F492905

General Info

Members Datasets Scaffolds Average Seq Length
1315 753 939 136

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1004890|Ga0055524_10048909
Length 153
Sequence MSEAARNILLVAACALIDADGRILLAQRPEGKSLAGLWEFPGGKVEPGETPEESLVRELHEELGITTKVACLAPLTFASHTYEKFHLLMPLYVCRRYEGIPHGKEGQALKWVKPQALRDYPMPPADEPLIPMLQDTLGTSDYYPVSVEFGCGY

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
26 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
27 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
28 2516143018 Ensifer sp. BR816 Isolate Nodule
29 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
30 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
31 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
32 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
33 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
34 2519899620 Rhizobium sp. Pop5 Isolate Nodule
35 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
36 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
37 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
38 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
39 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
40 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
41 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
42 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
43 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
44 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
45 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
46 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
47 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
48 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
49 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
50 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
51 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
52 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
53 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
54 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
55 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
56 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
57 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
58 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
59 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
60 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
61 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
62 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
63 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
64 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
65 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
66 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
67 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
68 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
69 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
70 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
71 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
72 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
73 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
74 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
75 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
76 2643221557 Ensifer sp. Root558 Isolate Unclassified
77 2643221568 Rhizobium sp. Root564 Isolate Unclassified
78 2643221582 Rhizobium sp. Root651 Isolate Unclassified
79 2643221591 Devosia sp. Root685 Isolate Unclassified
80 2643221599 Rhizobium sp. Root708 Isolate Unclassified
81 2643221607 Rhizobium sp. Root73 Isolate Unclassified
82 2643221610 Ensifer sp. Root74 Isolate Unclassified
83 2643221618 Ensifer sp. Root231 Isolate Unclassified
84 2643221626 Ensifer sp. Root31 Isolate Unclassified
85 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
86 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
87 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
88 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
89 2643221655 Ensifer sp. Root1252 Isolate Unclassified
90 2643221659 Ensifer sp. Root127 Isolate Unclassified
91 2643221668 Ensifer sp. Root423 Isolate Unclassified
92 2643221675 Ensifer sp. Root1298 Isolate Unclassified
93 2643221680 Ensifer sp. Root1312 Isolate Unclassified
94 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
95 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
96 2643221693 Rhizobium sp. Root491 Isolate Unclassified
97 2643221698 Ensifer sp. Root142 Isolate Unclassified
98 2643221712 Ensifer sp. Root258 Isolate Unclassified
99 2643221719 Rhizobium sp. Root274 Isolate Unclassified
100 2643221723 Ensifer sp. Root278 Isolate Unclassified
101 2643221726 Ensifer sp. Root954 Isolate Unclassified
102 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
103 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
104 2718217882 Rhizobium sp. N741 Isolate Nodule
105 2718217927 Rhizobium sp. N324 Isolate Nodule
106 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
107 2718218009 Rhizobium sp. N561 Isolate Nodule
108 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
109 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
110 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
111 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
112 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
113 2718218363 Rhizobium sp. N113 Isolate Nodule
114 2718218365 Rhizobium sp. N731 Isolate Nodule
115 2718218366 Rhizobium sp. N621 Isolate Nodule
116 2718218423 Rhizobium sp. N941 Isolate Nodule
117 2721755514 Rhizobium sp. N6212 Isolate Nodule
118 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
119 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
120 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
121 2721755809 Rhizobium sp. N541 Isolate Nodule
122 2721755810 Rhizobium sp. N871 Isolate Nodule
123 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
124 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
125 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
126 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
127 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
128 2728369365 Rhizobium sp. N1341 Isolate Nodule
129 2728369397 Rhizobium sp. N1314 Isolate Nodule
130 2738541293 Rhizobium sp. GV031 Isolate Unclassified
131 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
132 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
133 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
134 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
135 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
136 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
137 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
138 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
139 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
140 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
141 2791355256 Rhizobium sp. M10 Isolate Nodule
142 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
143 2791355260 Rhizobium sp. L9 Isolate Nodule
144 2791355261 Rhizobium sp. J15 Isolate Nodule
145 2791355262 Rhizobium sp. M1 Isolate Nodule
146 2791355263 Rhizobium chutanense C5 Isolate Nodule
147 2791355264 Rhizobium sp. S9 Isolate Nodule
148 2791355265 Rhizobium sp. H4 Isolate Nodule
149 2791355266 Rhizobium sp. L43 Isolate Nodule
150 2791355267 Rhizobium sp. L18 Isolate Nodule
151 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
152 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
153 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
154 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
155 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
156 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
157 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
158 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
159 2802429633 Rhizobium anhuiense J3 Isolate Nodule
160 2802429634 Rhizobium anhuiense S10 Isolate Nodule
161 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
162 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
163 2802429637 Rhizobium anhuiense C15 Isolate Nodule
164 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
165 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
166 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
167 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
168 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
169 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
170 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
171 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
172 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
173 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
174 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
175 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
176 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
177 2838048938 Rhizobium pisi 27/80 Isolate Nodule
178 2838061910 Rhizobium phaseoli L15 Isolate Nodule
179 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
180 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
181 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
182 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
183 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
184 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
185 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
186 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
187 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
188 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
189 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
190 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
191 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
192 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
193 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
194 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
195 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
196 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
197 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
198 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
199 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
200 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
201 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
202 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
203 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
204 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
205 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
206 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
207 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
208 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
209 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
210 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
211 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
212 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
213 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
214 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
215 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
216 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
217 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
218 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
219 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
220 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
221 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
222 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
223 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
224 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
225 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
226 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
227 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
228 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
229 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
230 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
231 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
232 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
233 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
234 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
235 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
236 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
237 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
238 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
239 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
240 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
241 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
242 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
243 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
244 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
245 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
246 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
247 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
248 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
249 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
250 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
251 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
252 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
253 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
254 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
255 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
256 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
257 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
258 2842694124 Methylopila sp. R-72369 Isolate Unclassified
259 2844163670 Ensifer sp. 1H6 Isolate Unclassified
260 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
261 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
262 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
263 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
264 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
265 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
266 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
267 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
268 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
269 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
270 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
271 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
272 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
273 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
274 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
275 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
276 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
277 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
278 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
279 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
280 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
281 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
282 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
283 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
284 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
285 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
286 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
287 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
288 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
289 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
290 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
291 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
292 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
293 2933599457 Rhizobium phaseoli M3 Isolate Nodule
294 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
295 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
296 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
297 2936381700 Rhizobium chutanense C16 Isolate Unclassified
298 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
299 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
300 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
301 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
302 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
303 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
304 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
305 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
306 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
307 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
308 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
309 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
310 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
311 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
312 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
313 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
314 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
315 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
316 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
317 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
318 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
319 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
320 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
321 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
322 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
323 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
324 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
325 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
326 2996887358 Rhizobium sp. R711 Isolate Nodule
327 2996893221 Rhizobium sp. R635 Isolate Nodule
328 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
329 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
330 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
331 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
332 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
333 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
334 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
335 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
336 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
337 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
338 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
339 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
340 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
341 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
342 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
343 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
344 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
345 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
346 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
347 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
348 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
349 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
350 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
351 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
352 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
353 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
354 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
355 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
356 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
357 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
358 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
359 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
360 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
361 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
362 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
363 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
364 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
365 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
366 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
367 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
368 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
369 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
370 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
371 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
372 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
373 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
374 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
375 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
376 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
377 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
378 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
379 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
380 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
381 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
382 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
383 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
384 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
385 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
386 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
387 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
388 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
389 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
390 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
391 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
392 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
393 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
394 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
395 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
396 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
397 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
398 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
399 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
400 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
401 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
402 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
403 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
404 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
405 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
406 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
407 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
408 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
409 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
410 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
411 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
412 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
413 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
414 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
415 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
416 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
417 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
418 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
419 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
420 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
421 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
422 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
423 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
424 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
425 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
426 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
427 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
428 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
429 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
430 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
431 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
432 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
433 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
434 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
435 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
436 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
437 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
438 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
439 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
440 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
441 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
442 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
443 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
444 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
445 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
446 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
447 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
448 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
449 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
450 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
451 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
452 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
453 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
454 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
457 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
458 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
459 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
461 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
462 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
494 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
495 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
496 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
499 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
500 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
501 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
502 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
504 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
505 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
506 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
507 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
508 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
509 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
510 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
511 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
512 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
513 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
514 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
515 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
516 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
517 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
518 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
519 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
520 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
521 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
522 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
523 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
524 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
525 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
526 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
527 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
528 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
529 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
530 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
531 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
532 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
533 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
534 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
535 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
536 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
537 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
538 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
539 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
540 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
541 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
542 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
543 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
544 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
545 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
546 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
