542 | Bacteria | 3221 |
| 561 | Ga0495597_0054860 | 3300046542 | Bacteria | 1749 |
| 562 | Ga0495633_0005629 | 3300046558 | Bacteria | 7595 |
| 563 | Ga0495633_0028120 | 3300046558 | Bacteria | 2743 |
| 564 | Ga0495633_0151673 | 3300046558 | Bacteria | 1070 |
| 565 | Ga0495633_0213847 | 3300046558 | Bacteria | 883 |
| 566 | Ga0495656_0033907 | 3300046615 | Bacteria | 2087 |
| 567 | Ga0495656_0098169 | 3300046615 | Bacteria | 1350 |
| 568 | Ga0495656_0541136 | 3300046615 | Bacteria | 620 |
| 569 | Ga0495668_0001138 | 3300046616 | Bacteria | 27251 |
| 570 | Ga0495668_0073181 | 3300046616 | Bacteria | 1882 |
| 571 | Ga0495634_0402062 | 3300046642 | Bacteria | 813 |
| 572 | Ga0495611_0002515 | 3300046648 | Bacteria | 8342 |
| 573 | Ga0495611_0043860 | 3300046648 | Bacteria | 2000 |
| 574 | Ga0495611_0048336 | 3300046648 | Bacteria | 1912 |
| 575 | Ga0495625_0006104 | 3300046660 | Bacteria | 10799 |
| 576 | Ga0495625_0008114 | 3300046660 | Bacteria | 8999 |
| 577 | Ga0495625_0016108 | 3300046660 | Bacteria | 5891 |
| 578 | Ga0495625_0051370 | 3300046660 | Bacteria | 2956 |
| 579 | Ga0495625_0068126 | 3300046660 | Bacteria | 2502 |
| 580 | Ga0495625_0238072 | 3300046660 | Bacteria | 1186 |
| 581 | Ga0495625_0263482 | 3300046660 | Bacteria | 1115 |
| 582 | Ga0495625_0313150 | 3300046660 | Bacteria | 1001 |
| 583 | Ga0495625_0523251 | 3300046660 | Bacteria | 722 |
| 584 | Ga0495635_0042978 | 3300046663 | Bacteria | 3120 |
| 585 | Ga0495635_0368494 | 3300046663 | Bacteria | 957 |
| 586 | Ga0495661_0019832 | 3300046665 | Bacteria | 4399 |
| 587 | Ga0495661_0262287 | 3300046665 | Bacteria | 877 |
| 588 | Ga0495661_0416352 | 3300046665 | Bacteria | 651 |
| 589 | Ga0495588_0022947 | 3300046674 | Bacteria | 3085 |
| 590 | Ga0495588_0059332 | 3300046674 | Bacteria | 1979 |
| 591 | Ga0495588_0482430 | 3300046674 | Bacteria | 650 |
| 592 | Ga0495588_0584123 | 3300046674 | Bacteria | 585 |
| 593 | Ga0495657_0034567 | 3300046675 | Bacteria | 3510 |
| 594 | Ga0495623_0630017 | 3300046679 | Bacteria | 555 |
| 595 | Ga0495646_0273637 | 3300046680 | Bacteria | 899 |
| 596 | Ga0495613_0609691 | 3300046689 | Bacteria | 726 |
| 597 | Ga0495624_0136347 | 3300046690 | Bacteria | 1504 |
| 598 | Ga0495670_0010861 | 3300046691 | Bacteria | 4475 |
| 599 | Ga0495670_0124853 | 3300046691 | Bacteria | 1339 |
| 600 | Ga0495670_0125560 | 3300046691 | Bacteria | 1335 |
| 601 | Ga0495670_0405791 | 3300046691 | Bacteria | 736 |
| 602 | Ga0495671_0025086 | 3300046692 | Bacteria | 3101 |
| 603 | Ga0495649_0098861 | 3300046694 | Bacteria | 1552 |
| 604 | Ga0495649_0132854 | 3300046694 | Bacteria | 1313 |
| 605 | Ga0495649_0230892 | 3300046694 | Bacteria | 955 |
| 606 | Ga0495660_0004419 | 3300046810 | Bacteria | 8512 |
| 607 | Ga0495660_0005703 | 3300046810 | Bacteria | 7437 |
| 608 | Ga0495660_0251591 | 3300046810 | Bacteria | 819 |
| 609 | Ga0495604_0021996 | 3300047317 | Bacteria | 5089 |
| 610 | Ga0495636_0006550 | 3300047318 | Bacteria | 4577 |
| 611 | Ga0495636_0028797 | 3300047318 | Bacteria | 2266 |
| 612 | Ga0495672_0015740 | 3300047320 | Bacteria | 5124 |
| 613 | Ga0495676_0237368 | 3300047321 | Bacteria | 1250 |
| 614 | Ga0495683_0108793 | 3300047323 | Bacteria | 1325 |
| 615 | Ga0495683_0225246 | 3300047323 | Bacteria | 834 |
| 616 | Ga0495687_006801 | 3300047443 | Bacteria | 6908 |
| 617 | Ga0495687_023996 | 3300047443 | Bacteria | 2906 |
| 618 | Ga0495677_0100233 | 3300047445 | Bacteria | 1096 |
| 619 | Ga0495685_025338 | 3300047447 | Bacteria | 2041 |
| 620 | Ga0495673_0081919 | 3300047469 | Bacteria | 1335 |
| 621 | Ga0495681_0070929 | 3300047470 | Bacteria | 1579 |
| 622 | Ga0495681_0139101 | 3300047470 | Bacteria | 1027 |
| 623 | Ga0495686_0002821 | 3300047472 | Bacteria | 15732 |
| 624 | Ga0495686_0004434 | 3300047472 | Bacteria | 11560 |
| 625 | Ga0495686_0040133 | 3300047472 | Bacteria | 2987 |
| 626 | Ga0495686_0054299 | 3300047472 | Bacteria | 2508 |
| 627 | Ga0495686_0086396 | 3300047472 | Bacteria | 1909 |
| 628 | Ga0495686_0180269 | 3300047472 | Bacteria | 1224 |
| 629 | Ga0495686_0340973 | 3300047472 | Bacteria | 817 |
| 630 | Ga0495602_0783170 | 3300048088 | Bacteria | 642 |
| 631 | Ga0495615_0009503 | 3300048090 | Bacteria | 1916 |
| 632 | Ga0495626_0060247 | 3300048091 | Bacteria | 1730 |
| 633 | Ga0496100_0069980 | 3300048903 | Bacteria | 2338 |
| 634 | Ga0496100_0097001 | 3300048903 | Bacteria | 2024 |
| 635 | Ga0496101_0366395 | 3300048904 | Bacteria | 1133 |
| 636 | Ga0496101_0394879 | 3300048904 | Bacteria | 1089 |
| 637 | Ga0496101_0435420 | 3300048904 | Bacteria | 1034 |
| 638 | Ga0496101_1292309 | 3300048904 | Bacteria | 571 |
| 639 | Ga0496101_1567764 | 3300048904 | Bacteria | 512 |
| 640 | Ga0496102_0028185 | 3300048905 | Bacteria | 5016 |
| 641 | Ga0496102_0513730 | 3300048905 | Bacteria | 1120 |
| 642 | Ga0496102_1768593 | 3300048905 | Bacteria | 535 |
| 643 | Ga0496102_1907778 | 3300048905 | Bacteria | 511 |
| 644 | Ga0496103_0016736 | 3300048906 | Bacteria | 4379 |
| 645 | Ga0496103_0287820 | 3300048906 | Bacteria | 1057 |
| 646 | Ga0496103_0413570 | 3300048906 | Bacteria | 866 |
| 647 | Ga0496104_0295268 | 3300048907 | Bacteria | 1533 |
| 648 | Ga0496104_0653497 | 3300048907 | Bacteria | 960 |
| 649 | Ga0496105_0301060 | 3300048908 | Bacteria | 1289 |
| 650 | Ga0496105_0737164 | 3300048908 | Bacteria | 753 |
| 651 | Ga0496105_0742704 | 3300048908 | Bacteria | 750 |
| 652 | Ga0496106_0004370 | 3300048909 | Bacteria | 10499 |
| 653 | Ga0496106_0042281 | 3300048909 | Bacteria | 3418 |
| 654 | Ga0496107_0305735 | 3300048910 | Bacteria | 1183 |
| 655 | Ga0496107_0615105 | 3300048910 | Bacteria | 802 |
| 656 | Ga0496108_0761168 | 3300048911 | Bacteria | 837 |
| 657 | Ga0496110_0058499 | 3300048913 | Bacteria | 3395 |
| 658 | Ga0496110_0560398 | 3300048913 | Bacteria | 1038 |
| 659 | Ga0496111_0002485 | 3300048914 | Bacteria | 11116 |
| 660 | Ga0496111_0827782 | 3300048914 | Bacteria | 669 |
| 661 | Ga0496112_1134886 | 3300048915 | Bacteria | 699 |
| 662 | Ga0496113_0020388 | 3300048916 | Bacteria | 4660 |
| 663 | Ga0496113_0199621 | 3300048916 | Bacteria | 1590 |
| 664 | Ga0496113_0433621 | 3300048916 | Bacteria | 1056 |
| 665 | Ga0496115_0114776 | 3300048918 | Bacteria | 2214 |
| 666 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 667 | Ga0496116_0013119 | 3300048919 | Bacteria | 6712 |
| 668 | Ga0496116_0017640 | 3300048919 | Bacteria | 5531 |
| 669 | Ga0496116_0034430 | 3300048919 | Bacteria | 3574 |
| 670 | Ga0496116_0036542 | 3300048919 | Bacteria | 3434 |
| 671 | Ga0496116_0044495 | 3300048919 | Bacteria | 3015 |
| 672 | Ga0496116_0057524 | 3300048919 | Bacteria | 2541 |
| 673 | Ga0496116_0079699 | 3300048919 | Bacteria | 2036 |
| 674 | Ga0496116_0085615 | 3300048919 | Bacteria | 1936 |
| 675 | Ga0496116_0103843 | 3300048919 | Bacteria | 1690 |
| 676 | Ga0496116_0165073 | 3300048919 | Bacteria | 1209 |
| 677 | Ga0496116_0206472 | 3300048919 | Bacteria | 1022 |
| 678 | Ga0496116_0236952 | 3300048919 | Bacteria | 920 |
| 679 | Ga0496116_0446722 | 3300048919 | Bacteria | 555 |
| 680 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 681 | Ga0496117_0005218 | 3300048920 | Bacteria | 13806 |
| 682 | Ga0496117_0005763 | 3300048920 | Bacteria | 12868 |
| 683 | Ga0496117_0006320 | 3300048920 | Bacteria | 12053 |
| 684 | Ga0496117_0053132 | 3300048920 | Bacteria | 2849 |
| 685 | Ga0496117_0209451 | 3300048920 | Bacteria | 1094 |
| 686 | Ga0496117_0265255 | 3300048920 | Bacteria | 928 |
| 687 | Ga0496117_0501062 | 3300048920 | Bacteria | 589 |
| 688 | Ga0496118_0002108 | 3300048921 | Bacteria | 27877 |
| 689 | Ga0496118_0011236 | 3300048921 | Bacteria | 8766 |
| 690 | Ga0496118_0020168 | 3300048921 | Bacteria | 5922 |
| 691 | Ga0496118_0025122 | 3300048921 | Bacteria | 5119 |
| 692 | Ga0496118_0054915 | 3300048921 | Bacteria | 3012 |
| 693 | Ga0496118_0096772 | 3300048921 | Bacteria | 2011 |
| 694 | Ga0496118_0104722 | 3300048921 | Bacteria | 1898 |
| 695 | Ga0496118_0350483 | 3300048921 | Bacteria | 787 |
| 696 | Ga0496119_0012077 | 3300048922 | Bacteria | 7057 |
| 697 | Ga0496119_0045071 | 3300048922 | Bacteria | 2769 |
| 698 | Ga0496119_0070145 | 3300048922 | Bacteria | 2057 |
| 699 | Ga0496119_0117422 | 3300048922 | Bacteria | 1467 |
| 700 | Ga0496119_0148290 | 3300048922 | Bacteria | 1260 |
| 701 | Ga0496119_0149016 | 3300048922 | Bacteria | 1256 |
| 702 | Ga0496119_0208472 | 3300048922 | Bacteria | 1007 |
| 703 | Ga0496119_0307496 | 3300048922 | Bacteria | 779 |
| 704 | Ga0496120_0000164 | 3300048923 | Bacteria | 111959 |
| 705 | Ga0496120_0041365 | 3300048923 | Bacteria | 2700 |
| 706 | Ga0496121_0000143 | 3300048924 | Bacteria | 159577 |
| 707 | Ga0496121_0001766 | 3300048924 | Bacteria | 35149 |
| 708 | Ga0496121_0006848 | 3300048924 | Bacteria | 13936 |
| 709 | Ga0496121_0019517 | 3300048924 | Bacteria | 6771 |
| 710 | Ga0496121_0021675 | 3300048924 | Bacteria | 6281 |
| 711 | Ga0496121_0035593 | 3300048924 | Bacteria | 4457 |
| 712 | Ga0496121_0113291 | 3300048924 | Bacteria | 2064 |
| 713 | Ga0496121_0133627 | 3300048924 | Bacteria | 1852 |
| 714 | Ga0496121_0145054 | 3300048924 | Bacteria | 1755 |
| 715 | Ga0496121_0166705 | 3300048924 | Bacteria | 1604 |
| 716 | Ga0496121_0193491 | 3300048924 | Bacteria | 1456 |
| 717 | Ga0496121_0217543 | 3300048924 | Bacteria | 1348 |
| 718 | Ga0496121_0436267 | 3300048924 | Bacteria | 848 |
| 719 | Ga0496121_0470263 | 3300048924 | Bacteria | 805 |
| 720 | Ga0496121_0870716 | 3300048924 | Bacteria | 521 |
| 721 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 722 | Ga0496122_0001424 | 3300048925 | Bacteria | 38740 |
| 723 | Ga0496122_0014992 | 3300048925 | Bacteria | 7447 |
| 724 | Ga0496122_0023147 | 3300048925 | Bacteria | 5489 |
| 725 | Ga0496122_0042005 | 3300048925 | Bacteria | 3604 |
| 726 | Ga0496122_0052406 | 3300048925 | Bacteria | 3089 |
| 727 | Ga0496122_0056862 | 3300048925 | Bacteria | 2911 |
| 728 | Ga0496122_0069274 | 3300048925 | Bacteria | 2527 |
| 729 | Ga0496122_0082971 | 3300048925 | Bacteria | 2224 |
| 730 | Ga0496122_0116946 | 3300048925 | Bacteria | 1732 |
| 731 | Ga0496122_0147062 | 3300048925 | Bacteria | 1462 |
| 732 | Ga0496122_0205249 | 3300048925 | Bacteria | 1147 |
| 733 | Ga0496122_0217556 | 3300048925 | Bacteria | 1099 |
| 734 | Ga0496122_0256914 | 3300048925 | Bacteria | 972 |
| 735 | Ga0496122_0297872 | 3300048925 | Bacteria | 871 |
| 736 | Ga0496122_0412798 | 3300048925 | Bacteria | 681 |
| 737 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 738 | Ga0496123_0001147 | 3300048926 | Bacteria | 39513 |
| 739 | Ga0496123_0011026 | 3300048926 | Bacteria | 7895 |
| 740 | Ga0496123_0016364 | 3300048926 | Bacteria | 6029 |
| 741 | Ga0496123_0022600 | 3300048926 | Bacteria | 4840 |
| 742 | Ga0496123_0038007 | 3300048926 | Bacteria | 3390 |
| 743 | Ga0496123_0040751 | 3300048926 | Bacteria | 3229 |
| 744 | Ga0496123_0048297 | 3300048926 | Bacteria | 2864 |
| 745 | Ga0496123_0057293 | 3300048926 | Bacteria | 2537 |
| 746 | Ga0496123_0188924 | 3300048926 | Bacteria | 1067 |
| 747 | Ga0496123_0398427 | 3300048926 | Bacteria | 627 |
| 748 | Ga0496124_0003004 | 3300048927 | Bacteria | 21101 |
| 749 | Ga0496124_0004440 | 3300048927 | Bacteria | 16357 |
| 750 | Ga0496124_0008164 | 3300048927 | Bacteria | 10985 |
| 751 | Ga0496124_0014197 | 3300048927 | Bacteria | 7717 |
| 752 | Ga0496124_0014344 | 3300048927 | Bacteria | 7665 |
| 753 | Ga0496124_0014740 | 3300048927 | Bacteria | 7544 |
| 754 | Ga0496124_0019883 | 3300048927 | Bacteria | 6229 |
| 755 | Ga0496124_0029107 | 3300048927 | Bacteria | 4928 |
| 756 | Ga0496124_0029120 | 3300048927 | Bacteria | 4926 |
| 757 | Ga0496124_0043528 | 3300048927 | Bacteria | 3860 |
| 758 | Ga0496124_0083763 | 3300048927 | Bacteria | 2616 |
| 759 | Ga0496124_0133870 | 3300048927 | Bacteria | 1965 |
| 760 | Ga0496124_0252188 | 3300048927 | Bacteria | 1304 |
| 761 | Ga0496124_0358508 | 3300048927 | Bacteria | 1028 |
| 762 | Ga0496124_0367373 | 3300048927 | Bacteria | 1011 |
| 763 | Ga0496124_0413403 | 3300048927 | Bacteria | 932 |
| 764 | Ga0496124_0429558 | 3300048927 | Bacteria | 907 |
| 765 | Ga0496124_0646303 | 3300048927 | Bacteria | 680 |
| 766 | Ga0496124_0659487 | 3300048927 | Bacteria | 670 |
| 767 | Ga0496125_0000564 | 3300048928 | Bacteria | 63635 |
| 768 | Ga0496125_0000585 | 3300048928 | Bacteria | 62191 |
| 769 | Ga0496125_0000589 | 3300048928 | Bacteria | 61966 |
| 770 | Ga0496125_0003773 | 3300048928 | Bacteria | 18023 |
| 771 | Ga0496125_0004692 | 3300048928 | Bacteria | 15572 |
| 772 | Ga0496125_0010306 | 3300048928 | Bacteria | 9464 |
| 773 | Ga0496125_0061172 | 3300048928 | Bacteria | 3021 |
| 774 | Ga0496125_0116340 | 3300048928 | Bacteria | 1920 |
| 775 | Ga0496125_0244891 | 3300048928 | Bacteria | 1135 |
| 776 | Ga0496126_0000059 | 3300048929 | Bacteria | 267449 |
| 777 | Ga0496126_0005852 | 3300048929 | Bacteria | 13881 |
| 778 | Ga0496126_0010139 | 3300048929 | Bacteria | 9922 |
| 779 | Ga0496126_0058717 | 3300048929 | Bacteria | 3466 |
| 780 | Ga0496126_0106668 | 3300048929 | Bacteria | 2445 |
| 781 | Ga0496126_0227357 | 3300048929 | Bacteria | 1564 |
| 782 | Ga0496126_0252384 | 3300048929 | Bacteria | 1469 |
| 783 | Ga0496126_0575510 | 3300048929 | Bacteria | 890 |
| 784 | Ga0495678_019884 | 3300049459 | Bacteria | 2985 |
| 785 | Ga0495678_036467 | 3300049459 | Bacteria | 2006 |
| 786 | Ga0495678_143066 | 3300049459 | Bacteria | 780 |
| 787 | Ga0495682_0038183 | 3300049460 | Bacteria | 1765 |
| 788 | Ga0501300_034757 | 3300049523 | Bacteria | 749 |
| 789 | Ga0501031_0001086 | 3300049568 | Bacteria | 16539 |
| 790 | Ga0501032_0000029 | 3300049569 | Bacteria | 130865 |
| 791 | Ga0501032_0082903 | 3300049569 | Bacteria | 2133 |
| 792 | Ga0501033_0000168 | 3300049570 | Bacteria | 62921 |
| 793 | Ga0501033_0444545 | 3300049570 | Bacteria | 901 |
| 794 | Ga0501033_0718987 | 3300049570 | Bacteria | 679 |
| 795 | Ga0501034_0000434 | 3300049571 | Bacteria | 69367 |
| 796 | Ga0501034_0044452 | 3300049571 | Bacteria | 4493 |
| 797 | Ga0501034_0181026 | 3300049571 | Bacteria | 2072 |
| 798 | Ga0501034_0209342 | 3300049571 | Bacteria | 1906 |
| 799 | Ga0501034_0758326 | 3300049571 | Bacteria | 865 |
| 800 | Ga0501034_1033431 | 3300049571 | Bacteria | 705 |
| 801 | Ga0501036_0000533 | 3300049572 | Bacteria | 27318 |
| 802 | Ga0501036_0142594 | 3300049572 | Bacteria | 2021 |
| 803 | Ga0501036_0355801 | 3300049572 | Bacteria | 1223 |
| 804 | Ga0501036_0909139 | 3300049572 | Bacteria | 722 |
| 805 | Ga0501037_0000335 | 3300049573 | Bacteria | 39826 |