547 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
548 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
549 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
550 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
551 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
552 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
553 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
554 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
555 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
556 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
557 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
558 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
559 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
560 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
561 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
562 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
563 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
564 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
565 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
566 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
567 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
568 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
569 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
570 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
571 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
572 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
573 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
574 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
575 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
576 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
577 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
578 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
579 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
580 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
581 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
582 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
583 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
584 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
585 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
586 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
587 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
588 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
589 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
590 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
591 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
592 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
593 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
594 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
595 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
596 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
597 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
598 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
599 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
600 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
601 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
602 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
603 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
604 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
605 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
606 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
607 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
608 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
609 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
610 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
611 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
612 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
613 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
614 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
615 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
616 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
617 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
618 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
619 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
620 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
621 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
622 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
623 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
624 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
625 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
626 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
627 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
628 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
629 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
630 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
631 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
632 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
633 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
634 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
635 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
636 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
637 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
638 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
639 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
640 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
641 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
642 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
643 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
644 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
645 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
653 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
655 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
656 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
658 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
659 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
660 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
661 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
662 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
663 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
664 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
665 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
666 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
667 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
669 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
670 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
671 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
672 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
673 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
674 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
675 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
676 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
677 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
678 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
679 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
680 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
681 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
682 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
683 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
684 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
685 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
686 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
687 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
688 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
689 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
690 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
691 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
692 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
693 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
694 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
695 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
696 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
697 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
698 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
699 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
700 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
701 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
702 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
703 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
704 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
705 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
706 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
707 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
708 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
709 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
710 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
711 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
712 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
713 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
714 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
715 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
716 8005258706 Rhizobium sp. R693 Isolate Nodule
717 8005275841 Rhizobium sp. N4311 Isolate Nodule
718 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
719 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
720 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
721 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
722 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
723 8005321885 Rhizobium sp. R72 Isolate Nodule
724 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
725 8005382845 Rhizobium sp. R634 Isolate Nodule
726 8005395548 Rhizobium sp. R339 Isolate Nodule
727 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
728 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
729 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
730 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
731 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
732 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
733 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
734 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
735 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
736 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
737 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
738 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
739 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
740 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
741 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
742 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
743 8018176218 Rhizobium sp. N122 Isolate Nodule
744 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
745 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
746 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
747 8024501048 Rhizobium sp. H4 Isolate Nodule
748 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
749 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
750 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
751 8056382006 Rhizobium croatiense 13T Isolate Nodule
752 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
753 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.33
Metatranscriptomes 0.15
Isolates 28.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 21.67
Nodule 20.46
Rhizoplane 3.8
Rhizosphere 35.67
Stem 0
Stem Tuber 0
Unclassified 18.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000006 3300001979 Bacteria 86112
2 JGI24739J22299_10267310 3300001989 Bacteria 501
3 JGI25155J39150_1000010 3300002704 Bacteria 207717
4 JGI25156J39149_1000186 3300002705 Bacteria 45132
5 JGI25162J39368_1001145 3300002737 Bacteria 15877
6 JGI25162J39368_1001856 3300002737 Bacteria 9773
7 JGI25154J39366_1000187 3300002738 Bacteria 46590
8 JGI25158J39367_1000078 3300002739 Bacteria 22361
9 JGI25158J39367_1001106 3300002739 Bacteria 4890
10 JGI25157J39369_1000009 3300002741 Bacteria 207868
11 JGI25152J39213_1001233 3300002773 Bacteria 11688
12 JGI25152J39213_1005065 3300002773 Bacteria 3965
13 JGI25152J39213_1007357 3300002773 Bacteria 2858
14 JGI25152J39213_1014180 3300002773 Bacteria 1627
15 JGI25150J39212_1000061 3300002774 Bacteria 64691
16 JGI25150J39212_1001592 3300002774 Bacteria 6185
17 JGI25159J45721_1000705 3300002987 Bacteria 14596
18 JGI25159J45721_1006597 3300002987 Bacteria 3453
19 JGI25151J46595_10000081 3300003187 Bacteria 131317
20 JGI25151J46595_10001107 3300003187 Bacteria 19786
21 JGI25151J46595_10010445 3300003187 Bacteria 4315
22 JGI25151J46595_10015280 3300003187 Bacteria 3389
23 JGI25151J46595_10043100 3300003187 Bacteria 1618
24 JGI25151J46595_10131101 3300003187 Bacteria 624
25 JGI25165J46597_1000931 3300003214 Bacteria 20259
26 JGI25165J46597_1001497 3300003214 Bacteria 11934
27 JGI25153J46596_10012416 3300003215 Bacteria 3676
28 JGI25153J46596_10012547 3300003215 Bacteria 3646
29 JGI25153J46596_10018618 3300003215 Bacteria 2691
30 rootH1_10152258 3300003316 Bacteria 1061
31 rootH2_10031031 3300003320 Bacteria 6868
32 rootH2_10083047 3300003320 Bacteria 2188
33 rootL2_10071739 3300003322 Bacteria 9200
34 rootL2_10087378 3300003322 Bacteria 1296
35 rootL2_10230007 3300003322 Bacteria 1326
36 rootH1_10049284 3300003323 Bacteria 3663
37 JGI25160J50197_1000085 3300003354 Bacteria 96359
38 JGI25160J50197_1000247 3300003354 Bacteria 41848
39 JGI25160J50197_1000573 3300003354 Bacteria 20785
40 JGI25160J50197_1015877 3300003354 Bacteria 2452
41 JGI25161J50226_1000065 3300003374 Bacteria 96359
42 JGI25161J50226_1000136 3300003374 Bacteria 50681
43 JGI25161J50226_1000620 3300003374 Bacteria 14553
44 JGI25161J50226_1001517 3300003374 Bacteria 6860
45 Ga0055526_1001073 3300003771 Bacteria 19979
46 Ga0055526_1001171 3300003771 Bacteria 19013
47 Ga0055526_1011715 3300003771 Bacteria 3912
48 Ga0055526_1011819 3300003771 Bacteria 3878
49 Ga0055526_1017122 3300003771 Bacteria 2791
50 Ga0055526_1017528 3300003771 Bacteria 2730
51 Ga0055524_1001593 3300003775 Bacteria 12729
52 Ga0055524_1001808 3300003775 Bacteria 11711
53 Ga0055524_1003160 3300003775 Bacteria 8112
54 Ga0055524_1004890 3300003775 Bacteria 6083
55 Ga0055524_1013856 3300003775 Bacteria 3016
56 Ga0055524_1018215 3300003775 Bacteria 2446
57 Ga0055524_1040205 3300003775 Bacteria 1196
58 Ga0055524_1056699 3300003775 Bacteria 842
59 Ga0055536_1001369 3300003781 Bacteria 14820
60 Ga0055528_1000998 3300003790 Bacteria 18796
61 Ga0055528_1001541 3300003790 Bacteria 13875
62 Ga0055528_1004794 3300003790 Bacteria 6438
63 Ga0055528_1008492 3300003790 Bacteria 4393
64 Ga0055528_1009155 3300003790 Bacteria 4169
65 Ga0055528_1014264 3300003790 Bacteria 2950
66 Ga0055528_1022360 3300003790 Bacteria 1973
67 Ga0055528_1036936 3300003790 Bacteria 1157
68 Ga0055530_10008430 3300003791 Bacteria 4131
69 Ga0055540_1004170 3300003792 Bacteria 6662
70 Ga0055540_1008152 3300003792 Bacteria 3816
71 Ga0055540_1009578 3300003792 Bacteria 3330
72 Ga0055540_1025029 3300003792 Bacteria 1469
73 Ga0055540_1027739 3300003792 Bacteria 1349
74 Ga0055531_10007968 3300003794 Bacteria 5672
75 Ga0055531_10055202 3300003794 Bacteria 1012
76 Ga0058692_1000999 3300003856 Bacteria 11113
77 Ga0058692_1001038 3300003856 Bacteria 10898
78 Ga0058692_1004538 3300003856 Bacteria 4097
79 Ga0055543_1000067 3300004625 Bacteria 96039
80 Ga0055543_1000228 3300004625 Bacteria 44611
81 Ga0055543_1000461 3300004625 Bacteria 24023
82 Ga0055543_1000496 3300004625 Bacteria 22765
83 Ga0065165_1000237 3300005262 Bacteria 96039
84 Ga0065165_1000804 3300005262 Bacteria 41886
85 Ga0065165_1013013 3300005262 Bacteria 3339
86 Ga0065165_1017307 3300005262 Bacteria 2660
87 Ga0065165_1060064 3300005262 Bacteria 1045
88 Ga0065165_1066922 3300005262 Bacteria 965
89 Ga0065704_10288861 3300005289 Bacteria 907
90 Ga0070658_10017272 3300005327 Bacteria 5775
91 Ga0070683_100044090 3300005329 Bacteria 4112
92 Ga0070670_100000117 3300005331 Bacteria 74455
93 Ga0070670_100117569 3300005331 Bacteria 2293
94 Ga0070670_101012134 3300005331 Bacteria 756
95 Ga0070666_10475267 3300005335 Bacteria 904
96 Ga0070682_100489930 3300005337 Bacteria 950
97 Ga0068868_100045047 3300005338 Bacteria 3450
98 Ga0070660_100385585 3300005339 Bacteria 1157
99 Ga0070661_100001446 3300005344 Bacteria 16504
100 Ga0070668_100177326 3300005347 Bacteria 1739
101 Ga0070668_100337499 3300005347 Bacteria 1272
102 Ga0070668_100389022 3300005347 Bacteria 1188
103 Ga0070668_101196096 3300005347 Bacteria 688
104 Ga0070669_100076983 3300005353 Bacteria 2477
105 Ga0070669_100493471 3300005353 Bacteria 1015
106 Ga0070671_100043577 3300005355 Bacteria 3728
107 Ga0070659_100007639 3300005366 Bacteria 7860
108 Ga0070659_100589014 3300005366 Bacteria 955
109 Ga0070667_100538785 3300005367 Bacteria 1072
110 Ga0070667_100927078 3300005367 Bacteria 811
111 Ga0070663_100172605 3300005455 Bacteria 1672
112 Ga0070663_100456881 3300005455 Bacteria 1054
113 Ga0070678_100525214 3300005456 Bacteria 1048
114 Ga0068867_100147252 3300005459 Bacteria 1847
115 Ga0070684_100073206 3300005535 Bacteria 3019
116 Ga0068853_100031644 3300005539 Bacteria 4476
117 Ga0068853_100133323 3300005539 Bacteria 2225
118 Ga0068853_100719345 3300005539 Bacteria 953
119 Ga0070693_100124673 3300005547 Bacteria 1602
120 Ga0070665_100009302 3300005548 Bacteria 9945
121 Ga0070665_100102624 3300005548 Bacteria 2863
122 Ga0070665_100159944 3300005548 Bacteria 2254
123 Ga0070665_100263451 3300005548 Bacteria 1725
124 Ga0070665_100351786 3300005548 Bacteria 1479
125 Ga0070665_101001956 3300005548 Bacteria 848
126 Ga0070665_101249323 3300005548 Bacteria 753
127 Ga0068855_100099528 3300005563 Bacteria 3348
128 Ga0068855_100152322 3300005563 Bacteria 2629
129 Ga0068855_100946216 3300005563 Bacteria 908
130 Ga0068855_101367829 3300005563 Bacteria 731
131 Ga0068857_100019717 3300005577 Bacteria 5923
132 Ga0068857_100085044 3300005577 Bacteria 2827
133 Ga0068854_100002452 3300005578 Bacteria 11478
134 Ga0068854_100105200 3300005578 Bacteria 2121
135 Ga0068852_100002904 3300005616 Bacteria 11896
136 Ga0068852_100270712 3300005616 Bacteria 1634
137 Ga0068852_100563181 3300005616 Bacteria 1141
138 Ga0068852_100713165 3300005616 Bacteria 1014
139 Ga0068861_102410655 3300005719 Bacteria 529
140 Ga0068851_10028883 3300005834 Bacteria 2742
141 Ga0068862_102512770 3300005844 Bacteria 527
142 Ga0075365_10003552 3300006038 Bacteria 8066
143 Ga0075365_10076293 3300006038 Bacteria 2263
144 Ga0075365_10479402 3300006038 Bacteria 879
145 Ga0075368_10033372 3300006042 Bacteria 2002
146 Ga0075368_10040883 3300006042 Bacteria 1821
147 Ga0075368_10080740 3300006042 Bacteria 1323
148 Ga0075368_10309975 3300006042 Bacteria 682
149 Ga0075368_10475228 3300006042 Bacteria 556
150 Ga0075363_100025004 3300006048 Bacteria 3041
151 Ga0075363_100060344 3300006048 Bacteria 2042
152 Ga0075363_100100368 3300006048 Bacteria 1601
153 Ga0075363_100167443 3300006048 Bacteria 1246
154 Ga0075364_10006976 3300006051 Bacteria 6674
155 Ga0075364_10090776 3300006051 Bacteria 2026
156 Ga0075364_10172507 3300006051 Bacteria 1462
157 Ga0075364_10259139 3300006051 Bacteria 1182
158 Ga0075362_10010373 3300006177 Bacteria 3636
159 Ga0075362_10214920 3300006177 Bacteria 938
160 Ga0075362_10231919 3300006177 Bacteria 904
161 Ga0075367_10002378 3300006178 Bacteria 8563
162 Ga0075367_10020524 3300006178 Bacteria 3681
163 Ga0075367_10044316 3300006178 Bacteria 2607
164 Ga0075367_10351943 3300006178 Bacteria 930
165 Ga0075367_10403665 3300006178 Bacteria 864
166 Ga0075369_10000556 3300006186 Bacteria 11754
167 Ga0075369_10001596 3300006186 Bacteria 7792
168 Ga0075369_10011871 3300006186 Bacteria 3432
169 Ga0075369_10018986 3300006186 Bacteria 2803
170 Ga0075369_10026625 3300006186 Bacteria 2412
171 Ga0075369_10166395 3300006186 Bacteria 1011
172 Ga0075366_10003442 3300006195 Bacteria 8348
173 Ga0075366_10058667 3300006195 Bacteria 2286
174 Ga0075366_10112785 3300006195 Bacteria 1636
175 Ga0075370_10012653 3300006353 Bacteria 4467
176 Ga0075370_10025702 3300006353 Bacteria 3258
177 Ga0075370_10028427 3300006353 Bacteria 3108
178 Ga0075370_10150675 3300006353 Bacteria 1363
179 Ga0075370_10194611 3300006353 Bacteria 1195
180 Ga0068871_100624372 3300006358 Bacteria 982
181 Ga0075428_100528715 3300006844 Bacteria 1261
182 Ga0079104_1000101 3300006946 Bacteria 125456
183 Ga0079104_1013490 3300006946 Bacteria 2513
184 Ga0099826_10000590 3300006948 Bacteria 18363
185 Ga0099826_10032648 3300006948 Bacteria 3750
186 Ga0099826_10109008 3300006948 Bacteria 1653
187 Ga0105251_10015497 3300009011 Bacteria 4164
188 Ga0105244_10103397 3300009036 Bacteria 1391
189 Ga0105250_10032609 3300009092 Bacteria 2092
190 Ga0105240_10000013 3300009093 Bacteria 483458
191 Ga0105240_10116139 3300009093 Bacteria 3229
192 Ga0105240_12217276 3300009093 Bacteria 569
193 Ga0105243_10268497 3300009148 Bacteria 1531
194 Ga0105243_10855822 3300009148 Bacteria 901
195 Ga0105243_11255511 3300009148 Bacteria 756
196 Ga0105241_10218315 3300009174 Bacteria 1601
197 Ga0105248_10090815 3300009177 Bacteria 3439
198 Ga0105237_10001167 3300009545 Bacteria 35083
199 Ga0105237_10190489 3300009545 Bacteria 2051
200 Ga0105237_10801268 3300009545 Bacteria 949
201 Ga0105238_10018169 3300009551 Bacteria 7150
202 Ga0105238_10819002 3300009551 Bacteria 947
203 Ga0105249_10639932 3300009553 Bacteria 1120
204 Ga0123340_1042431 3300009763 Bacteria 2033
205 Ga0123341_1000187 3300009765 Bacteria 31482
206 Ga0123341_1079145 3300009765 Bacteria 1312
207 Ga0123342_1016630 3300009766 Bacteria 6347
208 Ga0123342_1024950 3300009766 Bacteria 3669
209 Ga0105239_10093668 3300010375 Bacteria 3317
210 Ga0105239_10210486 3300010375 Bacteria 2179
211 Ga0105239_10498833 3300010375 Bacteria 1384
212 Ga0105239_11908473 3300010375 Bacteria 689
213 Ga0105239_12364335 3300010375 Bacteria 619
214 Ga0157373_10025106 3300013100 Bacteria 4314
215 Ga0157373_10037599 3300013100 Bacteria 3470
216 Ga0157373_10048623 3300013100 Bacteria 3024
217 Ga0157371_10000002 3300013102 Bacteria 665040
218 Ga0157371_10007550 3300013102 Bacteria 8786
219 Ga0157371_10163292 3300013102 Bacteria 1591
220 Ga0157371_10226699 3300013102 Bacteria 1342
221 Ga0157370_10000143 3300013104 Bacteria 87289
222 Ga0157370_10006960 3300013104 Bacteria 12353
223 Ga0157370_10237336 3300013104 Bacteria 1687
224 Ga0157370_11213204 3300013104 Bacteria 680
225 Ga0157369_10219048 3300013105 Bacteria 1993
226 Ga0157369_11600983 3300013105 Bacteria 662
227 Ga0171463_1006 3300013249 Bacteria 336402
228 Ga0157374_10503729 3300013296 Bacteria 1215
229 Ga0157378_10191660 3300013297 Bacteria 1928
230 Ga0157372_10012923 3300013307 Bacteria 8900
231 Ga0157372_10455409 3300013307 Bacteria 1491
232 Ga0157372_11896665 3300013307 Bacteria 685
233 Ga0157375_10303902 3300013308 Bacteria 1759
234 Ga0157375_11230542 3300013308 Bacteria 879
235 Ga0163163_11341135 3300014325 Bacteria 777
236 Ga0163163_11822364 3300014325 Bacteria 669
237 Ga0182008_10122763 3300014497 Bacteria 1291
238 Ga0157376_11872238 3300014969 Bacteria 637
239 Ga0182007_10001582 3300015262 Bacteria 12131
240 Ga0182005_1007805 3300015265 Bacteria 3186
241 Ga0183363_1095 3300015690 Bacteria 25674
242 Ga0163161_10374982 3300017792 Bacteria 1136
243 Ga0163161_10921347 3300017792 Bacteria 742
244 Ga0214544_1000132 3300021320 Bacteria 108681
245 Ga0214542_1004982 3300021321 Bacteria 25735
246 Ga0214542_1034961 3300021321 Bacteria 1588
247 Ga0214543_1000008 3300021327 Bacteria 385680
248 Ga0214543_1000102 3300021327 Bacteria 108906
249 Ga0213876_10110405 3300021384 Bacteria 1460
250 Ga0228711_1000022 3300022739 Bacteria 107483
251 Ga0228710_1000028 3300022740 Bacteria 102538
252 Ga0209435_100009 3300025206 Bacteria 476614
253 Ga0209436_100089 3300025208 Bacteria 45843
254 Ga0209436_100790 3300025208 Bacteria 13076
255 Ga0209672_101912 3300025228 Bacteria 5960
256 Ga0207427_111005 3300025231 Bacteria 929
257 Ga0209437_100057 3300025233 Bacteria 362922
258 Ga0209437_100452 3300025233 Bacteria 33764
259 Ga0209437_103994 3300025233 Bacteria 2621
260 Ga0207425_1000034 3300025245 Bacteria 227886
261 Ga0207425_1004151 3300025245 Bacteria 4419
262 Ga0207425_1004943 3300025245 Bacteria 3892
263 Ga0207425_1020525 3300025245 Bacteria 1411
264 Ga0209646_1000018 3300025246 Bacteria 476716
265 Ga0209646_1026581 3300025246 Bacteria 802
266 Ga0209026_1000068 3300025250 Bacteria 207601
267 Ga0209677_101882 3300025253 Bacteria 8509
268 Ga0209759_1000007 3300025256 Bacteria 476614
269 Ga0209129_1000094 3300025258 Bacteria 172051
270 Ga0209129_1000290 3300025258 Bacteria 47943
271 Ga0209129_1000519 3300025258 Bacteria 27449
272 Ga0209129_1001202 3300025258 Bacteria 14902
273 Ga0209129_1001250 3300025258 Bacteria 14582
274 Ga0209129_1009271 3300025258 Bacteria 2617
275 Ga0209233_1000134 3300025261 Bacteria 202535
276 Ga0209233_1000343 3300025261 Bacteria 45433
277 Ga0209233_1000367 3300025261 Bacteria 40782
278 Ga0209455_1009867 3300025272 Bacteria 2471
279 Ga0209673_1000158 3300025273 Bacteria 143067
280 Ga0209673_1000283 3300025273 Bacteria 94995
281 Ga0209673_1000771 3300025273 Bacteria 43169
282 Ga0209673_1002843 3300025273 Bacteria 11093
283 Ga0209673_1010655 3300025273 Bacteria 3856
284 Ga0209673_1016456 3300025273 Bacteria 2764
285 Ga0209673_1025562 3300025273 Bacteria 1960
286 Ga0209673_1076855 3300025273 Bacteria 776
287 Ga0209673_1076873 3300025273 Bacteria 776
288 Ga0209130_1000009 3300025284 Bacteria 498952
289 Ga0209130_1000265 3300025284 Bacteria 65775
290 Ga0209130_1000465 3300025284 Bacteria 41986
291 Ga0209130_1009861 3300025284 Bacteria 2679
292 Ga0209130_1036575 3300025284 Bacteria 974
293 Ga0209675_1025119 3300025291 Bacteria 1508
294 Ga0209676_1003840 3300025292 Bacteria 8817
295 Ga0209676_1040802 3300025292 Bacteria 1303
296 Ga0209676_1057007 3300025292 Bacteria 992
297 Ga0209025_1000184 3300025294 Bacteria 155611
298 Ga0209025_1000245 3300025294 Bacteria 127801
299 Ga0209025_1000725 3300025294 Bacteria 55900
300 Ga0209025_1001475 3300025294 Bacteria 30611
301 Ga0209025_1001628 3300025294 Bacteria 28018
302 Ga0209025_1002008 3300025294 Bacteria 23288
303 Ga0209025_1003091 3300025294 Bacteria 16331
304 Ga0209025_1016825 3300025294 Bacteria 4274
305 Ga0209025_1019068 3300025294 Bacteria 3838
306 Ga0209025_1019090 3300025294 Bacteria 3833
307 Ga0209025_1065561 3300025294 Bacteria 1325
308 Ga0209564_1000381 3300025295 Bacteria 81150
309 Ga0209564_1000960 3300025295 Bacteria 36623
310 Ga0209564_1001128 3300025295 Bacteria 31421
311 Ga0209564_1001662 3300025295 Bacteria 21363
312 Ga0209564_1007822 3300025295 Bacteria 5424
313 Ga0209564_1028109 3300025295 Bacteria 1807
314 Ga0209564_1053257 3300025295 Bacteria 965
315 Ga0209758_1000159 3300025297 Bacteria 155588
316 Ga0209758_1001526 3300025297 Bacteria 26781
317 Ga0209758_1002004 3300025297 Bacteria 21909
318 Ga0209758_1004118 3300025297 Bacteria 12457
319 Ga0209758_1006869 3300025297 Bacteria 7953
320 Ga0209758_1015934 3300025297 Bacteria 3854
321 Ga0209050_1001980 3300025298 Bacteria 19226
322 Ga0209050_1016935 3300025298 Bacteria 2943
323 Ga0209050_1019171 3300025298 Bacteria 2615
324 Ga0209256_1000440 3300025299 Bacteria 63735
325 Ga0209256_1000892 3300025299 Bacteria 36721
326 Ga0209256_1001107 3300025299 Bacteria 30848
327 Ga0209256_1002685 3300025299 Bacteria 13917
328 Ga0209256_1003593 3300025299 Bacteria 10682
329 Ga0209256_1007542 3300025299 Bacteria 5324
330 Ga0209256_1010198 3300025299 Bacteria 3976
331 Ga0209256_1016042 3300025299 Bacteria 2578
332 Ga0209256_1027473 3300025299 Bacteria 1621
333 Ga0207426_1000041 3300025302 Bacteria 433536
334 Ga0207426_1000048 3300025302 Bacteria 409127
335 Ga0207426_1000309 3300025302 Bacteria 96053
336 Ga0207426_1000646 3300025302 Bacteria 43187
337 Ga0207426_1003037 3300025302 Bacteria 9705
338 Ga0209051_1001583 3300025303 Bacteria 18715
339 Ga0209051_1001638 3300025303 Bacteria 18164
340 Ga0209051_1008054 3300025303 Bacteria 5642
341 Ga0209051_1008858 3300025303 Bacteria 5266
342 Ga0209051_1013569 3300025303 Bacteria 3868
343 Ga0209051_1022857 3300025303 Bacteria 2618
344 Ga0209257_1002473 3300025304 Bacteria 18276
345 Ga0209257_1007098 3300025304 Bacteria 6908