| 806 | Ga0501037_0069872 | 3300049573 | Bacteria | 2556 |
| 807 | Ga0501037_0432443 | 3300049573 | Bacteria | 900 |
| 808 | Ga0501038_0000275 | 3300049574 | Bacteria | 43504 |
| 809 | Ga0501038_0065544 | 3300049574 | Bacteria | 3094 |
| 810 | Ga0501038_0539042 | 3300049574 | Bacteria | 889 |
| 811 | Ga0501039_0000040 | 3300049575 | Bacteria | 115567 |
| 812 | Ga0501039_0071693 | 3300049575 | Bacteria | 2692 |
| 813 | Ga0501040_1396604 | 3300049576 | Bacteria | 508 |
| 814 | Ga0501042_0194519 | 3300049578 | Bacteria | 1463 |
| 815 | Ga0501043_0000236 | 3300049579 | Bacteria | 49931 |
| 816 | Ga0501043_0029323 | 3300049579 | Bacteria | 4322 |
| 817 | Ga0501043_0106716 | 3300049579 | Bacteria | 2200 |
| 818 | Ga0501043_0188675 | 3300049579 | Bacteria | 1604 |
| 819 | Ga0501046_0047897 | 3300049580 | Bacteria | 3387 |
| 820 | Ga0501046_0173853 | 3300049580 | Bacteria | 1615 |
| 821 | Ga0501047_0066767 | 3300049581 | Bacteria | 3468 |
| 822 | Ga0501047_0150678 | 3300049581 | Bacteria | 2202 |
| 823 | Ga0501047_0246950 | 3300049581 | Bacteria | 1634 |
| 824 | Ga0501047_0629636 | 3300049581 | Bacteria | 893 |
| 825 | Ga0501047_0986521 | 3300049581 | Bacteria | 656 |
| 826 | Ga0501048_0103125 | 3300049582 | Bacteria | 2013 |
| 827 | Ga0501067_0013788 | 3300049583 | Bacteria | 4475 |
| 828 | Ga0501067_0208276 | 3300049583 | Bacteria | 1089 |
| 829 | Ga0501070_0980866 | 3300049586 | Bacteria | 656 |
| 830 | Ga0501072_0004658 | 3300049588 | Bacteria | 10444 |
| 831 | Ga0501073_0032035 | 3300049589 | Bacteria | 3750 |
| 832 | Ga0501073_0215933 | 3300049589 | Bacteria | 1325 |
| 833 | Ga0501073_0389870 | 3300049589 | Bacteria | 962 |
| 834 | Ga0501073_0400986 | 3300049589 | Bacteria | 948 |
| 835 | Ga0501074_0065811 | 3300049590 | Bacteria | 2608 |
| 836 | Ga0501080_0141903 | 3300049742 | Bacteria | 2220 |
| 837 | Ga0501080_0151854 | 3300049742 | Bacteria | 2140 |
| 838 | Ga0501083_0044847 | 3300049744 | Bacteria | 2993 |
| 839 | Ga0501083_0072315 | 3300049744 | Bacteria | 2292 |
| 840 | Ga0501083_0164631 | 3300049744 | Bacteria | 1450 |
| 841 | Ga0501280_009131 | 3300049776 | Bacteria | 1379 |
| 842 | Ga0501280_009598 | 3300049776 | Bacteria | 1346 |
| 843 | Ga0501035_0000557 | 3300049822 | Bacteria | 41380 |
| 844 | Ga0501035_0026110 | 3300049822 | Bacteria | 5349 |
| 845 | Ga0501035_0073092 | 3300049822 | Bacteria | 3034 |
| 846 | Ga0501044_0040916 | 3300049823 | Bacteria | 4827 |
| 847 | Ga0501044_0139732 | 3300049823 | Bacteria | 2411 |
| 848 | Ga0501044_0454639 | 3300049823 | Bacteria | 1187 |
| 849 | Ga0501045_0057684 | 3300049824 | Bacteria | 2842 |
| 850 | nmdc:mga03683_16426_c1 | 3300050489 | Bacteria | 2781 |
| 851 | nmdc:mga03683_166356_c1 | 3300050489 | Bacteria | 1001 |
| 852 | nmdc:mga03683_2140_c2 | 3300050489 | Bacteria | 4021 |
| 853 | nmdc:mga03n38_31455_c1 | 3300050490 | Bacteria | 2240 |
| 854 | nmdc:mga03n38_346214_c1 | 3300050490 | Bacteria | 808 |
| 855 | nmdc:mga03n38_382044_c1 | 3300050490 | Bacteria | 772 |
| 856 | nmdc:mga03n38_38515_c1 | 3300050490 | Bacteria | 2068 |
| 857 | nmdc:mga00v17_225_c1 | 3300050491 | Bacteria | 33638 |
| 858 | nmdc:mga00v17_360491_c1 | 3300050491 | Bacteria | 945 |
| 859 | nmdc:mga00v17_537955_c1 | 3300050491 | Bacteria | 756 |
| 860 | nmdc:mga00v17_5512_c1 | 3300050491 | Bacteria | 6667 |
| 861 | nmdc:mga00v17_9956_c1 | 3300050491 | Bacteria | 5171 |
| 862 | nmdc:mga0yw44_186400_c1 | 3300050492 | Bacteria | 1367 |
| 863 | nmdc:mga0yw44_260_c1 | 3300050492 | Bacteria | 18045 |
| 864 | nmdc:mga0yw44_5353_c1 | 3300050492 | Bacteria | 6044 |
| 865 | nmdc:mga0yw44_733120_c1 | 3300050492 | Bacteria | 671 |
| 866 | nmdc:mga0k408_211289_c1 | 3300050493 | Bacteria | 1159 |
| 867 | nmdc:mga0k408_4199_c1 | 3300050493 | Bacteria | 7643 |
| 868 | nmdc:mga0k408_62132_c1 | 3300050493 | Bacteria | 2172 |
| 869 | nmdc:mga06z11_106882_c1 | 3300050494 | Bacteria | 1544 |
| 870 | nmdc:mga06z11_323289_c1 | 3300050494 | Bacteria | 921 |
| 871 | nmdc:mga06z11_877475_c1 | 3300050494 | Bacteria | 547 |
| 872 | nmdc:mga04h51_13396_c1 | 3300050495 | Bacteria | 2321 |
| 873 | nmdc:mga04h51_29053_c1 | 3300050495 | Bacteria | 1729 |
| 874 | nmdc:mga04h51_54979_c1 | 3300050495 | Bacteria | 1347 |
| 875 | nmdc:mga07m45_183696_c1 | 3300050496 | Bacteria | 1216 |
| 876 | nmdc:mga07m45_28339_c1 | 3300050496 | Bacteria | 3091 |
| 877 | nmdc:mga07m45_77135_c1 | 3300050496 | Bacteria | 1900 |
| 878 | nmdc:mga0sz30_101760_c1 | 3300050516 | Bacteria | 1255 |
| 879 | nmdc:mga0sz30_138578_c1 | 3300050516 | Bacteria | 1074 |
| 880 | nmdc:mga0sz30_152941_c1 | 3300050516 | Bacteria | 1021 |
| 881 | nmdc:mga0sz30_230260_c1 | 3300050516 | Bacteria | 824 |
| 882 | nmdc:mga0sz30_42100_c1 | 3300050516 | Bacteria | 1921 |
| 883 | nmdc:mga0sz30_847_c1 | 3300050516 | Bacteria | 11032 |
| 884 | Ga0495601_0092215 | 3300053077 | Bacteria | 1951 |
| 885 | Ga0495601_0260168 | 3300053077 | Bacteria | 1133 |
| 886 | Ga0500610_0002446 | 3300053079 | Bacteria | 6847 |
| 887 | Ga0495619_0011837 | 3300053085 | Bacteria | 5496 |
| 888 | Ga0500578_0227425 | 3300053086 | Bacteria | 1131 |
| 889 | Ga0500578_0397602 | 3300053086 | Bacteria | 795 |
| 890 | Ga0500578_0460176 | 3300053086 | Bacteria | 722 |
| 891 | Ga0500651_0182415 | 3300053093 | Bacteria | 1246 |
| 892 | Ga0500650_0142669 | 3300053098 | Bacteria | 1110 |
| 893 | Ga0500557_003736 | 3300053105 | Bacteria | 3079 |
| 894 | Ga0500560_000198 | 3300053107 | Bacteria | 7105 |
| 895 | Ga0500560_063464 | 3300053107 | Bacteria | 1208 |
| 896 | Ga0500562_059887 | 3300053108 | Bacteria | 1023 |
| 897 | Ga0500569_002914 | 3300053109 | Bacteria | 3430 |
| 898 | Ga0500594_0001479 | 3300053118 | Bacteria | 5107 |
| 899 | Ga0500594_0036262 | 3300053118 | Bacteria | 1326 |
| 900 | Ga0500595_061261 | 3300053119 | Bacteria | 1136 |
| 901 | Ga0500595_098780 | 3300053119 | Bacteria | 838 |
| 902 | Ga0500608_216916 | 3300053122 | Bacteria | 776 |
| 903 | Ga0500618_001112 | 3300053125 | Bacteria | 13174 |
| 904 | Ga0500618_009083 | 3300053125 | Bacteria | 2733 |
| 905 | Ga0500618_010286 | 3300053125 | Bacteria | 2515 |
| 906 | Ga0500618_019462 | 3300053125 | Bacteria | 1671 |
| 907 | Ga0500618_023440 | 3300053125 | Bacteria | 1494 |
| 908 | Ga0500618_062752 | 3300053125 | Bacteria | 835 |
| 909 | Ga0500642_0237264 | 3300053130 | Bacteria | 841 |
| 910 | Ga0500658_0000213 | 3300053134 | Bacteria | 27553 |
| 911 | Ga0500658_0041272 | 3300053134 | Bacteria | 1850 |
| 912 | Ga0500559_0011446 | 3300053136 | Bacteria | 3788 |
| 913 | Ga0500561_0000227 | 3300053137 | Bacteria | 10167 |
| 914 | Ga0500568_0000096 | 3300053139 | Bacteria | 82567 |
| 915 | Ga0500568_0000405 | 3300053139 | Bacteria | 32864 |
| 916 | Ga0500568_0046150 | 3300053139 | Bacteria | 1731 |
| 917 | Ga0500573_0201308 | 3300053140 | Bacteria | 1057 |
| 918 | Ga0500577_0133128 | 3300053142 | Bacteria | 1043 |
| 919 | Ga0500604_0019820 | 3300053151 | Bacteria | 1887 |
| 920 | Ga0500604_0128931 | 3300053151 | Bacteria | 850 |
| 921 | Ga0500616_0044973 | 3300053153 | Bacteria | 2354 |
| 922 | Ga0500616_0058508 | 3300053153 | Bacteria | 2004 |
| 923 | Ga0500616_0441939 | 3300053153 | Bacteria | 513 |
| 924 | Ga0500622_0005360 | 3300053156 | Bacteria | 7721 |
| 925 | Ga0500624_015397 | 3300053157 | Bacteria | 1169 |
| 926 | Ga0500624_033013 | 3300053157 | Bacteria | 899 |
| 927 | Ga0500627_0090005 | 3300053158 | Bacteria | 1373 |
| 928 | Ga0500627_0464406 | 3300053158 | Bacteria | 531 |
| 929 | Ga0500633_0002284 | 3300053160 | Bacteria | 3907 |
| 930 | Ga0500633_0242236 | 3300053160 | Bacteria | 671 |
| 931 | Ga0500634_0000002 | 3300053161 | Bacteria | 252372 |
| 932 | Ga0500634_0018607 | 3300053161 | Bacteria | 3733 |
| 933 | Ga0500634_0041700 | 3300053161 | Bacteria | 2492 |
| 934 | Ga0500636_0000011 | 3300053177 | Bacteria | 140769 |
| 935 | Ga0501084_0016758 | 3300054114 | Bacteria | 6087 |
| 936 | Ga0501084_0047009 | 3300054114 | Bacteria | 3614 |
| 937 | Ga0501084_0431606 | 3300054114 | Bacteria | 1114 |
| 938 | Ga0501084_0729228 | 3300054114 | Bacteria | 835 |
| 939 | Ga0501082_0032764 | 3300060353 | Bacteria | 4482 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0016758 | Ga0501084_0016758_4350_4727 | 125 |
| 2 | 3300046477 | Ga0495664_0086510 | Ga0495664_0086510_885_1268 | 127 |
| 3 | iso_pu_bacteria | 2854681122 | 2854684504 | 128 |
| 4 | 3300013105 | Ga0157369_11600983 | Ga0157369_116009832 | 129 |
| 5 | 3300041411 | Ga0439466_0223540 | Ga0439466_0223540_30_419 | 129 |
| 6 | 3300041492 | Ga0451835_0708937 | Ga0451835_0708937_171_560 | 129 |
| 7 | 3300041997 | Ga0439431_0269340 | Ga0439431_0269340_54_443 | 129 |
| 8 | 3300042435 | Ga0439434_0218895 | Ga0439434_0218895_81_470 | 129 |
| 9 | 3300042436 | Ga0439435_0103648 | Ga0439435_0103648_340_729 | 129 |
| 10 | 3300049589 | Ga0501073_0400986 | Ga0501073_0400986_189_581 | 130 |
| 11 | iso_pu_bacteria | 2818991461 | 2819687195 | 130 |
| 12 | 3300046660 | Ga0495625_0016108 | Ga0495625_0016108_4112_4507 | 131 |
| 13 | iso_pu_bacteria | 2508501122 | 2509112468 | 131 |
| 14 | iso_pu_bacteria | 2509276019 | 2509379098 | 131 |
| 15 | iso_pu_bacteria | 2512875026 | 2512970186 | 131 |
| 16 | iso_pu_bacteria | 2513237089 | 2513602124 | 131 |
| 17 | iso_pu_bacteria | 2513237156 | 2513987146 | 131 |
| 18 | iso_pu_bacteria | 2513237160 | 2514003712 | 131 |
| 19 | iso_pu_bacteria | 2517487022 | 2517570777 | 131 |
| 20 | iso_pu_bacteria | 2558860100 | 2558860200 | 131 |
| 21 | iso_pu_bacteria | 2738541317 | 2738947387 | 131 |
| 22 | iso_pu_bacteria | 2802428858 | 2802718132 | 131 |
| 23 | iso_pu_bacteria | 2802428859 | 2802725016 | 131 |
| 24 | iso_pu_bacteria | 2802428860 | 2802730860 | 131 |
| 25 | iso_pu_bacteria | 2802428861 | 2802738208 | 131 |
| 26 | iso_pu_bacteria | 2802428862 | 2802743924 | 131 |
| 27 | iso_pu_bacteria | 2802428863 | 2802750802 | 131 |
| 28 | iso_pu_bacteria | 2913308742 | 2913312292 | 131 |
| 29 | iso_pu_bacteria | 2915980308 | 2915980324 | 131 |
| 30 | iso_pu_bacteria | 2916061851 | 2916066817 | 131 |
| 31 | iso_pu_bacteria | 2921250672 | 2921252141 | 131 |
| 32 | iso_pu_bacteria | 2937029754 | 2937032455 | 131 |
| 33 | iso_pu_bacteria | 2937036028 | 2937039830 | 131 |
| 34 | iso_pu_bacteria | 2937078374 | 2937078390 | 131 |
| 35 | iso_pu_bacteria | 2937084907 | 2937090900 | 131 |
| 36 | iso_pu_bacteria | 2957375807 | 2957378350 | 131 |
| 37 | iso_pu_bacteria | 2957437181 | 2957440262 | 131 |
| 38 | iso_pu_bacteria | 2960591022 | 2960591038 | 131 |
| 39 | iso_pu_bacteria | 2960631154 | 2960636341 | 131 |
| 40 | iso_pu_bacteria | 2960680706 | 2960685381 | 131 |
| 41 | iso_pu_bacteria | 2960693952 | 2960699627 | 131 |
| 42 | iso_pu_bacteria | 2967686174 | 2967691721 | 131 |
| 43 | iso_pu_bacteria | 2967728569 | 2967729505 | 131 |
| 44 | iso_pu_bacteria | 2970026789 | 2970033475 | 131 |
| 45 | iso_pu_bacteria | 2970122695 | 2970128798 | 131 |
| 46 | iso_pu_bacteria | 2970143518 | 2970148198 | 131 |
| 47 | iso_pu_bacteria | 2977530762 | 2977534115 | 131 |
| 48 | iso_pu_bacteria | 2977544691 | 2977549275 | 131 |
| 49 | iso_pu_bacteria | 8003999396 | 8004002317 | 131 |
| 50 | 3300003316 | rootH1_10152258 | rootH1_101522582 | 132 |
| 51 | 3300003320 | rootH2_10031031 | rootH2_100310319 | 132 |
| 52 | 3300003320 | rootH2_10083047 | rootH2_100830472 | 132 |
| 53 | 3300003322 | rootL2_10087378 | rootL2_100873781 | 132 |
| 54 | 3300003323 | rootH1_10049284 | rootH1_100492843 | 132 |
| 55 | 3300006042 | Ga0075368_10309975 | Ga0075368_103099752 | 132 |
| 56 | 3300006353 | Ga0075370_10150675 | Ga0075370_101506753 | 132 |
| 57 | 3300009093 | Ga0105240_12217276 | Ga0105240_122172762 | 132 |
| 58 | 3300009148 | Ga0105243_10268497 | Ga0105243_102684973 | 132 |
| 59 | 3300009545 | Ga0105237_10190489 | Ga0105237_101904893 | 132 |
| 60 | 3300010375 | Ga0105239_11908473 | Ga0105239_119084731 | 132 |
| 61 | 3300025914 | Ga0207671_10422014 | Ga0207671_104220143 | 132 |
| 62 | 3300025935 | Ga0207709_10145751 | Ga0207709_101457512 | 132 |
| 63 | 3300026078 | Ga0207702_11469956 | Ga0207702_114699562 | 132 |
| 64 | 3300031731 | Ga0307405_10876135 | Ga0307405_108761351 | 132 |
| 65 | 3300031731 | Ga0307405_10979039 | Ga0307405_109790392 | 132 |
| 66 | 3300031911 | Ga0307412_10062068 | Ga0307412_100620682 | 132 |
| 67 | 3300031911 | Ga0307412_10850240 | Ga0307412_108502402 | 132 |
| 68 | 3300032004 | Ga0307414_10031302 | Ga0307414_100313023 | 132 |
| 69 | 3300041451 | Ga0451791_0471423 | Ga0451791_0471423_707_1105 | 132 |
| 70 | 3300041486 | Ga0451807_0447172 | Ga0451807_0447172_401_799 | 132 |
| 71 | 3300044683 | Ga0466965_0099069 | Ga0466965_0099069_851_1249 | 132 |
| 72 | 3300045836 | Ga0466958_0231814 | Ga0466958_0231814_89_490 | 132 |
| 73 | 3300048090 | Ga0495615_0009503 | Ga0495615_0009503_1469_1867 | 132 |
| 74 | 3300048927 | Ga0496124_0646303 | Ga0496124_0646303_212_610 | 132 |
| 75 | 3300049570 | Ga0501033_0718987 | Ga0501033_0718987_186_584 | 132 |
| 76 | 3300049571 | Ga0501034_0209342 | Ga0501034_0209342_779_1177 | 132 |
| 77 | 3300049571 | Ga0501034_0758326 | Ga0501034_0758326_63_461 | 132 |
| 78 | 3300049579 | Ga0501043_0106716 | Ga0501043_0106716_62_460 | 132 |
| 79 | 3300049581 | Ga0501047_0150678 | Ga0501047_0150678_203_601 | 132 |
| 80 | 3300049581 | Ga0501047_0986521 | Ga0501047_0986521_20_418 | 132 |
| 81 | 3300049586 | Ga0501070_0980866 | Ga0501070_0980866_167_565 | 132 |
| 82 | 3300049589 | Ga0501073_0215933 | Ga0501073_0215933_612_1010 | 132 |
| 83 | 3300049744 | Ga0501083_0164631 | Ga0501083_0164631_547_945 | 132 |
| 84 | 3300049822 | Ga0501035_0026110 | Ga0501035_0026110_1065_1463 | 132 |
| 85 | 3300049823 | Ga0501044_0139732 | Ga0501044_0139732_1263_1661 | 132 |
| 86 | 3300050496 | nmdc:mga07m45_77135_c1 | nmdc:mga07m45_77135_c1_538_936 | 132 |
| 87 | 3300053108 | Ga0500562_059887 | Ga0500562_059887_282_680 | 132 |
| 88 | 3300053136 | Ga0500559_0011446 | Ga0500559_0011446_1630_2028 | 132 |
| 89 | 3300053139 | Ga0500568_0046150 | Ga0500568_0046150_376_774 | 132 |
| 90 | 3300053153 | Ga0500616_0441939 | Ga0500616_0441939_41_439 | 132 |
| 91 | 3300053158 | Ga0500627_0464406 | Ga0500627_0464406_45_443 | 132 |
| 92 | 3300054114 | Ga0501084_0729228 | Ga0501084_0729228_412_810 | 132 |
| 93 | iso_pu_bacteria | 2599185236 | 2599720145 | 132 |
| 94 | iso_pu_bacteria | 2643221591 | 2643965562 | 132 |
| 95 | iso_pu_bacteria | 2821123053 | 2821128543 | 132 |
| 96 | iso_pu_bacteria | 2838736955 | 2838741560 | 132 |
| 97 | iso_pu_bacteria | 2841840854 | 2841845605 | 132 |
| 98 | iso_pu_bacteria | 2842140634 | 2842145309 | 132 |
| 99 | iso_pu_bacteria | 2857531043 | 2857534304 | 132 |
| 100 | 3300005327 | Ga0070658_10017272 | Ga0070658_100172724 | 133 |
| 101 | 3300005329 | Ga0070683_100044090 | Ga0070683_1000440903 | 133 |
| 102 | 3300005331 | Ga0070670_101012134 | Ga0070670_1010121341 | 133 |
| 103 | 3300005337 | Ga0070682_100489930 | Ga0070682_1004899303 | 133 |
| 104 | 3300005338 | Ga0068868_100045047 | Ga0068868_1000450475 | 133 |
| 105 | 3300005339 | Ga0070660_100385585 | Ga0070660_1003855853 | 133 |
| 106 | 3300005344 | Ga0070661_100001446 | Ga0070661_10000144610 | 133 |
| 107 | 3300005366 | Ga0070659_100007639 | Ga0070659_1000076396 | 133 |
| 108 | 3300005366 | Ga0070659_100589014 | Ga0070659_1005890142 | 133 |
| 109 | 3300005367 | Ga0070667_100927078 | Ga0070667_1009270781 | 133 |
| 110 | 3300005455 | Ga0070663_100172605 | Ga0070663_1001726053 | 133 |
| 111 | 3300005455 | Ga0070663_100456881 | Ga0070663_1004568812 | 133 |
| 112 | 3300005456 | Ga0070678_100525214 | Ga0070678_1005252143 | 133 |
| 113 | 3300005459 | Ga0068867_100147252 | Ga0068867_1001472522 | 133 |
| 114 | 3300005535 | Ga0070684_100073206 | Ga0070684_1000732063 | 133 |
| 115 | 3300005539 | Ga0068853_100031644 | Ga0068853_1000316445 | 133 |
| 116 | 3300005539 | Ga0068853_100133323 | Ga0068853_1001333233 | 133 |
| 117 | 3300005547 | Ga0070693_100124673 | Ga0070693_1001246733 | 133 |
| 118 | 3300005548 | Ga0070665_101001956 | Ga0070665_1010019562 | 133 |
| 119 | 3300005548 | Ga0070665_101249323 | Ga0070665_1012493232 | 133 |
| 120 | 3300005563 | Ga0068855_100099528 | Ga0068855_1000995282 | 133 |
| 121 | 3300005563 | Ga0068855_100946216 | Ga0068855_1009462163 | 133 |
| 122 | 3300005563 | Ga0068855_101367829 | Ga0068855_1013678292 | 133 |
| 123 | 3300005577 | Ga0068857_100019717 | Ga0068857_1000197176 | 133 |
| 124 | 3300005577 | Ga0068857_100085044 | Ga0068857_1000850445 | 133 |
| 125 | 3300005578 | Ga0068854_100002452 | Ga0068854_1000024527 | 133 |
| 126 | 3300005578 | Ga0068854_100105200 | Ga0068854_1001052003 | 133 |
| 127 | 3300005616 | Ga0068852_100002904 | Ga0068852_1000029047 | 133 |
| 128 | 3300005616 | Ga0068852_100270712 | Ga0068852_1002707123 | 133 |
| 129 | 3300005616 | Ga0068852_100563181 | Ga0068852_1005631813 | 133 |
| 130 | 3300005834 | Ga0068851_10028883 | Ga0068851_100288835 | 133 |
| 131 | 3300006042 | Ga0075368_10040883 | Ga0075368_100408832 | 133 |
| 132 | 3300006048 | Ga0075363_100060344 | Ga0075363_1000603443 | 133 |
| 133 | 3300006051 | Ga0075364_10172507 | Ga0075364_101725072 | 133 |
| 134 | 3300006177 | Ga0075362_10214920 | Ga0075362_102149202 | 133 |
| 135 | 3300006178 | Ga0075367_10044316 | Ga0075367_100443163 | 133 |
| 136 | 3300006195 | Ga0075366_10058667 | Ga0075366_100586673 | 133 |
| 137 | 3300006353 | Ga0075370_10028427 | Ga0075370_100284274 | 133 |
| 138 | 3300006358 | Ga0068871_100624372 | Ga0068871_1006243722 | 133 |
| 139 | 3300009093 | Ga0105240_10116139 | Ga0105240_101161393 | 133 |
| 140 | 3300009174 | Ga0105241_10218315 | Ga0105241_102183153 | 133 |
| 141 | 3300009551 | Ga0105238_10018169 | Ga0105238_100181694 | 133 |
| 142 | 3300010375 | Ga0105239_10210486 | Ga0105239_102104861 | 133 |
| 143 | 3300010375 | Ga0105239_12364335 | Ga0105239_123643351 | 133 |
| 144 | 3300013102 | Ga0157371_10226699 | Ga0157371_102266992 | 133 |
| 145 | 3300013104 | Ga0157370_10237336 | Ga0157370_102373363 | 133 |
| 146 | 3300013296 | Ga0157374_10503729 | Ga0157374_105037293 | 133 |
| 147 | 3300013297 | Ga0157378_10191660 | Ga0157378_101916601 | 133 |
| 148 | 3300013307 | Ga0157372_10012923 | Ga0157372_100129232 | 133 |
| 149 | 3300013307 | Ga0157372_10455409 | Ga0157372_104554093 | 133 |
| 150 | 3300013308 | Ga0157375_10303902 | Ga0157375_103039024 | 133 |
| 151 | 3300014325 | Ga0163163_11341135 | Ga0163163_113411351 | 133 |
| 152 | 3300014497 | Ga0182008_10122763 | Ga0182008_101227632 | 133 |
| 153 | 3300014969 | Ga0157376_11872238 | Ga0157376_118722382 | 133 |
| 154 | 3300025321 | Ga0207656_10010673 | Ga0207656_100106736 | 133 |
| 155 | 3300025899 | Ga0207642_10819594 | Ga0207642_108195941 | 133 |
| 156 | 3300025909 | Ga0207705_10021220 | Ga0207705_100212204 | 133 |
| 157 | 3300025911 | Ga0207654_10302413 | Ga0207654_103024132 | 133 |
| 158 | 3300025914 | Ga0207671_10103478 | Ga0207671_101034784 | 133 |
| 159 | 3300025919 | Ga0207657_10003807 | Ga0207657_1000380717 | 133 |
| 160 | 3300025919 | Ga0207657_10225922 | Ga0207657_102259222 | 133 |
| 161 | 3300025920 | Ga0207649_10003241 | Ga0207649_100032417 | 133 |
| 162 | 3300025925 | Ga0207650_10883583 | Ga0207650_108835833 | 133 |
| 163 | 3300025927 | Ga0207687_10900942 | Ga0207687_109009422 | 133 |
| 164 | 3300025945 | Ga0207679_10370569 | Ga0207679_103705693 | 133 |
| 165 | 3300025949 | Ga0207667_10920614 | Ga0207667_109206142 | 133 |
| 166 | 3300025960 | Ga0207651_10177865 | Ga0207651_101778652 | 133 |
| 167 | 3300025972 | Ga0207668_11555671 | Ga0207668_115556712 | 133 |
| 168 | 3300025981 | Ga0207640_10335462 | Ga0207640_103354622 | 133 |
| 169 | 3300025986 | Ga0207658_10840713 | Ga0207658_108407132 | 133 |
| 170 | 3300026023 | Ga0207677_10960035 | Ga0207677_109600352 | 133 |
| 171 | 3300026041 | Ga0207639_10001619 | Ga0207639_100016196 | 133 |
| 172 | 3300026041 | Ga0207639_10088854 | Ga0207639_100888544 | 133 |
| 173 | 3300026067 | Ga0207678_10974322 | Ga0207678_109743222 | 133 |
| 174 | 3300026078 | Ga0207702_10188122 | Ga0207702_101881223 | 133 |
| 175 | 3300026078 | Ga0207702_10516068 | Ga0207702_105160681 | 133 |
| 176 | 3300026089 | Ga0207648_10191456 | Ga0207648_101914563 | 133 |
| 177 | 3300026116 | Ga0207674_10012034 | Ga0207674_100120346 | 133 |
| 178 | 3300026116 | Ga0207674_10079019 | Ga0207674_100790192 | 133 |
| 179 | 3300026121 | Ga0207683_10127259 | Ga0207683_101272593 | 133 |
| 180 | 3300026142 | Ga0207698_10013047 | Ga0207698_100130473 | 133 |
| 181 | 3300026142 | Ga0207698_10037678 | Ga0207698_100376786 | 133 |
| 182 | 3300026142 | Ga0207698_10612754 | Ga0207698_106127542 | 133 |
| 183 | 3300027866 | Ga0209813_10094142 | Ga0209813_100941421 | 133 |
| 184 | 3300031344 | Ga0265316_10038608 | Ga0265316_100386085 | 133 |
| 185 | 3300031901 | Ga0307406_10052070 | Ga0307406_100520702 | 133 |
| 186 | 3300034817 | Ga0373948_0050325 | Ga0373948_0050325_160_567 | 133 |
| 187 | 3300035691 | Ga0373931_0096189 | Ga0373931_0096189_337_744 | 133 |
| 188 | 3300041451 | Ga0451791_1264307 | Ga0451791_1264307_119_526 | 133 |
| 189 | 3300041459 | Ga0451800_0984752 | Ga0451800_0984752_300_707 | 133 |
| 190 | 3300048919 | Ga0496116_0103843 | Ga0496116_0103843_663_1073 | 133 |
| 191 | 3300048921 | Ga0496118_0350483 | Ga0496118_0350483_216_626 | 133 |
| 192 | 3300048924 | Ga0496121_0436267 | Ga0496121_0436267_179_589 | 133 |
| 193 | 3300048927 | Ga0496124_0043528 | Ga0496124_0043528_2212_2622 | 133 |
| 194 | 3300048927 | Ga0496124_0413403 | Ga0496124_0413403_260_670 | 133 |
| 195 | 3300048927 | Ga0496124_0659487 | Ga0496124_0659487_65_475 | 133 |
| 196 | 3300048928 | Ga0496125_0000585 | Ga0496125_0000585_54797_55207 | 133 |
| 197 | 3300048929 | Ga0496126_0106668 | Ga0496126_0106668_1355_1762 | 133 |
| 198 | 3300049571 | Ga0501034_0044452 | Ga0501034_0044452_717_1118 | 133 |
| 199 | 3300049571 | Ga0501034_1033431 | Ga0501034_1033431_252_659 | 133 |
| 200 | 3300049572 | Ga0501036_0355801 | Ga0501036_0355801_487_897 | 133 |
| 201 | 3300049574 | Ga0501038_0539042 | Ga0501038_0539042_440_850 | 133 |
| 202 | 3300049581 | Ga0501047_0629636 | Ga0501047_0629636_128_538 | 133 |
| 203 | 3300049589 | Ga0501073_0389870 | Ga0501073_0389870_78_485 | 133 |
| 204 | 3300049823 | Ga0501044_0454639 | Ga0501044_0454639_276_683 | 133 |
| 205 | 3300050489 | nmdc:mga03683_166356_c1 | nmdc:mga03683_166356_c1_87_494 | 133 |
| 206 | 3300050492 | nmdc:mga0yw44_186400_c1 | nmdc:mga0yw44_186400_c1_725_1132 | 133 |
| 207 | 3300050493 | nmdc:mga0k408_62132_c1 | nmdc:mga0k408_62132_c1_1536_1943 | 133 |
| 208 | 3300050495 | nmdc:mga04h51_29053_c1 | nmdc:mga04h51_29053_c1_539_946 | 133 |
| 209 | 3300053119 | Ga0500595_061261 | Ga0500595_061261_10_417 | 133 |
| 210 | 3300053119 | Ga0500595_098780 | Ga0500595_098780_289_696 | 133 |
| 211 | 3300053125 | Ga0500618_062752 | Ga0500618_062752_167_571 | 133 |
| 212 | 3300053140 | Ga0500573_0201308 | Ga0500573_0201308_614_1021 | 133 |
| 213 | 3300053157 | Ga0500624_015397 | Ga0500624_015397_439_846 | 133 |
| 214 | 3300053161 | Ga0500634_0000002 | Ga0500634_0000002_11670_12077 | 133 |
| 215 | iso_pu_bacteria | 2510065019 | 2510135018 | 133 |
| 216 | iso_pu_bacteria | 2510461069 | 2510842584 | 133 |
| 217 | iso_pu_bacteria | 2510461076 | 2510896443 | 133 |
| 218 | iso_pu_bacteria | 2510917028 | 2511182840 | 133 |
| 219 | iso_pu_bacteria | 2510917030 | 2511199704 | 133 |
| 220 | iso_pu_bacteria | 2513237084 | 2513571388 | 133 |
| 221 | iso_pu_bacteria | 2513237085 | 2513581355 | 133 |
| 222 | iso_pu_bacteria | 2513237088 | 2513599730 | 133 |
| 223 | iso_pu_bacteria | 2513237093 | 2513630445 | 133 |
| 224 | iso_pu_bacteria | 2513237103 | 2513713968 | 133 |
| 225 | iso_pu_bacteria | 2513237138 | 2513869422 | 133 |
| 226 | iso_pu_bacteria | 2513237144 | 2513912952 | 133 |
| 227 | iso_pu_bacteria | 2513237146 | 2513929895 | 133 |
| 228 | iso_pu_bacteria | 2513237162 | 2514024227 | 133 |
| 229 | iso_pu_bacteria | 2515075009 | 2515114104 | 133 |
| 230 | iso_pu_bacteria | 2515154113 | 2515636367 | 133 |
| 231 | iso_pu_bacteria | 2515154114 | 2515646290 | 133 |
| 232 | iso_pu_bacteria | 2515154116 | 2515660527 | 133 |
| 233 | iso_pu_bacteria | 2515154134 | 2515741336 | 133 |
| 234 | iso_pu_bacteria | 2516143018 | 2516204989 | 133 |
| 235 | iso_pu_bacteria | 2516653077 | 2517037742 | 133 |
| 236 | iso_pu_bacteria | 2516653085 | 2517078055 | 133 |
| 237 | iso_pu_bacteria | 2517093000 | 2517096824 | 133 |
| 238 | iso_pu_bacteria | 2517287029 | 2517408762 | 133 |
| 239 | iso_pu_bacteria | 2519899620 | 2520380661 | 133 |
| 240 | iso_pu_bacteria | 2529292951 | 2530647554 | 133 |
| 241 | iso_pu_bacteria | 2534681796 | 2535518746 | 133 |
| 242 | iso_pu_bacteria | 2537561587 | 2537875788 | 133 |
| 243 | iso_pu_bacteria | 2554235003 | 2554245377 | 133 |
| 244 | iso_pu_bacteria | 2558860242 | 2559296794 | 133 |
| 245 | iso_pu_bacteria | 2582581298 | 2585223730 | 133 |
| 246 | iso_pu_bacteria | 2582581299 | 2585228900 | 133 |
| 247 | iso_pu_bacteria | 2582581304 | 2585257553 | 133 |
| 248 | iso_pu_bacteria | 2582581306 | 2585270342 | 133 |
| 249 | iso_pu_bacteria | 2582581308 | 2585280530 | 133 |
| 250 | iso_pu_bacteria | 2582581315 | 2585327895 | 133 |
| 251 | iso_pu_bacteria | 2582581316 | 2585334355 | 133 |
| 252 | iso_pu_bacteria | 2582581865 | 2585391486 | 133 |
| 253 | iso_pu_bacteria | 2582581866 | 2585394719 | 133 |
| 254 | iso_pu_bacteria | 2582581867 | 2585403601 | 133 |
| 255 | iso_pu_bacteria | 2585427526 | 2585530101 | 133 |
| 256 | iso_pu_bacteria | 2585427527 | 2585531468 | 133 |
| 257 | iso_pu_bacteria | 2585427528 | 2585543750 | 133 |
| 258 | iso_pu_bacteria | 2585427529 | 2585548953 | 133 |
| 259 | iso_pu_bacteria | 2585427530 | 2585557715 | 133 |
| 260 | iso_pu_bacteria | 2585427590 | 2585824205 | 133 |
| 261 | iso_pu_bacteria | 2585427593 | 2585842110 | 133 |
| 262 | iso_pu_bacteria | 2585427633 | 2585994528 | 133 |
| 263 | iso_pu_bacteria | 2599185170 | 2599420389 | 133 |
| 264 | iso_pu_bacteria | 2599185210 | 2599602715 | 133 |
| 265 | iso_pu_bacteria | 2599185352 | 2600197469 | 133 |
| 266 | iso_pu_bacteria | 2600255279 | 2601610336 | 133 |
| 267 | iso_pu_bacteria | 2600255308 | 2601747334 | 133 |
| 268 | iso_pu_bacteria | 2615840624 | 2616297915 | 133 |
| 269 | iso_pu_bacteria | 2615840626 | 2616306924 | 133 |
| 270 | iso_pu_bacteria | 2615840698 | 2616557786 | 133 |
| 271 | iso_pu_bacteria | 2617270742 | 2617386286 | 133 |
| 272 | iso_pu_bacteria | 2643221557 | 2643806792 | 133 |
| 273 | iso_pu_bacteria | 2643221568 | 2643854143 | 133 |
| 274 | iso_pu_bacteria | 2643221582 | 2643917228 | 133 |
| 275 | iso_pu_bacteria | 2643221599 | 2644002318 | 133 |
| 276 | iso_pu_bacteria | 2643221607 | 2644050825 | 133 |
| 277 | iso_pu_bacteria | 2643221610 | 2644064686 | 133 |
| 278 | iso_pu_bacteria | 2643221634 | 2644194078 | 133 |
| 279 | iso_pu_bacteria | 2643221636 | 2644205328 | 133 |
| 280 | iso_pu_bacteria | 2643221643 | 2644240741 | 133 |
| 281 | iso_pu_bacteria | 2643221653 | 2644300086 | 133 |
| 282 | iso_pu_bacteria | 2643221668 | 2644376321 | 133 |
| 283 | iso_pu_bacteria | 2643221675 | 2644416359 | 133 |
| 284 | iso_pu_bacteria | 2643221680 | 2644449399 | 133 |
| 285 | iso_pu_bacteria | 2643221686 | 2644483729 | 133 |
| 286 | iso_pu_bacteria | 2643221689 | 2644500442 | 133 |
| 287 | iso_pu_bacteria | 2643221693 | 2644520921 | 133 |
| 288 | iso_pu_bacteria | 2643221719 | 2644658312 | 133 |
| 289 | iso_pu_bacteria | 2643221723 | 2644676975 | 133 |
| 290 | iso_pu_bacteria | 2643221726 | 2644687972 | 133 |
| 291 | iso_pu_bacteria | 2667528174 | 2671113669 | 133 |
| 292 | iso_pu_bacteria | 2690316117 | 2692314863 | 133 |
| 293 | iso_pu_bacteria | 2718217882 | 2719182762 | 133 |
| 294 | iso_pu_bacteria | 2718217927 | 2719387448 | 133 |
| 295 | iso_pu_bacteria | 2718218009 | 2719733479 | 133 |
| 296 | iso_pu_bacteria | 2718218363 | 2721148874 | 133 |
| 297 | iso_pu_bacteria | 2718218365 | 2721160258 | 133 |
| 298 | iso_pu_bacteria | 2718218366 | 2721165687 | 133 |
| 299 | iso_pu_bacteria | 2718218423 | 2721401082 | 133 |
| 300 | iso_pu_bacteria | 2721755514 | 2722841857 | 133 |
| 301 | iso_pu_bacteria | 2721755809 | 2724039896 | 133 |
| 302 | iso_pu_bacteria | 2721755810 | 2724046235 | 133 |
| 303 | iso_pu_bacteria | 2724679232 | 2725947266 | 133 |
| 304 | iso_pu_bacteria | 2728369365 | 2730165997 | 133 |
| 305 | iso_pu_bacteria | 2728369397 | 2730299890 | 133 |
| 306 | iso_pu_bacteria | 2738541333 | 2739038964 | 133 |
| 307 | iso_pu_bacteria | 2765235942 | 2766062448 | 133 |
| 308 | iso_pu_bacteria | 2775507049 | 2776915277 | 133 |
| 309 | iso_pu_bacteria | 2775507266 | 2778176193 | 133 |
| 310 | iso_pu_bacteria | 2791355082 | 2792582766 | 133 |
| 311 | iso_pu_bacteria | 2791355091 | 2792624711 | 133 |
| 312 | iso_pu_bacteria | 2791355092 | 2792630763 | 133 |
| 313 | iso_pu_bacteria | 2791355094 | 2792643610 | 133 |
| 314 | iso_pu_bacteria | 2791355253 | 2793282660 | 133 |
| 315 | iso_pu_bacteria | 2791355256 | 2793299536 | 133 |
| 316 | iso_pu_bacteria | 2791355260 | 2793325147 | 133 |
| 317 | iso_pu_bacteria | 2791355261 | 2793330907 | 133 |
| 318 | iso_pu_bacteria | 2791355262 | 2793337746 | 133 |