346 Ga0207656_10010673 3300025321 Bacteria 3447
347 Ga0207713_1045049 3300025735 Bacteria 1805
348 Ga0207642_10819594 3300025899 Bacteria 593
349 Ga0207710_10412015 3300025900 Bacteria 694
350 Ga0207705_10021220 3300025909 Bacteria 4632
351 Ga0207654_10302413 3300025911 Bacteria 1088
352 Ga0207695_10001286 3300025913 Bacteria 42649
353 Ga0207671_10001380 3300025914 Bacteria 28264
354 Ga0207671_10103478 3300025914 Bacteria 2159
355 Ga0207671_10422014 3300025914 Bacteria 1061
356 Ga0207671_10770117 3300025914 Bacteria 764
357 Ga0207657_10003807 3300025919 Bacteria 16038
358 Ga0207657_10225922 3300025919 Bacteria 1498
359 Ga0207649_10003241 3300025920 Bacteria 8900
360 Ga0207681_10058022 3300025923 Bacteria 2649
361 Ga0207694_10365970 3300025924 Bacteria 1195
362 Ga0207650_10001181 3300025925 Bacteria 19172
363 Ga0207650_10883583 3300025925 Bacteria 759
364 Ga0207687_10900942 3300025927 Bacteria 757
365 Ga0207644_10033903 3300025931 Bacteria 3571
366 Ga0207690_10355277 3300025932 Bacteria 1160
367 Ga0207706_10382385 3300025933 Bacteria 1221
368 Ga0207709_10145751 3300025935 Bacteria 1633
369 Ga0207709_10296112 3300025935 Bacteria 1201
370 Ga0207711_10147161 3300025941 Bacteria 2123
371 Ga0207679_10370569 3300025945 Bacteria 1253
372 Ga0207667_10390283 3300025949 Bacteria 1418
373 Ga0207667_10920614 3300025949 Bacteria 865
374 Ga0207651_10177865 3300025960 Bacteria 1685
375 Ga0207668_10095809 3300025972 Bacteria 2191
376 Ga0207668_10243747 3300025972 Bacteria 1456
377 Ga0207668_10831945 3300025972 Bacteria 819
378 Ga0207668_10998019 3300025972 Bacteria 748
379 Ga0207668_11092490 3300025972 Bacteria 715
380 Ga0207668_11278734 3300025972 Bacteria 660
381 Ga0207668_11555671 3300025972 Bacteria 597
382 Ga0207640_10335462 3300025981 Bacteria 1209
383 Ga0207658_10840713 3300025986 Bacteria 834
384 Ga0207658_11088068 3300025986 Bacteria 730
385 Ga0207658_11160804 3300025986 Bacteria 706
386 Ga0207677_10960035 3300026023 Bacteria 773
387 Ga0207639_10001619 3300026041 Bacteria 15145
388 Ga0207639_10088854 3300026041 Bacteria 2467
389 Ga0207639_10673352 3300026041 Bacteria 958
390 Ga0207678_10974322 3300026067 Bacteria 750
391 Ga0207678_11122235 3300026067 Bacteria 696
392 Ga0207702_10142586 3300026078 Bacteria 2170
393 Ga0207702_10188122 3300026078 Bacteria 1905
394 Ga0207702_10516068 3300026078 Bacteria 1166
395 Ga0207702_11469956 3300026078 Bacteria 675
396 Ga0207641_10615884 3300026088 Bacteria 1064
397 Ga0207648_10191456 3300026089 Bacteria 1813
398 Ga0207674_10012034 3300026116 Bacteria 9692
399 Ga0207674_10079019 3300026116 Bacteria 3295
400 Ga0207683_10127259 3300026121 Bacteria 2290
401 Ga0207698_10013047 3300026142 Bacteria 5467
402 Ga0207698_10037678 3300026142 Bacteria 3564
403 Ga0207698_10612754 3300026142 Bacteria 1074
404 Ga0209281_1000028 3300027111 Bacteria 440027
405 Ga0209281_1000247 3300027111 Bacteria 107495
406 Ga0209371_1000003 3300027312 Bacteria 1122971
407 Ga0209371_1001357 3300027312 Bacteria 16945
408 Ga0209371_1001699 3300027312 Bacteria 13954
409 Ga0209371_1001789 3300027312 Bacteria 13450
410 Ga0209282_1000037 3300027666 Bacteria 130160
411 Ga0209282_1000342 3300027666 Bacteria 23118
412 Ga0209282_1017049 3300027666 Bacteria 4619
413 Ga0209813_10056995 3300027866 Bacteria 1238
414 Ga0209813_10092699 3300027866 Bacteria 1017
415 Ga0209813_10094142 3300027866 Bacteria 1010
416 Ga0209813_10120981 3300027866 Bacteria 911
417 Ga0268266_10007330 3300028379 Bacteria 9966
418 Ga0268266_10011023 3300028379 Bacteria 7871
419 Ga0268266_10287215 3300028379 Bacteria 1531
420 Ga0307515_10000860 3300028794 Bacteria 69854
421 Ga0307515_10016242 3300028794 Bacteria 13644
422 Ga0307515_10068193 3300028794 Bacteria 4891
423 Ga0307515_10870572 3300028794 Bacteria 529
424 Ga0268256_1000004 3300030500 Bacteria 1122967
425 Ga0268256_1000728 3300030500 Bacteria 24256
426 Ga0268256_1003113 3300030500 Bacteria 7733
427 Ga0316181_1122127 3300030744 Bacteria 2312
428 Ga0265316_10038608 3300031344 Bacteria 3845
429 Ga0307513_10002143 3300031456 Bacteria 27633
430 Ga0307513_10042417 3300031456 Bacteria 5010
431 Ga0307513_10618257 3300031456 Bacteria 792
432 Ga0307408_100618930 3300031548 Bacteria 964
433 Ga0307405_10000088 3300031731 Bacteria 39053
434 Ga0307405_10876135 3300031731 Bacteria 758
435 Ga0307405_10979039 3300031731 Bacteria 720
436 Ga0307405_11807209 3300031731 Bacteria 543
437 Ga0307410_10364385 3300031852 Bacteria 1158
438 Ga0307406_10052070 3300031901 Bacteria 2602
439 Ga0307406_10123869 3300031901 Bacteria 1802
440 Ga0307412_10004000 3300031911 Bacteria 8216
441 Ga0307412_10027402 3300031911 Bacteria 3552
442 Ga0307412_10062068 3300031911 Bacteria 2515
443 Ga0307412_10850240 3300031911 Bacteria 796
444 Ga0307412_11335103 3300031911 Bacteria 647
445 Ga0315914_1000002 3300031967 Bacteria 365357
446 Ga0307409_100071381 3300031995 Bacteria 2761
447 Ga0307414_10031302 3300032004 Bacteria 3488
448 Ga0307414_11158943 3300032004 Bacteria 715
449 Ga0307510_10366289 3300033180 Bacteria 888
450 Ga0315913_1000018 3300033430 Bacteria 102535
451 Ga0315915_1000005 3300033464 Bacteria 397591
452 Ga0373948_0050325 3300034817 Bacteria 894
453 Ga0373931_0096189 3300035691 Bacteria 1658
454 Ga0395900_0758731 3300037418 Bacteria 900
455 Ga0395898_0186187 3300037466 Bacteria 1984
456 Ga0436364_0583757 3300037853 Bacteria 1476
457 Ga0436365_1509750 3300039437 Bacteria 2905
458 Ga0439436_0037077 3300041404 Bacteria 1405
459 Ga0439436_0094264 3300041404 Bacteria 834
460 Ga0439439_0069703 3300041406 Bacteria 941
461 Ga0439466_0223540 3300041411 Bacteria 571
462 Ga0439465_0000679 3300041413 Bacteria 10418
463 Ga0439465_0022502 3300041413 Bacteria 1980
464 Ga0451787_114555 3300041441 Bacteria 2487
465 Ga0451789_0796484 3300041443 Bacteria 1679
466 Ga0451791_0471423 3300041451 Bacteria 1164
467 Ga0451791_0616845 3300041451 Bacteria 2096
468 Ga0451791_1264307 3300041451 Bacteria 555
469 Ga0451798_0339288 3300041458 Bacteria 1603
470 Ga0451800_0984752 3300041459 Bacteria 765
471 Ga0451802_0288055 3300041460 Bacteria 1524
472 Ga0451802_0399050 3300041460 Bacteria 677
473 Ga0451807_0447172 3300041486 Bacteria 941
474 Ga0451807_1709282 3300041486 Bacteria 865
475 Ga0451833_1324270 3300041491 Bacteria 1410
476 Ga0451835_0708937 3300041492 Bacteria 580
477 Ga0451835_0853460 3300041492 Bacteria 652
478 Ga0451837_1678452 3300041494 Bacteria 640
479 Ga0451841_0304265 3300041498 Bacteria 912
480 Ga0451841_1215396 3300041498 Bacteria 594
481 Ga0451846_32342 3300041502 Bacteria 1089
482 Ga0451847_0501180 3300041503 Bacteria 4369
483 Ga0451847_0600248 3300041503 Bacteria 1144
484 Ga0451850_13365 3300041506 Bacteria 544
485 Ga0451851_0365326 3300041507 Bacteria 518
486 Ga0451843_0027106 3300041509 Bacteria 1428
487 Ga0451843_0336235 3300041509 Bacteria 652
488 Ga0451853_0199191 3300041512 Bacteria 837
489 Ga0451853_0628529 3300041512 Bacteria 1862
490 Ga0439431_0269340 3300041997 Bacteria 508
491 Ga0439449_0017515 3300042007 Bacteria 2691
492 Ga0439462_0016669 3300042015 Bacteria 1900
493 Ga0450920_065072 3300042122 Bacteria 739
494 Ga0439434_0218895 3300042435 Bacteria 646
495 Ga0439435_0103648 3300042436 Bacteria 877
496 Ga0466965_0099069 3300044683 Bacteria 1489
497 Ga0466958_0231814 3300045836 Bacteria 1179
498 Ga0495617_086930 3300046452 Bacteria 1022
499 Ga0495592_0093162 3300046454 Bacteria 2158
500 Ga0495629_0062325 3300046459 Bacteria 2605
501 Ga0495638_0000397 3300046460 Bacteria 53684
502 Ga0495638_0111977 3300046460 Bacteria 1620
503 Ga0495638_0333994 3300046460 Bacteria 805
504 Ga0495651_0373218 3300046462 Bacteria 937
505 Ga0495650_0067763 3300046471 Bacteria 1409
506 Ga0495582_0217814 3300046473 Bacteria 1092
507 Ga0495605_0000412 3300046474 Bacteria 39061
508 Ga0495605_0104059 3300046474 Bacteria 1301
509 Ga0495605_0345296 3300046474 Bacteria 625
510 Ga0495662_0191803 3300046476 Bacteria 1007
511 Ga0495664_0086510 3300046477 Bacteria 1883
512 Ga0495585_0003057 3300046492 Bacteria 11511
513 Ga0495585_0013116 3300046492 Bacteria 4859
514 Ga0495585_0032443 3300046492 Bacteria 2959
515 Ga0495585_0035698 3300046492 Bacteria 2808
516 Ga0495596_0172013 3300046500 Bacteria 842
517 Ga0495607_0022128 3300046501 Bacteria 3996
518 Ga0495607_0097617 3300046501 Bacteria 1579
519 Ga0495607_0205452 3300046501 Bacteria 972
520 Ga0495583_0005093 3300046506 Bacteria 9061
521 Ga0495583_0095810 3300046506 Bacteria 1272
522 Ga0495583_0097278 3300046506 Bacteria 1260
523 Ga0495583_0136398 3300046506 Bacteria 1024
524 Ga0495606_0013838 3300046507 Bacteria 6336
525 Ga0495606_0071714 3300046507 Bacteria 2179
526 Ga0495606_0119006 3300046507 Bacteria 1583
527 Ga0495608_0818567 3300046511 Bacteria 549
528 Ga0495610_0002097 3300046512 Bacteria 17024
529 Ga0495610_0009996 3300046512 Bacteria 5930
530 Ga0495610_0038247 3300046512 Bacteria 2437
531 Ga0495616_0011491 3300046513 Bacteria 5069
532 Ga0495616_0053272 3300046513 Bacteria 2011
533 Ga0495616_0108638 3300046513 Bacteria 1291
534 Ga0495618_0355812 3300046514 Bacteria 902
535 Ga0495620_0005619 3300046515 Bacteria 6979
536 Ga0495620_0006922 3300046515 Bacteria 6197
537 Ga0495620_0067683 3300046515 Bacteria 1469
538 Ga0495620_0115832 3300046515 Bacteria 1059
539 Ga0495628_0448498 3300046516 Bacteria 937
540 Ga0495631_0003390 3300046518 Bacteria 8726
541 Ga0495631_0016450 3300046518 Bacteria 3525
542 Ga0495632_0025192 3300046519 Bacteria 3149
543 Ga0495632_0029566 3300046519 Bacteria 2851
544 Ga0495632_0075092 3300046519 Bacteria 1618
545 Ga0495643_0004851 3300046522 Bacteria 9265
546 Ga0495643_0042014 3300046522 Bacteria 2491
547 Ga0495643_0067836 3300046522 Bacteria 1878
548 Ga0495643_0084432 3300046522 Bacteria 1648
549 Ga0495643_0256186 3300046522 Bacteria 814
550 Ga0495644_0108959 3300046523 Bacteria 1050
551 Ga0495644_0239706 3300046523 Bacteria 703
552 Ga0495648_0264200 3300046524 Bacteria 824
553 Ga0495652_0397826 3300046529 Bacteria 976
554 Ga0495654_0000571 3300046530 Bacteria 29572
555 Ga0495654_0049687 3300046530 Bacteria 2053
556 Ga0495654_0079587 3300046530 Bacteria 1539
557 Ga0495640_0535023 3300046533 Bacteria 711
558 Ga0495609_0014093 3300046538 Bacteria 3763
559 Ga0495609_0018014 3300046538 Bacteria 3276
560 Ga0495597_0018985 3300046542 Bacteria 3221
561 Ga0495597_0054860 3300046542 Bacteria 1749
562 Ga0495633_0005629 3300046558 Bacteria 7595
563 Ga0495633_0028120 3300046558 Bacteria 2743
564 Ga0495633_0151673 3300046558 Bacteria 1070
565 Ga0495633_0213847 3300046558 Bacteria 883
566 Ga0495656_0033907 3300046615 Bacteria 2087
567 Ga0495656_0098169 3300046615 Bacteria 1350
568 Ga0495656_0541136 3300046615 Bacteria 620
569 Ga0495668_0001138 3300046616 Bacteria 27251
570 Ga0495668_0073181 3300046616 Bacteria 1882
571 Ga0495634_0402062 3300046642 Bacteria 813
572 Ga0495611_0002515 3300046648 Bacteria 8342
573 Ga0495611_0043860 3300046648 Bacteria 2000
574 Ga0495611_0048336 3300046648 Bacteria 1912
575 Ga0495625_0006104 3300046660 Bacteria 10799
576 Ga0495625_0008114 3300046660 Bacteria 8999
577 Ga0495625_0016108 3300046660 Bacteria 5891
578 Ga0495625_0051370 3300046660 Bacteria 2956
579 Ga0495625_0068126 3300046660 Bacteria 2502
580 Ga0495625_0238072 3300046660 Bacteria 1186
581 Ga0495625_0263482 3300046660 Bacteria 1115
582 Ga0495625_0313150 3300046660 Bacteria 1001
583 Ga0495625_0523251 3300046660 Bacteria 722
584 Ga0495635_0042978 3300046663 Bacteria 3120
585 Ga0495635_0368494 3300046663 Bacteria 957
586 Ga0495661_0019832 3300046665 Bacteria 4399
587 Ga0495661_0262287 3300046665 Bacteria 877
588 Ga0495661_0416352 3300046665 Bacteria 651
589 Ga0495588_0022947 3300046674 Bacteria 3085
590 Ga0495588_0059332 3300046674 Bacteria 1979
591 Ga0495588_0482430 3300046674 Bacteria 650
592 Ga0495588_0584123 3300046674 Bacteria 585
593 Ga0495657_0034567 3300046675 Bacteria 3510
594 Ga0495623_0630017 3300046679 Bacteria 555
595 Ga0495646_0273637 3300046680 Bacteria 899
596 Ga0495613_0609691 3300046689 Bacteria 726
597 Ga0495624_0136347 3300046690 Bacteria 1504
598 Ga0495670_0010861 3300046691 Bacteria 4475
599 Ga0495670_0124853 3300046691 Bacteria 1339
600 Ga0495670_0125560 3300046691 Bacteria 1335
601 Ga0495670_0405791 3300046691 Bacteria 736
602 Ga0495671_0025086 3300046692 Bacteria 3101
603 Ga0495649_0098861 3300046694 Bacteria 1552
604 Ga0495649_0132854 3300046694 Bacteria 1313
605 Ga0495649_0230892 3300046694 Bacteria 955
606 Ga0495660_0004419 3300046810 Bacteria 8512
607 Ga0495660_0005703 3300046810 Bacteria 7437
608 Ga0495660_0251591 3300046810 Bacteria 819
609 Ga0495604_0021996 3300047317 Bacteria 5089
610 Ga0495636_0006550 3300047318 Bacteria 4577
611 Ga0495636_0028797 3300047318 Bacteria 2266
612 Ga0495672_0015740 3300047320 Bacteria 5124
613 Ga0495676_0237368 3300047321 Bacteria 1250
614 Ga0495683_0108793 3300047323 Bacteria 1325
615 Ga0495683_0225246 3300047323 Bacteria 834
616 Ga0495687_006801 3300047443 Bacteria 6908
617 Ga0495687_023996 3300047443 Bacteria 2906
618 Ga0495677_0100233 3300047445 Bacteria 1096
619 Ga0495685_025338 3300047447 Bacteria 2041
620 Ga0495673_0081919 3300047469 Bacteria 1335
621 Ga0495681_0070929 3300047470 Bacteria 1579
622 Ga0495681_0139101 3300047470 Bacteria 1027
623 Ga0495686_0002821 3300047472 Bacteria 15732
624 Ga0495686_0004434 3300047472 Bacteria 11560
625 Ga0495686_0040133 3300047472 Bacteria 2987
626 Ga0495686_0054299 3300047472 Bacteria 2508
627 Ga0495686_0086396 3300047472 Bacteria 1909
628 Ga0495686_0180269 3300047472 Bacteria 1224
629 Ga0495686_0340973 3300047472 Bacteria 817
630 Ga0495602_0783170 3300048088 Bacteria 642
631 Ga0495615_0009503 3300048090 Bacteria 1916
632 Ga0495626_0060247 3300048091 Bacteria 1730
633 Ga0496100_0069980 3300048903 Bacteria 2338
634 Ga0496100_0097001 3300048903 Bacteria 2024
635 Ga0496101_0366395 3300048904 Bacteria 1133
636 Ga0496101_0394879 3300048904 Bacteria 1089
637 Ga0496101_0435420 3300048904 Bacteria 1034
638 Ga0496101_1292309 3300048904 Bacteria 571
639 Ga0496101_1567764 3300048904 Bacteria 512
640 Ga0496102_0028185 3300048905 Bacteria 5016
641 Ga0496102_0513730 3300048905 Bacteria 1120
642 Ga0496102_1768593 3300048905 Bacteria 535
643 Ga0496102_1907778 3300048905 Bacteria 511
644 Ga0496103_0016736 3300048906 Bacteria 4379
645 Ga0496103_0287820 3300048906 Bacteria 1057
646 Ga0496103_0413570 3300048906 Bacteria 866
647 Ga0496104_0295268 3300048907 Bacteria 1533
648 Ga0496104_0653497 3300048907 Bacteria 960
649 Ga0496105_0301060 3300048908 Bacteria 1289
650 Ga0496105_0737164 3300048908 Bacteria 753
651 Ga0496105_0742704 3300048908 Bacteria 750
652 Ga0496106_0004370 3300048909 Bacteria 10499
653 Ga0496106_0042281 3300048909 Bacteria 3418
654 Ga0496107_0305735 3300048910 Bacteria 1183
655 Ga0496107_0615105 3300048910 Bacteria 802
656 Ga0496108_0761168 3300048911 Bacteria 837
657 Ga0496110_0058499 3300048913 Bacteria 3395
658 Ga0496110_0560398 3300048913 Bacteria 1038
659 Ga0496111_0002485 3300048914 Bacteria 11116
660 Ga0496111_0827782 3300048914 Bacteria 669
661 Ga0496112_1134886 3300048915 Bacteria 699
662 Ga0496113_0020388 3300048916 Bacteria 4660
663 Ga0496113_0199621 3300048916 Bacteria 1590
664 Ga0496113_0433621 3300048916 Bacteria 1056
665 Ga0496115_0114776 3300048918 Bacteria 2214
666 Ga0496116_0000026 3300048919 Bacteria 450803
667 Ga0496116_0013119 3300048919 Bacteria 6712
668 Ga0496116_0017640 3300048919 Bacteria 5531
669 Ga0496116_0034430 3300048919 Bacteria 3574
670 Ga0496116_0036542 3300048919 Bacteria 3434
671 Ga0496116_0044495 3300048919 Bacteria 3015
672 Ga0496116_0057524 3300048919 Bacteria 2541
673 Ga0496116_0079699 3300048919 Bacteria 2036
674 Ga0496116_0085615 3300048919 Bacteria 1936
675 Ga0496116_0103843 3300048919 Bacteria 1690
676 Ga0496116_0165073 3300048919 Bacteria 1209
677 Ga0496116_0206472 3300048919 Bacteria 1022
678 Ga0496116_0236952 3300048919 Bacteria 920
679 Ga0496116_0446722 3300048919 Bacteria 555
680 Ga0496117_0000016 3300048920 Bacteria 523642
681 Ga0496117_0005218 3300048920 Bacteria 13806
682 Ga0496117_0005763 3300048920 Bacteria 12868
683 Ga0496117_0006320 3300048920 Bacteria 12053
684 Ga0496117_0053132 3300048920 Bacteria 2849
685 Ga0496117_0209451 3300048920 Bacteria 1094
686 Ga0496117_0265255 3300048920 Bacteria 928
687 Ga0496117_0501062 3300048920 Bacteria 589
688 Ga0496118_0002108 3300048921 Bacteria 27877
689 Ga0496118_0011236 3300048921 Bacteria 8766
690 Ga0496118_0020168 3300048921 Bacteria 5922
691 Ga0496118_0025122 3300048921 Bacteria 5119
692 Ga0496118_0054915 3300048921 Bacteria 3012
693 Ga0496118_0096772 3300048921 Bacteria 2011
694 Ga0496118_0104722 3300048921 Bacteria 1898
695 Ga0496118_0350483 3300048921 Bacteria 787
696 Ga0496119_0012077 3300048922 Bacteria 7057
697 Ga0496119_0045071 3300048922 Bacteria 2769
698 Ga0496119_0070145 3300048922 Bacteria 2057
699 Ga0496119_0117422 3300048922 Bacteria 1467
700 Ga0496119_0148290 3300048922 Bacteria 1260
701 Ga0496119_0149016 3300048922 Bacteria 1256
702 Ga0496119_0208472 3300048922 Bacteria 1007
703 Ga0496119_0307496 3300048922 Bacteria 779
704 Ga0496120_0000164 3300048923 Bacteria 111959
705 Ga0496120_0041365 3300048923 Bacteria 2700
706 Ga0496121_0000143 3300048924 Bacteria 159577
707 Ga0496121_0001766 3300048924 Bacteria 35149
708 Ga0496121_0006848 3300048924 Bacteria 13936
709 Ga0496121_0019517 3300048924 Bacteria 6771
710 Ga0496121_0021675 3300048924 Bacteria 6281
711 Ga0496121_0035593 3300048924 Bacteria 4457
712 Ga0496121_0113291 3300048924 Bacteria 2064
713 Ga0496121_0133627 3300048924 Bacteria 1852
714 Ga0496121_0145054 3300048924 Bacteria 1755
715 Ga0496121_0166705 3300048924 Bacteria 1604
716 Ga0496121_0193491 3300048924 Bacteria 1456
717 Ga0496121_0217543 3300048924 Bacteria 1348
718 Ga0496121_0436267 3300048924 Bacteria 848
719 Ga0496121_0470263 3300048924 Bacteria 805
720 Ga0496121_0870716 3300048924 Bacteria 521
721 Ga0496122_0000002 3300048925 Bacteria 905834
722 Ga0496122_0001424 3300048925 Bacteria 38740
723 Ga0496122_0014992 3300048925 Bacteria 7447
724 Ga0496122_0023147 3300048925 Bacteria 5489
725 Ga0496122_0042005 3300048925 Bacteria 3604
726 Ga0496122_0052406 3300048925 Bacteria 3089
727 Ga0496122_0056862 3300048925 Bacteria 2911
728 Ga0496122_0069274 3300048925 Bacteria 2527
729 Ga0496122_0082971 3300048925 Bacteria 2224
730 Ga0496122_0116946 3300048925 Bacteria 1732
731 Ga0496122_0147062 3300048925 Bacteria 1462
732 Ga0496122_0205249 3300048925 Bacteria 1147
733 Ga0496122_0217556 3300048925 Bacteria 1099
734 Ga0496122_0256914 3300048925 Bacteria 972
735 Ga0496122_0297872 3300048925 Bacteria 871
736 Ga0496122_0412798 3300048925 Bacteria 681
737 Ga0496123_0000002 3300048926 Bacteria 1811682
738 Ga0496123_0001147 3300048926 Bacteria 39513
739 Ga0496123_0011026 3300048926 Bacteria 7895
740 Ga0496123_0016364 3300048926 Bacteria 6029
741 Ga0496123_0022600 3300048926 Bacteria 4840
742 Ga0496123_0038007 3300048926 Bacteria 3390
743 Ga0496123_0040751 3300048926 Bacteria 3229
744 Ga0496123_0048297 3300048926 Bacteria 2864
745 Ga0496123_0057293 3300048926 Bacteria 2537
746 Ga0496123_0188924 3300048926 Bacteria 1067
747 Ga0496123_0398427 3300048926 Bacteria 627
748 Ga0496124_0003004 3300048927 Bacteria 21101
749 Ga0496124_0004440 3300048927 Bacteria 16357
750 Ga0496124_0008164 3300048927 Bacteria 10985
751 Ga0496124_0014197 3300048927 Bacteria 7717
752 Ga0496124_0014344 3300048927 Bacteria 7665
753 Ga0496124_0014740 3300048927 Bacteria 7544
754 Ga0496124_0019883 3300048927 Bacteria 6229
755 Ga0496124_0029107 3300048927 Bacteria 4928
756 Ga0496124_0029120 3300048927 Bacteria 4926
757 Ga0496124_0043528 3300048927 Bacteria 3860
758 Ga0496124_0083763 3300048927 Bacteria 2616
759 Ga0496124_0133870 3300048927 Bacteria 1965
760 Ga0496124_0252188 3300048927 Bacteria 1304
761 Ga0496124_0358508 3300048927 Bacteria 1028
762 Ga0496124_0367373 3300048927 Bacteria 1011
763 Ga0496124_0413403 3300048927 Bacteria 932
764 Ga0496124_0429558 3300048927 Bacteria 907
765 Ga0496124_0646303 3300048927 Bacteria 680
766 Ga0496124_0659487 3300048927 Bacteria 670
767 Ga0496125_0000564 3300048928 Bacteria 63635
768 Ga0496125_0000585 3300048928 Bacteria 62191
769 Ga0496125_0000589 3300048928 Bacteria 61966
770 Ga0496125_0003773 3300048928 Bacteria 18023
771 Ga0496125_0004692 3300048928 Bacteria 15572
772 Ga0496125_0010306 3300048928 Bacteria 9464
773 Ga0496125_0061172 3300048928 Bacteria 3021
774 Ga0496125_0116340 3300048928 Bacteria 1920
775 Ga0496125_0244891 3300048928 Bacteria 1135
776 Ga0496126_0000059 3300048929 Bacteria 267449
777 Ga0496126_0005852 3300048929 Bacteria 13881
778 Ga0496126_0010139 3300048929 Bacteria 9922
779 Ga0496126_0058717 3300048929 Bacteria 3466
780 Ga0496126_0106668 3300048929 Bacteria 2445
781 Ga0496126_0227357 3300048929 Bacteria 1564
782 Ga0496126_0252384 3300048929 Bacteria 1469
783 Ga0496126_0575510 3300048929 Bacteria 890
784 Ga0495678_019884 3300049459 Bacteria 2985
785 Ga0495678_036467 3300049459 Bacteria 2006
786 Ga0495678_143066 3300049459 Bacteria 780
787 Ga0495682_0038183 3300049460 Bacteria 1765
788 Ga0501300_034757 3300049523 Bacteria 749
789 Ga0501031_0001086 3300049568 Bacteria 16539
790 Ga0501032_0000029 3300049569 Bacteria 130865
791 Ga0501032_0082903 3300049569 Bacteria 2133
792 Ga0501033_0000168 3300049570 Bacteria 62921
793 Ga0501033_0444545 3300049570 Bacteria 901
794 Ga0501033_0718987 3300049570 Bacteria 679
795 Ga0501034_0000434 3300049571 Bacteria 69367
796 Ga0501034_0044452 3300049571 Bacteria 4493
797 Ga0501034_0181026 3300049571 Bacteria 2072
798 Ga0501034_0209342 3300049571 Bacteria 1906
799 Ga0501034_0758326 3300049571 Bacteria 865
800 Ga0501034_1033431 3300049571 Bacteria 705
801 Ga0501036_0000533 3300049572 Bacteria 27318
802 Ga0501036_0142594 3300049572 Bacteria 2021
803 Ga0501036_0355801 3300049572 Bacteria 1223
804 Ga0501036_0909139 3300049572 Bacteria 722
805 Ga0501037_0000335 3300049573 Bacteria 39826
806 Ga0501037_0069872 3300049573 Bacteria 2556
807 Ga0501037_0432443 3300049573 Bacteria 900
808 Ga0501038_0000275 3300049574 Bacteria 43504
809 Ga0501038_0065544 3300049574 Bacteria 3094
810 Ga0501038_0539042 3300049574 Bacteria 889
811 Ga0501039_0000040 3300049575 Bacteria 115567
812 Ga0501039_0071693 3300049575 Bacteria 2692
813 Ga0501040_1396604 3300049576 Bacteria 508
814 Ga0501042_0194519 3300049578 Bacteria 1463
815 Ga0501043_0000236 3300049579 Bacteria 49931
816 Ga0501043_0029323 3300049579 Bacteria 4322
817 Ga0501043_0106716 3300049579 Bacteria 2200
818 Ga0501043_0188675 3300049579 Bacteria 1604
819 Ga0501046_0047897 3300049580 Bacteria 3387
820 Ga0501046_0173853 3300049580 Bacteria 1615
821 Ga0501047_0066767 3300049581 Bacteria 3468
822 Ga0501047_0150678 3300049581 Bacteria 2202
823 Ga0501047_0246950 3300049581 Bacteria 1634
824 Ga0501047_0629636 3300049581 Bacteria 893
825 Ga0501047_0986521 3300049581 Bacteria 656
826 Ga0501048_0103125 3300049582 Bacteria 2013
827 Ga0501067_0013788 3300049583 Bacteria 4475
828 Ga0501067_0208276 3300049583 Bacteria 1089
829 Ga0501070_0980866 3300049586 Bacteria 656
830 Ga0501072_0004658 3300049588 Bacteria 10444
831 Ga0501073_0032035 3300049589 Bacteria 3750
832 Ga0501073_0215933 3300049589 Bacteria 1325
833 Ga0501073_0389870 3300049589 Bacteria 962
834 Ga0501073_0400986 3300049589 Bacteria 948
835 Ga0501074_0065811 3300049590 Bacteria 2608
836 Ga0501080_0141903 3300049742 Bacteria 2220
837 Ga0501080_0151854 3300049742 Bacteria 2140
838 Ga0501083_0044847 3300049744 Bacteria 2993
839 Ga0501083_0072315 3300049744 Bacteria 2292
840 Ga0501083_0164631 3300049744 Bacteria 1450
841 Ga0501280_009131 3300049776 Bacteria 1379
842 Ga0501280_009598 3300049776 Bacteria 1346
843 Ga0501035_0000557 3300049822 Bacteria 41380
844 Ga0501035_0026110 3300049822 Bacteria 5349
845 Ga0501035_0073092 3300049822 Bacteria 3034
846 Ga0501044_0040916 3300049823 Bacteria 4827
847 Ga0501044_0139732 3300049823 Bacteria 2411
848 Ga0501044_0454639 3300049823 Bacteria 1187
849 Ga0501045_0057684 3300049824 Bacteria 2842
850 nmdc:mga03683_16426_c1 3300050489 Bacteria 2781
851 nmdc:mga03683_166356_c1 3300050489 Bacteria 1001
852 nmdc:mga03683_2140_c2 3300050489 Bacteria 4021
853 nmdc:mga03n38_31455_c1 3300050490 Bacteria 2240
854 nmdc:mga03n38_346214_c1 3300050490 Bacteria 808
855 nmdc:mga03n38_382044_c1 3300050490 Bacteria 772
856 nmdc:mga03n38_38515_c1 3300050490 Bacteria 2068
857 nmdc:mga00v17_225_c1 3300050491 Bacteria 33638
858 nmdc:mga00v17_360491_c1 3300050491 Bacteria 945
859 nmdc:mga00v17_537955_c1 3300050491 Bacteria 756
860 nmdc:mga00v17_5512_c1 3300050491 Bacteria 6667
861 nmdc:mga00v17_9956_c1 3300050491 Bacteria 5171
862 nmdc:mga0yw44_186400_c1 3300050492 Bacteria 1367
863 nmdc:mga0yw44_260_c1 3300050492 Bacteria 18045
864 nmdc:mga0yw44_5353_c1 3300050492 Bacteria 6044
865 nmdc:mga0yw44_733120_c1 3300050492 Bacteria 671
866 nmdc:mga0k408_211289_c1 3300050493 Bacteria 1159
867 nmdc:mga0k408_4199_c1 3300050493 Bacteria 7643
868 nmdc:mga0k408_62132_c1 3300050493 Bacteria 2172
869 nmdc:mga06z11_106882_c1 3300050494 Bacteria 1544
870 nmdc:mga06z11_323289_c1 3300050494 Bacteria 921
871 nmdc:mga06z11_877475_c1 3300050494 Bacteria 547
872 nmdc:mga04h51_13396_c1 3300050495 Bacteria 2321
873 nmdc:mga04h51_29053_c1 3300050495 Bacteria 1729
874 nmdc:mga04h51_54979_c1 3300050495 Bacteria 1347
875 nmdc:mga07m45_183696_c1 3300050496 Bacteria 1216
876 nmdc:mga07m45_28339_c1 3300050496 Bacteria 3091
877 nmdc:mga07m45_77135_c1 3300050496 Bacteria 1900
878 nmdc:mga0sz30_101760_c1 3300050516 Bacteria 1255
879 nmdc:mga0sz30_138578_c1 3300050516 Bacteria 1074
880 nmdc:mga0sz30_152941_c1 3300050516 Bacteria 1021
881 nmdc:mga0sz30_230260_c1 3300050516 Bacteria 824
882 nmdc:mga0sz30_42100_c1 3300050516 Bacteria 1921
883 nmdc:mga0sz30_847_c1 3300050516 Bacteria 11032
884 Ga0495601_0092215 3300053077 Bacteria 1951
885 Ga0495601_0260168 3300053077 Bacteria 1133
886 Ga0500610_0002446 3300053079 Bacteria 6847
887 Ga0495619_0011837 3300053085 Bacteria 5496
888 Ga0500578_0227425 3300053086 Bacteria 1131
889 Ga0500578_0397602 3300053086 Bacteria 795
890 Ga0500578_0460176 3300053086 Bacteria 722
891 Ga0500651_0182415 3300053093 Bacteria 1246
892 Ga0500650_0142669 3300053098 Bacteria 1110
893 Ga0500557_003736 3300053105 Bacteria 3079
894 Ga0500560_000198 3300053107 Bacteria 7105
895 Ga0500560_063464 3300053107 Bacteria 1208
896 Ga0500562_059887 3300053108 Bacteria 1023
897 Ga0500569_002914 3300053109 Bacteria 3430
898 Ga0500594_0001479 3300053118 Bacteria 5107
899 Ga0500594_0036262 3300053118 Bacteria 1326
900 Ga0500595_061261 3300053119 Bacteria 1136
901 Ga0500595_098780 3300053119 Bacteria 838
902 Ga0500608_216916 3300053122 Bacteria 776
903 Ga0500618_001112 3300053125 Bacteria 13174
904 Ga0500618_009083 3300053125 Bacteria 2733
905 Ga0500618_010286 3300053125 Bacteria 2515
906 Ga0500618_019462 3300053125 Bacteria 1671
907 Ga0500618_023440 3300053125 Bacteria 1494
908 Ga0500618_062752 3300053125 Bacteria 835
909 Ga0500642_0237264 3300053130 Bacteria 841
910 Ga0500658_0000213 3300053134 Bacteria 27553
911 Ga0500658_0041272 3300053134 Bacteria 1850
912 Ga0500559_0011446 3300053136 Bacteria 3788
913 Ga0500561_0000227 3300053137 Bacteria 10167
914 Ga0500568_0000096 3300053139 Bacteria 82567
915 Ga0500568_0000405 3300053139 Bacteria 32864
916 Ga0500568_0046150 3300053139 Bacteria 1731
917 Ga0500573_0201308 3300053140 Bacteria 1057
918 Ga0500577_0133128 3300053142 Bacteria 1043
919 Ga0500604_0019820 3300053151 Bacteria 1887
920 Ga0500604_0128931 3300053151 Bacteria 850
921 Ga0500616_0044973 3300053153 Bacteria 2354
922 Ga0500616_0058508 3300053153 Bacteria 2004
923 Ga0500616_0441939 3300053153 Bacteria 513
924 Ga0500622_0005360 3300053156 Bacteria 7721
925 Ga0500624_015397 3300053157 Bacteria 1169
926 Ga0500624_033013 3300053157 Bacteria 899
927 Ga0500627_0090005 3300053158 Bacteria 1373
928 Ga0500627_0464406 3300053158 Bacteria 531
929 Ga0500633_0002284 3300053160 Bacteria 3907
930 Ga0500633_0242236 3300053160 Bacteria 671
931 Ga0500634_0000002 3300053161 Bacteria 252372
932 Ga0500634_0018607 3300053161 Bacteria 3733
933 Ga0500634_0041700 3300053161 Bacteria 2492
934 Ga0500636_0000011 3300053177 Bacteria 140769
935 Ga0501084_0016758 3300054114 Bacteria 6087
936 Ga0501084_0047009 3300054114 Bacteria 3614
937 Ga0501084_0431606 3300054114 Bacteria 1114
938 Ga0501084_0729228 3300054114 Bacteria 835
939 Ga0501082_0032764 3300060353 Bacteria 4482