| 319 | iso_pu_bacteria | 2791355263 | 2793338589 | 133 |
| 320 | iso_pu_bacteria | 2791355264 | 2793346399 | 133 |
| 321 | iso_pu_bacteria | 2791355265 | 2793357286 | 133 |
| 322 | iso_pu_bacteria | 2791355266 | 2793363963 | 133 |
| 323 | iso_pu_bacteria | 2791355267 | 2793370895 | 133 |
| 324 | iso_pu_bacteria | 2802429605 | 2805931576 | 133 |
| 325 | iso_pu_bacteria | 2802429606 | 2805937599 | 133 |
| 326 | iso_pu_bacteria | 2802429633 | 2806049318 | 133 |
| 327 | iso_pu_bacteria | 2802429634 | 2806056276 | 133 |
| 328 | iso_pu_bacteria | 2802429635 | 2806063450 | 133 |
| 329 | iso_pu_bacteria | 2802429636 | 2806070987 | 133 |
| 330 | iso_pu_bacteria | 2802429637 | 2806077868 | 133 |
| 331 | iso_pu_bacteria | 2808606387 | 2808987249 | 133 |
| 332 | iso_pu_bacteria | 2818991272 | 2819243580 | 133 |
| 333 | iso_pu_bacteria | 2818991439 | 2819557418 | 133 |
| 334 | iso_pu_bacteria | 2818991448 | 2819611052 | 133 |
| 335 | iso_pu_bacteria | 2818991453 | 2819639017 | 133 |
| 336 | iso_pu_bacteria | 2837678835 | 2837678873 | 133 |
| 337 | iso_pu_bacteria | 2838022645 | 2838028667 | 133 |
| 338 | iso_pu_bacteria | 2838029111 | 2838030739 | 133 |
| 339 | iso_pu_bacteria | 2838035591 | 2838042271 | 133 |
| 340 | iso_pu_bacteria | 2838074704 | 2838077158 | 133 |
| 341 | iso_pu_bacteria | 2838661181 | 2838668336 | 133 |
| 342 | iso_pu_bacteria | 2838668709 | 2838674776 | 133 |
| 343 | iso_pu_bacteria | 2838675328 | 2838678077 | 133 |
| 344 | iso_pu_bacteria | 2838680041 | 2838686444 | 133 |
| 345 | iso_pu_bacteria | 2838686498 | 2838693999 | 133 |
| 346 | iso_pu_bacteria | 2838694306 | 2838698630 | 133 |
| 347 | iso_pu_bacteria | 2838701080 | 2838707079 | 133 |
| 348 | iso_pu_bacteria | 2838707686 | 2838714165 | 133 |
| 349 | iso_pu_bacteria | 2838714209 | 2838717016 | 133 |
| 350 | iso_pu_bacteria | 2838719591 | 2838722373 | 133 |
| 351 | iso_pu_bacteria | 2838724970 | 2838727766 | 133 |
| 352 | iso_pu_bacteria | 2838729681 | 2838731795 | 133 |
| 353 | iso_pu_bacteria | 2838742623 | 2838749389 | 133 |
| 354 | iso_pu_bacteria | 2841846520 | 2841849422 | 133 |
| 355 | iso_pu_bacteria | 2841851746 | 2841858778 | 133 |
| 356 | iso_pu_bacteria | 2841859092 | 2841861535 | 133 |
| 357 | iso_pu_bacteria | 2842077413 | 2842081547 | 133 |
| 358 | iso_pu_bacteria | 2842110456 | 2842116194 | 133 |
| 359 | iso_pu_bacteria | 2842118031 | 2842124906 | 133 |
| 360 | iso_pu_bacteria | 2842124991 | 2842127829 | 133 |
| 361 | iso_pu_bacteria | 2842130223 | 2842132970 | 133 |
| 362 | iso_pu_bacteria | 2842146304 | 2842149824 | 133 |
| 363 | iso_pu_bacteria | 2842152218 | 2842154964 | 133 |
| 364 | iso_pu_bacteria | 2842156927 | 2842163464 | 133 |
| 365 | iso_pu_bacteria | 2842163707 | 2842166436 | 133 |
| 366 | iso_pu_bacteria | 2842170452 | 2842173463 | 133 |
| 367 | iso_pu_bacteria | 2842175837 | 2842178584 | 133 |
| 368 | iso_pu_bacteria | 2842180545 | 2842187032 | 133 |
| 369 | iso_pu_bacteria | 2842187318 | 2842190124 | 133 |
| 370 | iso_pu_bacteria | 2842192696 | 2842198660 | 133 |
| 371 | iso_pu_bacteria | 2842198810 | 2842204684 | 133 |
| 372 | iso_pu_bacteria | 2842205361 | 2842207197 | 133 |
| 373 | iso_pu_bacteria | 2842211629 | 2842214438 | 133 |
| 374 | iso_pu_bacteria | 2842217011 | 2842224129 | 133 |
| 375 | iso_pu_bacteria | 2842224351 | 2842227157 | 133 |
| 376 | iso_pu_bacteria | 2842229732 | 2842235899 | 133 |
| 377 | iso_pu_bacteria | 2842237096 | 2842243567 | 133 |
| 378 | iso_pu_bacteria | 2842243621 | 2842250404 | 133 |
| 379 | iso_pu_bacteria | 2842250916 | 2842256917 | 133 |
| 380 | iso_pu_bacteria | 2842257432 | 2842264298 | 133 |
| 381 | iso_pu_bacteria | 2842271015 | 2842278481 | 133 |
| 382 | iso_pu_bacteria | 2842278818 | 2842281092 | 133 |
| 383 | iso_pu_bacteria | 2842285085 | 2842288293 | 133 |
| 384 | iso_pu_bacteria | 2842291075 | 2842295203 | 133 |
| 385 | iso_pu_bacteria | 2842298080 | 2842303714 | 133 |
| 386 | iso_pu_bacteria | 2842304105 | 2842306112 | 133 |
| 387 | iso_pu_bacteria | 2842317721 | 2842320897 | 133 |
| 388 | iso_pu_bacteria | 2842357229 | 2842362222 | 133 |
| 389 | iso_pu_bacteria | 2842370503 | 2842374779 | 133 |
| 390 | iso_pu_bacteria | 2842377471 | 2842381603 | 133 |
| 391 | iso_pu_bacteria | 2842384541 | 2842388672 | 133 |
| 392 | iso_pu_bacteria | 2842402390 | 2842408598 | 133 |
| 393 | iso_pu_bacteria | 2842409023 | 2842415251 | 133 |
| 394 | iso_pu_bacteria | 2842415677 | 2842421870 | 133 |
| 395 | iso_pu_bacteria | 2842475841 | 2842477471 | 133 |
| 396 | iso_pu_bacteria | 2842482326 | 2842488039 | 133 |
| 397 | iso_pu_bacteria | 2842489311 | 2842490948 | 133 |
| 398 | iso_pu_bacteria | 2842495871 | 2842498287 | 133 |
| 399 | iso_pu_bacteria | 2842502639 | 2842504656 | 133 |
| 400 | iso_pu_bacteria | 2842509118 | 2842511911 | 133 |
| 401 | iso_pu_bacteria | 2842515876 | 2842518199 | 133 |
| 402 | iso_pu_bacteria | 2844454524 | 2844457282 | 133 |
| 403 | iso_pu_bacteria | 2847417321 | 2847420079 | 133 |
| 404 | iso_pu_bacteria | 2848992105 | 2848994990 | 133 |
| 405 | iso_pu_bacteria | 2850079185 | 2850082094 | 133 |
| 406 | iso_pu_bacteria | 2852387548 | 2852391485 | 133 |
| 407 | iso_pu_bacteria | 2855872281 | 2855874705 | 133 |
| 408 | iso_pu_bacteria | 2857516855 | 2857521236 | 133 |
| 409 | iso_pu_bacteria | 2896384573 | 2896387864 | 133 |
| 410 | iso_pu_bacteria | 2899792073 | 2899792657 | 133 |
| 411 | iso_pu_bacteria | 2899845264 | 2899850102 | 133 |
| 412 | iso_pu_bacteria | 2913295892 | 2913299617 | 133 |
| 413 | iso_pu_bacteria | 2919100787 | 2919105187 | 133 |
| 414 | iso_pu_bacteria | 2919114240 | 2919117274 | 133 |
| 415 | iso_pu_bacteria | 2919166419 | 2919168530 | 133 |
| 416 | iso_pu_bacteria | 2919408235 | 2919410871 | 133 |
| 417 | iso_pu_bacteria | 2920760137 | 2920760997 | 133 |
| 418 | iso_pu_bacteria | 2920822456 | 2920828747 | 133 |
| 419 | iso_pu_bacteria | 2926754445 | 2926758721 | 133 |
| 420 | iso_pu_bacteria | 2926760298 | 2926763749 | 133 |
| 421 | iso_pu_bacteria | 2929138655 | 2929141570 | 133 |
| 422 | iso_pu_bacteria | 2933006813 | 2933009654 | 133 |
| 423 | iso_pu_bacteria | 2933011516 | 2933013827 | 133 |
| 424 | iso_pu_bacteria | 2933016740 | 2933019599 | 133 |
| 425 | iso_pu_bacteria | 2933570622 | 2933572615 | 133 |
| 426 | iso_pu_bacteria | 2933586486 | 2933592412 | 133 |
| 427 | iso_pu_bacteria | 2933594066 | 2933595641 | 133 |
| 428 | iso_pu_bacteria | 2935894831 | 2935901284 | 133 |
| 429 | iso_pu_bacteria | 2935901341 | 2935903892 | 133 |
| 430 | iso_pu_bacteria | 2936375103 | 2936379351 | 133 |
| 431 | iso_pu_bacteria | 2936381700 | 2936385936 | 133 |
| 432 | iso_pu_bacteria | 2941499720 | 2941501944 | 133 |
| 433 | iso_pu_bacteria | 2978969890 | 2978971215 | 133 |
| 434 | iso_pu_bacteria | 2979089926 | 2979091210 | 133 |
| 435 | iso_pu_bacteria | 2979095461 | 2979096734 | 133 |
| 436 | iso_pu_bacteria | 2979100975 | 2979102457 | 133 |
| 437 | iso_pu_bacteria | 2984509177 | 2984509657 | 133 |
| 438 | iso_pu_bacteria | 2984537506 | 2984537995 | 133 |
| 439 | iso_pu_bacteria | 2984587000 | 2984588362 | 133 |
| 440 | iso_pu_bacteria | 2984601300 | 2984604739 | 133 |
| 441 | iso_pu_bacteria | 2989776772 | 2989779841 | 133 |
| 442 | iso_pu_bacteria | 2996887358 | 2996891034 | 133 |
| 443 | iso_pu_bacteria | 3005409236 | 3005409442 | 133 |
| 444 | iso_pu_bacteria | 3005416602 | 3005421827 | 133 |
| 445 | iso_pu_bacteria | 3005445848 | 3005449463 | 133 |
| 446 | iso_pu_bacteria | 3005452660 | 3005455789 | 133 |
| 447 | iso_pu_bacteria | 639633055 | 639650178 | 133 |
| 448 | iso_pu_bacteria | 643692032 | 643826862 | 133 |
| 449 | iso_pu_bacteria | 650716007 | 650843215 | 133 |
| 450 | iso_pu_bacteria | 8003570095 | 8003572793 | 133 |
| 451 | iso_pu_bacteria | 8005246636 | 8005249016 | 133 |
| 452 | iso_pu_bacteria | 8005258706 | 8005262784 | 133 |
| 453 | iso_pu_bacteria | 8005275841 | 8005282198 | 133 |
| 454 | iso_pu_bacteria | 8005289223 | 8005292199 | 133 |
| 455 | iso_pu_bacteria | 8005301065 | 8005302421 | 133 |
| 456 | iso_pu_bacteria | 8005307578 | 8005313442 | 133 |
| 457 | iso_pu_bacteria | 8005314921 | 8005319473 | 133 |
| 458 | iso_pu_bacteria | 8005321885 | 8005325561 | 133 |
| 459 | iso_pu_bacteria | 8005376324 | 8005381801 | 133 |
| 460 | iso_pu_bacteria | 8005382845 | 8005387983 | 133 |
| 461 | iso_pu_bacteria | 8005460587 | 8005464794 | 133 |
| 462 | iso_pu_bacteria | 8005542996 | 8005546452 | 133 |
| 463 | iso_pu_bacteria | 8005556819 | 8005560863 | 133 |
| 464 | iso_pu_bacteria | 8005563573 | 8005565063 | 133 |
| 465 | iso_pu_bacteria | 8005570704 | 8005576761 | 133 |
| 466 | iso_pu_bacteria | 8005645114 | 8005646758 | 133 |
| 467 | iso_pu_bacteria | 8005682033 | 8005687657 | 133 |
| 468 | iso_pu_bacteria | 8005688590 | 8005691320 | 133 |
| 469 | iso_pu_bacteria | 8018127388 | 8018130744 | 133 |
| 470 | iso_pu_bacteria | 8018163183 | 8018169537 | 133 |
| 471 | iso_pu_bacteria | 8018176218 | 8018178314 | 133 |
| 472 | iso_pu_bacteria | 8023680758 | 8023686280 | 133 |
| 473 | iso_pu_bacteria | 8024479707 | 8024482457 | 133 |
| 474 | iso_pu_bacteria | 8024486573 | 8024490641 | 133 |
| 475 | iso_pu_bacteria | 8024501048 | 8024504784 | 133 |
| 476 | iso_pu_bacteria | 8049293176 | 8049295719 | 133 |
| 477 | iso_pu_bacteria | 8056375014 | 8056379569 | 133 |
| 478 | iso_pu_bacteria | 8056382006 | 8056384021 | 133 |
| 479 | iso_pu_bacteria | 8057575449 | 8057580658 | 133 |
| 480 | iso_pu_bacteria | 8057874678 | 8057879975 | 133 |
| 481 | 3300025933 | Ga0207706_10382385 | Ga0207706_103823852 | 134 |
| 482 | 3300025972 | Ga0207668_10998019 | Ga0207668_109980192 | 134 |
| 483 | iso_pu_bacteria | 2582581283 | 2585167776 | 134 |
| 484 | iso_pu_bacteria | 2643221618 | 2644108733 | 134 |
| 485 | iso_pu_bacteria | 2643221626 | 2644149768 | 134 |
| 486 | iso_pu_bacteria | 2643221655 | 2644311129 | 134 |
| 487 | iso_pu_bacteria | 2643221659 | 2644335036 | 134 |
| 488 | iso_pu_bacteria | 2643221698 | 2644544522 | 134 |
| 489 | iso_pu_bacteria | 2643221712 | 2644616959 | 134 |
| 490 | iso_pu_bacteria | 2844163670 | 2844168884 | 134 |
| 491 | iso_pu_bacteria | 8054558443 | 8054563000 | 134 |
| 492 | 3300005331 | Ga0070670_100000117 | Ga0070670_1000001179 | 135 |
| 493 | 3300006051 | Ga0075364_10006976 | Ga0075364_1000697611 | 135 |
| 494 | 3300006946 | Ga0079104_1013490 | Ga0079104_10134902 | 135 |
| 495 | 3300006948 | Ga0099826_10109008 | Ga0099826_101090082 | 135 |
| 496 | 3300021321 | Ga0214542_1034961 | Ga0214542_10349611 | 135 |
| 497 | 3300021327 | Ga0214543_1000008 | Ga0214543_100000813 | 135 |
| 498 | 3300022739 | Ga0228711_1000022 | Ga0228711_100002217 | 135 |
| 499 | 3300022740 | Ga0228710_1000028 | Ga0228710_100002817 | 135 |
| 500 | 3300025925 | Ga0207650_10001181 | Ga0207650_1000118113 | 135 |
| 501 | 3300027111 | Ga0209281_1000247 | Ga0209281_100024717 | 135 |
| 502 | 3300027666 | Ga0209282_1000037 | Ga0209282_1000037118 | 135 |
| 503 | 3300031967 | Ga0315914_1000002 | Ga0315914_100000217 | 135 |
| 504 | 3300033430 | Ga0315913_1000018 | Ga0315913_100001883 | 135 |
| 505 | 3300033464 | Ga0315915_1000005 | Ga0315915_100000517 | 135 |
| 506 | 3300041507 | Ga0451851_0365326 | Ga0451851_0365326_44_451 | 135 |
| 507 | 3300048913 | Ga0496110_0058499 | Ga0496110_0058499_930_1337 | 135 |
| 508 | 3300048914 | Ga0496111_0002485 | Ga0496111_0002485_1415_1822 | 135 |
| 509 | 3300048925 | Ga0496122_0056862 | Ga0496122_0056862_1999_2406 | 135 |
| 510 | 3300048926 | Ga0496123_0011026 | Ga0496123_0011026_150_557 | 135 |
| 511 | 3300048927 | Ga0496124_0029120 | Ga0496124_0029120_1032_1439 | 135 |
| 512 | 3300053122 | Ga0500608_216916 | Ga0500608_216916_69_479 | 135 |
| 513 | 3300053125 | Ga0500618_019462 | Ga0500618_019462_1178_1588 | 135 |
| 514 | iso_pu_bacteria | 2842694124 | 2842696401 | 135 |
| 515 | 3300006946 | Ga0079104_1000101 | Ga0079104_100010114 | 136 |
| 516 | 3300027111 | Ga0209281_1000028 | Ga0209281_1000028208 | 136 |
| 517 | 3300046660 | Ga0495625_0523251 | Ga0495625_0523251_147_557 | 136 |
| 518 | 3300047472 | Ga0495686_0086396 | Ga0495686_0086396_239_649 | 136 |
| 519 | 3300048927 | Ga0496124_0019883 | Ga0496124_0019883_1154_1564 | 136 |
| 520 | 3300049568 | Ga0501031_0001086 | Ga0501031_0001086_948_1358 | 136 |
| 521 | 3300049569 | Ga0501032_0000029 | Ga0501032_0000029_108396_108806 | 136 |
| 522 | 3300049570 | Ga0501033_0000168 | Ga0501033_0000168_46980_47390 | 136 |
| 523 | 3300049571 | Ga0501034_0000434 | Ga0501034_0000434_46981_47391 | 136 |
| 524 | 3300049572 | Ga0501036_0000533 | Ga0501036_0000533_7676_8086 | 136 |
| 525 | 3300049573 | Ga0501037_0000335 | Ga0501037_0000335_21965_22375 | 136 |
| 526 | 3300049574 | Ga0501038_0000275 | Ga0501038_0000275_21122_21532 | 136 |
| 527 | 3300049575 | Ga0501039_0000040 | Ga0501039_0000040_92444_92854 | 136 |
| 528 | 3300049576 | Ga0501040_1396604 | Ga0501040_1396604_45_455 | 136 |
| 529 | 3300049578 | Ga0501042_0194519 | Ga0501042_0194519_537_947 | 136 |
| 530 | 3300049579 | Ga0501043_0000236 | Ga0501043_0000236_27512_27922 | 136 |
| 531 | 3300049580 | Ga0501046_0047897 | Ga0501046_0047897_2432_2842 | 136 |
| 532 | 3300049581 | Ga0501047_0246950 | Ga0501047_0246950_435_845 | 136 |
| 533 | 3300049822 | Ga0501035_0000557 | Ga0501035_0000557_18809_19219 | 136 |
| 534 | 3300049823 | Ga0501044_0040916 | Ga0501044_0040916_417_827 | 136 |
| 535 | 3300049824 | Ga0501045_0057684 | Ga0501045_0057684_741_1151 | 136 |
| 536 | 3300050491 | nmdc:mga00v17_360491_c1 | nmdc:mga00v17_360491_c1_53_463 | 136 |
| 537 | 3300053125 | Ga0500618_001112 | Ga0500618_001112_6918_7328 | 136 |
| 538 | 3300053130 | Ga0500642_0237264 | Ga0500642_0237264_207_623 | 136 |
| 539 | 3300053139 | Ga0500568_0000096 | Ga0500568_0000096_66373_66789 | 136 |
| 540 | iso_pu_bacteria | 2891373044 | 2891373805 | 136 |
| 541 | iso_pu_bacteria | 2989349275 | 2989354792 | 136 |
| 542 | 3300001979 | JGI24740J21852_10000006 | JGI24740J21852_1000000619 | 137 |
| 543 | 3300001989 | JGI24739J22299_10267310 | JGI24739J22299_102673101 | 137 |
| 544 | 3300002704 | JGI25155J39150_1000010 | JGI25155J39150_1000010190 | 137 |
| 545 | 3300002705 | JGI25156J39149_1000186 | JGI25156J39149_100018619 | 137 |
| 546 | 3300002737 | JGI25162J39368_1001145 | JGI25162J39368_100114515 | 137 |
| 547 | 3300002737 | JGI25162J39368_1001856 | JGI25162J39368_100185613 | 137 |
| 548 | 3300002738 | JGI25154J39366_1000187 | JGI25154J39366_100018727 | 137 |
| 549 | 3300002739 | JGI25158J39367_1000078 | JGI25158J39367_100007820 | 137 |
| 550 | 3300002739 | JGI25158J39367_1001106 | JGI25158J39367_10011062 | 137 |
| 551 | 3300002741 | JGI25157J39369_1000009 | JGI25157J39369_1000009189 | 137 |
| 552 | 3300002773 | JGI25152J39213_1001233 | JGI25152J39213_100123311 | 137 |
| 553 | 3300002773 | JGI25152J39213_1005065 | JGI25152J39213_10050651 | 137 |
| 554 | 3300002773 | JGI25152J39213_1007357 | JGI25152J39213_10073573 | 137 |
| 555 | 3300002773 | JGI25152J39213_1014180 | JGI25152J39213_10141804 | 137 |
| 556 | 3300002774 | JGI25150J39212_1000061 | JGI25150J39212_100006120 | 137 |
| 557 | 3300002774 | JGI25150J39212_1001592 | JGI25150J39212_10015924 | 137 |
| 558 | 3300002987 | JGI25159J45721_1000705 | JGI25159J45721_10007052 | 137 |
| 559 | 3300002987 | JGI25159J45721_1006597 | JGI25159J45721_10065974 | 137 |
| 560 | 3300003187 | JGI25151J46595_10000081 | JGI25151J46595_1000008167 | 137 |
| 561 | 3300003187 | JGI25151J46595_10001107 | JGI25151J46595_1000110710 | 137 |
| 562 | 3300003187 | JGI25151J46595_10010445 | JGI25151J46595_100104452 | 137 |
| 563 | 3300003187 | JGI25151J46595_10015280 | JGI25151J46595_100152805 | 137 |
| 564 | 3300003187 | JGI25151J46595_10043100 | JGI25151J46595_100431004 | 137 |
| 565 | 3300003187 | JGI25151J46595_10131101 | JGI25151J46595_101311011 | 137 |
| 566 | 3300003214 | JGI25165J46597_1000931 | JGI25165J46597_10009314 | 137 |
| 567 | 3300003214 | JGI25165J46597_1001497 | JGI25165J46597_10014974 | 137 |
| 568 | 3300003215 | JGI25153J46596_10012416 | JGI25153J46596_100124164 | 137 |
| 569 | 3300003215 | JGI25153J46596_10012547 | JGI25153J46596_100125474 | 137 |
| 570 | 3300003215 | JGI25153J46596_10018618 | JGI25153J46596_100186183 | 137 |
| 571 | 3300003322 | rootL2_10071739 | rootL2_100717399 | 137 |
| 572 | 3300003322 | rootL2_10230007 | rootL2_102300071 | 137 |
| 573 | 3300003354 | JGI25160J50197_1000085 | JGI25160J50197_100008525 | 137 |
| 574 | 3300003354 | JGI25160J50197_1000247 | JGI25160J50197_100024723 | 137 |
| 575 | 3300003354 | JGI25160J50197_1000573 | JGI25160J50197_100057312 | 137 |
| 576 | 3300003354 | JGI25160J50197_1015877 | JGI25160J50197_10158774 | 137 |
| 577 | 3300003374 | JGI25161J50226_1000065 | JGI25161J50226_100006525 | 137 |
| 578 | 3300003374 | JGI25161J50226_1000136 | JGI25161J50226_100013646 | 137 |
| 579 | 3300003374 | JGI25161J50226_1000620 | JGI25161J50226_100062012 | 137 |
| 580 | 3300003374 | JGI25161J50226_1001517 | JGI25161J50226_10015175 | 137 |
| 581 | 3300003771 | Ga0055526_1001073 | Ga0055526_100107315 | 137 |
| 582 | 3300003771 | Ga0055526_1001171 | Ga0055526_10011719 | 137 |
| 583 | 3300003771 | Ga0055526_1011715 | Ga0055526_10117154 | 137 |
| 584 | 3300003771 | Ga0055526_1011819 | Ga0055526_10118194 | 137 |
| 585 | 3300003771 | Ga0055526_1017122 | Ga0055526_10171225 | 137 |
| 586 | 3300003771 | Ga0055526_1017528 | Ga0055526_10175282 | 137 |
| 587 | 3300003775 | Ga0055524_1001593 | Ga0055524_10015934 | 137 |
| 588 | 3300003775 | Ga0055524_1001808 | Ga0055524_10018089 | 137 |
| 589 | 3300003775 | Ga0055524_1003160 | Ga0055524_10031604 | 137 |
| 590 | 3300003775 | Ga0055524_1004890 | Ga0055524_10048909 | 137 |
| 591 | 3300003775 | Ga0055524_1013856 | Ga0055524_10138564 | 137 |
| 592 | 3300003775 | Ga0055524_1018215 | Ga0055524_10182153 | 137 |
| 593 | 3300003775 | Ga0055524_1040205 | Ga0055524_10402053 | 137 |
| 594 | 3300003775 | Ga0055524_1056699 | Ga0055524_10566992 | 137 |
| 595 | 3300003781 | Ga0055536_1001369 | Ga0055536_10013693 | 137 |
| 596 | 3300003790 | Ga0055528_1000998 | Ga0055528_10009984 | 137 |
| 597 | 3300003790 | Ga0055528_1001541 | Ga0055528_10015414 | 137 |
| 598 | 3300003790 | Ga0055528_1004794 | Ga0055528_10047949 | 137 |
| 599 | 3300003790 | Ga0055528_1008492 | Ga0055528_10084925 | 137 |
| 600 | 3300003790 | Ga0055528_1009155 | Ga0055528_10091555 | 137 |
| 601 | 3300003790 | Ga0055528_1014264 | Ga0055528_10142644 | 137 |
| 602 | 3300003790 | Ga0055528_1022360 | Ga0055528_10223603 | 137 |
| 603 | 3300003790 | Ga0055528_1036936 | Ga0055528_10369362 | 137 |
| 604 | 3300003791 | Ga0055530_10008430 | Ga0055530_100084307 | 137 |
| 605 | 3300003792 | Ga0055540_1004170 | Ga0055540_10041703 | 137 |
| 606 | 3300003792 | Ga0055540_1008152 | Ga0055540_10081524 | 137 |
| 607 | 3300003792 | Ga0055540_1009578 | Ga0055540_10095784 | 137 |
| 608 | 3300003792 | Ga0055540_1025029 | Ga0055540_10250292 | 137 |
| 609 | 3300003792 | Ga0055540_1027739 | Ga0055540_10277392 | 137 |
| 610 | 3300003794 | Ga0055531_10007968 | Ga0055531_100079687 | 137 |
| 611 | 3300003794 | Ga0055531_10055202 | Ga0055531_100552021 | 137 |
| 612 | 3300003856 | Ga0058692_1000999 | Ga0058692_100099914 | 137 |
| 613 | 3300003856 | Ga0058692_1001038 | Ga0058692_100103811 | 137 |
| 614 | 3300003856 | Ga0058692_1004538 | Ga0058692_10045385 | 137 |
| 615 | 3300004625 | Ga0055543_1000067 | Ga0055543_100006724 | 137 |
| 616 | 3300004625 | Ga0055543_1000228 | Ga0055543_100022819 | 137 |
| 617 | 3300004625 | Ga0055543_1000461 | Ga0055543_100046112 | 137 |
| 618 | 3300004625 | Ga0055543_1000496 | Ga0055543_10004968 | 137 |
| 619 | 3300005262 | Ga0065165_1000237 | Ga0065165_100023779 | 137 |
| 620 | 3300005262 | Ga0065165_1000804 | Ga0065165_100080423 | 137 |
| 621 | 3300005262 | Ga0065165_1013013 | Ga0065165_10130134 | 137 |
| 622 | 3300005262 | Ga0065165_1017307 | Ga0065165_10173072 | 137 |
| 623 | 3300005262 | Ga0065165_1060064 | Ga0065165_10600642 | 137 |
| 624 | 3300005262 | Ga0065165_1066922 | Ga0065165_10669222 | 137 |
| 625 | 3300005289 | Ga0065704_10288861 | Ga0065704_102888611 | 137 |
| 626 | 3300005331 | Ga0070670_100117569 | Ga0070670_1001175692 | 137 |
| 627 | 3300005335 | Ga0070666_10475267 | Ga0070666_104752672 | 137 |
| 628 | 3300005347 | Ga0070668_100177326 | Ga0070668_1001773262 | 137 |
| 629 | 3300005347 | Ga0070668_100337499 | Ga0070668_1003374992 | 137 |
| 630 | 3300005347 | Ga0070668_100389022 | Ga0070668_1003890223 | 137 |
| 631 | 3300005347 | Ga0070668_101196096 | Ga0070668_1011960962 | 137 |
| 632 | 3300005353 | Ga0070669_100076983 | Ga0070669_1000769833 | 137 |
| 633 | 3300005353 | Ga0070669_100493471 | Ga0070669_1004934712 | 137 |
| 634 | 3300005355 | Ga0070671_100043577 | Ga0070671_1000435772 | 137 |
| 635 | 3300005367 | Ga0070667_100538785 | Ga0070667_1005387851 | 137 |
| 636 | 3300005539 | Ga0068853_100719345 | Ga0068853_1007193451 | 137 |
| 637 | 3300005548 | Ga0070665_100009302 | Ga0070665_1000093025 | 137 |
| 638 | 3300005548 | Ga0070665_100102624 | Ga0070665_1001026242 | 137 |
| 639 | 3300005548 | Ga0070665_100159944 | Ga0070665_1001599445 | 137 |
| 640 | 3300005548 | Ga0070665_100263451 | Ga0070665_1002634511 | 137 |
| 641 | 3300005548 | Ga0070665_100351786 | Ga0070665_1003517861 | 137 |
| 642 | 3300005563 | Ga0068855_100152322 | Ga0068855_1001523221 | 137 |
| 643 | 3300005616 | Ga0068852_100713165 | Ga0068852_1007131651 | 137 |
| 644 | 3300005719 | Ga0068861_102410655 | Ga0068861_1024106551 | 137 |
| 645 | 3300005844 | Ga0068862_102512770 | Ga0068862_1025127701 | 137 |
| 646 | 3300006038 | Ga0075365_10003552 | Ga0075365_100035525 | 137 |
| 647 | 3300006038 | Ga0075365_10076293 | Ga0075365_100762934 | 137 |
| 648 | 3300006038 | Ga0075365_10479402 | Ga0075365_104794022 | 137 |
| 649 | 3300006042 | Ga0075368_10033372 | Ga0075368_100333723 | 137 |
| 650 | 3300006042 | Ga0075368_10080740 | Ga0075368_100807402 | 137 |
| 651 | 3300006042 | Ga0075368_10475228 | Ga0075368_104752281 | 137 |
| 652 | 3300006048 | Ga0075363_100025004 | Ga0075363_1000250043 | 137 |
| 653 | 3300006048 | Ga0075363_100100368 | Ga0075363_1001003681 | 137 |
| 654 | 3300006048 | Ga0075363_100167443 | Ga0075363_1001674431 | 137 |
| 655 | 3300006051 | Ga0075364_10090776 | Ga0075364_100907762 | 137 |
| 656 | 3300006051 | Ga0075364_10259139 | Ga0075364_102591392 | 137 |
| 657 | 3300006177 | Ga0075362_10010373 | Ga0075362_100103734 | 137 |
| 658 | 3300006177 | Ga0075362_10231919 | Ga0075362_102319192 | 137 |
| 659 | 3300006178 | Ga0075367_10002378 | Ga0075367_100023789 | 137 |
| 660 | 3300006178 | Ga0075367_10020524 | Ga0075367_100205241 | 137 |
| 661 | 3300006178 | Ga0075367_10351943 | Ga0075367_103519431 | 137 |
| 662 | 3300006178 | Ga0075367_10403665 | Ga0075367_104036652 | 137 |
| 663 | 3300006186 | Ga0075369_10000556 | Ga0075369_100005564 | 137 |
| 664 | 3300006186 | Ga0075369_10001596 | Ga0075369_100015965 | 137 |
| 665 | 3300006186 | Ga0075369_10011871 | Ga0075369_100118713 | 137 |
| 666 | 3300006186 | Ga0075369_10018986 | Ga0075369_100189863 | 137 |
| 667 | 3300006186 | Ga0075369_10026625 | Ga0075369_100266253 | 137 |
| 668 | 3300006186 | Ga0075369_10166395 | Ga0075369_101663952 | 137 |
| 669 | 3300006195 | Ga0075366_10003442 | Ga0075366_100034425 | 137 |
| 670 | 3300006195 | Ga0075366_10112785 | Ga0075366_101127852 | 137 |
| 671 | 3300006353 | Ga0075370_10012653 | Ga0075370_100126534 | 137 |
| 672 | 3300006353 | Ga0075370_10025702 | Ga0075370_100257021 | 137 |
| 673 | 3300006353 | Ga0075370_10194611 | Ga0075370_101946112 | 137 |
| 674 | 3300006844 | Ga0075428_100528715 | Ga0075428_1005287154 | 137 |
| 675 | 3300006948 | Ga0099826_10000590 | Ga0099826_1000059020 | 137 |
| 676 | 3300006948 | Ga0099826_10032648 | Ga0099826_100326482 | 137 |
| 677 | 3300009011 | Ga0105251_10015497 | Ga0105251_100154973 | 137 |
| 678 | 3300009036 | Ga0105244_10103397 | Ga0105244_101033972 | 137 |
| 679 | 3300009092 | Ga0105250_10032609 | Ga0105250_100326094 | 137 |
| 680 | 3300009093 | Ga0105240_10000013 | Ga0105240_1000001322 | 137 |
| 681 | 3300009148 | Ga0105243_10855822 | Ga0105243_108558222 | 137 |
| 682 | 3300009148 | Ga0105243_11255511 | Ga0105243_112555111 | 137 |
| 683 | 3300009177 | Ga0105248_10090815 | Ga0105248_100908153 | 137 |
| 684 | 3300009545 | Ga0105237_10001167 | Ga0105237_1000116725 | 137 |
| 685 | 3300009545 | Ga0105237_10801268 | Ga0105237_108012682 | 137 |
| 686 | 3300009551 | Ga0105238_10819002 | Ga0105238_108190022 | 137 |
| 687 | 3300009553 | Ga0105249_10639932 | Ga0105249_106399322 | 137 |
| 688 | 3300009763 | Ga0123340_1042431 | Ga0123340_10424314 | 137 |
| 689 | 3300009765 | Ga0123341_1000187 | Ga0123341_100018710 | 137 |
| 690 | 3300009765 | Ga0123341_1079145 | Ga0123341_10791452 | 137 |
| 691 | 3300009766 | Ga0123342_1016630 | Ga0123342_10166309 | 137 |
| 692 | 3300009766 | Ga0123342_1024950 | Ga0123342_10249501 | 137 |
| 693 | 3300010375 | Ga0105239_10093668 | Ga0105239_100936682 | 137 |
| 694 | 3300010375 | Ga0105239_10498833 | Ga0105239_104988333 | 137 |
| 695 | 3300013100 | Ga0157373_10025106 | Ga0157373_100251066 | 137 |
| 696 | 3300013100 | Ga0157373_10037599 | Ga0157373_100375996 | 137 |
| 697 | 3300013100 | Ga0157373_10048623 | Ga0157373_100486233 | 137 |
| 698 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002254 | 137 |
| 699 | 3300013102 | Ga0157371_10007550 | Ga0157371_100075509 | 137 |
| 700 | 3300013102 | Ga0157371_10163292 | Ga0157371_101632922 | 137 |
| 701 | 3300013104 | Ga0157370_10000143 | Ga0157370_100001436 | 137 |
| 702 | 3300013104 | Ga0157370_10006960 | Ga0157370_100069609 | 137 |
| 703 | 3300013104 | Ga0157370_11213204 | Ga0157370_112132042 | 137 |
| 704 | 3300013105 | Ga0157369_10219048 | Ga0157369_102190483 | 137 |
| 705 | 3300013249 | Ga0171463_1006 | Ga0171463_100622 | 137 |
| 706 | 3300013307 | Ga0157372_11896665 | Ga0157372_118966652 | 137 |
| 707 | 3300013308 | Ga0157375_11230542 | Ga0157375_112305422 | 137 |
| 708 | 3300014325 | Ga0163163_11822364 | Ga0163163_118223642 | 137 |
| 709 | 3300015262 | Ga0182007_10001582 | Ga0182007_100015827 | 137 |
| 710 | 3300015265 | Ga0182005_1007805 | Ga0182005_10078053 | 137 |
| 711 | 3300015690 | Ga0183363_1095 | Ga0183363_10958 | 137 |
| 712 | 3300017792 | Ga0163161_10374982 | Ga0163161_103749822 | 137 |
| 713 | 3300017792 | Ga0163161_10921347 | Ga0163161_109213472 | 137 |
| 714 | 3300021320 | Ga0214544_1000132 | Ga0214544_100013288 | 137 |
| 715 | 3300021321 | Ga0214542_1004982 | Ga0214542_100498212 | 137 |
| 716 | 3300021327 | Ga0214543_1000102 | Ga0214543_100010218 | 137 |
| 717 | 3300021384 | Ga0213876_10110405 | Ga0213876_101104052 | 137 |
| 718 | 3300025206 | Ga0209435_100009 | Ga0209435_100009446 | 137 |
| 719 | 3300025208 | Ga0209436_100089 | Ga0209436_10008918 | 137 |
| 720 | 3300025208 | Ga0209436_100790 | Ga0209436_10079013 | 137 |
| 721 | 3300025228 | Ga0209672_101912 | Ga0209672_1019123 | 137 |
| 722 | 3300025231 | Ga0207427_111005 | Ga0207427_1110052 | 137 |
| 723 | 3300025233 | Ga0209437_100057 | Ga0209437_10005720 | 137 |
| 724 | 3300025233 | Ga0209437_100452 | Ga0209437_10045219 | 137 |
| 725 | 3300025233 | Ga0209437_103994 | Ga0209437_1039943 | 137 |
| 726 | 3300025245 | Ga0207425_1000034 | Ga0207425_1000034157 | 137 |
| 727 | 3300025245 | Ga0207425_1004151 | Ga0207425_10041512 | 137 |
| 728 | 3300025245 | Ga0207425_1004943 | Ga0207425_10049436 | 137 |
| 729 | 3300025245 | Ga0207425_1020525 | Ga0207425_10205254 | 137 |
| 730 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018446 | 137 |
| 731 | 3300025246 | Ga0209646_1026581 | Ga0209646_10265811 | 137 |
| 732 | 3300025250 | Ga0209026_1000068 | Ga0209026_1000068188 | 137 |
| 733 | 3300025253 | Ga0209677_101882 | Ga0209677_1018826 | 137 |
| 734 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007446 | 137 |
| 735 | 3300025258 | Ga0209129_1000094 | Ga0209129_1000094102 | 137 |
| 736 | 3300025258 | Ga0209129_1000290 | Ga0209129_100029025 | 137 |
| 737 | 3300025258 | Ga0209129_1000519 | Ga0209129_100051927 | 137 |
| 738 | 3300025258 | Ga0209129_1001202 | Ga0209129_10012027 | 137 |
| 739 | 3300025258 | Ga0209129_1001250 | Ga0209129_100125011 | 137 |
| 740 | 3300025258 | Ga0209129_1009271 | Ga0209129_10092712 | 137 |
| 741 | 3300025261 | Ga0209233_1000134 | Ga0209233_100013420 | 137 |
| 742 | 3300025261 | Ga0209233_1000343 | Ga0209233_100034319 | 137 |
| 743 | 3300025261 | Ga0209233_1000367 | Ga0209233_100036720 | 137 |
| 744 | 3300025272 | Ga0209455_1009867 | Ga0209455_10098671 | 137 |
| 745 | 3300025273 | Ga0209673_1000158 | Ga0209673_1000158116 | 137 |
| 746 | 3300025273 | Ga0209673_1000283 | Ga0209673_100028385 | 137 |
| 747 | 3300025273 | Ga0209673_1000771 | Ga0209673_100077117 | 137 |
| 748 | 3300025273 | Ga0209673_1002843 | Ga0209673_100284315 | 137 |
| 749 | 3300025273 | Ga0209673_1010655 | Ga0209673_10106554 | 137 |
| 750 | 3300025273 | Ga0209673_1016456 | Ga0209673_10164564 | 137 |
| 751 | 3300025273 | Ga0209673_1025562 | Ga0209673_10255621 | 137 |
| 752 | 3300025273 | Ga0209673_1076855 | Ga0209673_10768551 | 137 |
| 753 | 3300025273 | Ga0209673_1076873 | Ga0209673_10768731 | 137 |
| 754 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009464 | 137 |
| 755 | 3300025284 | Ga0209130_1000265 | Ga0209130_100026524 | 137 |