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0016758 Ga0501084_0016758_4350_4727 125
2 3300046477 Ga0495664_0086510 Ga0495664_0086510_885_1268 127
3 iso_pu_bacteria 2854681122 2854684504 128
4 3300013105 Ga0157369_11600983 Ga0157369_116009832 129
5 3300041411 Ga0439466_0223540 Ga0439466_0223540_30_419 129
6 3300041492 Ga0451835_0708937 Ga0451835_0708937_171_560 129
7 3300041997 Ga0439431_0269340 Ga0439431_0269340_54_443 129
8 3300042435 Ga0439434_0218895 Ga0439434_0218895_81_470 129
9 3300042436 Ga0439435_0103648 Ga0439435_0103648_340_729 129
10 3300049589 Ga0501073_0400986 Ga0501073_0400986_189_581 130
11 iso_pu_bacteria 2818991461 2819687195 130
12 3300046660 Ga0495625_0016108 Ga0495625_0016108_4112_4507 131
13 iso_pu_bacteria 2508501122 2509112468 131
14 iso_pu_bacteria 2509276019 2509379098 131
15 iso_pu_bacteria 2512875026 2512970186 131
16 iso_pu_bacteria 2513237089 2513602124 131
17 iso_pu_bacteria 2513237156 2513987146 131
18 iso_pu_bacteria 2513237160 2514003712 131
19 iso_pu_bacteria 2517487022 2517570777 131
20 iso_pu_bacteria 2558860100 2558860200 131
21 iso_pu_bacteria 2738541317 2738947387 131
22 iso_pu_bacteria 2802428858 2802718132 131
23 iso_pu_bacteria 2802428859 2802725016 131
24 iso_pu_bacteria 2802428860 2802730860 131
25 iso_pu_bacteria 2802428861 2802738208 131
26 iso_pu_bacteria 2802428862 2802743924 131
27 iso_pu_bacteria 2802428863 2802750802 131
28 iso_pu_bacteria 2913308742 2913312292 131
29 iso_pu_bacteria 2915980308 2915980324 131
30 iso_pu_bacteria 2916061851 2916066817 131
31 iso_pu_bacteria 2921250672 2921252141 131
32 iso_pu_bacteria 2937029754 2937032455 131
33 iso_pu_bacteria 2937036028 2937039830 131
34 iso_pu_bacteria 2937078374 2937078390 131
35 iso_pu_bacteria 2937084907 2937090900 131
36 iso_pu_bacteria 2957375807 2957378350 131
37 iso_pu_bacteria 2957437181 2957440262 131
38 iso_pu_bacteria 2960591022 2960591038 131
39 iso_pu_bacteria 2960631154 2960636341 131
40 iso_pu_bacteria 2960680706 2960685381 131
41 iso_pu_bacteria 2960693952 2960699627 131
42 iso_pu_bacteria 2967686174 2967691721 131
43 iso_pu_bacteria 2967728569 2967729505 131
44 iso_pu_bacteria 2970026789 2970033475 131
45 iso_pu_bacteria 2970122695 2970128798 131
46 iso_pu_bacteria 2970143518 2970148198 131
47 iso_pu_bacteria 2977530762 2977534115 131
48 iso_pu_bacteria 2977544691 2977549275 131
49 iso_pu_bacteria 8003999396 8004002317 131
50 3300003316 rootH1_10152258 rootH1_101522582 132
51 3300003320 rootH2_10031031 rootH2_100310319 132
52 3300003320 rootH2_10083047 rootH2_100830472 132
53 3300003322 rootL2_10087378 rootL2_100873781 132
54 3300003323 rootH1_10049284 rootH1_100492843 132
55 3300006042 Ga0075368_10309975 Ga0075368_103099752 132
56 3300006353 Ga0075370_10150675 Ga0075370_101506753 132
57 3300009093 Ga0105240_12217276 Ga0105240_122172762 132
58 3300009148 Ga0105243_10268497 Ga0105243_102684973 132
59 3300009545 Ga0105237_10190489 Ga0105237_101904893 132
60 3300010375 Ga0105239_11908473 Ga0105239_119084731 132
61 3300025914 Ga0207671_10422014 Ga0207671_104220143 132
62 3300025935 Ga0207709_10145751 Ga0207709_101457512 132
63 3300026078 Ga0207702_11469956 Ga0207702_114699562 132
64 3300031731 Ga0307405_10876135 Ga0307405_108761351 132
65 3300031731 Ga0307405_10979039 Ga0307405_109790392 132
66 3300031911 Ga0307412_10062068 Ga0307412_100620682 132
67 3300031911 Ga0307412_10850240 Ga0307412_108502402 132
68 3300032004 Ga0307414_10031302 Ga0307414_100313023 132
69 3300041451 Ga0451791_0471423 Ga0451791_0471423_707_1105 132
70 3300041486 Ga0451807_0447172 Ga0451807_0447172_401_799 132
71 3300044683 Ga0466965_0099069 Ga0466965_0099069_851_1249 132
72 3300045836 Ga0466958_0231814 Ga0466958_0231814_89_490 132
73 3300048090 Ga0495615_0009503 Ga0495615_0009503_1469_1867 132
74 3300048927 Ga0496124_0646303 Ga0496124_0646303_212_610 132
75 3300049570 Ga0501033_0718987 Ga0501033_0718987_186_584 132
76 3300049571 Ga0501034_0209342 Ga0501034_0209342_779_1177 132
77 3300049571 Ga0501034_0758326 Ga0501034_0758326_63_461 132
78 3300049579 Ga0501043_0106716 Ga0501043_0106716_62_460 132
79 3300049581 Ga0501047_0150678 Ga0501047_0150678_203_601 132
80 3300049581 Ga0501047_0986521 Ga0501047_0986521_20_418 132
81 3300049586 Ga0501070_0980866 Ga0501070_0980866_167_565 132
82 3300049589 Ga0501073_0215933 Ga0501073_0215933_612_1010 132
83 3300049744 Ga0501083_0164631 Ga0501083_0164631_547_945 132
84 3300049822 Ga0501035_0026110 Ga0501035_0026110_1065_1463 132
85 3300049823 Ga0501044_0139732 Ga0501044_0139732_1263_1661 132
86 3300050496 nmdc:mga07m45_77135_c1 nmdc:mga07m45_77135_c1_538_936 132
87 3300053108 Ga0500562_059887 Ga0500562_059887_282_680 132
88 3300053136 Ga0500559_0011446 Ga0500559_0011446_1630_2028 132
89 3300053139 Ga0500568_0046150 Ga0500568_0046150_376_774 132
90 3300053153 Ga0500616_0441939 Ga0500616_0441939_41_439 132
91 3300053158 Ga0500627_0464406 Ga0500627_0464406_45_443 132
92 3300054114 Ga0501084_0729228 Ga0501084_0729228_412_810 132
93 iso_pu_bacteria 2599185236 2599720145 132
94 iso_pu_bacteria 2643221591 2643965562 132
95 iso_pu_bacteria 2821123053 2821128543 132
96 iso_pu_bacteria 2838736955 2838741560 132
97 iso_pu_bacteria 2841840854 2841845605 132
98 iso_pu_bacteria 2842140634 2842145309 132
99 iso_pu_bacteria 2857531043 2857534304 132
100 3300005327 Ga0070658_10017272 Ga0070658_100172724 133
101 3300005329 Ga0070683_100044090 Ga0070683_1000440903 133
102 3300005331 Ga0070670_101012134 Ga0070670_1010121341 133
103 3300005337 Ga0070682_100489930 Ga0070682_1004899303 133
104 3300005338 Ga0068868_100045047 Ga0068868_1000450475 133
105 3300005339 Ga0070660_100385585 Ga0070660_1003855853 133
106 3300005344 Ga0070661_100001446 Ga0070661_10000144610 133
107 3300005366 Ga0070659_100007639 Ga0070659_1000076396 133
108 3300005366 Ga0070659_100589014 Ga0070659_1005890142 133
109 3300005367 Ga0070667_100927078 Ga0070667_1009270781 133
110 3300005455 Ga0070663_100172605 Ga0070663_1001726053 133
111 3300005455 Ga0070663_100456881 Ga0070663_1004568812 133
112 3300005456 Ga0070678_100525214 Ga0070678_1005252143 133
113 3300005459 Ga0068867_100147252 Ga0068867_1001472522 133
114 3300005535 Ga0070684_100073206 Ga0070684_1000732063 133
115 3300005539 Ga0068853_100031644 Ga0068853_1000316445 133
116 3300005539 Ga0068853_100133323 Ga0068853_1001333233 133
117 3300005547 Ga0070693_100124673 Ga0070693_1001246733 133
118 3300005548 Ga0070665_101001956 Ga0070665_1010019562 133
119 3300005548 Ga0070665_101249323 Ga0070665_1012493232 133
120 3300005563 Ga0068855_100099528 Ga0068855_1000995282 133
121 3300005563 Ga0068855_100946216 Ga0068855_1009462163 133
122 3300005563 Ga0068855_101367829 Ga0068855_1013678292 133
123 3300005577 Ga0068857_100019717 Ga0068857_1000197176 133
124 3300005577 Ga0068857_100085044 Ga0068857_1000850445 133
125 3300005578 Ga0068854_100002452 Ga0068854_1000024527 133
126 3300005578 Ga0068854_100105200 Ga0068854_1001052003 133
127 3300005616 Ga0068852_100002904 Ga0068852_1000029047 133
128 3300005616 Ga0068852_100270712 Ga0068852_1002707123 133
129 3300005616 Ga0068852_100563181 Ga0068852_1005631813 133
130 3300005834 Ga0068851_10028883 Ga0068851_100288835 133
131 3300006042 Ga0075368_10040883 Ga0075368_100408832 133
132 3300006048 Ga0075363_100060344 Ga0075363_1000603443 133
133 3300006051 Ga0075364_10172507 Ga0075364_101725072 133
134 3300006177 Ga0075362_10214920 Ga0075362_102149202 133
135 3300006178 Ga0075367_10044316 Ga0075367_100443163 133
136 3300006195 Ga0075366_10058667 Ga0075366_100586673 133
137 3300006353 Ga0075370_10028427 Ga0075370_100284274 133
138 3300006358 Ga0068871_100624372 Ga0068871_1006243722 133
139 3300009093 Ga0105240_10116139 Ga0105240_101161393 133
140 3300009174 Ga0105241_10218315 Ga0105241_102183153 133
141 3300009551 Ga0105238_10018169 Ga0105238_100181694 133
142 3300010375 Ga0105239_10210486 Ga0105239_102104861 133
143 3300010375 Ga0105239_12364335 Ga0105239_123643351 133
144 3300013102 Ga0157371_10226699 Ga0157371_102266992 133
145 3300013104 Ga0157370_10237336 Ga0157370_102373363 133
146 3300013296 Ga0157374_10503729 Ga0157374_105037293 133
147 3300013297 Ga0157378_10191660 Ga0157378_101916601 133
148 3300013307 Ga0157372_10012923 Ga0157372_100129232 133
149 3300013307 Ga0157372_10455409 Ga0157372_104554093 133
150 3300013308 Ga0157375_10303902 Ga0157375_103039024 133
151 3300014325 Ga0163163_11341135 Ga0163163_113411351 133
152 3300014497 Ga0182008_10122763 Ga0182008_101227632 133
153 3300014969 Ga0157376_11872238 Ga0157376_118722382 133
154 3300025321 Ga0207656_10010673 Ga0207656_100106736 133
155 3300025899 Ga0207642_10819594 Ga0207642_108195941 133
156 3300025909 Ga0207705_10021220 Ga0207705_100212204 133
157 3300025911 Ga0207654_10302413 Ga0207654_103024132 133
158 3300025914 Ga0207671_10103478 Ga0207671_101034784 133
159 3300025919 Ga0207657_10003807 Ga0207657_1000380717 133
160 3300025919 Ga0207657_10225922 Ga0207657_102259222 133
161 3300025920 Ga0207649_10003241 Ga0207649_100032417 133
162 3300025925 Ga0207650_10883583 Ga0207650_108835833 133
163 3300025927 Ga0207687_10900942 Ga0207687_109009422 133
164 3300025945 Ga0207679_10370569 Ga0207679_103705693 133
165 3300025949 Ga0207667_10920614 Ga0207667_109206142 133
166 3300025960 Ga0207651_10177865 Ga0207651_101778652 133
167 3300025972 Ga0207668_11555671 Ga0207668_115556712 133
168 3300025981 Ga0207640_10335462 Ga0207640_103354622 133
169 3300025986 Ga0207658_10840713 Ga0207658_108407132 133
170 3300026023 Ga0207677_10960035 Ga0207677_109600352 133
171 3300026041 Ga0207639_10001619 Ga0207639_100016196 133
172 3300026041 Ga0207639_10088854 Ga0207639_100888544 133
173 3300026067 Ga0207678_10974322 Ga0207678_109743222 133
174 3300026078 Ga0207702_10188122 Ga0207702_101881223 133
175 3300026078 Ga0207702_10516068 Ga0207702_105160681 133
176 3300026089 Ga0207648_10191456 Ga0207648_101914563 133
177 3300026116 Ga0207674_10012034 Ga0207674_100120346 133
178 3300026116 Ga0207674_10079019 Ga0207674_100790192 133
179 3300026121 Ga0207683_10127259 Ga0207683_101272593 133
180 3300026142 Ga0207698_10013047 Ga0207698_100130473 133
181 3300026142 Ga0207698_10037678 Ga0207698_100376786 133
182 3300026142 Ga0207698_10612754 Ga0207698_106127542 133
183 3300027866 Ga0209813_10094142 Ga0209813_100941421 133
184 3300031344 Ga0265316_10038608 Ga0265316_100386085 133
185 3300031901 Ga0307406_10052070 Ga0307406_100520702 133
186 3300034817 Ga0373948_0050325 Ga0373948_0050325_160_567 133
187 3300035691 Ga0373931_0096189 Ga0373931_0096189_337_744 133
188 3300041451 Ga0451791_1264307 Ga0451791_1264307_119_526 133
189 3300041459 Ga0451800_0984752 Ga0451800_0984752_300_707 133
190 3300048919 Ga0496116_0103843 Ga0496116_0103843_663_1073 133
191 3300048921 Ga0496118_0350483 Ga0496118_0350483_216_626 133
192 3300048924 Ga0496121_0436267 Ga0496121_0436267_179_589 133
193 3300048927 Ga0496124_0043528 Ga0496124_0043528_2212_2622 133
194 3300048927 Ga0496124_0413403 Ga0496124_0413403_260_670 133
195 3300048927 Ga0496124_0659487 Ga0496124_0659487_65_475 133
196 3300048928 Ga0496125_0000585 Ga0496125_0000585_54797_55207 133
197 3300048929 Ga0496126_0106668 Ga0496126_0106668_1355_1762 133
198 3300049571 Ga0501034_0044452 Ga0501034_0044452_717_1118 133
199 3300049571 Ga0501034_1033431 Ga0501034_1033431_252_659 133
200 3300049572 Ga0501036_0355801 Ga0501036_0355801_487_897 133
201 3300049574 Ga0501038_0539042 Ga0501038_0539042_440_850 133
202 3300049581 Ga0501047_0629636 Ga0501047_0629636_128_538 133
203 3300049589 Ga0501073_0389870 Ga0501073_0389870_78_485 133
204 3300049823 Ga0501044_0454639 Ga0501044_0454639_276_683 133
205 3300050489 nmdc:mga03683_166356_c1 nmdc:mga03683_166356_c1_87_494 133
206 3300050492 nmdc:mga0yw44_186400_c1 nmdc:mga0yw44_186400_c1_725_1132 133
207 3300050493 nmdc:mga0k408_62132_c1 nmdc:mga0k408_62132_c1_1536_1943 133
208 3300050495 nmdc:mga04h51_29053_c1 nmdc:mga04h51_29053_c1_539_946 133
209 3300053119 Ga0500595_061261 Ga0500595_061261_10_417 133
210 3300053119 Ga0500595_098780 Ga0500595_098780_289_696 133
211 3300053125 Ga0500618_062752 Ga0500618_062752_167_571 133
212 3300053140 Ga0500573_0201308 Ga0500573_0201308_614_1021 133
213 3300053157 Ga0500624_015397 Ga0500624_015397_439_846 133
214 3300053161 Ga0500634_0000002 Ga0500634_0000002_11670_12077 133
215 iso_pu_bacteria 2510065019 2510135018 133
216 iso_pu_bacteria 2510461069 2510842584 133
217 iso_pu_bacteria 2510461076 2510896443 133
218 iso_pu_bacteria 2510917028 2511182840 133
219 iso_pu_bacteria 2510917030 2511199704 133
220 iso_pu_bacteria 2513237084 2513571388 133
221 iso_pu_bacteria 2513237085 2513581355 133
222 iso_pu_bacteria 2513237088 2513599730 133
223 iso_pu_bacteria 2513237093 2513630445 133
224 iso_pu_bacteria 2513237103 2513713968 133
225 iso_pu_bacteria 2513237138 2513869422 133
226 iso_pu_bacteria 2513237144 2513912952 133
227 iso_pu_bacteria 2513237146 2513929895 133
228 iso_pu_bacteria 2513237162 2514024227 133
229 iso_pu_bacteria 2515075009 2515114104 133
230 iso_pu_bacteria 2515154113 2515636367 133
231 iso_pu_bacteria 2515154114 2515646290 133
232 iso_pu_bacteria 2515154116 2515660527 133
233 iso_pu_bacteria 2515154134 2515741336 133
234 iso_pu_bacteria 2516143018 2516204989 133
235 iso_pu_bacteria 2516653077 2517037742 133
236 iso_pu_bacteria 2516653085 2517078055 133
237 iso_pu_bacteria 2517093000 2517096824 133
238 iso_pu_bacteria 2517287029 2517408762 133
239 iso_pu_bacteria 2519899620 2520380661 133
240 iso_pu_bacteria 2529292951 2530647554 133
241 iso_pu_bacteria 2534681796 2535518746 133
242 iso_pu_bacteria 2537561587 2537875788 133
243 iso_pu_bacteria 2554235003 2554245377 133
244 iso_pu_bacteria 2558860242 2559296794 133
245 iso_pu_bacteria 2582581298 2585223730 133
246 iso_pu_bacteria 2582581299 2585228900 133
247 iso_pu_bacteria 2582581304 2585257553 133
248 iso_pu_bacteria 2582581306 2585270342 133
249 iso_pu_bacteria 2582581308 2585280530 133
250 iso_pu_bacteria 2582581315 2585327895 133
251 iso_pu_bacteria 2582581316 2585334355 133
252 iso_pu_bacteria 2582581865 2585391486 133
253 iso_pu_bacteria 2582581866 2585394719 133
254 iso_pu_bacteria 2582581867 2585403601 133
255 iso_pu_bacteria 2585427526 2585530101 133
256 iso_pu_bacteria 2585427527 2585531468 133
257 iso_pu_bacteria 2585427528 2585543750 133
258 iso_pu_bacteria 2585427529 2585548953 133
259 iso_pu_bacteria 2585427530 2585557715 133
260 iso_pu_bacteria 2585427590 2585824205 133
261 iso_pu_bacteria 2585427593 2585842110 133
262 iso_pu_bacteria 2585427633 2585994528 133
263 iso_pu_bacteria 2599185170 2599420389 133
264 iso_pu_bacteria 2599185210 2599602715 133
265 iso_pu_bacteria 2599185352 2600197469 133
266 iso_pu_bacteria 2600255279 2601610336 133
267 iso_pu_bacteria 2600255308 2601747334 133
268 iso_pu_bacteria 2615840624 2616297915 133
269 iso_pu_bacteria 2615840626 2616306924 133
270 iso_pu_bacteria 2615840698 2616557786 133
271 iso_pu_bacteria 2617270742 2617386286 133
272 iso_pu_bacteria 2643221557 2643806792 133
273 iso_pu_bacteria 2643221568 2643854143 133
274 iso_pu_bacteria 2643221582 2643917228 133
275 iso_pu_bacteria 2643221599 2644002318 133
276 iso_pu_bacteria 2643221607 2644050825 133
277 iso_pu_bacteria 2643221610 2644064686 133
278 iso_pu_bacteria 2643221634 2644194078 133
279 iso_pu_bacteria 2643221636 2644205328 133
280 iso_pu_bacteria 2643221643 2644240741 133
281 iso_pu_bacteria 2643221653 2644300086 133
282 iso_pu_bacteria 2643221668 2644376321 133
283 iso_pu_bacteria 2643221675 2644416359 133
284 iso_pu_bacteria 2643221680 2644449399 133
285 iso_pu_bacteria 2643221686 2644483729 133
286 iso_pu_bacteria 2643221689 2644500442 133
287 iso_pu_bacteria 2643221693 2644520921 133
288 iso_pu_bacteria 2643221719 2644658312 133
289 iso_pu_bacteria 2643221723 2644676975 133
290 iso_pu_bacteria 2643221726 2644687972 133
291 iso_pu_bacteria 2667528174 2671113669 133
292 iso_pu_bacteria 2690316117 2692314863 133
293 iso_pu_bacteria 2718217882 2719182762 133
294 iso_pu_bacteria 2718217927 2719387448 133
295 iso_pu_bacteria 2718218009 2719733479 133
296 iso_pu_bacteria 2718218363 2721148874 133
297 iso_pu_bacteria 2718218365 2721160258 133
298 iso_pu_bacteria 2718218366 2721165687 133
299 iso_pu_bacteria 2718218423 2721401082 133
300 iso_pu_bacteria 2721755514 2722841857 133
301 iso_pu_bacteria 2721755809 2724039896 133
302 iso_pu_bacteria 2721755810 2724046235 133
303 iso_pu_bacteria 2724679232 2725947266 133
304 iso_pu_bacteria 2728369365 2730165997 133
305 iso_pu_bacteria 2728369397 2730299890 133
306 iso_pu_bacteria 2738541333 2739038964 133
307 iso_pu_bacteria 2765235942 2766062448 133
308 iso_pu_bacteria 2775507049 2776915277 133
309 iso_pu_bacteria 2775507266 2778176193 133
310 iso_pu_bacteria 2791355082 2792582766 133
311 iso_pu_bacteria 2791355091 2792624711 133
312 iso_pu_bacteria 2791355092 2792630763 133
313 iso_pu_bacteria 2791355094 2792643610 133
314 iso_pu_bacteria 2791355253 2793282660 133
315 iso_pu_bacteria 2791355256 2793299536 133
316 iso_pu_bacteria 2791355260 2793325147 133
317 iso_pu_bacteria 2791355261 2793330907 133
318 iso_pu_bacteria 2791355262 2793337746 133
319 iso_pu_bacteria 2791355263 2793338589 133
320 iso_pu_bacteria 2791355264 2793346399 133
321 iso_pu_bacteria 2791355265 2793357286 133
322 iso_pu_bacteria 2791355266 2793363963 133
323 iso_pu_bacteria 2791355267 2793370895 133
324 iso_pu_bacteria 2802429605 2805931576 133
325 iso_pu_bacteria 2802429606 2805937599 133
326 iso_pu_bacteria 2802429633 2806049318 133
327 iso_pu_bacteria 2802429634 2806056276 133
328 iso_pu_bacteria 2802429635 2806063450 133
329 iso_pu_bacteria 2802429636 2806070987 133
330 iso_pu_bacteria 2802429637 2806077868 133
331 iso_pu_bacteria 2808606387 2808987249 133
332 iso_pu_bacteria 2818991272 2819243580 133
333 iso_pu_bacteria 2818991439 2819557418 133
334 iso_pu_bacteria 2818991448 2819611052 133
335 iso_pu_bacteria 2818991453 2819639017 133
336 iso_pu_bacteria 2837678835 2837678873 133
337 iso_pu_bacteria 2838022645 2838028667 133
338 iso_pu_bacteria 2838029111 2838030739 133
339 iso_pu_bacteria 2838035591 2838042271 133
340 iso_pu_bacteria 2838074704 2838077158 133
341 iso_pu_bacteria 2838661181 2838668336 133
342 iso_pu_bacteria 2838668709 2838674776 133
343 iso_pu_bacteria 2838675328 2838678077 133
344 iso_pu_bacteria 2838680041 2838686444 133
345 iso_pu_bacteria 2838686498 2838693999 133
346 iso_pu_bacteria 2838694306 2838698630 133
347 iso_pu_bacteria 2838701080 2838707079 133
348 iso_pu_bacteria 2838707686 2838714165 133
349 iso_pu_bacteria 2838714209 2838717016 133
350 iso_pu_bacteria 2838719591 2838722373 133
351 iso_pu_bacteria 2838724970 2838727766 133
352 iso_pu_bacteria 2838729681 2838731795 133
353 iso_pu_bacteria 2838742623 2838749389 133
354 iso_pu_bacteria 2841846520 2841849422 133
355 iso_pu_bacteria 2841851746 2841858778 133
356 iso_pu_bacteria 2841859092 2841861535 133
357 iso_pu_bacteria 2842077413 2842081547 133
358 iso_pu_bacteria 2842110456 2842116194 133
359 iso_pu_bacteria 2842118031 2842124906 133
360 iso_pu_bacteria 2842124991 2842127829 133
361 iso_pu_bacteria 2842130223 2842132970 133
362 iso_pu_bacteria 2842146304 2842149824 133
363 iso_pu_bacteria 2842152218 2842154964 133
364 iso_pu_bacteria 2842156927 2842163464 133
365 iso_pu_bacteria 2842163707 2842166436 133
366 iso_pu_bacteria 2842170452 2842173463 133
367 iso_pu_bacteria 2842175837 2842178584 133
368 iso_pu_bacteria 2842180545 2842187032 133
369 iso_pu_bacteria 2842187318 2842190124 133
370 iso_pu_bacteria 2842192696 2842198660 133
371 iso_pu_bacteria 2842198810 2842204684 133
372 iso_pu_bacteria 2842205361 2842207197 133
373 iso_pu_bacteria 2842211629 2842214438 133
374 iso_pu_bacteria 2842217011 2842224129 133
375 iso_pu_bacteria 2842224351 2842227157 133
376 iso_pu_bacteria 2842229732 2842235899 133
377 iso_pu_bacteria 2842237096 2842243567 133
378 iso_pu_bacteria 2842243621 2842250404 133
379 iso_pu_bacteria 2842250916 2842256917 133
380 iso_pu_bacteria 2842257432 2842264298 133
381 iso_pu_bacteria 2842271015 2842278481 133
382 iso_pu_bacteria 2842278818 2842281092 133
383 iso_pu_bacteria 2842285085 2842288293 133
384 iso_pu_bacteria 2842291075 2842295203 133
385 iso_pu_bacteria 2842298080 2842303714 133
386 iso_pu_bacteria 2842304105 2842306112 133
387 iso_pu_bacteria 2842317721 2842320897 133
388 iso_pu_bacteria 2842357229 2842362222 133
389 iso_pu_bacteria 2842370503 2842374779 133
390 iso_pu_bacteria 2842377471 2842381603 133
391 iso_pu_bacteria 2842384541 2842388672 133
392 iso_pu_bacteria 2842402390 2842408598 133
393 iso_pu_bacteria 2842409023 2842415251 133
394 iso_pu_bacteria 2842415677 2842421870 133
395 iso_pu_bacteria 2842475841 2842477471 133
396 iso_pu_bacteria 2842482326 2842488039 133
397 iso_pu_bacteria 2842489311 2842490948 133
398 iso_pu_bacteria 2842495871 2842498287 133
399 iso_pu_bacteria 2842502639 2842504656 133
400 iso_pu_bacteria 2842509118 2842511911 133
401 iso_pu_bacteria 2842515876 2842518199 133
402 iso_pu_bacteria 2844454524 2844457282 133
403 iso_pu_bacteria 2847417321 2847420079 133
404 iso_pu_bacteria 2848992105 2848994990 133
405 iso_pu_bacteria 2850079185 2850082094 133
406 iso_pu_bacteria 2852387548 2852391485 133
407 iso_pu_bacteria 2855872281 2855874705 133
408 iso_pu_bacteria 2857516855 2857521236 133
409 iso_pu_bacteria 2896384573 2896387864 133
410 iso_pu_bacteria 2899792073 2899792657 133
411 iso_pu_bacteria 2899845264 2899850102 133
412 iso_pu_bacteria 2913295892 2913299617 133
413 iso_pu_bacteria 2919100787 2919105187 133
414 iso_pu_bacteria 2919114240 2919117274 133
415 iso_pu_bacteria 2919166419 2919168530 133
416 iso_pu_bacteria 2919408235 2919410871 133
417 iso_pu_bacteria 2920760137 2920760997 133
418 iso_pu_bacteria 2920822456 2920828747 133
419 iso_pu_bacteria 2926754445 2926758721 133
420 iso_pu_bacteria 2926760298 2926763749 133
421 iso_pu_bacteria 2929138655 2929141570 133
422 iso_pu_bacteria 2933006813 2933009654 133
423 iso_pu_bacteria 2933011516 2933013827 133
424 iso_pu_bacteria 2933016740 2933019599 133
425 iso_pu_bacteria 2933570622 2933572615 133
426 iso_pu_bacteria 2933586486 2933592412 133
427 iso_pu_bacteria 2933594066 2933595641 133
428 iso_pu_bacteria 2935894831 2935901284 133
429 iso_pu_bacteria 2935901341 2935903892 133
430 iso_pu_bacteria 2936375103 2936379351 133
431 iso_pu_bacteria 2936381700 2936385936 133
432 iso_pu_bacteria 2941499720 2941501944 133
433 iso_pu_bacteria 2978969890 2978971215 133
434 iso_pu_bacteria 2979089926 2979091210 133
435 iso_pu_bacteria 2979095461 2979096734 133
436 iso_pu_bacteria 2979100975 2979102457 133
437 iso_pu_bacteria 2984509177 2984509657 133
438 iso_pu_bacteria 2984537506 2984537995 133
439 iso_pu_bacteria 2984587000 2984588362 133
440 iso_pu_bacteria 2984601300 2984604739 133
441 iso_pu_bacteria 2989776772 2989779841 133
442 iso_pu_bacteria 2996887358 2996891034 133
443 iso_pu_bacteria 3005409236 3005409442 133
444 iso_pu_bacteria 3005416602 3005421827 133
445 iso_pu_bacteria 3005445848 3005449463 133
446 iso_pu_bacteria 3005452660 3005455789 133
447 iso_pu_bacteria 639633055 639650178 133
448 iso_pu_bacteria 643692032 643826862 133
449 iso_pu_bacteria 650716007 650843215 133
450 iso_pu_bacteria 8003570095 8003572793 133
451 iso_pu_bacteria 8005246636 8005249016 133
452 iso_pu_bacteria 8005258706 8005262784 133
453 iso_pu_bacteria 8005275841 8005282198 133
454 iso_pu_bacteria 8005289223 8005292199 133
455 iso_pu_bacteria 8005301065 8005302421 133
456 iso_pu_bacteria 8005307578 8005313442 133
457 iso_pu_bacteria 8005314921 8005319473 133
458 iso_pu_bacteria 8005321885 8005325561 133
459 iso_pu_bacteria 8005376324 8005381801 133
460 iso_pu_bacteria 8005382845 8005387983 133
461 iso_pu_bacteria 8005460587 8005464794 133
462 iso_pu_bacteria 8005542996 8005546452 133
463 iso_pu_bacteria 8005556819 8005560863 133
464 iso_pu_bacteria 8005563573 8005565063 133
465 iso_pu_bacteria 8005570704 8005576761 133
466 iso_pu_bacteria 8005645114 8005646758 133
467 iso_pu_bacteria 8005682033 8005687657 133
468 iso_pu_bacteria 8005688590 8005691320 133
469 iso_pu_bacteria 8018127388 8018130744 133
470 iso_pu_bacteria 8018163183 8018169537 133
471 iso_pu_bacteria 8018176218 8018178314 133
472 iso_pu_bacteria 8023680758 8023686280 133
473 iso_pu_bacteria 8024479707 8024482457 133
474 iso_pu_bacteria 8024486573 8024490641 133
475 iso_pu_bacteria 8024501048 8024504784 133
476 iso_pu_bacteria 8049293176 8049295719 133
477 iso_pu_bacteria 8056375014 8056379569 133
478 iso_pu_bacteria 8056382006 8056384021 133
479 iso_pu_bacteria 8057575449 8057580658 133
480 iso_pu_bacteria 8057874678 8057879975 133
481 3300025933 Ga0207706_10382385 Ga0207706_103823852 134
482 3300025972 Ga0207668_10998019 Ga0207668_109980192 134
483 iso_pu_bacteria 2582581283 2585167776 134
484 iso_pu_bacteria 2643221618 2644108733 134
485 iso_pu_bacteria 2643221626 2644149768 134
486 iso_pu_bacteria 2643221655 2644311129 134
487 iso_pu_bacteria 2643221659 2644335036 134
488 iso_pu_bacteria 2643221698 2644544522 134
489 iso_pu_bacteria 2643221712 2644616959 134
490 iso_pu_bacteria 2844163670 2844168884 134
491 iso_pu_bacteria 8054558443 8054563000 134
492 3300005331 Ga0070670_100000117 Ga0070670_1000001179 135
493 3300006051 Ga0075364_10006976 Ga0075364_1000697611 135
494 3300006946 Ga0079104_1013490 Ga0079104_10134902 135
495 3300006948 Ga0099826_10109008 Ga0099826_101090082 135
496 3300021321 Ga0214542_1034961 Ga0214542_10349611 135
497 3300021327 Ga0214543_1000008 Ga0214543_100000813 135
498 3300022739 Ga0228711_1000022 Ga0228711_100002217 135
499 3300022740 Ga0228710_1000028 Ga0228710_100002817 135
500 3300025925 Ga0207650_10001181 Ga0207650_1000118113 135
501 3300027111 Ga0209281_1000247 Ga0209281_100024717 135
502 3300027666 Ga0209282_1000037 Ga0209282_1000037118 135
503 3300031967 Ga0315914_1000002 Ga0315914_100000217 135
504 3300033430 Ga0315913_1000018 Ga0315913_100001883 135
505 3300033464 Ga0315915_1000005 Ga0315915_100000517 135
506 3300041507 Ga0451851_0365326 Ga0451851_0365326_44_451 135
507 3300048913 Ga0496110_0058499 Ga0496110_0058499_930_1337 135
508 3300048914 Ga0496111_0002485 Ga0496111_0002485_1415_1822 135
509 3300048925 Ga0496122_0056862 Ga0496122_0056862_1999_2406 135
510 3300048926 Ga0496123_0011026 Ga0496123_0011026_150_557 135
511 3300048927 Ga0496124_0029120 Ga0496124_0029120_1032_1439 135
512 3300053122 Ga0500608_216916 Ga0500608_216916_69_479 135
513 3300053125 Ga0500618_019462 Ga0500618_019462_1178_1588 135
514 iso_pu_bacteria 2842694124 2842696401 135
515 3300006946 Ga0079104_1000101 Ga0079104_100010114 136
516 3300027111 Ga0209281_1000028 Ga0209281_1000028208 136
517 3300046660 Ga0495625_0523251 Ga0495625_0523251_147_557 136
518 3300047472 Ga0495686_0086396 Ga0495686_0086396_239_649 136
519 3300048927 Ga0496124_0019883 Ga0496124_0019883_1154_1564 136
520 3300049568 Ga0501031_0001086 Ga0501031_0001086_948_1358 136
521 3300049569 Ga0501032_0000029 Ga0501032_0000029_108396_108806 136
522 3300049570 Ga0501033_0000168 Ga0501033_0000168_46980_47390 136
523 3300049571 Ga0501034_0000434 Ga0501034_0000434_46981_47391 136
524 3300049572 Ga0501036_0000533 Ga0501036_0000533_7676_8086 136
525 3300049573 Ga0501037_0000335 Ga0501037_0000335_21965_22375 136
526 3300049574 Ga0501038_0000275 Ga0501038_0000275_21122_21532 136
527 3300049575 Ga0501039_0000040 Ga0501039_0000040_92444_92854 136
528 3300049576 Ga0501040_1396604 Ga0501040_1396604_45_455 136
529 3300049578 Ga0501042_0194519 Ga0501042_0194519_537_947 136
530 3300049579 Ga0501043_0000236 Ga0501043_0000236_27512_27922 136
531 3300049580 Ga0501046_0047897 Ga0501046_0047897_2432_2842 136
532 3300049581 Ga0501047_0246950 Ga0501047_0246950_435_845 136
533 3300049822 Ga0501035_0000557 Ga0501035_0000557_18809_19219 136
534 3300049823 Ga0501044_0040916 Ga0501044_0040916_417_827 136
535 3300049824 Ga0501045_0057684 Ga0501045_0057684_741_1151 136
536 3300050491 nmdc:mga00v17_360491_c1 nmdc:mga00v17_360491_c1_53_463 136
537 3300053125 Ga0500618_001112 Ga0500618_001112_6918_7328 136
538 3300053130 Ga0500642_0237264 Ga0500642_0237264_207_623 136
539 3300053139 Ga0500568_0000096 Ga0500568_0000096_66373_66789 136
540 iso_pu_bacteria 2891373044 2891373805 136
541 iso_pu_bacteria 2989349275 2989354792 136
542 3300001979 JGI24740J21852_10000006 JGI24740J21852_1000000619 137
543 3300001989 JGI24739J22299_10267310 JGI24739J22299_102673101 137
544 3300002704 JGI25155J39150_1000010 JGI25155J39150_1000010190 137
545 3300002705 JGI25156J39149_1000186 JGI25156J39149_100018619 137
546 3300002737 JGI25162J39368_1001145 JGI25162J39368_100114515 137
547 3300002737 JGI25162J39368_1001856 JGI25162J39368_100185613 137
548 3300002738 JGI25154J39366_1000187 JGI25154J39366_100018727 137
549 3300002739 JGI25158J39367_1000078 JGI25158J39367_100007820 137
550 3300002739 JGI25158J39367_1001106 JGI25158J39367_10011062 137
551 3300002741 JGI25157J39369_1000009 JGI25157J39369_1000009189 137
552 3300002773 JGI25152J39213_1001233 JGI25152J39213_100123311 137
553 3300002773 JGI25152J39213_1005065 JGI25152J39213_10050651 137
554 3300002773 JGI25152J39213_1007357 JGI25152J39213_10073573 137
555 3300002773 JGI25152J39213_1014180 JGI25152J39213_10141804 137
556 3300002774 JGI25150J39212_1000061 JGI25150J39212_100006120 137
557 3300002774 JGI25150J39212_1001592 JGI25150J39212_10015924 137
558 3300002987 JGI25159J45721_1000705 JGI25159J45721_10007052 137
559 3300002987 JGI25159J45721_1006597 JGI25159J45721_10065974 137
560 3300003187 JGI25151J46595_10000081 JGI25151J46595_1000008167 137
561 3300003187 JGI25151J46595_10001107 JGI25151J46595_1000110710 137
562 3300003187 JGI25151J46595_10010445 JGI25151J46595_100104452 137
563 3300003187 JGI25151J46595_10015280 JGI25151J46595_100152805 137
564 3300003187 JGI25151J46595_10043100 JGI25151J46595_100431004 137
565 3300003187 JGI25151J46595_10131101 JGI25151J46595_101311011 137
566 3300003214 JGI25165J46597_1000931 JGI25165J46597_10009314 137
567 3300003214 JGI25165J46597_1001497 JGI25165J46597_10014974 137
568 3300003215 JGI25153J46596_10012416 JGI25153J46596_100124164 137
569 3300003215 JGI25153J46596_10012547 JGI25153J46596_100125474 137
570 3300003215 JGI25153J46596_10018618 JGI25153J46596_100186183 137
571 3300003322 rootL2_10071739 rootL2_100717399 137
572 3300003322 rootL2_10230007 rootL2_102300071 137
573 3300003354 JGI25160J50197_1000085 JGI25160J50197_100008525 137
574 3300003354 JGI25160J50197_1000247 JGI25160J50197_100024723 137
575 3300003354 JGI25160J50197_1000573 JGI25160J50197_100057312 137
576 3300003354 JGI25160J50197_1015877 JGI25160J50197_10158774 137
577 3300003374 JGI25161J50226_1000065 JGI25161J50226_100006525 137
578 3300003374 JGI25161J50226_1000136 JGI25161J50226_100013646 137
579 3300003374 JGI25161J50226_1000620 JGI25161J50226_100062012 137
580 3300003374 JGI25161J50226_1001517 JGI25161J50226_10015175 137
581 3300003771 Ga0055526_1001073 Ga0055526_100107315 137
582 3300003771 Ga0055526_1001171 Ga0055526_10011719 137
583 3300003771 Ga0055526_1011715 Ga0055526_10117154 137
584 3300003771 Ga0055526_1011819 Ga0055526_10118194 137
585 3300003771 Ga0055526_1017122 Ga0055526_10171225 137
586 3300003771 Ga0055526_1017528 Ga0055526_10175282 137
587 3300003775 Ga0055524_1001593 Ga0055524_10015934 137
588 3300003775 Ga0055524_1001808 Ga0055524_10018089 137
589 3300003775 Ga0055524_1003160 Ga0055524_10031604 137
590 3300003775 Ga0055524_1004890 Ga0055524_10048909 137
591 3300003775 Ga0055524_1013856 Ga0055524_10138564 137
592 3300003775 Ga0055524_1018215 Ga0055524_10182153 137
593 3300003775 Ga0055524_1040205 Ga0055524_10402053 137
594 3300003775 Ga0055524_1056699 Ga0055524_10566992 137
595 3300003781 Ga0055536_1001369 Ga0055536_10013693 137
596 3300003790 Ga0055528_1000998 Ga0055528_10009984 137
597 3300003790 Ga0055528_1001541 Ga0055528_10015414 137
598 3300003790 Ga0055528_1004794 Ga0055528_10047949 137
599 3300003790 Ga0055528_1008492 Ga0055528_10084925 137
600 3300003790 Ga0055528_1009155 Ga0055528_10091555 137
601 3300003790 Ga0055528_1014264 Ga0055528_10142644 137
602 3300003790 Ga0055528_1022360 Ga0055528_10223603 137
603 3300003790 Ga0055528_1036936 Ga0055528_10369362 137
604 3300003791 Ga0055530_10008430 Ga0055530_100084307 137
605 3300003792 Ga0055540_1004170 Ga0055540_10041703 137
606 3300003792 Ga0055540_1008152 Ga0055540_10081524 137
607 3300003792 Ga0055540_1009578 Ga0055540_10095784 137
608 3300003792 Ga0055540_1025029 Ga0055540_10250292 137
609 3300003792 Ga0055540_1027739 Ga0055540_10277392 137
610 3300003794 Ga0055531_10007968 Ga0055531_100079687 137
611 3300003794 Ga0055531_10055202 Ga0055531_100552021 137
612 3300003856 Ga0058692_1000999 Ga0058692_100099914 137
613 3300003856 Ga0058692_1001038 Ga0058692_100103811 137
614 3300003856 Ga0058692_1004538 Ga0058692_10045385 137
615 3300004625 Ga0055543_1000067 Ga0055543_100006724 137
616 3300004625 Ga0055543_1000228 Ga0055543_100022819 137
617 3300004625 Ga0055543_1000461 Ga0055543_100046112 137
618 3300004625 Ga0055543_1000496 Ga0055543_10004968 137
619 3300005262 Ga0065165_1000237 Ga0065165_100023779 137
620 3300005262 Ga0065165_1000804 Ga0065165_100080423 137
621 3300005262 Ga0065165_1013013 Ga0065165_10130134 137
622 3300005262 Ga0065165_1017307 Ga0065165_10173072 137
623 3300005262 Ga0065165_1060064 Ga0065165_10600642 137
624 3300005262 Ga0065165_1066922 Ga0065165_10669222 137
625 3300005289 Ga0065704_10288861 Ga0065704_102888611 137
626 3300005331 Ga0070670_100117569 Ga0070670_1001175692 137
627 3300005335 Ga0070666_10475267 Ga0070666_104752672 137
628 3300005347 Ga0070668_100177326 Ga0070668_1001773262 137
629 3300005347 Ga0070668_100337499 Ga0070668_1003374992 137
630 3300005347 Ga0070668_100389022 Ga0070668_1003890223 137
631 3300005347 Ga0070668_101196096 Ga0070668_1011960962 137
632 3300005353 Ga0070669_100076983 Ga0070669_1000769833 137
633 3300005353 Ga0070669_100493471 Ga0070669_1004934712 137
634 3300005355 Ga0070671_100043577 Ga0070671_1000435772 137
635 3300005367 Ga0070667_100538785 Ga0070667_1005387851 137
636 3300005539 Ga0068853_100719345 Ga0068853_1007193451 137
637 3300005548 Ga0070665_100009302 Ga0070665_1000093025 137
638 3300005548 Ga0070665_100102624 Ga0070665_1001026242 137
639 3300005548 Ga0070665_100159944 Ga0070665_1001599445 137
640 3300005548 Ga0070665_100263451 Ga0070665_1002634511 137
641 3300005548 Ga0070665_100351786 Ga0070665_1003517861 137
642 3300005563 Ga0068855_100152322 Ga0068855_1001523221 137
643 3300005616 Ga0068852_100713165 Ga0068852_1007131651 137
644 3300005719 Ga0068861_102410655 Ga0068861_1024106551 137
645 3300005844 Ga0068862_102512770 Ga0068862_1025127701 137
646 3300006038 Ga0075365_10003552 Ga0075365_100035525 137
647 3300006038 Ga0075365_10076293 Ga0075365_100762934 137
648 3300006038 Ga0075365_10479402 Ga0075365_104794022 137
649 3300006042 Ga0075368_10033372 Ga0075368_100333723 137
650 3300006042 Ga0075368_10080740 Ga0075368_100807402 137
651 3300006042 Ga0075368_10475228 Ga0075368_104752281 137
652 3300006048 Ga0075363_100025004 Ga0075363_1000250043 137
653 3300006048 Ga0075363_100100368 Ga0075363_1001003681 137
654 3300006048 Ga0075363_100167443 Ga0075363_1001674431 137
655 3300006051 Ga0075364_10090776 Ga0075364_100907762 137
656 3300006051 Ga0075364_10259139 Ga0075364_102591392 137
657 3300006177 Ga0075362_10010373 Ga0075362_100103734 137
658 3300006177 Ga0075362_10231919 Ga0075362_102319192 137
659 3300006178 Ga0075367_10002378 Ga0075367_100023789 137
660 3300006178 Ga0075367_10020524 Ga0075367_100205241 137
661 3300006178 Ga0075367_10351943 Ga0075367_103519431 137
662 3300006178 Ga0075367_10403665 Ga0075367_104036652 137
663 3300006186 Ga0075369_10000556 Ga0075369_100005564 137
664 3300006186 Ga0075369_10001596 Ga0075369_100015965 137
665 3300006186 Ga0075369_10011871 Ga0075369_100118713 137
666 3300006186 Ga0075369_10018986 Ga0075369_100189863 137
667 3300006186 Ga0075369_10026625 Ga0075369_100266253 137
668 3300006186 Ga0075369_10166395 Ga0075369_101663952 137
669 3300006195 Ga0075366_10003442 Ga0075366_100034425 137
670 3300006195 Ga0075366_10112785 Ga0075366_101127852 137
671 3300006353 Ga0075370_10012653 Ga0075370_100126534 137
672 3300006353 Ga0075370_10025702 Ga0075370_100257021 137
673 3300006353 Ga0075370_10194611 Ga0075370_101946112 137
674 3300006844 Ga0075428_100528715 Ga0075428_1005287154 137
675 3300006948 Ga0099826_10000590 Ga0099826_1000059020 137
676 3300006948 Ga0099826_10032648 Ga0099826_100326482 137
677 3300009011 Ga0105251_10015497 Ga0105251_100154973 137
678 3300009036 Ga0105244_10103397 Ga0105244_101033972 137
679 3300009092 Ga0105250_10032609 Ga0105250_100326094 137
680 3300009093 Ga0105240_10000013 Ga0105240_1000001322 137
681 3300009148 Ga0105243_10855822 Ga0105243_108558222 137
682 3300009148 Ga0105243_11255511 Ga0105243_112555111 137
683 3300009177 Ga0105248_10090815 Ga0105248_100908153 137
684 3300009545 Ga0105237_10001167 Ga0105237_1000116725 137
685 3300009545 Ga0105237_10801268 Ga0105237_108012682 137
686 3300009551 Ga0105238_10819002 Ga0105238_108190022 137
687 3300009553 Ga0105249_10639932 Ga0105249_106399322 137
688 3300009763 Ga0123340_1042431 Ga0123340_10424314 137
689 3300009765 Ga0123341_1000187 Ga0123341_100018710 137
690 3300009765 Ga0123341_1079145 Ga0123341_10791452 137
691 3300009766 Ga0123342_1016630 Ga0123342_10166309 137
692 3300009766 Ga0123342_1024950 Ga0123342_10249501 137
693 3300010375 Ga0105239_10093668 Ga0105239_100936682 137
694 3300010375 Ga0105239_10498833 Ga0105239_104988333 137
695 3300013100 Ga0157373_10025106 Ga0157373_100251066 137
696 3300013100 Ga0157373_10037599 Ga0157373_100375996 137
697 3300013100 Ga0157373_10048623 Ga0157373_100486233 137
698 3300013102 Ga0157371_10000002 Ga0157371_10000002254 137
699 3300013102 Ga0157371_10007550 Ga0157371_100075509 137
700 3300013102 Ga0157371_10163292 Ga0157371_101632922 137
701 3300013104 Ga0157370_10000143 Ga0157370_100001436 137
702 3300013104 Ga0157370_10006960 Ga0157370_100069609 137
703 3300013104 Ga0157370_11213204 Ga0157370_112132042 137
704 3300013105 Ga0157369_10219048 Ga0157369_102190483 137
705 3300013249 Ga0171463_1006 Ga0171463_100622 137
706 3300013307 Ga0157372_11896665 Ga0157372_118966652 137
707 3300013308 Ga0157375_11230542 Ga0157375_112305422 137
708 3300014325 Ga0163163_11822364 Ga0163163_118223642 137
709 3300015262 Ga0182007_10001582 Ga0182007_100015827 137
710 3300015265 Ga0182005_1007805 Ga0182005_10078053 137
711 3300015690 Ga0183363_1095 Ga0183363_10958 137
712 3300017792 Ga0163161_10374982 Ga0163161_103749822 137
713 3300017792 Ga0163161_10921347 Ga0163161_109213472 137
714 3300021320 Ga0214544_1000132 Ga0214544_100013288 137
715 3300021321 Ga0214542_1004982 Ga0214542_100498212 137
716 3300021327 Ga0214543_1000102 Ga0214543_100010218 137
717 3300021384 Ga0213876_10110405 Ga0213876_101104052 137
718 3300025206 Ga0209435_100009 Ga0209435_100009446 137
719 3300025208 Ga0209436_100089 Ga0209436_10008918 137
720 3300025208 Ga0209436_100790 Ga0209436_10079013 137
721 3300025228 Ga0209672_101912 Ga0209672_1019123 137
722 3300025231 Ga0207427_111005 Ga0207427_1110052 137
723 3300025233 Ga0209437_100057 Ga0209437_10005720 137
724 3300025233 Ga0209437_100452 Ga0209437_10045219 137
725 3300025233 Ga0209437_103994 Ga0209437_1039943 137
726 3300025245 Ga0207425_1000034 Ga0207425_1000034157 137
727 3300025245 Ga0207425_1004151 Ga0207425_10041512 137
728 3300025245 Ga0207425_1004943 Ga0207425_10049436 137
729 3300025245 Ga0207425_1020525 Ga0207425_10205254 137
730 3300025246 Ga0209646_1000018 Ga0209646_1000018446 137
731 3300025246 Ga0209646_1026581 Ga0209646_10265811 137
732 3300025250 Ga0209026_1000068 Ga0209026_1000068188 137
733 3300025253 Ga0209677_101882 Ga0209677_1018826 137
734 3300025256 Ga0209759_1000007 Ga0209759_1000007446 137
735 3300025258 Ga0209129_1000094 Ga0209129_1000094102 137
736 3300025258 Ga0209129_1000290 Ga0209129_100029025 137
737 3300025258 Ga0209129_1000519 Ga0209129_100051927 137
738 3300025258 Ga0209129_1001202 Ga0209129_10012027 137
739 3300025258 Ga0209129_1001250 Ga0209129_100125011 137
740 3300025258 Ga0209129_1009271 Ga0209129_10092712 137
741 3300025261 Ga0209233_1000134 Ga0209233_100013420 137
742 3300025261 Ga0209233_1000343 Ga0209233_100034319 137
743 3300025261 Ga0209233_1000367 Ga0209233_100036720 137
744 3300025272 Ga0209455_1009867 Ga0209455_10098671 137
745 3300025273 Ga0209673_1000158 Ga0209673_1000158116 137
746 3300025273 Ga0209673_1000283 Ga0209673_100028385 137
747 3300025273 Ga0209673_1000771 Ga0209673_100077117 137
748 3300025273 Ga0209673_1002843 Ga0209673_100284315 137
749 3300025273 Ga0209673_1010655 Ga0209673_10106554 137
750 3300025273 Ga0209673_1016456 Ga0209673_10164564 137
751 3300025273 Ga0209673_1025562 Ga0209673_10255621 137
752 3300025273 Ga0209673_1076855 Ga0209673_10768551 137
753 3300025273 Ga0209673_1076873 Ga0209673_10768731 137
754 3300025284 Ga0209130_1000009 Ga0209130_1000009464 137
755 3300025284 Ga0209130_1000265 Ga0209130_100026524 137
756 3300025284 Ga0209130_1000465 Ga0209130_100046520 137
757 3300025284 Ga0209130_1009861 Ga0209130_10098614 137
758 3300025284 Ga0209130_1036575 Ga0209130_10365752 137
759 3300025291 Ga0209675_1025119 Ga0209675_10251192 137
760 3300025292 Ga0209676_1003840 Ga0209676_100384013 137
761 3300025292 Ga0209676_1040802 Ga0209676_10408022 137
762 3300025292 Ga0209676_1057007 Ga0209676_10570072 137
763 3300025294 Ga0209025_1000184 Ga0209025_100018468 137
764 3300025294 Ga0209025_1000245 Ga0209025_1000245100 137
765 3300025294 Ga0209025_1000725 Ga0209025_100072543 137
766 3300025294 Ga0209025_1001475 Ga0209025_100147519 137
767 3300025294 Ga0209025_1001628 Ga0209025_10016288 137
768 3300025294 Ga0209025_1002008 Ga0209025_100200816 137
769 3300025294 Ga0209025_1003091 Ga0209025_10030912 137
770 3300025294 Ga0209025_1016825 Ga0209025_10168255 137
771 3300025294 Ga0209025_1019068 Ga0209025_10190682 137
772 3300025294 Ga0209025_1019090 Ga0209025_10190903 137
773 3300025294 Ga0209025_1065561 Ga0209025_10655612 137
774 3300025295 Ga0209564_1000381 Ga0209564_100038168 137
775 3300025295 Ga0209564_1000960 Ga0209564_100096020 137
776 3300025295 Ga0209564_1001128 Ga0209564_100112817 137
777 3300025295 Ga0209564_1001662 Ga0209564_100166212 137
778 3300025295 Ga0209564_1007822 Ga0209564_100782210 137
779 3300025295 Ga0209564_1028109 Ga0209564_10281094 137
780 3300025295 Ga0209564_1053257 Ga0209564_10532571 137
781 3300025297 Ga0209758_1000159 Ga0209758_100015968 137
782 3300025297 Ga0209758_1001526 Ga0209758_10015269 137
783 3300025297 Ga0209758_1002004 Ga0209758_10020045 137
784 3300025297 Ga0209758_1004118 Ga0209758_100411813 137
785 3300025297 Ga0209758_1006869 Ga0209758_10068694 137
786 3300025297 Ga0209758_1015934 Ga0209758_10159345 137
787 3300025298 Ga0209050_1001980 Ga0209050_100198020 137
788 3300025298 Ga0209050_1016935 Ga0209050_10169354 137
789 3300025298 Ga0209050_1019171 Ga0209050_10191713 137
790 3300025299 Ga0209256_1000440 Ga0209256_100044057 137
791 3300025299 Ga0209256_1000892 Ga0209256_100089213 137
792 3300025299 Ga0209256_1001107 Ga0209256_100110716 137
793 3300025299 Ga0209256_1002685 Ga0209256_100268515 137
794 3300025299 Ga0209256_1003593 Ga0209256_100359311 137
795 3300025299 Ga0209256_1007542 Ga0209256_10075424 137
796 3300025299 Ga0209256_1010198 Ga0209256_10101987 137
797 3300025299 Ga0209256_1016042 Ga0209256_10160423 137
798 3300025299 Ga0209256_1027473 Ga0209256_10274731 137
799 3300025302 Ga0207426_1000041 Ga0207426_1000041402 137
800 3300025302 Ga0207426_1000048 Ga0207426_100004822 137
801 3300025302 Ga0207426_1000309 Ga0207426_100030980 137
802 3300025302 Ga0207426_1000646 Ga0207426_100064627 137
803 3300025302 Ga0207426_1003037 Ga0207426_100303712 137
804 3300025303 Ga0209051_1001583 Ga0209051_100158317 137
805 3300025303 Ga0209051_1001638 Ga0209051_100163817 137
806 3300025303 Ga0209051_1008054 Ga0209051_10080549 137
807 3300025303 Ga0209051_1008858 Ga0209051_10088585 137
808 3300025303 Ga0209051_1013569 Ga0209051_10135691 137
809 3300025303 Ga0209051_1022857 Ga0209051_10228573 137
810 3300025304 Ga0209257_1002473 Ga0209257_10024739 137
811 3300025304 Ga0209257_1007098 Ga0209257_100709810 137
812 3300025735 Ga0207713_1045049 Ga0207713_10450491 137
813 3300025900 Ga0207710_10412015 Ga0207710_104120151 137
814 3300025913 Ga0207695_10001286 Ga0207695_1000128621 137
815 3300025914 Ga0207671_10001380 Ga0207671_1000138024 137
816 3300025914 Ga0207671_10770117 Ga0207671_107701172 137
817 3300025923 Ga0207681_10058022 Ga0207681_100580221 137
818 3300025924 Ga0207694_10365970 Ga0207694_103659702 137
819 3300025931 Ga0207644_10033903 Ga0207644_100339035 137
820 3300025932 Ga0207690_10355277 Ga0207690_103552772 137
821 3300025935 Ga0207709_10296112 Ga0207709_102961122 137
822 3300025941 Ga0207711_10147161 Ga0207711_101471612 137
823 3300025949 Ga0207667_10390283 Ga0207667_103902832 137
824 3300025972 Ga0207668_10095809 Ga0207668_100958094 137
825 3300025972 Ga0207668_10243747 Ga0207668_102437472 137
826 3300025972 Ga0207668_10831945 Ga0207668_108319452 137
827 3300025972 Ga0207668_11092490 Ga0207668_110924902 137
828 3300025972 Ga0207668_11278734 Ga0207668_112787342 137
829 3300025986 Ga0207658_11088068 Ga0207658_110880681 137
830 3300025986 Ga0207658_11160804 Ga0207658_111608042 137
831 3300026041 Ga0207639_10673352 Ga0207639_106733521 137
832 3300026067 Ga0207678_11122235 Ga0207678_111222351 137
833 3300026078 Ga0207702_10142586 Ga0207702_101425863 137
834 3300026088 Ga0207641_10615884 Ga0207641_106158842 137
835 3300027312 Ga0209371_1000003 Ga0209371_1000003559 137
836 3300027312 Ga0209371_1001357 Ga0209371_100135719 137
837 3300027312 Ga0209371_1001699 Ga0209371_10016992 137
838 3300027312 Ga0209371_1001789 Ga0209371_10017898 137
839 3300027666 Ga0209282_1000342 Ga0209282_100034215 137
840 3300027666 Ga0209282_1017049 Ga0209282_10170498 137
841 3300027866 Ga0209813_10056995 Ga0209813_100569951 137
842 3300027866 Ga0209813_10092699 Ga0209813_100926992 137
843 3300027866 Ga0209813_10120981 Ga0209813_101209811 137
844 3300028379 Ga0268266_10007330 Ga0268266_100073305 137
845 3300028379 Ga0268266_10011023 Ga0268266_100110236 137
846 3300028379 Ga0268266_10287215 Ga0268266_102872152 137
847 3300028794 Ga0307515_10000860 Ga0307515_1000086028 137
848 3300028794 Ga0307515_10016242 Ga0307515_100162424 137
849 3300028794 Ga0307515_10068193 Ga0307515_100681934 137
850 3300028794 Ga0307515_10870572 Ga0307515_108705721 137
851 3300030500 Ga0268256_1000004 Ga0268256_1000004491 137
852 3300030500 Ga0268256_1000728 Ga0268256_100072824 137
853 3300030500 Ga0268256_1003113 Ga0268256_10031138 137
854 3300030744 Ga0316181_1122127 Ga0316181_11221272 137
855 3300031456 Ga0307513_10002143 Ga0307513_1000214319 137
856 3300031456 Ga0307513_10042417 Ga0307513_100424173 137
857 3300031456 Ga0307513_10618257 Ga0307513_106182571 137
858 3300031548 Ga0307408_100618930 Ga0307408_1006189301 137
859 3300031731 Ga0307405_10000088 Ga0307405_1000008826 137
860 3300031731 Ga0307405_11807209 Ga0307405_118072091 137
861 3300031852 Ga0307410_10364385 Ga0307410_103643852 137
862 3300031901 Ga0307406_10123869 Ga0307406_101238692 137
863 3300031911 Ga0307412_10004000 Ga0307412_100040005 137
864 3300031911 Ga0307412_10027402 Ga0307412_100274025 137
865 3300031911 Ga0307412_11335103 Ga0307412_113351032 137
866 3300031995 Ga0307409_100071381 Ga0307409_1000713813 137
867 3300032004 Ga0307414_11158943 Ga0307414_111589432 137
868 3300033180 Ga0307510_10366289 Ga0307510_103662892 137
869 3300037418 Ga0395900_0758731 Ga0395900_0758731_62_496 137
870 3300037466 Ga0395898_0186187 Ga0395898_0186187_413_847 137
871 3300037853 Ga0436364_0583757 Ga0436364_0583757_874_1314 137
872 3300039437 Ga0436365_1509750 Ga0436365_1509750_1778_2218 137
873 3300041404 Ga0439436_0037077 Ga0439436_0037077_560_973 137
874 3300041404 Ga0439436_0094264 Ga0439436_0094264_84_497 137
875 3300041406 Ga0439439_0069703 Ga0439439_0069703_93_506 137
876 3300041413 Ga0439465_0000679 Ga0439465_0000679_9705_10118 137
877 3300041413 Ga0439465_0022502 Ga0439465_0022502_123_536 137
878 3300041441 Ga0451787_114555 Ga0451787_114555_1332_1745 137
879 3300041443 Ga0451789_0796484 Ga0451789_0796484_393_806 137
880 3300041451 Ga0451791_0616845 Ga0451791_0616845_827_1240 137
881 3300041458 Ga0451798_0339288 Ga0451798_0339288_735_1148 137
882 3300041460 Ga0451802_0288055 Ga0451802_0288055_870_1283 137
883 3300041460 Ga0451802_0399050 Ga0451802_0399050_193_606 137
884 3300041486 Ga0451807_1709282 Ga0451807_1709282_111_524 137
885 3300041491 Ga0451833_1324270 Ga0451833_1324270_233_646 137
886 3300041492 Ga0451835_0853460 Ga0451835_0853460_69_482 137
887 3300041494 Ga0451837_1678452 Ga0451837_1678452_57_470 137
888 3300041498 Ga0451841_0304265 Ga0451841_0304265_77_490 137
889 3300041498 Ga0451841_1215396 Ga0451841_1215396_158_571 137
890 3300041502 Ga0451846_32342 Ga0451846_32342_22_435 137
891 3300041503 Ga0451847_0501180 Ga0451847_0501180_3786_4199 137
892 3300041503 Ga0451847_0600248 Ga0451847_0600248_561_974 137
893 3300041506 Ga0451850_13365 Ga0451850_13365_69_482 137
894 3300041509 Ga0451843_0027106 Ga0451843_0027106_171_584 137
895 3300041509 Ga0451843_0336235 Ga0451843_0336235_69_482 137
896 3300041512 Ga0451853_0199191 Ga0451853_0199191_228_641 137
897 3300041512 Ga0451853_0628529 Ga0451853_0628529_1359_1772 137
898 3300042007 Ga0439449_0017515 Ga0439449_0017515_897_1310 137
899 3300042015 Ga0439462_0016669 Ga0439462_0016669_875_1288 137
900 3300042122 Ga0450920_065072 Ga0450920_065072_71_484 137
901 3300046452 Ga0495617_086930 Ga0495617_086930_81_494 137
902 3300046454 Ga0495592_0093162 Ga0495592_0093162_786_1199 137
903 3300046459 Ga0495629_0062325 Ga0495629_0062325_1894_2307 137
904 3300046460 Ga0495638_0000397 Ga0495638_0000397_25112_25525 137
905 3300046460 Ga0495638_0111977 Ga0495638_0111977_485_898 137
906 3300046460 Ga0495638_0333994 Ga0495638_0333994_60_473 137
907 3300046462 Ga0495651_0373218 Ga0495651_0373218_53_466 137
908 3300046471 Ga0495650_0067763 Ga0495650_0067763_433_846 137
909 3300046473 Ga0495582_0217814 Ga0495582_0217814_593_1006 137
910 3300046474 Ga0495605_0000412 Ga0495605_0000412_19176_19589 137
911 3300046474 Ga0495605_0104059 Ga0495605_0104059_554_967 137
912 3300046474 Ga0495605_0345296 Ga0495605_0345296_161_574 137
913 3300046476 Ga0495662_0191803 Ga0495662_0191803_479_892 137
914 3300046492 Ga0495585_0003057 Ga0495585_0003057_1697_2110 137
915 3300046492 Ga0495585_0013116 Ga0495585_0013116_2515_2928 137
916 3300046492 Ga0495585_0032443 Ga0495585_0032443_506_919 137
917 3300046492 Ga0495585_0035698 Ga0495585_0035698_36_449 137
918 3300046500 Ga0495596_0172013 Ga0495596_0172013_396_809 137
919 3300046501 Ga0495607_0022128 Ga0495607_0022128_2758_3171 137
920 3300046501 Ga0495607_0097617 Ga0495607_0097617_655_1068 137
921 3300046501 Ga0495607_0205452 Ga0495607_0205452_64_483 137
922 3300046506 Ga0495583_0005093 Ga0495583_0005093_5459_5872 137
923 3300046506 Ga0495583_0095810 Ga0495583_0095810_354_767 137
924 3300046506 Ga0495583_0097278 Ga0495583_0097278_430_843 137
925 3300046506 Ga0495583_0136398 Ga0495583_0136398_593_1006 137
926 3300046507 Ga0495606_0013838 Ga0495606_0013838_1805_2218 137
927 3300046507 Ga0495606_0071714 Ga0495606_0071714_604_1017 137
928 3300046507 Ga0495606_0119006 Ga0495606_0119006_1094_1507 137
929 3300046511 Ga0495608_0818567 Ga0495608_0818567_73_513 137
930 3300046512 Ga0495610_0002097 Ga0495610_0002097_14129_14542 137
931 3300046512 Ga0495610_0009996 Ga0495610_0009996_312_725 137
932 3300046512 Ga0495610_0038247 Ga0495610_0038247_1943_2356 137
933 3300046513 Ga0495616_0011491 Ga0495616_0011491_3756_4169 137
934 3300046513 Ga0495616_0053272 Ga0495616_0053272_1103_1516 137
935 3300046513 Ga0495616_0108638 Ga0495616_0108638_316_729 137
936 3300046514 Ga0495618_0355812 Ga0495618_0355812_402_815 137
937 3300046515 Ga0495620_0005619 Ga0495620_0005619_2596_3009 137
938 3300046515 Ga0495620_0006922 Ga0495620_0006922_4331_4744 137
939 3300046515 Ga0495620_0067683 Ga0495620_0067683_505_918 137
940 3300046515 Ga0495620_0115832 Ga0495620_0115832_535_948 137
941 3300046516 Ga0495628_0448498 Ga0495628_0448498_495_908 137
942 3300046518 Ga0495631_0003390 Ga0495631_0003390_5137_5550 137
943 3300046518 Ga0495631_0016450 Ga0495631_0016450_845_1258 137
944 3300046519 Ga0495632_0025192 Ga0495632_0025192_2202_2615 137
945 3300046519 Ga0495632_0029566 Ga0495632_0029566_60_473 137
946 3300046519 Ga0495632_0075092 Ga0495632_0075092_145_558 137
947 3300046522 Ga0495643_0004851 Ga0495643_0004851_2189_2602 137
948 3300046522 Ga0495643_0042014 Ga0495643_0042014_989_1402 137
949 3300046522 Ga0495643_0067836 Ga0495643_0067836_981_1394 137
950 3300046522 Ga0495643_0084432 Ga0495643_0084432_972_1385 137
951 3300046522 Ga0495643_0256186 Ga0495643_0256186_332_745 137
952 3300046523 Ga0495644_0108959 Ga0495644_0108959_436_849 137
953 3300046523 Ga0495644_0239706 Ga0495644_0239706_81_494 137
954 3300046524 Ga0495648_0264200 Ga0495648_0264200_155_568 137
955 3300046529 Ga0495652_0397826 Ga0495652_0397826_550_963 137
956 3300046530 Ga0495654_0000571 Ga0495654_0000571_5760_6182 137
957 3300046530 Ga0495654_0049687 Ga0495654_0049687_145_558 137
958 3300046530 Ga0495654_0079587 Ga0495654_0079587_893_1306 137
959 3300046533 Ga0495640_0535023 Ga0495640_0535023_109_522 137
960 3300046538 Ga0495609_0014093 Ga0495609_0014093_864_1277 137
961 3300046538 Ga0495609_0018014 Ga0495609_0018014_2420_2833 137
962 3300046542 Ga0495597_0018985 Ga0495597_0018985_1901_2314 137
963 3300046542 Ga0495597_0054860 Ga0495597_0054860_342_755 137
964 3300046558 Ga0495633_0005629 Ga0495633_0005629_2738_3151 137
965 3300046558 Ga0495633_0028120 Ga0495633_0028120_350_763 137
966 3300046558 Ga0495633_0151673 Ga0495633_0151673_456_869 137
967 3300046558 Ga0495633_0213847 Ga0495633_0213847_165_578 137
968 3300046615 Ga0495656_0033907 Ga0495656_0033907_921_1334 137
969 3300046615 Ga0495656_0098169 Ga0495656_0098169_608_1021 137
970 3300046615 Ga0495656_0541136 Ga0495656_0541136_66_479 137
971 3300046616 Ga0495668_0001138 Ga0495668_0001138_25913_26326 137
972 3300046616 Ga0495668_0073181 Ga0495668_0073181_1129_1542 137
973 3300046642 Ga0495634_0402062 Ga0495634_0402062_359_772 137
974 3300046648 Ga0495611_0002515 Ga0495611_0002515_3378_3791 137
975 3300046648 Ga0495611_0043860 Ga0495611_0043860_669_1082 137
976 3300046648 Ga0495611_0048336 Ga0495611_0048336_466_879 137
977 3300046660 Ga0495625_0006104 Ga0495625_0006104_7980_8393 137
978 3300046660 Ga0495625_0008114 Ga0495625_0008114_5410_5823 137
979 3300046660 Ga0495625_0051370 Ga0495625_0051370_750_1163 137
980 3300046660 Ga0495625_0068126 Ga0495625_0068126_1503_1916 137
981 3300046660 Ga0495625_0238072 Ga0495625_0238072_132_545 137
982 3300046660 Ga0495625_0263482 Ga0495625_0263482_269_682 137
983 3300046660 Ga0495625_0313150 Ga0495625_0313150_436_849 137
984 3300046663 Ga0495635_0042978 Ga0495635_0042978_1039_1452 137
985 3300046663 Ga0495635_0368494 Ga0495635_0368494_470_910 137
986 3300046665 Ga0495661_0019832 Ga0495661_0019832_1595_2008 137
987 3300046665 Ga0495661_0262287 Ga0495661_0262287_202_615 137
988 3300046665 Ga0495661_0416352 Ga0495661_0416352_81_494 137
989 3300046674 Ga0495588_0022947 Ga0495588_0022947_2056_2469 137
990 3300046674 Ga0495588_0059332 Ga0495588_0059332_1091_1504 137
991 3300046674 Ga0495588_0482430 Ga0495588_0482430_176_589 137
992 3300046674 Ga0495588_0584123 Ga0495588_0584123_87_500 137
993 3300046675 Ga0495657_0034567 Ga0495657_0034567_2410_2823 137
994 3300046679 Ga0495623_0630017 Ga0495623_0630017_50_463 137
995 3300046680 Ga0495646_0273637 Ga0495646_0273637_94_507 137
996 3300046689 Ga0495613_0609691 Ga0495613_0609691_233_646 137
997 3300046690 Ga0495624_0136347 Ga0495624_0136347_666_1079 137
998 3300046691 Ga0495670_0010861 Ga0495670_0010861_78_491 137
999 3300046691 Ga0495670_0124853 Ga0495670_0124853_617_1030 137
1000 3300046691 Ga0495670_0125560 Ga0495670_0125560_792_1205 137
1001 3300046691 Ga0495670_0405791 Ga0495670_0405791_168_581 137
1002 3300046692 Ga0495671_0025086 Ga0495671_0025086_1121_1534 137
1003 3300046694 Ga0495649_0098861 Ga0495649_0098861_45_458 137
1004 3300046694 Ga0495649_0132854 Ga0495649_0132854_439_852 137
1005 3300046694 Ga0495649_0230892 Ga0495649_0230892_328_741 137
1006 3300046810 Ga0495660_0004419 Ga0495660_0004419_4188_4601 137
1007 3300046810 Ga0495660_0005703 Ga0495660_0005703_6444_6857 137
1008 3300046810 Ga0495660_0251591 Ga0495660_0251591_285_698 137
1009 3300047317 Ga0495604_0021996 Ga0495604_0021996_2584_2997 137
1010 3300047318 Ga0495636_0006550 Ga0495636_0006550_2967_3380 137
1011 3300047318 Ga0495636_0028797 Ga0495636_0028797_70_483 137
1012 3300047320 Ga0495672_0015740 Ga0495672_0015740_2436_2849 137
1013 3300047321 Ga0495676_0237368 Ga0495676_0237368_788_1201 137
1014 3300047323 Ga0495683_0108793 Ga0495683_0108793_166_579 137
1015 3300047323 Ga0495683_0225246 Ga0495683_0225246_175_588 137
1016 3300047443 Ga0495687_006801 Ga0495687_006801_1232_1645 137
1017 3300047443 Ga0495687_023996 Ga0495687_023996_1757_2170 137
1018 3300047445 Ga0495677_0100233 Ga0495677_0100233_366_779 137
1019 3300047447 Ga0495685_025338 Ga0495685_025338_802_1215 137
1020 3300047469 Ga0495673_0081919 Ga0495673_0081919_702_1115 137
1021 3300047470 Ga0495681_0070929 Ga0495681_0070929_718_1131 137
1022 3300047470 Ga0495681_0139101 Ga0495681_0139101_438_851 137
1023 3300047472 Ga0495686_0002821 Ga0495686_0002821_3161_3574 137
1024 3300047472 Ga0495686_0004434 Ga0495686_0004434_1133_1546 137
1025 3300047472 Ga0495686_0040133 Ga0495686_0040133_82_495 137
1026 3300047472 Ga0495686_0054299 Ga0495686_0054299_407_820 137
1027 3300047472 Ga0495686_0180269 Ga0495686_0180269_776_1189 137
1028 3300047472 Ga0495686_0340973 Ga0495686_0340973_95_508 137
1029 3300048088 Ga0495602_0783170 Ga0495602_0783170_188_604 137
1030 3300048091 Ga0495626_0060247 Ga0495626_0060247_395_808 137
1031 3300048903 Ga0496100_0069980 Ga0496100_0069980_300_713 137
1032 3300048903 Ga0496100_0097001 Ga0496100_0097001_1479_1913 137
1033 3300048904 Ga0496101_0366395 Ga0496101_0366395_615_1028 137
1034 3300048904 Ga0496101_0394879 Ga0496101_0394879_92_505 137
1035 3300048904 Ga0496101_0435420 Ga0496101_0435420_209_622 137
1036 3300048904 Ga0496101_1292309 Ga0496101_1292309_116_556 137
1037 3300048904 Ga0496101_1567764 Ga0496101_1567764_71_484 137
1038 3300048905 Ga0496102_0028185 Ga0496102_0028185_4075_4488 137
1039 3300048905 Ga0496102_0513730 Ga0496102_0513730_363_797 137
1040 3300048905 Ga0496102_1768593 Ga0496102_1768593_86_499 137
1041 3300048905 Ga0496102_1907778 Ga0496102_1907778_38_451 137
1042 3300048906 Ga0496103_0016736 Ga0496103_0016736_637_1050 137
1043 3300048906 Ga0496103_0287820 Ga0496103_0287820_513_926 137
1044 3300048906 Ga0496103_0413570 Ga0496103_0413570_411_824 137
1045 3300048907 Ga0496104_0295268 Ga0496104_0295268_1065_1499 137
1046 3300048907 Ga0496104_0653497 Ga0496104_0653497_129_542 137
1047 3300048908 Ga0496105_0301060 Ga0496105_0301060_22_456 137
1048 3300048908 Ga0496105_0737164 Ga0496105_0737164_296_709 137
1049 3300048908 Ga0496105_0742704 Ga0496105_0742704_229_642 137
1050 3300048909 Ga0496106_0004370 Ga0496106_0004370_3336_3749 137
1051 3300048909 Ga0496106_0042281 Ga0496106_0042281_2198_2611 137
1052 3300048910 Ga0496107_0305735 Ga0496107_0305735_735_1148 137
1053 3300048910 Ga0496107_0615105 Ga0496107_0615105_354_788 137
1054 3300048911 Ga0496108_0761168 Ga0496108_0761168_413_826 137
1055 3300048913 Ga0496110_0560398 Ga0496110_0560398_358_771 137
1056 3300048914 Ga0496111_0827782 Ga0496111_0827782_192_620 137
1057 3300048915 Ga0496112_1134886 Ga0496112_1134886_134_547 137
1058 3300048916 Ga0496113_0020388 Ga0496113_0020388_897_1310 137
1059 3300048916 Ga0496113_0199621 Ga0496113_0199621_784_1218 137
1060 3300048916 Ga0496113_0433621 Ga0496113_0433621_430_843 137
1061 3300048918 Ga0496115_0114776 Ga0496115_0114776_1446_1880 137
1062 3300048919 Ga0496116_0000026 Ga0496116_0000026_347004_347417 137
1063 3300048919 Ga0496116_0013119 Ga0496116_0013119_4285_4698 137
1064 3300048919 Ga0496116_0017640 Ga0496116_0017640_2565_2978 137
1065 3300048919 Ga0496116_0034430 Ga0496116_0034430_669_1082 137
1066 3300048919 Ga0496116_0036542 Ga0496116_0036542_33_446 137
1067 3300048919 Ga0496116_0044495 Ga0496116_0044495_2554_2982 137
1068 3300048919 Ga0496116_0057524 Ga0496116_0057524_654_1067 137
1069 3300048919 Ga0496116_0079699 Ga0496116_0079699_609_1022 137
1070 3300048919 Ga0496116_0085615 Ga0496116_0085615_1036_1464 137
1071 3300048919 Ga0496116_0165073 Ga0496116_0165073_467_880 137
1072 3300048919 Ga0496116_0206472 Ga0496116_0206472_15_428 137
1073 3300048919 Ga0496116_0236952 Ga0496116_0236952_26_439 137
1074 3300048919 Ga0496116_0446722 Ga0496116_0446722_93_506 137
1075 3300048920 Ga0496117_0000016 Ga0496117_0000016_114854_115267 137
1076 3300048920 Ga0496117_0005218 Ga0496117_0005218_754_1182 137
1077 3300048920 Ga0496117_0005763 Ga0496117_0005763_8319_8741 137
1078 3300048920 Ga0496117_0006320 Ga0496117_0006320_6935_7348 137
1079 3300048920 Ga0496117_0053132 Ga0496117_0053132_2252_2665 137
1080 3300048920 Ga0496117_0209451 Ga0496117_0209451_279_692 137
1081 3300048920 Ga0496117_0265255 Ga0496117_0265255_445_873 137
1082 3300048920 Ga0496117_0501062 Ga0496117_0501062_38_451 137
1083 3300048921 Ga0496118_0002108 Ga0496118_0002108_4610_5023 137
1084 3300048921 Ga0496118_0011236 Ga0496118_0011236_2593_3006 137
1085 3300048921 Ga0496118_0020168 Ga0496118_0020168_3165_3578 137
1086 3300048921 Ga0496118_0025122 Ga0496118_0025122_160_573 137
1087 3300048921 Ga0496118_0054915 Ga0496118_0054915_1802_2230 137
1088 3300048921 Ga0496118_0096772 Ga0496118_0096772_1184_1597 137
1089 3300048921 Ga0496118_0104722 Ga0496118_0104722_865_1278 137
1090 3300048922 Ga0496119_0012077 Ga0496119_0012077_4369_4782 137
1091 3300048922 Ga0496119_0045071 Ga0496119_0045071_892_1305 137
1092 3300048922 Ga0496119_0070145 Ga0496119_0070145_1380_1802 137
1093 3300048922 Ga0496119_0117422 Ga0496119_0117422_568_996 137
1094 3300048922 Ga0496119_0148290 Ga0496119_0148290_37_450 137
1095 3300048922 Ga0496119_0149016 Ga0496119_0149016_418_831 137
1096 3300048922 Ga0496119_0208472 Ga0496119_0208472_38_451 137
1097 3300048922 Ga0496119_0307496 Ga0496119_0307496_262_675 137
1098 3300048923 Ga0496120_0000164 Ga0496120_0000164_80037_80450 137
1099 3300048923 Ga0496120_0041365 Ga0496120_0041365_1238_1651 137
1100 3300048924 Ga0496121_0000143 Ga0496121_0000143_8638_9051 137
1101 3300048924 Ga0496121_0001766 Ga0496121_0001766_30187_30600 137
1102 3300048924 Ga0496121_0006848 Ga0496121_0006848_2343_2771 137
1103 3300048924 Ga0496121_0019517 Ga0496121_0019517_1585_1998 137
1104 3300048924 Ga0496121_0021675 Ga0496121_0021675_5462_5875 137
1105 3300048924 Ga0496121_0035593 Ga0496121_0035593_2509_2922 137
1106 3300048924 Ga0496121_0113291 Ga0496121_0113291_1604_2017 137
1107 3300048924 Ga0496121_0133627 Ga0496121_0133627_25_438 137
1108 3300048924 Ga0496121_0145054 Ga0496121_0145054_391_804 137
1109 3300048924 Ga0496121_0166705 Ga0496121_0166705_847_1275 137
1110 3300048924 Ga0496121_0193491 Ga0496121_0193491_421_834 137
1111 3300048924 Ga0496121_0217543 Ga0496121_0217543_353_766 137
1112 3300048924 Ga0496121_0470263 Ga0496121_0470263_153_566 137
1113 3300048924 Ga0496121_0870716 Ga0496121_0870716_35_448 137
1114 3300048925 Ga0496122_0000002 Ga0496122_0000002_115515_115928 137
1115 3300048925 Ga0496122_0001424 Ga0496122_0001424_18510_18923 137
1116 3300048925 Ga0496122_0014992 Ga0496122_0014992_4572_4985 137
1117 3300048925 Ga0496122_0023147 Ga0496122_0023147_766_1179 137
1118 3300048925 Ga0496122_0042005 Ga0496122_0042005_798_1211 137
1119 3300048925 Ga0496122_0052406 Ga0496122_0052406_532_945 137
1120 3300048925 Ga0496122_0069274 Ga0496122_0069274_684_1097 137
1121 3300048925 Ga0496122_0082971 Ga0496122_0082971_1781_2194 137
1122 3300048925 Ga0496122_0116946 Ga0496122_0116946_67_489 137
1123 3300048925 Ga0496122_0147062 Ga0496122_0147062_619_1032 137
1124 3300048925 Ga0496122_0205249 Ga0496122_0205249_507_935 137
1125 3300048925 Ga0496122_0217556 Ga0496122_0217556_129_542 137
1126 3300048925 Ga0496122_0256914 Ga0496122_0256914_546_959 137
1127 3300048925 Ga0496122_0297872 Ga0496122_0297872_62_475 137
1128 3300048925 Ga0496122_0412798 Ga0496122_0412798_140_553 137
1129 3300048926 Ga0496123_0000002 Ga0496123_0000002_115515_115928 137
1130 3300048926 Ga0496123_0000002 Ga0496123_0000002_1695755_1696168 137
1131 3300048926 Ga0496123_0001147 Ga0496123_0001147_19283_19696 137
1132 3300048926 Ga0496123_0016364 Ga0496123_0016364_3177_3590 137
1133 3300048926 Ga0496123_0022600 Ga0496123_0022600_234_662 137
1134 3300048926 Ga0496123_0038007 Ga0496123_0038007_2351_2764 137
1135 3300048926 Ga0496123_0040751 Ga0496123_0040751_1598_2011 137
1136 3300048926 Ga0496123_0048297 Ga0496123_0048297_2040_2453 137
1137 3300048926 Ga0496123_0057293 Ga0496123_0057293_1178_1591 137
1138 3300048926 Ga0496123_0188924 Ga0496123_0188924_76_504 137
1139 3300048926 Ga0496123_0398427 Ga0496123_0398427_194_607 137
1140 3300048927 Ga0496124_0003004 Ga0496124_0003004_12465_12887 137
1141 3300048927 Ga0496124_0004440 Ga0496124_0004440_7621_8034 137
1142 3300048927 Ga0496124_0008164 Ga0496124_0008164_2568_2981 137
1143 3300048927 Ga0496124_0014197 Ga0496124_0014197_4450_4878 137
1144 3300048927 Ga0496124_0014344 Ga0496124_0014344_5523_5936 137
1145 3300048927 Ga0496124_0014740 Ga0496124_0014740_1646_2059 137
1146 3300048927 Ga0496124_0029107 Ga0496124_0029107_667_1080 137
1147 3300048927 Ga0496124_0083763 Ga0496124_0083763_464_877 137
1148 3300048927 Ga0496124_0133870 Ga0496124_0133870_1283_1696 137
1149 3300048927 Ga0496124_0252188 Ga0496124_0252188_72_485 137
1150 3300048927 Ga0496124_0358508 Ga0496124_0358508_68_481 137
1151 3300048927 Ga0496124_0367373 Ga0496124_0367373_10_423 137
1152 3300048927 Ga0496124_0429558 Ga0496124_0429558_72_500 137
1153 3300048928 Ga0496125_0000564 Ga0496125_0000564_54864_55286 137
1154 3300048928 Ga0496125_0000589 Ga0496125_0000589_52954_53367 137
1155 3300048928 Ga0496125_0003773 Ga0496125_0003773_2684_3097 137
1156 3300048928 Ga0496125_0004692 Ga0496125_0004692_12629_13057 137
1157 3300048928 Ga0496125_0010306 Ga0496125_0010306_4622_5035 137
1158 3300048928 Ga0496125_0061172 Ga0496125_0061172_2026_2439 137
1159 3300048928 Ga0496125_0116340 Ga0496125_0116340_812_1225 137
1160 3300048928 Ga0496125_0244891 Ga0496125_0244891_165_578 137
1161 3300048929 Ga0496126_0000059 Ga0496126_0000059_46703_47116 137
1162 3300048929 Ga0496126_0005852 Ga0496126_0005852_4260_4682 137
1163 3300048929 Ga0496126_0010139 Ga0496126_0010139_3623_4045 137
1164 3300048929 Ga0496126_0058717 Ga0496126_0058717_530_943 137
1165 3300048929 Ga0496126_0227357 Ga0496126_0227357_530_943 137
1166 3300048929 Ga0496126_0252384 Ga0496126_0252384_443_856 137
1167 3300048929 Ga0496126_0575510 Ga0496126_0575510_419_832 137
1168 3300049459 Ga0495678_019884 Ga0495678_019884_549_962 137
1169 3300049459 Ga0495678_036467 Ga0495678_036467_525_938 137
1170 3300049459 Ga0495678_143066 Ga0495678_143066_344_757 137
1171 3300049460 Ga0495682_0038183 Ga0495682_0038183_469_882 137
1172 3300049523 Ga0501300_034757 Ga0501300_034757_251_682 137
1173 3300049569 Ga0501032_0082903 Ga0501032_0082903_679_1092 137
1174 3300049570 Ga0501033_0444545 Ga0501033_0444545_95_508 137
1175 3300049571 Ga0501034_0181026 Ga0501034_0181026_603_1016 137
1176 3300049572 Ga0501036_0142594 Ga0501036_0142594_687_1100 137
1177 3300049572 Ga0501036_0909139 Ga0501036_0909139_235_648 137
1178 3300049573 Ga0501037_0069872 Ga0501037_0069872_1550_1963 137
1179 3300049573 Ga0501037_0432443 Ga0501037_0432443_325_738 137
1180 3300049574 Ga0501038_0065544 Ga0501038_0065544_1013_1426 137
1181 3300049575 Ga0501039_0071693 Ga0501039_0071693_1271_1684 137
1182 3300049579 Ga0501043_0029323 Ga0501043_0029323_3238_3684 137
1183 3300049579 Ga0501043_0188675 Ga0501043_0188675_1064_1477 137
1184 3300049580 Ga0501046_0173853 Ga0501046_0173853_355_768 137
1185 3300049581 Ga0501047_0066767 Ga0501047_0066767_1988_2401 137
1186 3300049582 Ga0501048_0103125 Ga0501048_0103125_708_1121 137
1187 3300049583 Ga0501067_0013788 Ga0501067_0013788_2735_3160 137
1188 3300049583 Ga0501067_0208276 Ga0501067_0208276_176_589 137
1189 3300049588 Ga0501072_0004658 Ga0501072_0004658_5228_5653 137
1190 3300049589 Ga0501073_0032035 Ga0501073_0032035_1934_2359 137
1191 3300049590 Ga0501074_0065811 Ga0501074_0065811_487_912 137
1192 3300049742 Ga0501080_0141903 Ga0501080_0141903_1005_1430 137
1193 3300049742 Ga0501080_0151854 Ga0501080_0151854_1600_2013 137
1194 3300049744 Ga0501083_0044847 Ga0501083_0044847_1586_1999 137
1195 3300049744 Ga0501083_0072315 Ga0501083_0072315_1527_1952 137
1196 3300049776 Ga0501280_009131 Ga0501280_009131_365_778 137
1197 3300049776 Ga0501280_009598 Ga0501280_009598_124_537 137
1198 3300049822 Ga0501035_0073092 Ga0501035_0073092_1698_2111 137
1199 3300050489 nmdc:mga03683_16426_c1 nmdc:mga03683_16426_c1_1104_1517 137
1200 3300050489 nmdc:mga03683_2140_c2 nmdc:mga03683_2140_c2_1687_2100 137
1201 3300050490 nmdc:mga03n38_31455_c1 nmdc:mga03n38_31455_c1_1261_1674 137
1202 3300050490 nmdc:mga03n38_346214_c1 nmdc:mga03n38_346214_c1_331_744 137
1203 3300050490 nmdc:mga03n38_382044_c1 nmdc:mga03n38_382044_c1_230_643 137
1204 3300050490 nmdc:mga03n38_38515_c1 nmdc:mga03n38_38515_c1_761_1174 137
1205 3300050491 nmdc:mga00v17_225_c1 nmdc:mga00v17_225_c1_9540_9953 137
1206 3300050491 nmdc:mga00v17_537955_c1 nmdc:mga00v17_537955_c1_154_567 137
1207 3300050491 nmdc:mga00v17_5512_c1 nmdc:mga00v17_5512_c1_4309_4722 137
1208 3300050491 nmdc:mga00v17_9956_c1 nmdc:mga00v17_9956_c1_1104_1517 137
1209 3300050492 nmdc:mga0yw44_260_c1 nmdc:mga0yw44_260_c1_8206_8619 137
1210 3300050492 nmdc:mga0yw44_5353_c1 nmdc:mga0yw44_5353_c1_1982_2395 137
1211 3300050492 nmdc:mga0yw44_733120_c1 nmdc:mga0yw44_733120_c1_225_638 137
1212 3300050493 nmdc:mga0k408_211289_c1 nmdc:mga0k408_211289_c1_280_693 137
1213 3300050493 nmdc:mga0k408_4199_c1 nmdc:mga0k408_4199_c1_6108_6521 137
1214 3300050494 nmdc:mga06z11_106882_c1 nmdc:mga06z11_106882_c1_146_559 137
1215 3300050494 nmdc:mga06z11_323289_c1 nmdc:mga06z11_323289_c1_116_529 137
1216 3300050494 nmdc:mga06z11_877475_c1 nmdc:mga06z11_877475_c1_98_511 137
1217 3300050495 nmdc:mga04h51_13396_c1 nmdc:mga04h51_13396_c1_813_1226 137
1218 3300050495 nmdc:mga04h51_54979_c1 nmdc:mga04h51_54979_c1_154_567 137
1219 3300050496 nmdc:mga07m45_183696_c1 nmdc:mga07m45_183696_c1_596_1009 137
1220 3300050496 nmdc:mga07m45_28339_c1 nmdc:mga07m45_28339_c1_1270_1683 137
1221 3300050516 nmdc:mga0sz30_101760_c1 nmdc:mga0sz30_101760_c1_647_1060 137
1222 3300050516 nmdc:mga0sz30_138578_c1 nmdc:mga0sz30_138578_c1_609_1022 137
1223 3300050516 nmdc:mga0sz30_152941_c1 nmdc:mga0sz30_152941_c1_433_846 137
1224 3300050516 nmdc:mga0sz30_230260_c1 nmdc:mga0sz30_230260_c1_218_631 137
1225 3300050516 nmdc:mga0sz30_42100_c1 nmdc:mga0sz30_42100_c1_46_459 137
1226 3300050516 nmdc:mga0sz30_847_c1 nmdc:mga0sz30_847_c1_7855_8268 137
1227 3300053077 Ga0495601_0092215 Ga0495601_0092215_786_1226 137
1228 3300053077 Ga0495601_0260168 Ga0495601_0260168_374_787 137
1229 3300053079 Ga0500610_0002446 Ga0500610_0002446_2829_3242 137
1230 3300053085 Ga0495619_0011837 Ga0495619_0011837_3718_4158 137
1231 3300053086 Ga0500578_0227425 Ga0500578_0227425_407_820 137
1232 3300053086 Ga0500578_0397602 Ga0500578_0397602_161_574 137
1233 3300053086 Ga0500578_0460176 Ga0500578_0460176_35_448 137
1234 3300053093 Ga0500651_0182415 Ga0500651_0182415_223_636 137
1235 3300053098 Ga0500650_0142669 Ga0500650_0142669_495_908 137
1236 3300053105 Ga0500557_003736 Ga0500557_003736_32_445 137
1237 3300053107 Ga0500560_000198 Ga0500560_000198_4588_5001 137
1238 3300053107 Ga0500560_063464 Ga0500560_063464_150_563 137
1239 3300053109 Ga0500569_002914 Ga0500569_002914_2706_3119 137
1240 3300053118 Ga0500594_0001479 Ga0500594_0001479_4540_4953 137
1241 3300053118 Ga0500594_0036262 Ga0500594_0036262_591_1004 137
1242 3300053125 Ga0500618_009083 Ga0500618_009083_1500_1913 137
1243 3300053125 Ga0500618_010286 Ga0500618_010286_484_903 137
1244 3300053125 Ga0500618_023440 Ga0500618_023440_804_1217 137
1245 3300053134 Ga0500658_0000213 Ga0500658_0000213_10822_11235 137
1246 3300053134 Ga0500658_0041272 Ga0500658_0041272_477_890 137
1247 3300053137 Ga0500561_0000227 Ga0500561_0000227_285_698 137
1248 3300053139 Ga0500568_0000405 Ga0500568_0000405_16755_17168 137
1249 3300053142 Ga0500577_0133128 Ga0500577_0133128_362_775 137
1250 3300053151 Ga0500604_0019820 Ga0500604_0019820_386_799 137
1251 3300053151 Ga0500604_0128931 Ga0500604_0128931_168_584 137
1252 3300053153 Ga0500616_0044973 Ga0500616_0044973_1489_1902 137
1253 3300053153 Ga0500616_0058508 Ga0500616_0058508_1281_1694 137
1254 3300053156 Ga0500622_0005360 Ga0500622_0005360_2663_3076 137
1255 3300053157 Ga0500624_033013 Ga0500624_033013_28_441 137
1256 3300053158 Ga0500627_0090005 Ga0500627_0090005_327_740 137
1257 3300053160 Ga0500633_0002284 Ga0500633_0002284_1452_1865 137
1258 3300053160 Ga0500633_0242236 Ga0500633_0242236_62_475 137
1259 3300053161 Ga0500634_0018607 Ga0500634_0018607_3157_3570 137
1260 3300053161 Ga0500634_0041700 Ga0500634_0041700_227_640 137
1261 3300053177 Ga0500636_0000011 Ga0500636_0000011_66035_66448 137
1262 3300054114 Ga0501084_0047009 Ga0501084_0047009_2447_2872 137
1263 3300054114 Ga0501084_0431606 Ga0501084_0431606_406_819 137
1264 3300060353 Ga0501082_0032764 Ga0501082_0032764_2650_3075 137
1265 iso_pu_bacteria 2509276021 2509389640 137
1266 iso_pu_bacteria 2509276033 2509445945 137
1267 iso_pu_bacteria 2582581307 2585271454 137
1268 iso_pu_bacteria 2585427531 2585563305 137
1269 iso_pu_bacteria 2585427594 2585844744 137
1270 iso_pu_bacteria 2585427608 2585902645 137
1271 iso_pu_bacteria 2585427609 2585907524 137
1272 iso_pu_bacteria 2585428125 2587982482 137
1273 iso_pu_bacteria 2718217997 2719667098 137
1274 iso_pu_bacteria 2718218199 2720493518 137
1275 iso_pu_bacteria 2718218232 2720614976 137
1276 iso_pu_bacteria 2718218233 2720621747 137
1277 iso_pu_bacteria 2718218235 2720633082 137
1278 iso_pu_bacteria 2718218269 2720776801 137
1279 iso_pu_bacteria 2721755556 2723028391 137
1280 iso_pu_bacteria 2721755684 2723562017 137
1281 iso_pu_bacteria 2721755685 2723568649 137
1282 iso_pu_bacteria 2721755819 2724091408 137
1283 iso_pu_bacteria 2721755822 2724105914 137
1284 iso_pu_bacteria 2721755823 2724111739 137
1285 iso_pu_bacteria 2728369352 2730109327 137
1286 iso_pu_bacteria 2738541293 2738803852 137
1287 iso_pu_bacteria 2791355259 2793318279 137
1288 iso_pu_bacteria 2838016132 2838021978 137
1289 iso_pu_bacteria 2838042994 2838048238 137
1290 iso_pu_bacteria 2838048938 2838053604 137
1291 iso_pu_bacteria 2838061910 2838067565 137
1292 iso_pu_bacteria 2838068647 2838073930 137
1293 iso_pu_bacteria 2841864319 2841867979 137
1294 iso_pu_bacteria 2842264693 2842269124 137
1295 iso_pu_bacteria 2842311132 2842311145 137
1296 iso_pu_bacteria 2842341865 2842348027 137
1297 iso_pu_bacteria 2842363717 2842366485 137
1298 iso_pu_bacteria 2842395702 2842396270 137
1299 iso_pu_bacteria 2842422224 2842427731 137
1300 iso_pu_bacteria 2842428310 2842433183 137
1301 iso_pu_bacteria 2842434925 2842439609 137
1302 iso_pu_bacteria 2842441272 2842446312 137
1303 iso_pu_bacteria 2842447887 2842448991 137
1304 iso_pu_bacteria 2842462802 2842467507 137
1305 iso_pu_bacteria 2842469257 2842473980 137
1306 iso_pu_bacteria 2933599457 2933604249 137
1307 iso_pu_bacteria 2996893221 2996895967 137
1308 iso_pu_bacteria 8005282627 8005286366 137
1309 iso_pu_bacteria 8005395548 8005401021 137
1310 iso_pu_bacteria 8005430974 8005435296 137
1311 iso_pu_bacteria 8005497431 8005497448 137
1312 iso_pu_bacteria 8005619151 8005623191 137
1313 iso_pu_bacteria 8005626139 8005627691 137
1314 iso_pu_bacteria 8005668836 8005668853 137
1315 iso_pu_bacteria 8005695170 8005695502 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14815

NUDIX_4

NUDIX domain

12

132

0.86

PF00293

NUDIX

NUDIX domain

8

133

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9913 8 137
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9836 5 137
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9764 8 137
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9687 5 137
3hhj-assembly1.cif.gz_A crystal structure of mutator mutt from bartonella henselae 0.9547 7 135
ID Description Score Start End Superfamily
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9832 5 137 3.90.79.10
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.968 5 137 3.90.79.10
af_P77788_1_135_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9386 7 136 3.90.79.10
3a6uA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9312 10 134 3.90.79.10
af_Q54BB8_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.931 1 135 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A560FIT1-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9992 6 137 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
GO:0046872
AF-A0A1G3IE84-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9991 10 111 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A066PPN8-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9984 4 137 GO:0006260
GO:0006281
GO:0008413
GO:0016747
GO:0035539
GO:0044715
GO:0044716
AF-A0A2E8XTE8-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9981 9 137 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A5J6MP78-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.998 4 137 GO:0006260
GO:0006281
GO:0008413
GO:0016747
GO:0035539
GO:0044715
GO:0044716

Feature Viewer

pLDDT pTM Quality
94.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map