| 756 | 3300025284 | Ga0209130_1000465 | Ga0209130_100046520 | 137 |
| 757 | 3300025284 | Ga0209130_1009861 | Ga0209130_10098614 | 137 |
| 758 | 3300025284 | Ga0209130_1036575 | Ga0209130_10365752 | 137 |
| 759 | 3300025291 | Ga0209675_1025119 | Ga0209675_10251192 | 137 |
| 760 | 3300025292 | Ga0209676_1003840 | Ga0209676_100384013 | 137 |
| 761 | 3300025292 | Ga0209676_1040802 | Ga0209676_10408022 | 137 |
| 762 | 3300025292 | Ga0209676_1057007 | Ga0209676_10570072 | 137 |
| 763 | 3300025294 | Ga0209025_1000184 | Ga0209025_100018468 | 137 |
| 764 | 3300025294 | Ga0209025_1000245 | Ga0209025_1000245100 | 137 |
| 765 | 3300025294 | Ga0209025_1000725 | Ga0209025_100072543 | 137 |
| 766 | 3300025294 | Ga0209025_1001475 | Ga0209025_100147519 | 137 |
| 767 | 3300025294 | Ga0209025_1001628 | Ga0209025_10016288 | 137 |
| 768 | 3300025294 | Ga0209025_1002008 | Ga0209025_100200816 | 137 |
| 769 | 3300025294 | Ga0209025_1003091 | Ga0209025_10030912 | 137 |
| 770 | 3300025294 | Ga0209025_1016825 | Ga0209025_10168255 | 137 |
| 771 | 3300025294 | Ga0209025_1019068 | Ga0209025_10190682 | 137 |
| 772 | 3300025294 | Ga0209025_1019090 | Ga0209025_10190903 | 137 |
| 773 | 3300025294 | Ga0209025_1065561 | Ga0209025_10655612 | 137 |
| 774 | 3300025295 | Ga0209564_1000381 | Ga0209564_100038168 | 137 |
| 775 | 3300025295 | Ga0209564_1000960 | Ga0209564_100096020 | 137 |
| 776 | 3300025295 | Ga0209564_1001128 | Ga0209564_100112817 | 137 |
| 777 | 3300025295 | Ga0209564_1001662 | Ga0209564_100166212 | 137 |
| 778 | 3300025295 | Ga0209564_1007822 | Ga0209564_100782210 | 137 |
| 779 | 3300025295 | Ga0209564_1028109 | Ga0209564_10281094 | 137 |
| 780 | 3300025295 | Ga0209564_1053257 | Ga0209564_10532571 | 137 |
| 781 | 3300025297 | Ga0209758_1000159 | Ga0209758_100015968 | 137 |
| 782 | 3300025297 | Ga0209758_1001526 | Ga0209758_10015269 | 137 |
| 783 | 3300025297 | Ga0209758_1002004 | Ga0209758_10020045 | 137 |
| 784 | 3300025297 | Ga0209758_1004118 | Ga0209758_100411813 | 137 |
| 785 | 3300025297 | Ga0209758_1006869 | Ga0209758_10068694 | 137 |
| 786 | 3300025297 | Ga0209758_1015934 | Ga0209758_10159345 | 137 |
| 787 | 3300025298 | Ga0209050_1001980 | Ga0209050_100198020 | 137 |
| 788 | 3300025298 | Ga0209050_1016935 | Ga0209050_10169354 | 137 |
| 789 | 3300025298 | Ga0209050_1019171 | Ga0209050_10191713 | 137 |
| 790 | 3300025299 | Ga0209256_1000440 | Ga0209256_100044057 | 137 |
| 791 | 3300025299 | Ga0209256_1000892 | Ga0209256_100089213 | 137 |
| 792 | 3300025299 | Ga0209256_1001107 | Ga0209256_100110716 | 137 |
| 793 | 3300025299 | Ga0209256_1002685 | Ga0209256_100268515 | 137 |
| 794 | 3300025299 | Ga0209256_1003593 | Ga0209256_100359311 | 137 |
| 795 | 3300025299 | Ga0209256_1007542 | Ga0209256_10075424 | 137 |
| 796 | 3300025299 | Ga0209256_1010198 | Ga0209256_10101987 | 137 |
| 797 | 3300025299 | Ga0209256_1016042 | Ga0209256_10160423 | 137 |
| 798 | 3300025299 | Ga0209256_1027473 | Ga0209256_10274731 | 137 |
| 799 | 3300025302 | Ga0207426_1000041 | Ga0207426_1000041402 | 137 |
| 800 | 3300025302 | Ga0207426_1000048 | Ga0207426_100004822 | 137 |
| 801 | 3300025302 | Ga0207426_1000309 | Ga0207426_100030980 | 137 |
| 802 | 3300025302 | Ga0207426_1000646 | Ga0207426_100064627 | 137 |
| 803 | 3300025302 | Ga0207426_1003037 | Ga0207426_100303712 | 137 |
| 804 | 3300025303 | Ga0209051_1001583 | Ga0209051_100158317 | 137 |
| 805 | 3300025303 | Ga0209051_1001638 | Ga0209051_100163817 | 137 |
| 806 | 3300025303 | Ga0209051_1008054 | Ga0209051_10080549 | 137 |
| 807 | 3300025303 | Ga0209051_1008858 | Ga0209051_10088585 | 137 |
| 808 | 3300025303 | Ga0209051_1013569 | Ga0209051_10135691 | 137 |
| 809 | 3300025303 | Ga0209051_1022857 | Ga0209051_10228573 | 137 |
| 810 | 3300025304 | Ga0209257_1002473 | Ga0209257_10024739 | 137 |
| 811 | 3300025304 | Ga0209257_1007098 | Ga0209257_100709810 | 137 |
| 812 | 3300025735 | Ga0207713_1045049 | Ga0207713_10450491 | 137 |
| 813 | 3300025900 | Ga0207710_10412015 | Ga0207710_104120151 | 137 |
| 814 | 3300025913 | Ga0207695_10001286 | Ga0207695_1000128621 | 137 |
| 815 | 3300025914 | Ga0207671_10001380 | Ga0207671_1000138024 | 137 |
| 816 | 3300025914 | Ga0207671_10770117 | Ga0207671_107701172 | 137 |
| 817 | 3300025923 | Ga0207681_10058022 | Ga0207681_100580221 | 137 |
| 818 | 3300025924 | Ga0207694_10365970 | Ga0207694_103659702 | 137 |
| 819 | 3300025931 | Ga0207644_10033903 | Ga0207644_100339035 | 137 |
| 820 | 3300025932 | Ga0207690_10355277 | Ga0207690_103552772 | 137 |
| 821 | 3300025935 | Ga0207709_10296112 | Ga0207709_102961122 | 137 |
| 822 | 3300025941 | Ga0207711_10147161 | Ga0207711_101471612 | 137 |
| 823 | 3300025949 | Ga0207667_10390283 | Ga0207667_103902832 | 137 |
| 824 | 3300025972 | Ga0207668_10095809 | Ga0207668_100958094 | 137 |
| 825 | 3300025972 | Ga0207668_10243747 | Ga0207668_102437472 | 137 |
| 826 | 3300025972 | Ga0207668_10831945 | Ga0207668_108319452 | 137 |
| 827 | 3300025972 | Ga0207668_11092490 | Ga0207668_110924902 | 137 |
| 828 | 3300025972 | Ga0207668_11278734 | Ga0207668_112787342 | 137 |
| 829 | 3300025986 | Ga0207658_11088068 | Ga0207658_110880681 | 137 |
| 830 | 3300025986 | Ga0207658_11160804 | Ga0207658_111608042 | 137 |
| 831 | 3300026041 | Ga0207639_10673352 | Ga0207639_106733521 | 137 |
| 832 | 3300026067 | Ga0207678_11122235 | Ga0207678_111222351 | 137 |
| 833 | 3300026078 | Ga0207702_10142586 | Ga0207702_101425863 | 137 |
| 834 | 3300026088 | Ga0207641_10615884 | Ga0207641_106158842 | 137 |
| 835 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003559 | 137 |
| 836 | 3300027312 | Ga0209371_1001357 | Ga0209371_100135719 | 137 |
| 837 | 3300027312 | Ga0209371_1001699 | Ga0209371_10016992 | 137 |
| 838 | 3300027312 | Ga0209371_1001789 | Ga0209371_10017898 | 137 |
| 839 | 3300027666 | Ga0209282_1000342 | Ga0209282_100034215 | 137 |
| 840 | 3300027666 | Ga0209282_1017049 | Ga0209282_10170498 | 137 |
| 841 | 3300027866 | Ga0209813_10056995 | Ga0209813_100569951 | 137 |
| 842 | 3300027866 | Ga0209813_10092699 | Ga0209813_100926992 | 137 |
| 843 | 3300027866 | Ga0209813_10120981 | Ga0209813_101209811 | 137 |
| 844 | 3300028379 | Ga0268266_10007330 | Ga0268266_100073305 | 137 |
| 845 | 3300028379 | Ga0268266_10011023 | Ga0268266_100110236 | 137 |
| 846 | 3300028379 | Ga0268266_10287215 | Ga0268266_102872152 | 137 |
| 847 | 3300028794 | Ga0307515_10000860 | Ga0307515_1000086028 | 137 |
| 848 | 3300028794 | Ga0307515_10016242 | Ga0307515_100162424 | 137 |
| 849 | 3300028794 | Ga0307515_10068193 | Ga0307515_100681934 | 137 |
| 850 | 3300028794 | Ga0307515_10870572 | Ga0307515_108705721 | 137 |
| 851 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004491 | 137 |
| 852 | 3300030500 | Ga0268256_1000728 | Ga0268256_100072824 | 137 |
| 853 | 3300030500 | Ga0268256_1003113 | Ga0268256_10031138 | 137 |
| 854 | 3300030744 | Ga0316181_1122127 | Ga0316181_11221272 | 137 |
| 855 | 3300031456 | Ga0307513_10002143 | Ga0307513_1000214319 | 137 |
| 856 | 3300031456 | Ga0307513_10042417 | Ga0307513_100424173 | 137 |
| 857 | 3300031456 | Ga0307513_10618257 | Ga0307513_106182571 | 137 |
| 858 | 3300031548 | Ga0307408_100618930 | Ga0307408_1006189301 | 137 |
| 859 | 3300031731 | Ga0307405_10000088 | Ga0307405_1000008826 | 137 |
| 860 | 3300031731 | Ga0307405_11807209 | Ga0307405_118072091 | 137 |
| 861 | 3300031852 | Ga0307410_10364385 | Ga0307410_103643852 | 137 |
| 862 | 3300031901 | Ga0307406_10123869 | Ga0307406_101238692 | 137 |
| 863 | 3300031911 | Ga0307412_10004000 | Ga0307412_100040005 | 137 |
| 864 | 3300031911 | Ga0307412_10027402 | Ga0307412_100274025 | 137 |
| 865 | 3300031911 | Ga0307412_11335103 | Ga0307412_113351032 | 137 |
| 866 | 3300031995 | Ga0307409_100071381 | Ga0307409_1000713813 | 137 |
| 867 | 3300032004 | Ga0307414_11158943 | Ga0307414_111589432 | 137 |
| 868 | 3300033180 | Ga0307510_10366289 | Ga0307510_103662892 | 137 |
| 869 | 3300037418 | Ga0395900_0758731 | Ga0395900_0758731_62_496 | 137 |
| 870 | 3300037466 | Ga0395898_0186187 | Ga0395898_0186187_413_847 | 137 |
| 871 | 3300037853 | Ga0436364_0583757 | Ga0436364_0583757_874_1314 | 137 |
| 872 | 3300039437 | Ga0436365_1509750 | Ga0436365_1509750_1778_2218 | 137 |
| 873 | 3300041404 | Ga0439436_0037077 | Ga0439436_0037077_560_973 | 137 |
| 874 | 3300041404 | Ga0439436_0094264 | Ga0439436_0094264_84_497 | 137 |
| 875 | 3300041406 | Ga0439439_0069703 | Ga0439439_0069703_93_506 | 137 |
| 876 | 3300041413 | Ga0439465_0000679 | Ga0439465_0000679_9705_10118 | 137 |
| 877 | 3300041413 | Ga0439465_0022502 | Ga0439465_0022502_123_536 | 137 |
| 878 | 3300041441 | Ga0451787_114555 | Ga0451787_114555_1332_1745 | 137 |
| 879 | 3300041443 | Ga0451789_0796484 | Ga0451789_0796484_393_806 | 137 |
| 880 | 3300041451 | Ga0451791_0616845 | Ga0451791_0616845_827_1240 | 137 |
| 881 | 3300041458 | Ga0451798_0339288 | Ga0451798_0339288_735_1148 | 137 |
| 882 | 3300041460 | Ga0451802_0288055 | Ga0451802_0288055_870_1283 | 137 |
| 883 | 3300041460 | Ga0451802_0399050 | Ga0451802_0399050_193_606 | 137 |
| 884 | 3300041486 | Ga0451807_1709282 | Ga0451807_1709282_111_524 | 137 |
| 885 | 3300041491 | Ga0451833_1324270 | Ga0451833_1324270_233_646 | 137 |
| 886 | 3300041492 | Ga0451835_0853460 | Ga0451835_0853460_69_482 | 137 |
| 887 | 3300041494 | Ga0451837_1678452 | Ga0451837_1678452_57_470 | 137 |
| 888 | 3300041498 | Ga0451841_0304265 | Ga0451841_0304265_77_490 | 137 |
| 889 | 3300041498 | Ga0451841_1215396 | Ga0451841_1215396_158_571 | 137 |
| 890 | 3300041502 | Ga0451846_32342 | Ga0451846_32342_22_435 | 137 |
| 891 | 3300041503 | Ga0451847_0501180 | Ga0451847_0501180_3786_4199 | 137 |
| 892 | 3300041503 | Ga0451847_0600248 | Ga0451847_0600248_561_974 | 137 |
| 893 | 3300041506 | Ga0451850_13365 | Ga0451850_13365_69_482 | 137 |
| 894 | 3300041509 | Ga0451843_0027106 | Ga0451843_0027106_171_584 | 137 |
| 895 | 3300041509 | Ga0451843_0336235 | Ga0451843_0336235_69_482 | 137 |
| 896 | 3300041512 | Ga0451853_0199191 | Ga0451853_0199191_228_641 | 137 |
| 897 | 3300041512 | Ga0451853_0628529 | Ga0451853_0628529_1359_1772 | 137 |
| 898 | 3300042007 | Ga0439449_0017515 | Ga0439449_0017515_897_1310 | 137 |
| 899 | 3300042015 | Ga0439462_0016669 | Ga0439462_0016669_875_1288 | 137 |
| 900 | 3300042122 | Ga0450920_065072 | Ga0450920_065072_71_484 | 137 |
| 901 | 3300046452 | Ga0495617_086930 | Ga0495617_086930_81_494 | 137 |
| 902 | 3300046454 | Ga0495592_0093162 | Ga0495592_0093162_786_1199 | 137 |
| 903 | 3300046459 | Ga0495629_0062325 | Ga0495629_0062325_1894_2307 | 137 |
| 904 | 3300046460 | Ga0495638_0000397 | Ga0495638_0000397_25112_25525 | 137 |
| 905 | 3300046460 | Ga0495638_0111977 | Ga0495638_0111977_485_898 | 137 |
| 906 | 3300046460 | Ga0495638_0333994 | Ga0495638_0333994_60_473 | 137 |
| 907 | 3300046462 | Ga0495651_0373218 | Ga0495651_0373218_53_466 | 137 |
| 908 | 3300046471 | Ga0495650_0067763 | Ga0495650_0067763_433_846 | 137 |
| 909 | 3300046473 | Ga0495582_0217814 | Ga0495582_0217814_593_1006 | 137 |
| 910 | 3300046474 | Ga0495605_0000412 | Ga0495605_0000412_19176_19589 | 137 |
| 911 | 3300046474 | Ga0495605_0104059 | Ga0495605_0104059_554_967 | 137 |
| 912 | 3300046474 | Ga0495605_0345296 | Ga0495605_0345296_161_574 | 137 |
| 913 | 3300046476 | Ga0495662_0191803 | Ga0495662_0191803_479_892 | 137 |
| 914 | 3300046492 | Ga0495585_0003057 | Ga0495585_0003057_1697_2110 | 137 |
| 915 | 3300046492 | Ga0495585_0013116 | Ga0495585_0013116_2515_2928 | 137 |
| 916 | 3300046492 | Ga0495585_0032443 | Ga0495585_0032443_506_919 | 137 |
| 917 | 3300046492 | Ga0495585_0035698 | Ga0495585_0035698_36_449 | 137 |
| 918 | 3300046500 | Ga0495596_0172013 | Ga0495596_0172013_396_809 | 137 |
| 919 | 3300046501 | Ga0495607_0022128 | Ga0495607_0022128_2758_3171 | 137 |
| 920 | 3300046501 | Ga0495607_0097617 | Ga0495607_0097617_655_1068 | 137 |
| 921 | 3300046501 | Ga0495607_0205452 | Ga0495607_0205452_64_483 | 137 |
| 922 | 3300046506 | Ga0495583_0005093 | Ga0495583_0005093_5459_5872 | 137 |
| 923 | 3300046506 | Ga0495583_0095810 | Ga0495583_0095810_354_767 | 137 |
| 924 | 3300046506 | Ga0495583_0097278 | Ga0495583_0097278_430_843 | 137 |
| 925 | 3300046506 | Ga0495583_0136398 | Ga0495583_0136398_593_1006 | 137 |
| 926 | 3300046507 | Ga0495606_0013838 | Ga0495606_0013838_1805_2218 | 137 |
| 927 | 3300046507 | Ga0495606_0071714 | Ga0495606_0071714_604_1017 | 137 |
| 928 | 3300046507 | Ga0495606_0119006 | Ga0495606_0119006_1094_1507 | 137 |
| 929 | 3300046511 | Ga0495608_0818567 | Ga0495608_0818567_73_513 | 137 |
| 930 | 3300046512 | Ga0495610_0002097 | Ga0495610_0002097_14129_14542 | 137 |
| 931 | 3300046512 | Ga0495610_0009996 | Ga0495610_0009996_312_725 | 137 |
| 932 | 3300046512 | Ga0495610_0038247 | Ga0495610_0038247_1943_2356 | 137 |
| 933 | 3300046513 | Ga0495616_0011491 | Ga0495616_0011491_3756_4169 | 137 |
| 934 | 3300046513 | Ga0495616_0053272 | Ga0495616_0053272_1103_1516 | 137 |
| 935 | 3300046513 | Ga0495616_0108638 | Ga0495616_0108638_316_729 | 137 |
| 936 | 3300046514 | Ga0495618_0355812 | Ga0495618_0355812_402_815 | 137 |
| 937 | 3300046515 | Ga0495620_0005619 | Ga0495620_0005619_2596_3009 | 137 |
| 938 | 3300046515 | Ga0495620_0006922 | Ga0495620_0006922_4331_4744 | 137 |
| 939 | 3300046515 | Ga0495620_0067683 | Ga0495620_0067683_505_918 | 137 |
| 940 | 3300046515 | Ga0495620_0115832 | Ga0495620_0115832_535_948 | 137 |
| 941 | 3300046516 | Ga0495628_0448498 | Ga0495628_0448498_495_908 | 137 |
| 942 | 3300046518 | Ga0495631_0003390 | Ga0495631_0003390_5137_5550 | 137 |
| 943 | 3300046518 | Ga0495631_0016450 | Ga0495631_0016450_845_1258 | 137 |
| 944 | 3300046519 | Ga0495632_0025192 | Ga0495632_0025192_2202_2615 | 137 |
| 945 | 3300046519 | Ga0495632_0029566 | Ga0495632_0029566_60_473 | 137 |
| 946 | 3300046519 | Ga0495632_0075092 | Ga0495632_0075092_145_558 | 137 |
| 947 | 3300046522 | Ga0495643_0004851 | Ga0495643_0004851_2189_2602 | 137 |
| 948 | 3300046522 | Ga0495643_0042014 | Ga0495643_0042014_989_1402 | 137 |
| 949 | 3300046522 | Ga0495643_0067836 | Ga0495643_0067836_981_1394 | 137 |
| 950 | 3300046522 | Ga0495643_0084432 | Ga0495643_0084432_972_1385 | 137 |
| 951 | 3300046522 | Ga0495643_0256186 | Ga0495643_0256186_332_745 | 137 |
| 952 | 3300046523 | Ga0495644_0108959 | Ga0495644_0108959_436_849 | 137 |
| 953 | 3300046523 | Ga0495644_0239706 | Ga0495644_0239706_81_494 | 137 |
| 954 | 3300046524 | Ga0495648_0264200 | Ga0495648_0264200_155_568 | 137 |
| 955 | 3300046529 | Ga0495652_0397826 | Ga0495652_0397826_550_963 | 137 |
| 956 | 3300046530 | Ga0495654_0000571 | Ga0495654_0000571_5760_6182 | 137 |
| 957 | 3300046530 | Ga0495654_0049687 | Ga0495654_0049687_145_558 | 137 |
| 958 | 3300046530 | Ga0495654_0079587 | Ga0495654_0079587_893_1306 | 137 |
| 959 | 3300046533 | Ga0495640_0535023 | Ga0495640_0535023_109_522 | 137 |
| 960 | 3300046538 | Ga0495609_0014093 | Ga0495609_0014093_864_1277 | 137 |
| 961 | 3300046538 | Ga0495609_0018014 | Ga0495609_0018014_2420_2833 | 137 |
| 962 | 3300046542 | Ga0495597_0018985 | Ga0495597_0018985_1901_2314 | 137 |
| 963 | 3300046542 | Ga0495597_0054860 | Ga0495597_0054860_342_755 | 137 |
| 964 | 3300046558 | Ga0495633_0005629 | Ga0495633_0005629_2738_3151 | 137 |
| 965 | 3300046558 | Ga0495633_0028120 | Ga0495633_0028120_350_763 | 137 |
| 966 | 3300046558 | Ga0495633_0151673 | Ga0495633_0151673_456_869 | 137 |
| 967 | 3300046558 | Ga0495633_0213847 | Ga0495633_0213847_165_578 | 137 |
| 968 | 3300046615 | Ga0495656_0033907 | Ga0495656_0033907_921_1334 | 137 |
| 969 | 3300046615 | Ga0495656_0098169 | Ga0495656_0098169_608_1021 | 137 |
| 970 | 3300046615 | Ga0495656_0541136 | Ga0495656_0541136_66_479 | 137 |
| 971 | 3300046616 | Ga0495668_0001138 | Ga0495668_0001138_25913_26326 | 137 |
| 972 | 3300046616 | Ga0495668_0073181 | Ga0495668_0073181_1129_1542 | 137 |
| 973 | 3300046642 | Ga0495634_0402062 | Ga0495634_0402062_359_772 | 137 |
| 974 | 3300046648 | Ga0495611_0002515 | Ga0495611_0002515_3378_3791 | 137 |
| 975 | 3300046648 | Ga0495611_0043860 | Ga0495611_0043860_669_1082 | 137 |
| 976 | 3300046648 | Ga0495611_0048336 | Ga0495611_0048336_466_879 | 137 |
| 977 | 3300046660 | Ga0495625_0006104 | Ga0495625_0006104_7980_8393 | 137 |
| 978 | 3300046660 | Ga0495625_0008114 | Ga0495625_0008114_5410_5823 | 137 |
| 979 | 3300046660 | Ga0495625_0051370 | Ga0495625_0051370_750_1163 | 137 |
| 980 | 3300046660 | Ga0495625_0068126 | Ga0495625_0068126_1503_1916 | 137 |
| 981 | 3300046660 | Ga0495625_0238072 | Ga0495625_0238072_132_545 | 137 |
| 982 | 3300046660 | Ga0495625_0263482 | Ga0495625_0263482_269_682 | 137 |
| 983 | 3300046660 | Ga0495625_0313150 | Ga0495625_0313150_436_849 | 137 |
| 984 | 3300046663 | Ga0495635_0042978 | Ga0495635_0042978_1039_1452 | 137 |
| 985 | 3300046663 | Ga0495635_0368494 | Ga0495635_0368494_470_910 | 137 |
| 986 | 3300046665 | Ga0495661_0019832 | Ga0495661_0019832_1595_2008 | 137 |
| 987 | 3300046665 | Ga0495661_0262287 | Ga0495661_0262287_202_615 | 137 |
| 988 | 3300046665 | Ga0495661_0416352 | Ga0495661_0416352_81_494 | 137 |
| 989 | 3300046674 | Ga0495588_0022947 | Ga0495588_0022947_2056_2469 | 137 |
| 990 | 3300046674 | Ga0495588_0059332 | Ga0495588_0059332_1091_1504 | 137 |
| 991 | 3300046674 | Ga0495588_0482430 | Ga0495588_0482430_176_589 | 137 |
| 992 | 3300046674 | Ga0495588_0584123 | Ga0495588_0584123_87_500 | 137 |
| 993 | 3300046675 | Ga0495657_0034567 | Ga0495657_0034567_2410_2823 | 137 |
| 994 | 3300046679 | Ga0495623_0630017 | Ga0495623_0630017_50_463 | 137 |
| 995 | 3300046680 | Ga0495646_0273637 | Ga0495646_0273637_94_507 | 137 |
| 996 | 3300046689 | Ga0495613_0609691 | Ga0495613_0609691_233_646 | 137 |
| 997 | 3300046690 | Ga0495624_0136347 | Ga0495624_0136347_666_1079 | 137 |
| 998 | 3300046691 | Ga0495670_0010861 | Ga0495670_0010861_78_491 | 137 |
| 999 | 3300046691 | Ga0495670_0124853 | Ga0495670_0124853_617_1030 | 137 |
| 1000 | 3300046691 | Ga0495670_0125560 | Ga0495670_0125560_792_1205 | 137 |
| 1001 | 3300046691 | Ga0495670_0405791 | Ga0495670_0405791_168_581 | 137 |
| 1002 | 3300046692 | Ga0495671_0025086 | Ga0495671_0025086_1121_1534 | 137 |
| 1003 | 3300046694 | Ga0495649_0098861 | Ga0495649_0098861_45_458 | 137 |
| 1004 | 3300046694 | Ga0495649_0132854 | Ga0495649_0132854_439_852 | 137 |
| 1005 | 3300046694 | Ga0495649_0230892 | Ga0495649_0230892_328_741 | 137 |
| 1006 | 3300046810 | Ga0495660_0004419 | Ga0495660_0004419_4188_4601 | 137 |
| 1007 | 3300046810 | Ga0495660_0005703 | Ga0495660_0005703_6444_6857 | 137 |
| 1008 | 3300046810 | Ga0495660_0251591 | Ga0495660_0251591_285_698 | 137 |
| 1009 | 3300047317 | Ga0495604_0021996 | Ga0495604_0021996_2584_2997 | 137 |
| 1010 | 3300047318 | Ga0495636_0006550 | Ga0495636_0006550_2967_3380 | 137 |
| 1011 | 3300047318 | Ga0495636_0028797 | Ga0495636_0028797_70_483 | 137 |
| 1012 | 3300047320 | Ga0495672_0015740 | Ga0495672_0015740_2436_2849 | 137 |
| 1013 | 3300047321 | Ga0495676_0237368 | Ga0495676_0237368_788_1201 | 137 |
| 1014 | 3300047323 | Ga0495683_0108793 | Ga0495683_0108793_166_579 | 137 |
| 1015 | 3300047323 | Ga0495683_0225246 | Ga0495683_0225246_175_588 | 137 |
| 1016 | 3300047443 | Ga0495687_006801 | Ga0495687_006801_1232_1645 | 137 |
| 1017 | 3300047443 | Ga0495687_023996 | Ga0495687_023996_1757_2170 | 137 |
| 1018 | 3300047445 | Ga0495677_0100233 | Ga0495677_0100233_366_779 | 137 |
| 1019 | 3300047447 | Ga0495685_025338 | Ga0495685_025338_802_1215 | 137 |
| 1020 | 3300047469 | Ga0495673_0081919 | Ga0495673_0081919_702_1115 | 137 |
| 1021 | 3300047470 | Ga0495681_0070929 | Ga0495681_0070929_718_1131 | 137 |
| 1022 | 3300047470 | Ga0495681_0139101 | Ga0495681_0139101_438_851 | 137 |
| 1023 | 3300047472 | Ga0495686_0002821 | Ga0495686_0002821_3161_3574 | 137 |
| 1024 | 3300047472 | Ga0495686_0004434 | Ga0495686_0004434_1133_1546 | 137 |
| 1025 | 3300047472 | Ga0495686_0040133 | Ga0495686_0040133_82_495 | 137 |
| 1026 | 3300047472 | Ga0495686_0054299 | Ga0495686_0054299_407_820 | 137 |
| 1027 | 3300047472 | Ga0495686_0180269 | Ga0495686_0180269_776_1189 | 137 |
| 1028 | 3300047472 | Ga0495686_0340973 | Ga0495686_0340973_95_508 | 137 |
| 1029 | 3300048088 | Ga0495602_0783170 | Ga0495602_0783170_188_604 | 137 |
| 1030 | 3300048091 | Ga0495626_0060247 | Ga0495626_0060247_395_808 | 137 |
| 1031 | 3300048903 | Ga0496100_0069980 | Ga0496100_0069980_300_713 | 137 |
| 1032 | 3300048903 | Ga0496100_0097001 | Ga0496100_0097001_1479_1913 | 137 |
| 1033 | 3300048904 | Ga0496101_0366395 | Ga0496101_0366395_615_1028 | 137 |
| 1034 | 3300048904 | Ga0496101_0394879 | Ga0496101_0394879_92_505 | 137 |
| 1035 | 3300048904 | Ga0496101_0435420 | Ga0496101_0435420_209_622 | 137 |
| 1036 | 3300048904 | Ga0496101_1292309 | Ga0496101_1292309_116_556 | 137 |
| 1037 | 3300048904 | Ga0496101_1567764 | Ga0496101_1567764_71_484 | 137 |
| 1038 | 3300048905 | Ga0496102_0028185 | Ga0496102_0028185_4075_4488 | 137 |
| 1039 | 3300048905 | Ga0496102_0513730 | Ga0496102_0513730_363_797 | 137 |
| 1040 | 3300048905 | Ga0496102_1768593 | Ga0496102_1768593_86_499 | 137 |
| 1041 | 3300048905 | Ga0496102_1907778 | Ga0496102_1907778_38_451 | 137 |
| 1042 | 3300048906 | Ga0496103_0016736 | Ga0496103_0016736_637_1050 | 137 |
| 1043 | 3300048906 | Ga0496103_0287820 | Ga0496103_0287820_513_926 | 137 |
| 1044 | 3300048906 | Ga0496103_0413570 | Ga0496103_0413570_411_824 | 137 |
| 1045 | 3300048907 | Ga0496104_0295268 | Ga0496104_0295268_1065_1499 | 137 |
| 1046 | 3300048907 | Ga0496104_0653497 | Ga0496104_0653497_129_542 | 137 |
| 1047 | 3300048908 | Ga0496105_0301060 | Ga0496105_0301060_22_456 | 137 |
| 1048 | 3300048908 | Ga0496105_0737164 | Ga0496105_0737164_296_709 | 137 |
| 1049 | 3300048908 | Ga0496105_0742704 | Ga0496105_0742704_229_642 | 137 |
| 1050 | 3300048909 | Ga0496106_0004370 | Ga0496106_0004370_3336_3749 | 137 |
| 1051 | 3300048909 | Ga0496106_0042281 | Ga0496106_0042281_2198_2611 | 137 |
| 1052 | 3300048910 | Ga0496107_0305735 | Ga0496107_0305735_735_1148 | 137 |
| 1053 | 3300048910 | Ga0496107_0615105 | Ga0496107_0615105_354_788 | 137 |
| 1054 | 3300048911 | Ga0496108_0761168 | Ga0496108_0761168_413_826 | 137 |
| 1055 | 3300048913 | Ga0496110_0560398 | Ga0496110_0560398_358_771 | 137 |
| 1056 | 3300048914 | Ga0496111_0827782 | Ga0496111_0827782_192_620 | 137 |
| 1057 | 3300048915 | Ga0496112_1134886 | Ga0496112_1134886_134_547 | 137 |
| 1058 | 3300048916 | Ga0496113_0020388 | Ga0496113_0020388_897_1310 | 137 |
| 1059 | 3300048916 | Ga0496113_0199621 | Ga0496113_0199621_784_1218 | 137 |
| 1060 | 3300048916 | Ga0496113_0433621 | Ga0496113_0433621_430_843 | 137 |
| 1061 | 3300048918 | Ga0496115_0114776 | Ga0496115_0114776_1446_1880 | 137 |
| 1062 | 3300048919 | Ga0496116_0000026 | Ga0496116_0000026_347004_347417 | 137 |
| 1063 | 3300048919 | Ga0496116_0013119 | Ga0496116_0013119_4285_4698 | 137 |
| 1064 | 3300048919 | Ga0496116_0017640 | Ga0496116_0017640_2565_2978 | 137 |
| 1065 | 3300048919 | Ga0496116_0034430 | Ga0496116_0034430_669_1082 | 137 |
| 1066 | 3300048919 | Ga0496116_0036542 | Ga0496116_0036542_33_446 | 137 |
| 1067 | 3300048919 | Ga0496116_0044495 | Ga0496116_0044495_2554_2982 | 137 |
| 1068 | 3300048919 | Ga0496116_0057524 | Ga0496116_0057524_654_1067 | 137 |
| 1069 | 3300048919 | Ga0496116_0079699 | Ga0496116_0079699_609_1022 | 137 |
| 1070 | 3300048919 | Ga0496116_0085615 | Ga0496116_0085615_1036_1464 | 137 |
| 1071 | 3300048919 | Ga0496116_0165073 | Ga0496116_0165073_467_880 | 137 |
| 1072 | 3300048919 | Ga0496116_0206472 | Ga0496116_0206472_15_428 | 137 |
| 1073 | 3300048919 | Ga0496116_0236952 | Ga0496116_0236952_26_439 | 137 |
| 1074 | 3300048919 | Ga0496116_0446722 | Ga0496116_0446722_93_506 | 137 |
| 1075 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_114854_115267 | 137 |
| 1076 | 3300048920 | Ga0496117_0005218 | Ga0496117_0005218_754_1182 | 137 |
| 1077 | 3300048920 | Ga0496117_0005763 | Ga0496117_0005763_8319_8741 | 137 |
| 1078 | 3300048920 | Ga0496117_0006320 | Ga0496117_0006320_6935_7348 | 137 |
| 1079 | 3300048920 | Ga0496117_0053132 | Ga0496117_0053132_2252_2665 | 137 |
| 1080 | 3300048920 | Ga0496117_0209451 | Ga0496117_0209451_279_692 | 137 |
| 1081 | 3300048920 | Ga0496117_0265255 | Ga0496117_0265255_445_873 | 137 |
| 1082 | 3300048920 | Ga0496117_0501062 | Ga0496117_0501062_38_451 | 137 |
| 1083 | 3300048921 | Ga0496118_0002108 | Ga0496118_0002108_4610_5023 | 137 |
| 1084 | 3300048921 | Ga0496118_0011236 | Ga0496118_0011236_2593_3006 | 137 |
| 1085 | 3300048921 | Ga0496118_0020168 | Ga0496118_0020168_3165_3578 | 137 |
| 1086 | 3300048921 | Ga0496118_0025122 | Ga0496118_0025122_160_573 | 137 |
| 1087 | 3300048921 | Ga0496118_0054915 | Ga0496118_0054915_1802_2230 | 137 |
| 1088 | 3300048921 | Ga0496118_0096772 | Ga0496118_0096772_1184_1597 | 137 |
| 1089 | 3300048921 | Ga0496118_0104722 | Ga0496118_0104722_865_1278 | 137 |
| 1090 | 3300048922 | Ga0496119_0012077 | Ga0496119_0012077_4369_4782 | 137 |
| 1091 | 3300048922 | Ga0496119_0045071 | Ga0496119_0045071_892_1305 | 137 |
| 1092 | 3300048922 | Ga0496119_0070145 | Ga0496119_0070145_1380_1802 | 137 |
| 1093 | 3300048922 | Ga0496119_0117422 | Ga0496119_0117422_568_996 | 137 |
| 1094 | 3300048922 | Ga0496119_0148290 | Ga0496119_0148290_37_450 | 137 |
| 1095 | 3300048922 | Ga0496119_0149016 | Ga0496119_0149016_418_831 | 137 |
| 1096 | 3300048922 | Ga0496119_0208472 | Ga0496119_0208472_38_451 | 137 |
| 1097 | 3300048922 | Ga0496119_0307496 | Ga0496119_0307496_262_675 | 137 |
| 1098 | 3300048923 | Ga0496120_0000164 | Ga0496120_0000164_80037_80450 | 137 |
| 1099 | 3300048923 | Ga0496120_0041365 | Ga0496120_0041365_1238_1651 | 137 |
| 1100 | 3300048924 | Ga0496121_0000143 | Ga0496121_0000143_8638_9051 | 137 |
| 1101 | 3300048924 | Ga0496121_0001766 | Ga0496121_0001766_30187_30600 | 137 |
| 1102 | 3300048924 | Ga0496121_0006848 | Ga0496121_0006848_2343_2771 | 137 |
| 1103 | 3300048924 | Ga0496121_0019517 | Ga0496121_0019517_1585_1998 | 137 |
| 1104 | 3300048924 | Ga0496121_0021675 | Ga0496121_0021675_5462_5875 | 137 |
| 1105 | 3300048924 | Ga0496121_0035593 | Ga0496121_0035593_2509_2922 | 137 |
| 1106 | 3300048924 | Ga0496121_0113291 | Ga0496121_0113291_1604_2017 | 137 |
| 1107 | 3300048924 | Ga0496121_0133627 | Ga0496121_0133627_25_438 | 137 |
| 1108 | 3300048924 | Ga0496121_0145054 | Ga0496121_0145054_391_804 | 137 |
| 1109 | 3300048924 | Ga0496121_0166705 | Ga0496121_0166705_847_1275 | 137 |
| 1110 | 3300048924 | Ga0496121_0193491 | Ga0496121_0193491_421_834 | 137 |
| 1111 | 3300048924 | Ga0496121_0217543 | Ga0496121_0217543_353_766 | 137 |
| 1112 | 3300048924 | Ga0496121_0470263 | Ga0496121_0470263_153_566 | 137 |
| 1113 | 3300048924 | Ga0496121_0870716 | Ga0496121_0870716_35_448 | 137 |
| 1114 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_115515_115928 | 137 |
| 1115 | 3300048925 | Ga0496122_0001424 | Ga0496122_0001424_18510_18923 | 137 |
| 1116 | 3300048925 | Ga0496122_0014992 | Ga0496122_0014992_4572_4985 | 137 |
| 1117 | 3300048925 | Ga0496122_0023147 | Ga0496122_0023147_766_1179 | 137 |
| 1118 | 3300048925 | Ga0496122_0042005 | Ga0496122_0042005_798_1211 | 137 |
| 1119 | 3300048925 | Ga0496122_0052406 | Ga0496122_0052406_532_945 | 137 |
| 1120 | 3300048925 | Ga0496122_0069274 | Ga0496122_0069274_684_1097 | 137 |
| 1121 | 3300048925 | Ga0496122_0082971 | Ga0496122_0082971_1781_2194 | 137 |
| 1122 | 3300048925 | Ga0496122_0116946 | Ga0496122_0116946_67_489 | 137 |
| 1123 | 3300048925 | Ga0496122_0147062 | Ga0496122_0147062_619_1032 | 137 |
| 1124 | 3300048925 | Ga0496122_0205249 | Ga0496122_0205249_507_935 | 137 |
| 1125 | 3300048925 | Ga0496122_0217556 | Ga0496122_0217556_129_542 | 137 |
| 1126 | 3300048925 | Ga0496122_0256914 | Ga0496122_0256914_546_959 | 137 |
| 1127 | 3300048925 | Ga0496122_0297872 | Ga0496122_0297872_62_475 | 137 |
| 1128 | 3300048925 | Ga0496122_0412798 | Ga0496122_0412798_140_553 | 137 |
| 1129 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_115515_115928 | 137 |
| 1130 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1695755_1696168 | 137 |
| 1131 | 3300048926 | Ga0496123_0001147 | Ga0496123_0001147_19283_19696 | 137 |
| 1132 | 3300048926 | Ga0496123_0016364 | Ga0496123_0016364_3177_3590 | 137 |
| 1133 | 3300048926 | Ga0496123_0022600 | Ga0496123_0022600_234_662 | 137 |
| 1134 | 3300048926 | Ga0496123_0038007 | Ga0496123_0038007_2351_2764 | 137 |
| 1135 | 3300048926 | Ga0496123_0040751 | Ga0496123_0040751_1598_2011 | 137 |
| 1136 | 3300048926 | Ga0496123_0048297 | Ga0496123_0048297_2040_2453 | 137 |
| 1137 | 3300048926 | Ga0496123_0057293 | Ga0496123_0057293_1178_1591 | 137 |
| 1138 | 3300048926 | Ga0496123_0188924 | Ga0496123_0188924_76_504 | 137 |
| 1139 | 3300048926 | Ga0496123_0398427 | Ga0496123_0398427_194_607 | 137 |
| 1140 | 3300048927 | Ga0496124_0003004 | Ga0496124_0003004_12465_12887 | 137 |
| 1141 | 3300048927 | Ga0496124_0004440 | Ga0496124_0004440_7621_8034 | 137 |
| 1142 | 3300048927 | Ga0496124_0008164 | Ga0496124_0008164_2568_2981 | 137 |
| 1143 | 3300048927 | Ga0496124_0014197 | Ga0496124_0014197_4450_4878 | 137 |
| 1144 | 3300048927 | Ga0496124_0014344 | Ga0496124_0014344_5523_5936 | 137 |
| 1145 | 3300048927 | Ga0496124_0014740 | Ga0496124_0014740_1646_2059 | 137 |
| 1146 | 3300048927 | Ga0496124_0029107 | Ga0496124_0029107_667_1080 | 137 |
| 1147 | 3300048927 | Ga0496124_0083763 | Ga0496124_0083763_464_877 | 137 |
| 1148 | 3300048927 | Ga0496124_0133870 | Ga0496124_0133870_1283_1696 | 137 |
| 1149 | 3300048927 | Ga0496124_0252188 | Ga0496124_0252188_72_485 | 137 |
| 1150 | 3300048927 | Ga0496124_0358508 | Ga0496124_0358508_68_481 | 137 |
| 1151 | 3300048927 | Ga0496124_0367373 | Ga0496124_0367373_10_423 | 137 |
| 1152 | 3300048927 | Ga0496124_0429558 | Ga0496124_0429558_72_500 | 137 |
| 1153 | 3300048928 | Ga0496125_0000564 | Ga0496125_0000564_54864_55286 | 137 |
| 1154 | 3300048928 | Ga0496125_0000589 | Ga0496125_0000589_52954_53367 | 137 |
| 1155 | 3300048928 | Ga0496125_0003773 | Ga0496125_0003773_2684_3097 | 137 |
| 1156 | 3300048928 | Ga0496125_0004692 | Ga0496125_0004692_12629_13057 | 137 |
| 1157 | 3300048928 | Ga0496125_0010306 | Ga0496125_0010306_4622_5035 | 137 |
| 1158 | 3300048928 | Ga0496125_0061172 | Ga0496125_0061172_2026_2439 | 137 |
| 1159 | 3300048928 | Ga0496125_0116340 | Ga0496125_0116340_812_1225 | 137 |
| 1160 | 3300048928 | Ga0496125_0244891 | Ga0496125_0244891_165_578 | 137 |
| 1161 | 3300048929 | Ga0496126_0000059 | Ga0496126_0000059_46703_47116 | 137 |
| 1162 | 3300048929 | Ga0496126_0005852 | Ga0496126_0005852_4260_4682 | 137 |
| 1163 | 3300048929 | Ga0496126_0010139 | Ga0496126_0010139_3623_4045 | 137 |
| 1164 | 3300048929 | Ga0496126_0058717 | Ga0496126_0058717_530_943 | 137 |
| 1165 | 3300048929 | Ga0496126_0227357 | Ga0496126_0227357_530_943 | 137 |
| 1166 | 3300048929 | Ga0496126_0252384 | Ga0496126_0252384_443_856 | 137 |
| 1167 | 3300048929 | Ga0496126_0575510 | Ga0496126_0575510_419_832 | 137 |
| 1168 | 3300049459 | Ga0495678_019884 | Ga0495678_019884_549_962 | 137 |
| 1169 | 3300049459 | Ga0495678_036467 | Ga0495678_036467_525_938 | 137 |
| 1170 | 3300049459 | Ga0495678_143066 | Ga0495678_143066_344_757 | 137 |
| 1171 | 3300049460 | Ga0495682_0038183 | Ga0495682_0038183_469_882 | 137 |
| 1172 | 3300049523 | Ga0501300_034757 | Ga0501300_034757_251_682 | 137 |
| 1173 | 3300049569 | Ga0501032_0082903 | Ga0501032_0082903_679_1092 | 137 |
| 1174 | 3300049570 | Ga0501033_0444545 | Ga0501033_0444545_95_508 | 137 |
| 1175 | 3300049571 | Ga0501034_0181026 | Ga0501034_0181026_603_1016 | 137 |
| 1176 | 3300049572 | Ga0501036_0142594 | Ga0501036_0142594_687_1100 | 137 |
| 1177 | 3300049572 | Ga0501036_0909139 | Ga0501036_0909139_235_648 | 137 |
| 1178 | 3300049573 | Ga0501037_0069872 | Ga0501037_0069872_1550_1963 | 137 |
| 1179 | 3300049573 | Ga0501037_0432443 | Ga0501037_0432443_325_738 | 137 |
| 1180 | 3300049574 | Ga0501038_0065544 | Ga0501038_0065544_1013_1426 | 137 |
| 1181 | 3300049575 | Ga0501039_0071693 | Ga0501039_0071693_1271_1684 | 137 |
| 1182 | 3300049579 | Ga0501043_0029323 | Ga0501043_0029323_3238_3684 | 137 |
| 1183 | 3300049579 | Ga0501043_0188675 | Ga0501043_0188675_1064_1477 | 137 |
| 1184 | 3300049580 | Ga0501046_0173853 | Ga0501046_0173853_355_768 | 137 |
| 1185 | 3300049581 | Ga0501047_0066767 | Ga0501047_0066767_1988_2401 | 137 |
| 1186 | 3300049582 | Ga0501048_0103125 | Ga0501048_0103125_708_1121 | 137 |
| 1187 | 3300049583 | Ga0501067_0013788 | Ga0501067_0013788_2735_3160 | 137 |
| 1188 | 3300049583 | Ga0501067_0208276 | Ga0501067_0208276_176_589 | 137 |
| 1189 | 3300049588 | Ga0501072_0004658 | Ga0501072_0004658_5228_5653 | 137 |
| 1190 | 3300049589 | Ga0501073_0032035 | Ga0501073_0032035_1934_2359 | 137 |
| 1191 | 3300049590 | Ga0501074_0065811 | Ga0501074_0065811_487_912 | 137 |
| 1192 | 3300049742 | Ga0501080_0141903 | Ga0501080_0141903_1005_1430 | 137 |
| 1193 | 3300049742 | Ga0501080_0151854 | Ga0501080_0151854_1600_2013 | 137 |
| 1194 | 3300049744 | Ga0501083_0044847 | Ga0501083_0044847_1586_1999 | 137 |
| 1195 | 3300049744 | Ga0501083_0072315 | Ga0501083_0072315_1527_1952 | 137 |
| 1196 | 3300049776 | Ga0501280_009131 | Ga0501280_009131_365_778 | 137 |
| 1197 | 3300049776 | Ga0501280_009598 | Ga0501280_009598_124_537 | 137 |
| 1198 | 3300049822 | Ga0501035_0073092 | Ga0501035_0073092_1698_2111 | 137 |
| 1199 | 3300050489 | nmdc:mga03683_16426_c1 | nmdc:mga03683_16426_c1_1104_1517 | 137 |
| 1200 | 3300050489 | nmdc:mga03683_2140_c2 | nmdc:mga03683_2140_c2_1687_2100 | 137 |
| 1201 | 3300050490 | nmdc:mga03n38_31455_c1 | nmdc:mga03n38_31455_c1_1261_1674 | 137 |
| 1202 | 3300050490 | nmdc:mga03n38_346214_c1 | nmdc:mga03n38_346214_c1_331_744 | 137 |
| 1203 | 3300050490 | nmdc:mga03n38_382044_c1 | nmdc:mga03n38_382044_c1_230_643 | 137 |
| 1204 | 3300050490 | nmdc:mga03n38_38515_c1 | nmdc:mga03n38_38515_c1_761_1174 | 137 |
| 1205 | 3300050491 | nmdc:mga00v17_225_c1 | nmdc:mga00v17_225_c1_9540_9953 | 137 |
| 1206 | 3300050491 | nmdc:mga00v17_537955_c1 | nmdc:mga00v17_537955_c1_154_567 | 137 |
| 1207 | 3300050491 | nmdc:mga00v17_5512_c1 | nmdc:mga00v17_5512_c1_4309_4722 | 137 |
| 1208 | 3300050491 | nmdc:mga00v17_9956_c1 | nmdc:mga00v17_9956_c1_1104_1517 | 137 |
| 1209 | 3300050492 | nmdc:mga0yw44_260_c1 | nmdc:mga0yw44_260_c1_8206_8619 | 137 |
| 1210 | 3300050492 | nmdc:mga0yw44_5353_c1 | nmdc:mga0yw44_5353_c1_1982_2395 | 137 |
| 1211 | 3300050492 | nmdc:mga0yw44_733120_c1 | nmdc:mga0yw44_733120_c1_225_638 | 137 |
| 1212 | 3300050493 | nmdc:mga0k408_211289_c1 | nmdc:mga0k408_211289_c1_280_693 | 137 |
| 1213 | 3300050493 | nmdc:mga0k408_4199_c1 | nmdc:mga0k408_4199_c1_6108_6521 | 137 |
| 1214 | 3300050494 | nmdc:mga06z11_106882_c1 | nmdc:mga06z11_106882_c1_146_559 | 137 |
| 1215 | 3300050494 | nmdc:mga06z11_323289_c1 | nmdc:mga06z11_323289_c1_116_529 | 137 |
| 1216 | 3300050494 | nmdc:mga06z11_877475_c1 | nmdc:mga06z11_877475_c1_98_511 | 137 |
| 1217 | 3300050495 | nmdc:mga04h51_13396_c1 | nmdc:mga04h51_13396_c1_813_1226 | 137 |
| 1218 | 3300050495 | nmdc:mga04h51_54979_c1 | nmdc:mga04h51_54979_c1_154_567 | 137 |
| 1219 | 3300050496 | nmdc:mga07m45_183696_c1 | nmdc:mga07m45_183696_c1_596_1009 | 137 |
| 1220 | 3300050496 | nmdc:mga07m45_28339_c1 | nmdc:mga07m45_28339_c1_1270_1683 | 137 |
| 1221 | 3300050516 | nmdc:mga0sz30_101760_c1 | nmdc:mga0sz30_101760_c1_647_1060 | 137 |
| 1222 | 3300050516 | nmdc:mga0sz30_138578_c1 | nmdc:mga0sz30_138578_c1_609_1022 | 137 |
| 1223 | 3300050516 | nmdc:mga0sz30_152941_c1 | nmdc:mga0sz30_152941_c1_433_846 | 137 |
| 1224 | 3300050516 | nmdc:mga0sz30_230260_c1 | nmdc:mga0sz30_230260_c1_218_631 | 137 |
| 1225 | 3300050516 | nmdc:mga0sz30_42100_c1 | nmdc:mga0sz30_42100_c1_46_459 | 137 |
| 1226 | 3300050516 | nmdc:mga0sz30_847_c1 | nmdc:mga0sz30_847_c1_7855_8268 | 137 |
| 1227 | 3300053077 | Ga0495601_0092215 | Ga0495601_0092215_786_1226 | 137 |
| 1228 | 3300053077 | Ga0495601_0260168 | Ga0495601_0260168_374_787 | 137 |
| 1229 | 3300053079 | Ga0500610_0002446 | Ga0500610_0002446_2829_3242 | 137 |
| 1230 | 3300053085 | Ga0495619_0011837 | Ga0495619_0011837_3718_4158 | 137 |
| 1231 | 3300053086 | Ga0500578_0227425 | Ga0500578_0227425_407_820 | 137 |
| 1232 | 3300053086 | Ga0500578_0397602 | Ga0500578_0397602_161_574 | 137 |
| 1233 | 3300053086 | Ga0500578_0460176 | Ga0500578_0460176_35_448 | 137 |
| 1234 | 3300053093 | Ga0500651_0182415 | Ga0500651_0182415_223_636 | 137 |
| 1235 | 3300053098 | Ga0500650_0142669 | Ga0500650_0142669_495_908 | 137 |
| 1236 | 3300053105 | Ga0500557_003736 | Ga0500557_003736_32_445 | 137 |
| 1237 | 3300053107 | Ga0500560_000198 | Ga0500560_000198_4588_5001 | 137 |
| 1238 | 3300053107 | Ga0500560_063464 | Ga0500560_063464_150_563 | 137 |
| 1239 | 3300053109 | Ga0500569_002914 | Ga0500569_002914_2706_3119 | 137 |
| 1240 | 3300053118 | Ga0500594_0001479 | Ga0500594_0001479_4540_4953 | 137 |
| 1241 | 3300053118 | Ga0500594_0036262 | Ga0500594_0036262_591_1004 | 137 |
| 1242 | 3300053125 | Ga0500618_009083 | Ga0500618_009083_1500_1913 | 137 |
| 1243 | 3300053125 | Ga0500618_010286 | Ga0500618_010286_484_903 | 137 |
| 1244 | 3300053125 | Ga0500618_023440 | Ga0500618_023440_804_1217 | 137 |
| 1245 | 3300053134 | Ga0500658_0000213 | Ga0500658_0000213_10822_11235 | 137 |
| 1246 | 3300053134 | Ga0500658_0041272 | Ga0500658_0041272_477_890 | 137 |
| 1247 | 3300053137 | Ga0500561_0000227 | Ga0500561_0000227_285_698 | 137 |
| 1248 | 3300053139 | Ga0500568_0000405 | Ga0500568_0000405_16755_17168 | 137 |
| 1249 | 3300053142 | Ga0500577_0133128 | Ga0500577_0133128_362_775 | 137 |
| 1250 | 3300053151 | Ga0500604_0019820 | Ga0500604_0019820_386_799 | 137 |
| 1251 | 3300053151 | Ga0500604_0128931 | Ga0500604_0128931_168_584 | 137 |
| 1252 | 3300053153 | Ga0500616_0044973 | Ga0500616_0044973_1489_1902 | 137 |
| 1253 | 3300053153 | Ga0500616_0058508 | Ga0500616_0058508_1281_1694 | 137 |
| 1254 | 3300053156 | Ga0500622_0005360 | Ga0500622_0005360_2663_3076 | 137 |
| 1255 | 3300053157 | Ga0500624_033013 | Ga0500624_033013_28_441 | 137 |
| 1256 | 3300053158 | Ga0500627_0090005 | Ga0500627_0090005_327_740 | 137 |
| 1257 | 3300053160 | Ga0500633_0002284 | Ga0500633_0002284_1452_1865 | 137 |
| 1258 | 3300053160 | Ga0500633_0242236 | Ga0500633_0242236_62_475 | 137 |
| 1259 | 3300053161 | Ga0500634_0018607 | Ga0500634_0018607_3157_3570 | 137 |
| 1260 | 3300053161 | Ga0500634_0041700 | Ga0500634_0041700_227_640 | 137 |
| 1261 | 3300053177 | Ga0500636_0000011 | Ga0500636_0000011_66035_66448 | 137 |
| 1262 | 3300054114 | Ga0501084_0047009 | Ga0501084_0047009_2447_2872 | 137 |
| 1263 | 3300054114 | Ga0501084_0431606 | Ga0501084_0431606_406_819 | 137 |
| 1264 | 3300060353 | Ga0501082_0032764 | Ga0501082_0032764_2650_3075 | 137 |
| 1265 | iso_pu_bacteria | 2509276021 | 2509389640 | 137 |
| 1266 | iso_pu_bacteria | 2509276033 | 2509445945 | 137 |
| 1267 | iso_pu_bacteria | 2582581307 | 2585271454 | 137 |
| 1268 | iso_pu_bacteria | 2585427531 | 2585563305 | 137 |
| 1269 | iso_pu_bacteria | 2585427594 | 2585844744 | 137 |
| 1270 | iso_pu_bacteria | 2585427608 | 2585902645 | 137 |
| 1271 | iso_pu_bacteria | 2585427609 | 2585907524 | 137 |
| 1272 | iso_pu_bacteria | 2585428125 | 2587982482 | 137 |
| 1273 | iso_pu_bacteria | 2718217997 | 2719667098 | 137 |
| 1274 | iso_pu_bacteria | 2718218199 | 2720493518 | 137 |
| 1275 | iso_pu_bacteria | 2718218232 | 2720614976 | 137 |
| 1276 | iso_pu_bacteria | 2718218233 | 2720621747 | 137 |
| 1277 | iso_pu_bacteria | 2718218235 | 2720633082 | 137 |
| 1278 | iso_pu_bacteria | 2718218269 | 2720776801 | 137 |
| 1279 | iso_pu_bacteria | 2721755556 | 2723028391 | 137 |
| 1280 | iso_pu_bacteria | 2721755684 | 2723562017 | 137 |
| 1281 | iso_pu_bacteria | 2721755685 | 2723568649 | 137 |
| 1282 | iso_pu_bacteria | 2721755819 | 2724091408 | 137 |
| 1283 | iso_pu_bacteria | 2721755822 | 2724105914 | 137 |
| 1284 | iso_pu_bacteria | 2721755823 | 2724111739 | 137 |
| 1285 | iso_pu_bacteria | 2728369352 | 2730109327 | 137 |
| 1286 | iso_pu_bacteria | 2738541293 | 2738803852 | 137 |
| 1287 | iso_pu_bacteria | 2791355259 | 2793318279 | 137 |
| 1288 | iso_pu_bacteria | 2838016132 | 2838021978 | 137 |
| 1289 | iso_pu_bacteria | 2838042994 | 2838048238 | 137 |
| 1290 | iso_pu_bacteria | 2838048938 | 2838053604 | 137 |
| 1291 | iso_pu_bacteria | 2838061910 | 2838067565 | 137 |
| 1292 | iso_pu_bacteria | 2838068647 | 2838073930 | 137 |
| 1293 | iso_pu_bacteria | 2841864319 | 2841867979 | 137 |
| 1294 | iso_pu_bacteria | 2842264693 | 2842269124 | 137 |
| 1295 | iso_pu_bacteria | 2842311132 | 2842311145 | 137 |
| 1296 | iso_pu_bacteria | 2842341865 | 2842348027 | 137 |
| 1297 | iso_pu_bacteria | 2842363717 | 2842366485 | 137 |
| 1298 | iso_pu_bacteria | 2842395702 | 2842396270 | 137 |
| 1299 | iso_pu_bacteria | 2842422224 | 2842427731 | 137 |
| 1300 | iso_pu_bacteria | 2842428310 | 2842433183 | 137 |
| 1301 | iso_pu_bacteria | 2842434925 | 2842439609 | 137 |
| 1302 | iso_pu_bacteria | 2842441272 | 2842446312 | 137 |
| 1303 | iso_pu_bacteria | 2842447887 | 2842448991 | 137 |
| 1304 | iso_pu_bacteria | 2842462802 | 2842467507 | 137 |
| 1305 | iso_pu_bacteria | 2842469257 | 2842473980 | 137 |
| 1306 | iso_pu_bacteria | 2933599457 | 2933604249 | 137 |
| 1307 | iso_pu_bacteria | 2996893221 | 2996895967 | 137 |
| 1308 | iso_pu_bacteria | 8005282627 | 8005286366 | 137 |
| 1309 | iso_pu_bacteria | 8005395548 | 8005401021 | 137 |
| 1310 | iso_pu_bacteria | 8005430974 | 8005435296 | 137 |
| 1311 | iso_pu_bacteria | 8005497431 | 8005497448 | 137 |
| 1312 | iso_pu_bacteria | 8005619151 | 8005623191 | 137 |
| 1313 | iso_pu_bacteria | 8005626139 | 8005627691 | 137 |
| 1314 | iso_pu_bacteria | 8005668836 | 8005668853 | 137 |
| 1315 | iso_pu_bacteria | 8005695170 | 8005695502 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r03-assembly1.cif.gz_A | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9913 | 8 | 137 |
| 3r03-assembly1.cif.gz_B | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9836 | 5 | 137 |
| 3r03-assembly1.cif.gz_A | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9764 | 8 | 137 |
| 3r03-assembly1.cif.gz_B | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9687 | 5 | 137 |
| 3hhj-assembly1.cif.gz_A | crystal structure of mutator mutt from bartonella henselae | 0.9547 | 7 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r03B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9832 | 5 | 137 | 3.90.79.10 |
| 3r03B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.968 | 5 | 137 | 3.90.79.10 |
| af_P77788_1_135_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9386 | 7 | 136 | 3.90.79.10 |
| 3a6uA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9312 | 10 | 134 | 3.90.79.10 |
| af_Q54BB8_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.931 | 1 | 135 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A560FIT1-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9992 | 6 | 137 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 GO:0046872 |
| AF-A0A1G3IE84-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9991 | 10 | 111 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A066PPN8-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9984 | 4 | 137 |
GO:0006260
GO:0006281 GO:0008413 GO:0016747 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A2E8XTE8-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9981 | 9 | 137 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A5J6MP78-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.998 | 4 | 137 |
GO:0006260
GO:0006281 GO:0008413 GO:0016747 GO:0035539 GO:0044715 GO:0044716 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar