F492469
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1275 | 503 | 1128 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0008238|Ga0495638_0008238_1906_2607 |
| Length | 233 |
| Sequence | MAMRRGNRIMSFFDTLQDATRQERHELFNLPIIVDALEGKVSLESYQAFLTQAYYHVRHTVPLMMACGARLPQRLEWLRKAVCEYIEDEYGHEQWVLNDIQACGGDPDAVRDGRPSLPIELMVSFLYDLIARDNPVGLFGMVNVLEGTSIALATHAATSIRDRLKLPQSAFSYLSSHGSLDIEHMQTYRQLMNKLHDPDDQAAVIHASKVVYRLYTEMFRGLPRNGEKLHASV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 6 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 7 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 8 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 9 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 10 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 11 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 12 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 13 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 14 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 15 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 16 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 17 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 18 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 19 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 20 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 21 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 22 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 23 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 24 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 25 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 26 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 27 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 28 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 29 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 30 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 31 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 32 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 33 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 34 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 35 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 36 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 37 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 38 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 39 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 40 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 41 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 42 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 43 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 44 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 45 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 46 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 47 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 48 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 49 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 50 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 51 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 52 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 53 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 54 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 55 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 56 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 57 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 58 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 59 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 60 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 61 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 62 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 63 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 64 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 65 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 66 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 67 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 68 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 69 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 70 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 71 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 72 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 73 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 74 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 75 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 76 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 77 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 78 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 79 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 80 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 81 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 82 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 83 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 84 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 85 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 86 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 87 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 88 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 89 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 90 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 91 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 92 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 93 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 94 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 95 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 96 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 97 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 98 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 99 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 100 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 101 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 102 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 103 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 104 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 105 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 106 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 107 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 108 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 109 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 110 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 111 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 112 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 113 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 114 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 115 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 116 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 117 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 118 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 119 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 120 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 121 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 122 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 123 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 124 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 125 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 126 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 127 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 128 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 129 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 130 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 131 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 132 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 133 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 134 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 135 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 136 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 137 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 138 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 139 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 140 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 141 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 143 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 145 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 152 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 161 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 167 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 169 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 170 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 171 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 172 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 173 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 174 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 175 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 176 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 177 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 178 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 179 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 180 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 181 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 182 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 184 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 185 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 186 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 187 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 188 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 189 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 190 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 192 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 193 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 194 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 210 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 221 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 224 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 225 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 226 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 230 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 234 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 275 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 281 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 282 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 283 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 284 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 285 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 286 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 287 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 288 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 290 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 291 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 292 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 293 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 294 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 295 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 296 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 297 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 298 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 299 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 300 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 301 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 302 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 305 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 306 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 307 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 308 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 309 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 310 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 311 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 312 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 313 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 314 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 315 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 316 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 317 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 318 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 319 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 320 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 321 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 322 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 323 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 324 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 325 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 326 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 327 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 328 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 329 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 330 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 331 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 332 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 333 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 334 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 335 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 336 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 337 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 338 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 339 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 340 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 343 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 420 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 421 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 422 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 423 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 424 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 425 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 426 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 427 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 428 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 429 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 430 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 431 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 432 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 460 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 461 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 462 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 465 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 475 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 476 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 477 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 479 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 481 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 482 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 483 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 484 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 485 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 486 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 487 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 488 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 489 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 490 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 491 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 492 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 493 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 494 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 495 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 496 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 497 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 498 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 499 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 500 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 501 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 502 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 503 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.47 |
| Metatranscriptomes | 0 |
| Isolates | 11.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 1.65 |
| Rhizoplane | 3.22 |
| Rhizosphere | 82.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_51 | 2124908027 | Bacteria | 27969 |
| 2 | SwRhRL2b_contig_1371190 | 2162886007 | Bacteria | 6871 |
| 3 | SwRhRL2b_contig_1398382 | 2162886007 | Bacteria | 4323 |
| 4 | SwRhRL2b_contig_2863385 | 2162886007 | Bacteria | 4353 |
| 5 | SwRhRL2b_contig_3602964 | 2162886007 | Bacteria | 4606 |
| 6 | MRS1b_contig_6654047 | 2162886011 | Bacteria | 3204 |
| 7 | MBSR1b_contig_14104337 | 2162886012 | Unclassified | 1224 |
| 8 | MBSR1b_contig_2013439 | 2162886012 | Bacteria | 1804 |
| 9 | MBSR1b_contig_7046176 | 2162886012 | Bacteria | 1569 |
| 10 | Ga0055525_1006818 | 3300003759 | Bacteria | 966 |
| 11 | Ga0055526_1002931 | 3300003771 | Bacteria | 11184 |
| 12 | Ga0055524_1003743 | 3300003775 | Bacteria | 7262 |
| 13 | Ga0055536_1000025 | 3300003781 | Bacteria | 183172 |
| 14 | Ga0055536_1000037 | 3300003781 | Bacteria | 138437 |
| 15 | Ga0055536_1004947 | 3300003781 | Bacteria | 6637 |
| 16 | Ga0055536_1040265 | 3300003781 | Bacteria | 1114 |
| 17 | Ga0055534_1001147 | 3300003784 | Bacteria | 11209 |
| 18 | Ga0055534_1028430 | 3300003784 | Bacteria | 876 |
| 19 | Ga0055530_10000007 | 3300003791 | Bacteria | 183172 |
| 20 | Ga0055530_10000320 | 3300003791 | Bacteria | 43510 |
| 21 | Ga0055530_10000621 | 3300003791 | Bacteria | 30767 |
| 22 | Ga0055530_10001019 | 3300003791 | Bacteria | 22405 |
| 23 | Ga0055530_10008962 | 3300003791 | Bacteria | 3917 |
| 24 | Ga0055540_1000025 | 3300003792 | Bacteria | 197801 |
| 25 | Ga0055540_1000729 | 3300003792 | Bacteria | 22405 |
| 26 | Ga0055540_1000990 | 3300003792 | Bacteria | 18352 |
| 27 | Ga0055531_10000585 | 3300003794 | Bacteria | 31831 |
| 28 | Ga0065714_10000222 | 3300005288 | Bacteria | 7687 |
| 29 | Ga0065714_10002603 | 3300005288 | Bacteria | 16794 |
| 30 | Ga0065714_10003536 | 3300005288 | Bacteria | 6802 |
| 31 | Ga0065714_10005770 | 3300005288 | Bacteria | 6942 |
| 32 | Ga0065714_10012118 | 3300005288 | Bacteria | 2136 |
| 33 | Ga0065714_10012484 | 3300005288 | Bacteria | 3393 |
| 34 | Ga0065714_10064853 | 3300005288 | Bacteria | 16996 |
| 35 | Ga0065714_10065246 | 3300005288 | Bacteria | 11484 |
| 36 | Ga0065714_10069398 | 3300005288 | Bacteria | 4245 |
| 37 | Ga0065714_10071297 | 3300005288 | Bacteria | 3610 |
| 38 | Ga0065714_10073329 | 3300005288 | Bacteria | 3204 |
| 39 | Ga0065714_10159950 | 3300005288 | Bacteria | 1045 |
| 40 | Ga0065704_10000555 | 3300005289 | Bacteria | 20066 |
| 41 | Ga0065704_10001427 | 3300005289 | Bacteria | 13125 |
| 42 | Ga0065704_10070749 | 3300005289 | Bacteria | 16750 |
| 43 | Ga0065704_10077367 | 3300005289 | Bacteria | 4754 |
| 44 | Ga0065704_10084659 | 3300005289 | Bacteria | 3310 |
| 45 | Ga0065704_10241941 | 3300005289 | Bacteria | 1013 |
| 46 | Ga0065704_10331112 | 3300005289 | Bacteria | 837 |
| 47 | Ga0065712_10002972 | 3300005290 | Bacteria | 5702 |
| 48 | Ga0065712_10067857 | 3300005290 | Bacteria | 25214 |
| 49 | Ga0065715_10009061 | 3300005293 | Bacteria | 4799 |
| 50 | Ga0070670_100000079 | 3300005331 | Bacteria | 92916 |
| 51 | Ga0070670_100001054 | 3300005331 | Bacteria | 21894 |
| 52 | Ga0070670_100045437 | 3300005331 | Bacteria | 3776 |
| 53 | Ga0070670_100103194 | 3300005331 | Bacteria | 2456 |
| 54 | Ga0068869_100432542 | 3300005334 | Bacteria | 1088 |
| 55 | Ga0070666_10011793 | 3300005335 | Bacteria | 5494 |
| 56 | Ga0070680_100014625 | 3300005336 | Bacteria | 6138 |
| 57 | Ga0070661_100001004 | 3300005344 | Bacteria | 20032 |
| 58 | Ga0070661_100011542 | 3300005344 | Bacteria | 6155 |
| 59 | Ga0070692_10014293 | 3300005345 | Bacteria | 3725 |
| 60 | Ga0070668_100001244 | 3300005347 | Bacteria | 18179 |
| 61 | Ga0070668_100006258 | 3300005347 | Bacteria | 8815 |
| 62 | Ga0070669_100050193 | 3300005353 | Bacteria | 3047 |
| 63 | Ga0070669_100084129 | 3300005353 | Bacteria | 2373 |
| 64 | Ga0070675_100019354 | 3300005354 | Bacteria | 5424 |
| 65 | Ga0070675_100035489 | 3300005354 | Unclassified | 4052 |
| 66 | Ga0070671_100205240 | 3300005355 | Bacteria | 1671 |
| 67 | Ga0070688_100369696 | 3300005365 | Unclassified | 1054 |
| 68 | Ga0070667_100031180 | 3300005367 | Bacteria | 4445 |
| 69 | Ga0070705_100018250 | 3300005440 | Bacteria | 3675 |
| 70 | Ga0070700_100176345 | 3300005441 | Bacteria | 1484 |
| 71 | Ga0070694_100010869 | 3300005444 | Bacteria | 5632 |
| 72 | Ga0070663_100009462 | 3300005455 | Bacteria | 6035 |
| 73 | Ga0070678_100520271 | 3300005456 | Unclassified | 1052 |
| 74 | Ga0070662_100067167 | 3300005457 | Bacteria | 2633 |
| 75 | Ga0070698_100544295 | 3300005471 | Bacteria | 1100 |
| 76 | Ga0068853_100608259 | 3300005539 | Bacteria | 1038 |
| 77 | Ga0070672_100630325 | 3300005543 | Unclassified | 935 |
| 78 | Ga0070695_100094224 | 3300005545 | Bacteria | 2005 |
| 79 | Ga0070696_100100258 | 3300005546 | Bacteria | 2074 |
| 80 | Ga0070665_100027248 | 3300005548 | Bacteria | 5755 |
| 81 | Ga0070665_100064152 | 3300005548 | Bacteria | 3683 |
| 82 | Ga0070665_100217303 | 3300005548 | Bacteria | 1912 |
| 83 | Ga0070704_100087426 | 3300005549 | Bacteria | 2313 |
| 84 | Ga0068855_100059513 | 3300005563 | Bacteria | 4469 |
| 85 | Ga0070664_100001292 | 3300005564 | Bacteria | 20032 |
| 86 | Ga0070664_100014557 | 3300005564 | Bacteria | 6417 |
| 87 | Ga0068857_100219116 | 3300005577 | Bacteria | 1738 |
| 88 | Ga0068857_100223848 | 3300005577 | Bacteria | 1719 |
| 89 | Ga0068856_100005484 | 3300005614 | Bacteria | 12501 |
| 90 | Ga0068852_100016445 | 3300005616 | Bacteria | 5770 |
| 91 | Ga0068859_100724752 | 3300005617 | Bacteria | 1084 |
| 92 | Ga0068864_100101506 | 3300005618 | Bacteria | 2552 |
| 93 | Ga0068864_100183681 | 3300005618 | Bacteria | 1913 |
| 94 | Ga0068870_10010401 | 3300005840 | Unclassified | 4274 |
| 95 | Ga0068863_100112621 | 3300005841 | Bacteria | 2591 |
| 96 | Ga0068863_100533439 | 3300005841 | Bacteria | 1158 |
| 97 | Ga0068858_100018150 | 3300005842 | Bacteria | 6590 |
| 98 | Ga0068860_100049041 | 3300005843 | Bacteria | 4024 |
| 99 | Ga0068860_100819355 | 3300005843 | Unclassified | 944 |
| 100 | Ga0068862_100109262 | 3300005844 | Bacteria | 2426 |
| 101 | Ga0075364_10054755 | 3300006051 | Bacteria | 2609 |
| 102 | Ga0075364_10079676 | 3300006051 | Bacteria | 2164 |
| 103 | Ga0075364_10104434 | 3300006051 | Bacteria | 1887 |
| 104 | Ga0075364_10266995 | 3300006051 | Bacteria | 1163 |
| 105 | Ga0075364_10483289 | 3300006051 | Bacteria | 847 |
| 106 | Ga0075432_10000121 | 3300006058 | Bacteria | 17497 |
| 107 | Ga0075432_10001179 | 3300006058 | Bacteria | 8376 |
| 108 | Ga0075432_10007880 | 3300006058 | Bacteria | 3632 |
| 109 | Ga0075432_10009488 | 3300006058 | Bacteria | 3314 |
| 110 | Ga0075432_10013725 | 3300006058 | Bacteria | 2755 |
| 111 | Ga0075432_10092655 | 3300006058 | Bacteria | 1108 |
| 112 | Ga0075432_10207738 | 3300006058 | Bacteria | 777 |
| 113 | Ga0075362_10019840 | 3300006177 | Bacteria | 2801 |
| 114 | Ga0075362_10245620 | 3300006177 | Bacteria | 880 |
| 115 | Ga0075369_10067944 | 3300006186 | Bacteria | 1566 |
| 116 | Ga0097621_100229426 | 3300006237 | Bacteria | 1620 |
| 117 | Ga0097621_100555393 | 3300006237 | Unclassified | 1045 |
| 118 | Ga0068871_100084532 | 3300006358 | Bacteria | 2633 |
| 119 | Ga0075428_100127125 | 3300006844 | Bacteria | 2773 |
| 120 | Ga0075430_100009781 | 3300006846 | Bacteria | 8110 |
| 121 | Ga0075430_100012611 | 3300006846 | Bacteria | 7197 |
| 122 | Ga0075430_100096463 | 3300006846 | Bacteria | 2471 |
| 123 | Ga0075431_100005495 | 3300006847 | Bacteria | 12513 |
| 124 | Ga0075431_100014326 | 3300006847 | Bacteria | 8019 |
| 125 | Ga0075429_100017386 | 3300006880 | Bacteria | 6217 |
| 126 | Ga0075429_100072638 | 3300006880 | Bacteria | 2996 |
| 127 | Ga0068865_100006683 | 3300006881 | Bacteria | 7053 |
| 128 | Ga0068865_100237600 | 3300006881 | Bacteria | 1432 |
| 129 | Ga0075436_100056214 | 3300006914 | Bacteria | 2718 |
| 130 | Ga0097620_100724861 | 3300006931 | Bacteria | 1084 |
| 131 | Ga0099823_1000001 | 3300006944 | Bacteria | 216833 |
| 132 | Ga0079104_1000085 | 3300006946 | Bacteria | 136289 |
| 133 | Ga0079104_1000245 | 3300006946 | Bacteria | 72407 |
| 134 | Ga0079104_1008099 | 3300006946 | Bacteria | 3723 |
| 135 | Ga0099826_10000365 | 3300006948 | Bacteria | 20892 |
| 136 | Ga0105251_10000001 | 3300009011 | Bacteria | 466643 |
| 137 | Ga0105251_10001168 | 3300009011 | Bacteria | 22786 |
| 138 | Ga0105251_10001289 | 3300009011 | Bacteria | 21676 |
| 139 | Ga0105251_10002617 | 3300009011 | Bacteria | 13912 |
| 140 | Ga0105251_10005442 | 3300009011 | Bacteria | 8317 |
| 141 | Ga0105251_10058790 | 3300009011 | Bacteria | 1815 |
| 142 | Ga0105251_10064855 | 3300009011 | Bacteria | 1711 |
| 143 | Ga0105251_10193305 | 3300009011 | Bacteria | 917 |
| 144 | Ga0105244_10000806 | 3300009036 | Bacteria | 26610 |
| 145 | Ga0105244_10000914 | 3300009036 | Bacteria | 24937 |
| 146 | Ga0105244_10000938 | 3300009036 | Bacteria | 24575 |
| 147 | Ga0105244_10001369 | 3300009036 | Bacteria | 19810 |
| 148 | Ga0105244_10011979 | 3300009036 | Bacteria | 5158 |
| 149 | Ga0105244_10015608 | 3300009036 | Bacteria | 4352 |
| 150 | Ga0105244_10025248 | 3300009036 | Bacteria | 3232 |
| 151 | Ga0105244_10047865 | 3300009036 | Bacteria | 2190 |
| 152 | Ga0105244_10057992 | 3300009036 | Bacteria | 1956 |
| 153 | Ga0105244_10059458 | 3300009036 | Bacteria | 1927 |
| 154 | Ga0105244_10065107 | 3300009036 | Bacteria | 1827 |
| 155 | Ga0105244_10082793 | 3300009036 | Bacteria | 1586 |
| 156 | Ga0105244_10169378 | 3300009036 | Bacteria | 1040 |
| 157 | Ga0105244_10193456 | 3300009036 | Bacteria | 961 |
| 158 | Ga0105250_10002103 | 3300009092 | Bacteria | 10224 |
| 159 | Ga0105250_10002655 | 3300009092 | Bacteria | 8867 |
| 160 | Ga0105250_10007126 | 3300009092 | Bacteria | 4826 |
| 161 | Ga0105240_10186568 | 3300009093 | Bacteria | 2442 |
| 162 | Ga0105240_10890075 | 3300009093 | Bacteria | 958 |
| 163 | Ga0111539_10265555 | 3300009094 | Bacteria | 1998 |
| 164 | Ga0105247_10112543 | 3300009101 | Bacteria | 1754 |
| 165 | Ga0114129_10128597 | 3300009147 | Bacteria | 3481 |
| 166 | Ga0105243_10000230 | 3300009148 | Bacteria | 64559 |
| 167 | Ga0105243_10002867 | 3300009148 | Bacteria | 14298 |
| 168 | Ga0105243_10011221 | 3300009148 | Bacteria | 6778 |
| 169 | Ga0105243_10681108 | 3300009148 | Bacteria | 1000 |
| 170 | Ga0105242_10001326 | 3300009176 | Bacteria | 19534 |
| 171 | Ga0105248_10043825 | 3300009177 | Bacteria | 5018 |
| 172 | Ga0105248_10725386 | 3300009177 | Bacteria | 1121 |
| 173 | Ga0105237_10000937 | 3300009545 | Bacteria | 39281 |
| 174 | Ga0105237_10177519 | 3300009545 | Bacteria | 2130 |
| 175 | Ga0105238_10192285 | 3300009551 | Bacteria | 2017 |
| 176 | Ga0105249_10026653 | 3300009553 | Bacteria | 5211 |
| 177 | Ga0105239_10037499 | 3300010375 | Bacteria | 5312 |
| 178 | Ga0105246_10000047 | 3300011119 | Bacteria | 47128 |
| 179 | Ga0105246_10047044 | 3300011119 | Bacteria | 2944 |
| 180 | Ga0157345_1000005 | 3300012498 | Bacteria | 78097 |
| 181 | Ga0157373_10000409 | 3300013100 | Bacteria | 34480 |
| 182 | Ga0157373_10000598 | 3300013100 | Bacteria | 28031 |
| 183 | Ga0157373_10000845 | 3300013100 | Bacteria | 23804 |
| 184 | Ga0157373_10003727 | 3300013100 | Bacteria | 11530 |
| 185 | Ga0157373_10004523 | 3300013100 | Bacteria | 10457 |
| 186 | Ga0157373_10061079 | 3300013100 | Bacteria | 2669 |
| 187 | Ga0157371_10000535 | 3300013102 | Bacteria | 45229 |
| 188 | Ga0157370_10014974 | 3300013104 | Bacteria | 7907 |
| 189 | Ga0157370_10023243 | 3300013104 | Bacteria | 6157 |
| 190 | Ga0157370_10100923 | 3300013104 | Bacteria | 2703 |
| 191 | Ga0157370_10180973 | 3300013104 | Bacteria | 1959 |
| 192 | Ga0157370_10217427 | 3300013104 | Bacteria | 1770 |
| 193 | Ga0157369_10002178 | 3300013105 | Bacteria | 23587 |
| 194 | Ga0157369_10003376 | 3300013105 | Bacteria | 18972 |
| 195 | Ga0157374_10037667 | 3300013296 | Bacteria | 4441 |
| 196 | Ga0163162_10016024 | 3300013306 | Bacteria | 7325 |
| 197 | Ga0163162_10198059 | 3300013306 | Unclassified | 2137 |
| 198 | Ga0163162_10388684 | 3300013306 | Bacteria | 1528 |
| 199 | Ga0157372_10006552 | 3300013307 | Bacteria | 12388 |
| 200 | Ga0157372_10026527 | 3300013307 | Bacteria | 6304 |
| 201 | Ga0157372_10065042 | 3300013307 | Bacteria | 4094 |
| 202 | Ga0157375_10002189 | 3300013308 | Bacteria | 16893 |
| 203 | Ga0157375_10025389 | 3300013308 | Bacteria | 5505 |
| 204 | Ga0157375_10056866 | 3300013308 | Bacteria | 3865 |
| 205 | Ga0163163_10104001 | 3300014325 | Bacteria | 2864 |
| 206 | Ga0163163_10148815 | 3300014325 | Bacteria | 2386 |
| 207 | Ga0157380_10000547 | 3300014326 | Bacteria | 23134 |
| 208 | Ga0157380_10004385 | 3300014326 | Bacteria | 9781 |
| 209 | Ga0157380_10071701 | 3300014326 | Unclassified | 2803 |
| 210 | Ga0157380_10108487 | 3300014326 | Unclassified | 2327 |
| 211 | Ga0182008_10000449 | 3300014497 | Bacteria | 31373 |
| 212 | Ga0182008_10001226 | 3300014497 | Bacteria | 17694 |
| 213 | Ga0182008_10001820 | 3300014497 | Bacteria | 13894 |
| 214 | Ga0182008_10004720 | 3300014497 | Bacteria | 7902 |
| 215 | Ga0182008_10013526 | 3300014497 | Bacteria | 4291 |
| 216 | Ga0182008_10026759 | 3300014497 | Bacteria | 2924 |
| 217 | Ga0182008_10029382 | 3300014497 | Bacteria | 2778 |
| 218 | Ga0157377_10216381 | 3300014745 | Unclassified | 1224 |
| 219 | Ga0157379_10596819 | 3300014968 | Unclassified | 1030 |
| 220 | Ga0182006_1000099 | 3300015261 | Bacteria | 98453 |
| 221 | Ga0182006_1000607 | 3300015261 | Bacteria | 25961 |
| 222 | Ga0182006_1003156 | 3300015261 | Bacteria | 8614 |
| 223 | Ga0182006_1004677 | 3300015261 | Bacteria | 6702 |
| 224 | Ga0182006_1008171 | 3300015261 | Bacteria | 4749 |
| 225 | Ga0182006_1022998 | 3300015261 | Bacteria | 2584 |
| 226 | Ga0182007_10000130 | 3300015262 | Bacteria | 53164 |
| 227 | Ga0182007_10000379 | 3300015262 | Bacteria | 28020 |
| 228 | Ga0182007_10077788 | 3300015262 | Bacteria | 1088 |
| 229 | Ga0182005_1000208 | 3300015265 | Bacteria | 39222 |
| 230 | Ga0182005_1001653 | 3300015265 | Bacteria | 8673 |
| 231 | Ga0182005_1010131 | 3300015265 | Bacteria | 2716 |
| 232 | Ga0182005_1010980 | 3300015265 | Bacteria | 2593 |
| 233 | Ga0182005_1014213 | 3300015265 | Bacteria | 2230 |
| 234 | Ga0182005_1014215 | 3300015265 | Bacteria | 2230 |
| 235 | Ga0182005_1023764 | 3300015265 | Bacteria | 1674 |
| 236 | Ga0182005_1028502 | 3300015265 | Bacteria | 1522 |
| 237 | Ga0182005_1118122 | 3300015265 | Bacteria | 753 |
| 238 | Ga0163161_10000236 | 3300017792 | Bacteria | 50548 |
| 239 | Ga0163161_10000813 | 3300017792 | Bacteria | 24473 |
| 240 | Ga0163161_10001902 | 3300017792 | Bacteria | 15246 |
| 241 | Ga0163161_10024615 | 3300017792 | Bacteria | 4254 |
| 242 | Ga0209563_100648 | 3300025230 | Bacteria | 11181 |
| 243 | Ga0209565_1001320 | 3300025263 | Bacteria | 11384 |
| 244 | Ga0209675_1001584 | 3300025291 | Bacteria | 12867 |
| 245 | Ga0209675_1001855 | 3300025291 | Bacteria | 11471 |
| 246 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 247 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 248 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 249 | Ga0209676_1001013 | 3300025292 | Bacteria | 32853 |
| 250 | Ga0209676_1021986 | 3300025292 | Bacteria | 2125 |
| 251 | Ga0209676_1028919 | 3300025292 | Bacteria | 1718 |
| 252 | Ga0209564_1003298 | 3300025295 | Bacteria | 11215 |
| 253 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 254 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 255 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 256 | Ga0209050_1000383 | 3300025298 | Bacteria | 83450 |
| 257 | Ga0209050_1000782 | 3300025298 | Bacteria | 45306 |
| 258 | Ga0209050_1048449 | 3300025298 | Bacteria | 1098 |
| 259 | Ga0209256_1003993 | 3300025299 | Bacteria | 9671 |
| 260 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 261 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 262 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 263 | Ga0209051_1004486 | 3300025303 | Bacteria | 8584 |
| 264 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 265 | Ga0207696_1000016 | 3300025711 | Bacteria | 502467 |
| 266 | Ga0207696_1005875 | 3300025711 | Bacteria | 5032 |
| 267 | Ga0207696_1006185 | 3300025711 | Bacteria | 4865 |
| 268 | Ga0207696_1008566 | 3300025711 | Bacteria | 3892 |
| 269 | Ga0207696_1026560 | 3300025711 | Bacteria | 1791 |
| 270 | Ga0207696_1030704 | 3300025711 | Bacteria | 1630 |
| 271 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 272 | Ga0207655_1000287 | 3300025728 | Bacteria | 77056 |
| 273 | Ga0207655_1001371 | 3300025728 | Bacteria | 22824 |
| 274 | Ga0207655_1003372 | 3300025728 | Bacteria | 11943 |
| 275 | Ga0207655_1004780 | 3300025728 | Bacteria | 9447 |
| 276 | Ga0207655_1015434 | 3300025728 | Bacteria | 4246 |
| 277 | Ga0207655_1017660 | 3300025728 | Bacteria | 3836 |
| 278 | Ga0207655_1023783 | 3300025728 | Bacteria | 3025 |
| 279 | Ga0207655_1025112 | 3300025728 | Bacteria | 2900 |
| 280 | Ga0207655_1029251 | 3300025728 | Bacteria | 2583 |
| 281 | Ga0207655_1068749 | 3300025728 | Bacteria | 1327 |
| 282 | Ga0207655_1081852 | 3300025728 | Bacteria | 1162 |
| 283 | Ga0207655_1104984 | 3300025728 | Bacteria | 965 |
| 284 | Ga0207713_1000268 | 3300025735 | Bacteria | 64095 |
| 285 | Ga0207713_1000774 | 3300025735 | Bacteria | 29524 |
| 286 | Ga0207713_1001306 | 3300025735 | Bacteria | 20453 |
| 287 | Ga0207713_1001375 | 3300025735 | Bacteria | 19748 |
| 288 | Ga0207713_1006880 | 3300025735 | Bacteria | 6840 |
| 289 | Ga0207713_1009175 | 3300025735 | Bacteria | 5603 |
| 290 | Ga0207713_1009217 | 3300025735 | Bacteria | 5590 |
| 291 | Ga0207713_1014040 | 3300025735 | Bacteria | 4184 |
| 292 | Ga0207713_1040707 | 3300025735 | Bacteria | 1947 |
| 293 | Ga0207713_1054695 | 3300025735 | Bacteria | 1563 |
| 294 | Ga0207710_10114076 | 3300025900 | Bacteria | 1285 |
| 295 | Ga0207688_10112727 | 3300025901 | Bacteria | 1580 |
| 296 | Ga0207680_10400830 | 3300025903 | Bacteria | 969 |
| 297 | Ga0207647_10067925 | 3300025904 | Bacteria | 2158 |
| 298 | Ga0207645_10017381 | 3300025907 | Bacteria | 4748 |
| 299 | Ga0207643_10023040 | 3300025908 | Bacteria | 3432 |
| 300 | Ga0207671_10001472 | 3300025914 | Bacteria | 27195 |
| 301 | Ga0207660_10014715 | 3300025917 | Bacteria | 5153 |
| 302 | Ga0207649_10000818 | 3300025920 | Bacteria | 20019 |
| 303 | Ga0207650_10001079 | 3300025925 | Bacteria | 20203 |
| 304 | Ga0207650_10002898 | 3300025925 | Bacteria | 11840 |
| 305 | Ga0207650_10041412 | 3300025925 | Bacteria | 3375 |
| 306 | Ga0207659_10004554 | 3300025926 | Bacteria | 8382 |
| 307 | Ga0207659_10212090 | 3300025926 | Bacteria | 1552 |
| 308 | Ga0207644_10030980 | 3300025931 | Bacteria | 3725 |
| 309 | Ga0207706_10064186 | 3300025933 | Unclassified | 3233 |
| 310 | Ga0207709_10000014 | 3300025935 | Bacteria | 526302 |
| 311 | Ga0207709_10056469 | 3300025935 | Bacteria | 2430 |
| 312 | Ga0207709_10095532 | 3300025935 | Bacteria | 1953 |
| 313 | Ga0207711_10594429 | 3300025941 | Bacteria | 1032 |
| 314 | Ga0207689_10123987 | 3300025942 | Bacteria | 2125 |
| 315 | Ga0207679_10000818 | 3300025945 | Bacteria | 20047 |
| 316 | Ga0207667_10698138 | 3300025949 | Bacteria | 1017 |
| 317 | Ga0207651_10413336 | 3300025960 | Bacteria | 1150 |
| 318 | Ga0207668_10000866 | 3300025972 | Bacteria | 18274 |
| 319 | Ga0207668_10002134 | 3300025972 | Bacteria | 11544 |
| 320 | Ga0207677_10116517 | 3300026023 | Bacteria | 2000 |
| 321 | Ga0207703_10127412 | 3300026035 | Bacteria | 2194 |
| 322 | Ga0207639_10170170 | 3300026041 | Bacteria | 1844 |
| 323 | Ga0207678_10014112 | 3300026067 | Bacteria | 7026 |
| 324 | Ga0207708_10124035 | 3300026075 | Unclassified | 2015 |
| 325 | Ga0207641_10059699 | 3300026088 | Bacteria | 3248 |
| 326 | Ga0207648_10205801 | 3300026089 | Bacteria | 1746 |
| 327 | Ga0207676_10241605 | 3300026095 | Bacteria | 1620 |
| 328 | Ga0207676_10401223 | 3300026095 | Unclassified | 1281 |
| 329 | Ga0207674_10014157 | 3300026116 | Bacteria | 8815 |
| 330 | Ga0207675_100050770 | 3300026118 | Bacteria | 3871 |
| 331 | Ga0207698_10083754 | 3300026142 | Bacteria | 2582 |
| 332 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 333 | Ga0209281_1000046 | 3300027111 | Bacteria | 327042 |
| 334 | Ga0209281_1002511 | 3300027111 | Bacteria | 7222 |
| 335 | Ga0209281_1007690 | 3300027111 | Bacteria | 2684 |
| 336 | Ga0209389_1000007 | 3300027296 | Bacteria | 227459 |
| 337 | Ga0209995_1007422 | 3300027471 | Bacteria | 1767 |
| 338 | Ga0209983_1036744 | 3300027665 | Bacteria | 1054 |
| 339 | Ga0209282_1050167 | 3300027666 | Bacteria | 2401 |
| 340 | Ga0209966_1013396 | 3300027695 | Bacteria | 1518 |
| 341 | Ga0207428_10017115 | 3300027907 | Bacteria | 6228 |
| 342 | Ga0207428_10017815 | 3300027907 | Bacteria | 6091 |
| 343 | Ga0207428_10019253 | 3300027907 | Bacteria | 5820 |
| 344 | Ga0207428_10034208 | 3300027907 | Bacteria | 4167 |
| 345 | Ga0207428_10123299 | 3300027907 | Bacteria | 1985 |
| 346 | Ga0207428_10225764 | 3300027907 | Bacteria | 1403 |
| 347 | Ga0207428_10259779 | 3300027907 | Bacteria | 1294 |
| 348 | Ga0268266_10048863 | 3300028379 | Bacteria | 3627 |
| 349 | Ga0268266_10050083 | 3300028379 | Bacteria | 3583 |
| 350 | Ga0268265_10007470 | 3300028380 | Bacteria | 7381 |
| 351 | Ga0268264_10183688 | 3300028381 | Bacteria | 1901 |
| 352 | Ga0268264_10523369 | 3300028381 | Unclassified | 1160 |
| 353 | Ga0265323_10011964 | 3300028653 | Bacteria | 3487 |
| 354 | Ga0307511_10062589 | 3300030521 | Bacteria | 2822 |
| 355 | Ga0316178_1106511 | 3300030735 | Bacteria | 11740 |
| 356 | Ga0316183_1170431 | 3300030742 | Bacteria | 1509 |
| 357 | Ga0265316_10029947 | 3300031344 | Bacteria | 4469 |
| 358 | Ga0265316_10062393 | 3300031344 | Bacteria | 2892 |
| 359 | Ga0265316_10096499 | 3300031344 | Bacteria | 2251 |
| 360 | Ga0265316_10100443 | 3300031344 | Bacteria | 2199 |
| 361 | Ga0307408_100000047 | 3300031548 | Bacteria | 166310 |
| 362 | Ga0307408_100003404 | 3300031548 | Bacteria | 10909 |
| 363 | Ga0307408_100005033 | 3300031548 | Bacteria | 8863 |
| 364 | Ga0307408_100009387 | 3300031548 | Bacteria | 6446 |
| 365 | Ga0307408_100095499 | 3300031548 | Bacteria | 2253 |
| 366 | Ga0307408_100125860 | 3300031548 | Bacteria | 1993 |
| 367 | Ga0307408_100270503 | 3300031548 | Bacteria | 1410 |
| 368 | Ga0307508_10078052 | 3300031616 | Bacteria | 2891 |
| 369 | Ga0307508_10176152 | 3300031616 | Bacteria | 1742 |
| 370 | Ga0307508_10203368 | 3300031616 | Bacteria | 1581 |
| 371 | Ga0316579_10009679 | 3300031691 | Bacteria | 4057 |
| 372 | Ga0265314_10182434 | 3300031711 | Bacteria | 1256 |
| 373 | Ga0316576_10009168 | 3300031727 | Bacteria | 6375 |
| 374 | Ga0316576_10157736 | 3300031727 | Bacteria | 1711 |
| 375 | Ga0316576_10213850 | 3300031727 | Bacteria | 1451 |
| 376 | Ga0316578_10023883 | 3300031728 | Bacteria | 3425 |
| 377 | Ga0316578_10029071 | 3300031728 | Bacteria | 3135 |
| 378 | Ga0307405_10000422 | 3300031731 | Bacteria | 15864 |
| 379 | Ga0307405_10010749 | 3300031731 | Bacteria | 4758 |
| 380 | Ga0307405_10383751 | 3300031731 | Bacteria | 1094 |
| 381 | Ga0316577_10076554 | 3300031733 | Bacteria | 1868 |
| 382 | Ga0307413_10095851 | 3300031824 | Bacteria | 1946 |
| 383 | Ga0307413_10159791 | 3300031824 | Bacteria | 1581 |
| 384 | Ga0307406_10011073 | 3300031901 | Bacteria | 5108 |
| 385 | Ga0307412_10002369 | 3300031911 | Bacteria | 10459 |
| 386 | Ga0307412_10022250 | 3300031911 | Bacteria | 3883 |
| 387 | Ga0307412_10037205 | 3300031911 | Bacteria | 3125 |
| 388 | Ga0307416_100293500 | 3300032002 | Bacteria | 1611 |
| 389 | Ga0307414_10028655 | 3300032004 | Bacteria | 3614 |
| 390 | Ga0307414_10058324 | 3300032004 | Bacteria | 2719 |
| 391 | Ga0307414_10207854 | 3300032004 | Bacteria | 1597 |
| 392 | Ga0307411_10024420 | 3300032005 | Bacteria | 3603 |
| 393 | Ga0316583_10001608 | 3300032133 | Bacteria | 7629 |
| 394 | Ga0307510_10001358 | 3300033180 | Bacteria | 26701 |
| 395 | Ga0373952_0000171 | 3300035092 | Bacteria | 9988 |
| 396 | Ga0373945_0141493 | 3300035116 | Bacteria | 970 |
| 397 | Ga0373960_0003863 | 3300035121 | Bacteria | 3410 |
| 398 | Ga0316574_0002215 | 3300035398 | Bacteria | 9667 |
| 399 | Ga0316574_0010594 | 3300035398 | Bacteria | 5215 |
| 400 | Ga0316582_0010867 | 3300036647 | Bacteria | 5007 |
| 401 | Ga0316582_0058437 | 3300036647 | Bacteria | 2466 |
| 402 | Ga0316582_0088112 | 3300036647 | Bacteria | 2038 |
| 403 | Ga0316584_0114042 | 3300036712 | Bacteria | 2022 |
| 404 | Ga0316584_0223231 | 3300036712 | Bacteria | 1383 |
| 405 | Ga0316581_0096076 | 3300037588 | Bacteria | 912 |
| 406 | Ga0439436_0024245 | 3300041404 | Bacteria | 1791 |
| 407 | Ga0439438_000008 | 3300041405 | Bacteria | 178072 |
| 408 | Ga0439438_000048 | 3300041405 | Bacteria | 58674 |
| 409 | Ga0439438_000395 | 3300041405 | Bacteria | 19478 |
| 410 | Ga0439438_002317 | 3300041405 | Bacteria | 8146 |
| 411 | Ga0439438_003069 | 3300041405 | Bacteria | 6868 |
| 412 | Ga0439438_003967 | 3300041405 | Bacteria | 5823 |
| 413 | Ga0439438_020350 | 3300041405 | Bacteria | 1863 |
| 414 | Ga0439447_000490 | 3300041407 | Bacteria | 14702 |
| 415 | Ga0439447_000765 | 3300041407 | Bacteria | 11888 |
| 416 | Ga0439447_003573 | 3300041407 | Bacteria | 5508 |
| 417 | Ga0439447_004724 | 3300041407 | Bacteria | 4641 |
| 418 | Ga0439461_0006726 | 3300041410 | Bacteria | 2009 |
| 419 | Ga0439466_0000188 | 3300041411 | Bacteria | 24642 |
| 420 | Ga0439466_0002518 | 3300041411 | Bacteria | 7166 |
| 421 | Ga0439466_0004909 | 3300041411 | Bacteria | 5140 |
| 422 | Ga0439466_0008059 | 3300041411 | Bacteria | 3971 |
| 423 | Ga0439466_0012018 | 3300041411 | Bacteria | 3196 |
| 424 | Ga0439466_0012559 | 3300041411 | Bacteria | 3118 |
| 425 | Ga0439466_0064276 | 3300041411 | Bacteria | 1176 |
| 426 | Ga0439431_0000014 | 3300041997 | Bacteria | 30148 |
| 427 | Ga0439441_000448 | 3300042001 | Bacteria | 4406 |
| 428 | Ga0439441_069068 | 3300042001 | Bacteria | 755 |
| 429 | Ga0439432_000051 | 3300042006 | Bacteria | 36464 |
| 430 | Ga0439432_000847 | 3300042006 | Bacteria | 11460 |
| 431 | Ga0439432_003061 | 3300042006 | Bacteria | 6226 |
| 432 | Ga0439432_006757 | 3300042006 | Bacteria | 4084 |
| 433 | Ga0439432_018715 | 3300042006 | Bacteria | 2312 |
| 434 | Ga0439432_059967 | 3300042006 | Bacteria | 1174 |
| 435 | Ga0439451_001530 | 3300042009 | Bacteria | 4575 |
| 436 | Ga0439451_006063 | 3300042009 | Bacteria | 2470 |
| 437 | Ga0439451_006614 | 3300042009 | Bacteria | 2367 |
| 438 | Ga0439452_000043 | 3300042010 | Bacteria | 132609 |
| 439 | Ga0439452_000053 | 3300042010 | Bacteria | 113190 |
| 440 | Ga0439452_004509 | 3300042010 | Bacteria | 4658 |
| 441 | Ga0439452_007002 | 3300042010 | Bacteria | 3485 |
| 442 | Ga0439456_001801 | 3300042013 | Bacteria | 4322 |
| 443 | Ga0439456_006597 | 3300042013 | Bacteria | 2375 |
| 444 | Ga0439456_013271 | 3300042013 | Bacteria | 1714 |
| 445 | Ga0439456_020437 | 3300042013 | Bacteria | 1396 |
| 446 | Ga0439457_035433 | 3300042014 | Bacteria | 1110 |
| 447 | Ga0439463_000359 | 3300042016 | Bacteria | 12684 |
| 448 | Ga0439463_006594 | 3300042016 | Bacteria | 2874 |
| 449 | Ga0439463_021408 | 3300042016 | Bacteria | 1614 |
| 450 | Ga0450911_000009 | 3300042115 | Bacteria | 162968 |
| 451 | Ga0450911_000510 | 3300042115 | Bacteria | 12299 |
| 452 | Ga0450911_001101 | 3300042115 | Bacteria | 6752 |
| 453 | Ga0450919_010242 | 3300042121 | Bacteria | 1073 |
| 454 | Ga0450922_001118 | 3300042124 | Bacteria | 2663 |
| 455 | Ga0450923_004694 | 3300042125 | Bacteria | 2158 |
| 456 | Ga0450923_007230 | 3300042125 | Bacteria | 1869 |
| 457 | Ga0450900_000709 | 3300042136 | Bacteria | 2825 |
| 458 | Ga0450902_041111 | 3300042137 | Bacteria | 787 |
| 459 | Ga0450903_002877 | 3300042138 | Bacteria | 3010 |
| 460 | Ga0450903_003555 | 3300042138 | Bacteria | 2692 |
| 461 | Ga0450905_000799 | 3300042142 | Bacteria | 3892 |
| 462 | Ga0450906_003015 | 3300042145 | Bacteria | 3654 |
| 463 | Ga0450907_000120 | 3300042146 | Bacteria | 30093 |
| 464 | Ga0450910_000572 | 3300042147 | Bacteria | 4377 |
| 465 | Ga0450910_007604 | 3300042147 | Bacteria | 1513 |
| 466 | Ga0439446_0000066 | 3300042156 | Bacteria | 16983 |
| 467 | Ga0439446_0009231 | 3300042156 | Bacteria | 2635 |
| 468 | Ga0439446_0024885 | 3300042156 | Bacteria | 1710 |
| 469 | Ga0439446_0031787 | 3300042156 | Bacteria | 1528 |
| 470 | Ga0439434_0000831 | 3300042435 | Bacteria | 8910 |
| 471 | Ga0439434_0001508 | 3300042435 | Bacteria | 6702 |
| 472 | Ga0439434_0024151 | 3300042435 | Bacteria | 1833 |
| 473 | Ga0439435_0000108 | 3300042436 | Bacteria | 10573 |
| 474 | Ga0439435_0001905 | 3300042436 | Bacteria | 4001 |
| 475 | Ga0439444_0013238 | 3300042437 | Bacteria | 1364 |
| 476 | Ga0439464_0000770 | 3300042439 | Bacteria | 6979 |
| 477 | Ga0439464_0012303 | 3300042439 | Bacteria | 2277 |
| 478 | Ga0439464_0023797 | 3300042439 | Bacteria | 1692 |
| 479 | Ga0439464_0075656 | 3300042439 | Bacteria | 1000 |
| 480 | Ga0439460_0013355 | 3300042461 | Bacteria | 2147 |
| 481 | Ga0439460_0014794 | 3300042461 | Bacteria | 2055 |
| 482 | Ga0439460_0026357 | 3300042461 | Bacteria | 1625 |
| 483 | Ga0450916_000452 | 3300042530 | Bacteria | 3535 |
| 484 | Ga0451577_0004262 | 3300042876 | Bacteria | 15214 |
| 485 | Ga0451577_0007024 | 3300042876 | Bacteria | 11104 |
| 486 | Ga0439440_0002062 | 3300042993 | Bacteria | 3748 |
| 487 | Ga0439440_0008036 | 3300042993 | Bacteria | 2156 |
| 488 | Ga0439440_0030147 | 3300042993 | Bacteria | 1276 |
| 489 | Ga0453684_0002778 | 3300044712 | Bacteria | 41417 |
| 490 | Ga0453684_0333204 | 3300044712 | Bacteria | 1715 |
| 491 | Ga0451576_0084912 | 3300045051 | Bacteria | 3293 |
| 492 | Ga0495617_000263 | 3300046452 | Bacteria | 30333 |
| 493 | Ga0495617_001790 | 3300046452 | Bacteria | 9164 |
| 494 | Ga0495617_001945 | 3300046452 | Bacteria | 8668 |
| 495 | Ga0495617_006314 | 3300046452 | Bacteria | 4163 |
| 496 | Ga0495617_007955 | 3300046452 | Bacteria | 3665 |
| 497 | Ga0495617_026788 | 3300046452 | Bacteria | 1941 |
| 498 | Ga0495617_038440 | 3300046452 | Bacteria | 1601 |
| 499 | Ga0495617_096457 | 3300046452 | Bacteria | 962 |
| 500 | Ga0495617_108589 | 3300046452 | Bacteria | 898 |
| 501 | Ga0495627_000039 | 3300046453 | Bacteria | 197253 |
| 502 | Ga0495627_000140 | 3300046453 | Bacteria | 86227 |
| 503 | Ga0495627_000203 | 3300046453 | Bacteria | 64485 |
| 504 | Ga0495627_003143 | 3300046453 | Bacteria | 7459 |
| 505 | Ga0495627_003323 | 3300046453 | Bacteria | 7153 |
| 506 | Ga0495627_006275 | 3300046453 | Bacteria | 4672 |
| 507 | Ga0495627_018494 | 3300046453 | Bacteria | 2348 |
| 508 | Ga0495627_020609 | 3300046453 | Bacteria | 2195 |
| 509 | Ga0495627_024236 | 3300046453 | Bacteria | 1979 |
| 510 | Ga0495627_038820 | 3300046453 | Bacteria | 1471 |
| 511 | Ga0495603_0026163 | 3300046455 | Bacteria | 3526 |
| 512 | Ga0495590_0000235 | 3300046457 | Bacteria | 30406 |
| 513 | Ga0495590_0001793 | 3300046457 | Bacteria | 9110 |
| 514 | Ga0495590_0009342 | 3300046457 | Bacteria | 3719 |
| 515 | Ga0495590_0011308 | 3300046457 | Bacteria | 3339 |
| 516 | Ga0495591_000116 | 3300046458 | Bacteria | 92275 |
| 517 | Ga0495591_000138 | 3300046458 | Bacteria | 78836 |
| 518 | Ga0495591_000162 | 3300046458 | Bacteria | 71164 |
| 519 | Ga0495591_000749 | 3300046458 | Bacteria | 23491 |
| 520 | Ga0495591_002613 | 3300046458 | Bacteria | 9883 |
| 521 | Ga0495591_004348 | 3300046458 | Bacteria | 6977 |
| 522 | Ga0495591_004502 | 3300046458 | Bacteria | 6790 |
| 523 | Ga0495591_004931 | 3300046458 | Bacteria | 6335 |
| 524 | Ga0495591_005726 | 3300046458 | Bacteria | 5669 |
| 525 | Ga0495591_006991 | 3300046458 | Bacteria | 4873 |
| 526 | Ga0495591_013509 | 3300046458 | Bacteria | 2980 |
| 527 | Ga0495638_0000196 | 3300046460 | Bacteria | 87444 |
| 528 | Ga0495638_0000298 | 3300046460 | Bacteria | 64005 |
| 529 | Ga0495638_0001043 | 3300046460 | Bacteria | 27399 |
| 530 | Ga0495638_0003321 | 3300046460 | Bacteria | 12688 |
| 531 | Ga0495638_0005270 | 3300046460 | Bacteria | 9660 |
| 532 | Ga0495638_0008238 | 3300046460 | Bacteria | 7406 |
| 533 | Ga0495638_0016482 | 3300046460 | Bacteria | 4948 |
| 534 | Ga0495638_0017286 | 3300046460 | Bacteria | 4813 |
| 535 | Ga0495638_0099766 | 3300046460 | Bacteria | 1737 |
| 536 | Ga0495653_0001940 | 3300046463 | Bacteria | 16269 |
| 537 | Ga0495653_0008459 | 3300046463 | Bacteria | 8438 |
| 538 | Ga0495653_0068879 | 3300046463 | Bacteria | 2652 |
| 539 | Ga0495653_0174142 | 3300046463 | Bacteria | 1482 |
| 540 | Ga0495653_0229955 | 3300046463 | Bacteria | 1241 |
| 541 | Ga0495650_0000077 | 3300046471 | Bacteria | 245511 |
| 542 | Ga0495650_0001734 | 3300046471 | Bacteria | 19931 |
| 543 | Ga0495650_0002021 | 3300046471 | Bacteria | 17769 |
| 544 | Ga0495650_0002403 | 3300046471 | Bacteria | 15277 |
| 545 | Ga0495650_0004530 | 3300046471 | Bacteria | 9490 |
| 546 | Ga0495650_0008010 | 3300046471 | Bacteria | 6247 |
| 547 | Ga0495650_0015875 | 3300046471 | Bacteria | 3844 |
| 548 | Ga0495650_0020041 | 3300046471 | Bacteria | 3272 |
| 549 | Ga0495650_0021794 | 3300046471 | Bacteria | 3084 |
| 550 | Ga0495650_0023322 | 3300046471 | Bacteria | 2948 |
| 551 | Ga0495650_0026329 | 3300046471 | Bacteria | 2707 |
| 552 | Ga0495582_0005980 | 3300046473 | Bacteria | 6782 |
| 553 | Ga0495605_0000002 | 3300046474 | Bacteria | 522417 |
| 554 | Ga0495605_0000047 | 3300046474 | Bacteria | 171270 |
| 555 | Ga0495605_0000279 | 3300046474 | Bacteria | 57152 |
| 556 | Ga0495605_0000810 | 3300046474 | Bacteria | 22320 |
| 557 | Ga0495605_0001142 | 3300046474 | Bacteria | 17614 |
| 558 | Ga0495605_0001334 | 3300046474 | Bacteria | 16321 |
| 559 | Ga0495605_0002151 | 3300046474 | Bacteria | 12315 |
| 560 | Ga0495605_0006683 | 3300046474 | Bacteria | 6604 |
| 561 | Ga0495605_0008450 | 3300046474 | Bacteria | 5819 |
| 562 | Ga0495605_0013545 | 3300046474 | Bacteria | 4488 |
| 563 | Ga0495605_0105906 | 3300046474 | Bacteria | 1288 |
| 564 | Ga0495605_0151892 | 3300046474 | Bacteria | 1033 |
| 565 | Ga0495605_0173453 | 3300046474 | Bacteria | 951 |
| 566 | Ga0495639_0000059 | 3300046475 | Bacteria | 49016 |
| 567 | Ga0495639_0017743 | 3300046475 | Bacteria | 3092 |
| 568 | Ga0495584_0000579 | 3300046491 | Bacteria | 24738 |
| 569 | Ga0495584_0002024 | 3300046491 | Bacteria | 11648 |
| 570 | Ga0495584_0003053 | 3300046491 | Bacteria | 9298 |
| 571 | Ga0495584_0019991 | 3300046491 | Bacteria | 3401 |
| 572 | Ga0495584_0027799 | 3300046491 | Bacteria | 2866 |
| 573 | Ga0495584_0028337 | 3300046491 | Bacteria | 2837 |
| 574 | Ga0495584_0028993 | 3300046491 | Bacteria | 2805 |
| 575 | Ga0495584_0029615 | 3300046491 | Bacteria | 2775 |
| 576 | Ga0495584_0039340 | 3300046491 | Bacteria | 2388 |
| 577 | Ga0495585_0000202 | 3300046492 | Bacteria | 62078 |
| 578 | Ga0495585_0000333 | 3300046492 | Bacteria | 45988 |
| 579 | Ga0495585_0000372 | 3300046492 | Bacteria | 43337 |
| 580 | Ga0495585_0000622 | 3300046492 | Bacteria | 32989 |
| 581 | Ga0495585_0007020 | 3300046492 | Bacteria | 6934 |
| 582 | Ga0495585_0014085 | 3300046492 | Bacteria | 4669 |
| 583 | Ga0495585_0036694 | 3300046492 | Bacteria | 2762 |
| 584 | Ga0495585_0054670 | 3300046492 | Bacteria | 2206 |
| 585 | Ga0495585_0078162 | 3300046492 | Bacteria | 1795 |
| 586 | Ga0495594_0007594 | 3300046499 | Bacteria | 5580 |
| 587 | Ga0495594_0036652 | 3300046499 | Bacteria | 2675 |
| 588 | Ga0495594_0040160 | 3300046499 | Bacteria | 2559 |
| 589 | Ga0495594_0307820 | 3300046499 | Bacteria | 903 |
| 590 | Ga0495596_0000049 | 3300046500 | Bacteria | 87906 |
| 591 | Ga0495596_0002506 | 3300046500 | Bacteria | 9838 |
| 592 | Ga0495596_0108880 | 3300046500 | Bacteria | 1075 |
| 593 | Ga0495607_0000043 | 3300046501 | Bacteria | 127616 |
| 594 | Ga0495607_0000503 | 3300046501 | Bacteria | 39144 |
| 595 | Ga0495607_0000770 | 3300046501 | Bacteria | 30744 |
| 596 | Ga0495607_0002404 | 3300046501 | Bacteria | 15274 |
| 597 | Ga0495607_0002730 | 3300046501 | Bacteria | 14079 |
| 598 | Ga0495607_0003453 | 3300046501 | Bacteria | 12100 |
| 599 | Ga0495607_0007340 | 3300046501 | Bacteria | 7638 |
| 600 | Ga0495607_0012487 | 3300046501 | Bacteria | 5604 |
| 601 | Ga0495607_0013496 | 3300046501 | Bacteria | 5351 |
| 602 | Ga0495607_0023397 | 3300046501 | Bacteria | 3868 |
| 603 | Ga0495607_0047363 | 3300046501 | Bacteria | 2519 |
| 604 | Ga0495607_0049644 | 3300046501 | Bacteria | 2445 |
| 605 | Ga0495607_0089212 | 3300046501 | Bacteria | 1674 |
| 606 | Ga0495607_0104685 | 3300046501 | Bacteria | 1509 |
| 607 | Ga0495607_0114963 | 3300046501 | Bacteria | 1421 |
| 608 | Ga0495583_0000012 | 3300046506 | Bacteria | 324839 |
| 609 | Ga0495583_0000528 | 3300046506 | Bacteria | 54010 |
| 610 | Ga0495583_0000534 | 3300046506 | Bacteria | 53761 |
| 611 | Ga0495583_0001642 | 3300046506 | Bacteria | 21784 |
| 612 | Ga0495583_0002701 | 3300046506 | Bacteria | 14740 |
| 613 | Ga0495583_0005647 | 3300046506 | Bacteria | 8425 |
| 614 | Ga0495583_0012000 | 3300046506 | Bacteria | 4935 |
| 615 | Ga0495606_0000207 | 3300046507 | Bacteria | 103669 |
| 616 | Ga0495606_0001383 | 3300046507 | Bacteria | 32778 |
| 617 | Ga0495606_0001516 | 3300046507 | Bacteria | 30798 |
| 618 | Ga0495606_0001673 | 3300046507 | Bacteria | 28701 |
| 619 | Ga0495606_0003190 | 3300046507 | Bacteria | 17683 |
| 620 | Ga0495606_0004547 | 3300046507 | Bacteria | 13790 |
| 621 | Ga0495606_0040858 | 3300046507 | Bacteria | 3113 |
| 622 | Ga0495606_0042512 | 3300046507 | Bacteria | 3038 |
| 623 | Ga0495606_0053208 | 3300046507 | Bacteria | 2627 |
| 624 | Ga0495606_0059862 | 3300046507 | Bacteria | 2441 |
| 625 | Ga0495606_0127326 | 3300046507 | Bacteria | 1517 |
| 626 | Ga0495610_0002360 | 3300046512 | Bacteria | 15955 |
| 627 | Ga0495610_0004087 | 3300046512 | Bacteria | 10939 |
| 628 | Ga0495610_0006715 | 3300046512 | Bacteria | 7826 |
| 629 | Ga0495610_0009393 | 3300046512 | Bacteria | 6190 |
| 630 | Ga0495610_0009485 | 3300046512 | Bacteria | 6148 |
| 631 | Ga0495610_0013198 | 3300046512 | Bacteria | 4920 |
| 632 | Ga0495610_0024883 | 3300046512 | Bacteria | 3224 |
| 633 | Ga0495610_0029643 | 3300046512 | Bacteria | 2878 |
| 634 | Ga0495610_0090327 | 3300046512 | Bacteria | 1389 |
| 635 | Ga0495610_0098211 | 3300046512 | Bacteria | 1315 |
| 636 | Ga0495616_0001576 | 3300046513 | Bacteria | 15673 |
| 637 | Ga0495616_0002736 | 3300046513 | Bacteria | 11540 |
| 638 | Ga0495616_0016240 | 3300046513 | Bacteria | 4124 |
| 639 | Ga0495616_0020170 | 3300046513 | Bacteria | 3630 |
| 640 | Ga0495616_0034760 | 3300046513 | Bacteria | 2614 |
| 641 | Ga0495616_0040210 | 3300046513 | Bacteria | 2390 |
| 642 | Ga0495616_0042257 | 3300046513 | Bacteria | 2321 |
| 643 | Ga0495616_0049796 | 3300046513 | Bacteria | 2097 |
| 644 | Ga0495616_0050793 | 3300046513 | Bacteria | 2071 |
| 645 | Ga0495620_0000010 | 3300046515 | Bacteria | 173604 |
| 646 | Ga0495620_0000062 | 3300046515 | Bacteria | 93605 |
| 647 | Ga0495620_0000855 | 3300046515 | Bacteria | 18810 |
| 648 | Ga0495620_0000898 | 3300046515 | Bacteria | 18251 |
| 649 | Ga0495620_0002748 | 3300046515 | Bacteria | 10135 |
| 650 | Ga0495620_0003212 | 3300046515 | Bacteria | 9384 |
| 651 | Ga0495620_0004920 | 3300046515 | Bacteria | 7493 |
| 652 | Ga0495620_0015431 | 3300046515 | Bacteria | 3858 |
| 653 | Ga0495620_0078137 | 3300046515 | Bacteria | 1342 |
| 654 | Ga0495630_0003718 | 3300046517 | Bacteria | 10634 |
| 655 | Ga0495630_0018138 | 3300046517 | Bacteria | 5167 |
| 656 | Ga0495630_0429250 | 3300046517 | Bacteria | 1012 |
| 657 | Ga0495630_0560957 | 3300046517 | Unclassified | 876 |
| 658 | Ga0495631_0000002 | 3300046518 | Bacteria | 178694 |
| 659 | Ga0495631_0000255 | 3300046518 | Bacteria | 36934 |
| 660 | Ga0495631_0000479 | 3300046518 | Bacteria | 26745 |
| 661 | Ga0495631_0005450 | 3300046518 | Bacteria | 6655 |
| 662 | Ga0495631_0006994 | 3300046518 | Bacteria | 5775 |
| 663 | Ga0495631_0008780 | 3300046518 | Bacteria | 5078 |
| 664 | Ga0495631_0019680 | 3300046518 | Bacteria | 3164 |
| 665 | Ga0495631_0179071 | 3300046518 | Bacteria | 908 |
| 666 | Ga0495632_0000232 | 3300046519 | Bacteria | 55806 |
| 667 | Ga0495632_0001723 | 3300046519 | Bacteria | 17774 |
| 668 | Ga0495632_0003247 | 3300046519 | Bacteria | 11654 |
| 669 | Ga0495632_0003257 | 3300046519 | Bacteria | 11625 |
| 670 | Ga0495632_0008066 | 3300046519 | Bacteria | 6525 |
| 671 | Ga0495632_0010340 | 3300046519 | Bacteria | 5535 |
| 672 | Ga0495632_0011430 | 3300046519 | Bacteria | 5179 |
| 673 | Ga0495632_0016203 | 3300046519 | Bacteria | 4152 |
| 674 | Ga0495632_0016206 | 3300046519 | Bacteria | 4152 |
| 675 | Ga0495632_0052108 | 3300046519 | Bacteria | 2012 |
| 676 | Ga0495637_0000044 | 3300046520 | Bacteria | 111531 |
| 677 | Ga0495637_0000127 | 3300046520 | Bacteria | 56837 |
| 678 | Ga0495637_0002779 | 3300046520 | Bacteria | 9495 |
| 679 | Ga0495637_0002832 | 3300046520 | Bacteria | 9403 |
| 680 | Ga0495637_0003064 | 3300046520 | Bacteria | 8924 |
| 681 | Ga0495637_0003435 | 3300046520 | Bacteria | 8412 |
| 682 | Ga0495637_0004013 | 3300046520 | Bacteria | 7680 |
| 683 | Ga0495637_0004709 | 3300046520 | Bacteria | 7041 |
| 684 | Ga0495637_0005030 | 3300046520 | Bacteria | 6794 |
| 685 | Ga0495637_0015510 | 3300046520 | Bacteria | 3573 |
| 686 | Ga0495637_0026580 | 3300046520 | Bacteria | 2595 |
| 687 | Ga0495637_0031028 | 3300046520 | Bacteria | 2366 |
| 688 | Ga0495637_0035786 | 3300046520 | Bacteria | 2166 |
| 689 | Ga0495643_0000049 | 3300046522 | Bacteria | 212242 |
| 690 | Ga0495643_0000284 | 3300046522 | Bacteria | 72435 |
| 691 | Ga0495643_0002169 | 3300046522 | Bacteria | 16068 |
| 692 | Ga0495643_0003292 | 3300046522 | Bacteria | 11932 |
| 693 | Ga0495643_0010678 | 3300046522 | Bacteria | 5641 |
| 694 | Ga0495643_0013147 | 3300046522 | Bacteria | 4967 |
| 695 | Ga0495643_0014053 | 3300046522 | Bacteria | 4774 |
| 696 | Ga0495643_0030427 | 3300046522 | Bacteria | 3014 |
| 697 | Ga0495643_0057520 | 3300046522 | Bacteria | 2072 |
| 698 | Ga0495643_0107566 | 3300046522 | Bacteria | 1421 |
| 699 | Ga0495644_0000159 | 3300046523 | Bacteria | 32152 |
| 700 | Ga0495644_0000878 | 3300046523 | Bacteria | 12434 |
| 701 | Ga0495644_0003676 | 3300046523 | Bacteria | 6036 |
| 702 | Ga0495644_0045069 | 3300046523 | Bacteria | 1658 |
| 703 | Ga0495644_0105559 | 3300046523 | Bacteria | 1067 |
| 704 | Ga0495644_0111793 | 3300046523 | Bacteria | 1036 |
| 705 | Ga0495648_0000337 | 3300046524 | Bacteria | 51818 |
| 706 | Ga0495648_0001764 | 3300046524 | Bacteria | 20892 |
| 707 | Ga0495648_0002321 | 3300046524 | Bacteria | 17712 |
| 708 | Ga0495648_0002415 | 3300046524 | Bacteria | 17319 |
| 709 | Ga0495648_0003859 | 3300046524 | Bacteria | 12999 |
| 710 | Ga0495648_0004627 | 3300046524 | Bacteria | 11687 |
| 711 | Ga0495648_0005118 | 3300046524 | Bacteria | 10985 |
| 712 | Ga0495648_0015063 | 3300046524 | Bacteria | 5631 |
| 713 | Ga0495648_0067018 | 3300046524 | Bacteria | 2101 |
| 714 | Ga0495648_0104675 | 3300046524 | Bacteria | 1553 |
| 715 | Ga0495666_0001016 | 3300046526 | Bacteria | 13312 |
| 716 | Ga0495666_0084302 | 3300046526 | Bacteria | 1501 |
| 717 | Ga0495666_0144543 | 3300046526 | Bacteria | 1107 |
| 718 | Ga0495654_0000157 | 3300046530 | Bacteria | 67490 |
| 719 | Ga0495654_0000197 | 3300046530 | Bacteria | 58733 |
| 720 | Ga0495654_0000312 | 3300046530 | Bacteria | 42611 |
| 721 | Ga0495654_0000350 | 3300046530 | Bacteria | 39799 |
| 722 | Ga0495654_0000561 | 3300046530 | Bacteria | 30020 |
| 723 | Ga0495654_0000851 | 3300046530 | Bacteria | 23130 |
| 724 | Ga0495654_0004135 | 3300046530 | Bacteria | 8706 |
| 725 | Ga0495654_0006790 | 3300046530 | Bacteria | 6463 |
| 726 | Ga0495654_0012024 | 3300046530 | Bacteria | 4664 |
| 727 | Ga0495654_0012774 | 3300046530 | Bacteria | 4507 |
| 728 | Ga0495654_0013179 | 3300046530 | Bacteria | 4428 |
| 729 | Ga0495654_0084028 | 3300046530 | Bacteria | 1487 |
| 730 | Ga0495654_0094385 | 3300046530 | Bacteria | 1384 |
| 731 | Ga0495654_0103854 | 3300046530 | Bacteria | 1304 |
| 732 | Ga0495654_0243632 | 3300046530 | Bacteria | 751 |
| 733 | Ga0495586_0009415 | 3300046535 | Bacteria | 5198 |
| 734 | Ga0495587_0000089 | 3300046536 | Bacteria | 70764 |
| 735 | Ga0495587_0007118 | 3300046536 | Bacteria | 7257 |
| 736 | Ga0495609_0000008 | 3300046538 | Bacteria | 383025 |
| 737 | Ga0495609_0000358 | 3300046538 | Bacteria | 39792 |
| 738 | Ga0495609_0001094 | 3300046538 | Bacteria | 18849 |
| 739 | Ga0495609_0001600 | 3300046538 | Bacteria | 14800 |
| 740 | Ga0495609_0003087 | 3300046538 | Bacteria | 9763 |
| 741 | Ga0495609_0003417 | 3300046538 | Bacteria | 9106 |
| 742 | Ga0495609_0021168 | 3300046538 | Bacteria | 3000 |
| 743 | Ga0495609_0025066 | 3300046538 | Bacteria | 2735 |
| 744 | Ga0495609_0121162 | 3300046538 | Bacteria | 1124 |
| 745 | Ga0495597_0001188 | 3300046542 | Bacteria | 19515 |
| 746 | Ga0495597_0001323 | 3300046542 | Bacteria | 18107 |
| 747 | Ga0495597_0001929 | 3300046542 | Bacteria | 14004 |
| 748 | Ga0495597_0003566 | 3300046542 | Bacteria | 8980 |
| 749 | Ga0495597_0004046 | 3300046542 | Bacteria | 8212 |
| 750 | Ga0495597_0007169 | 3300046542 | Bacteria | 5690 |
| 751 | Ga0495597_0048542 | 3300046542 | Bacteria | 1877 |
| 752 | Ga0495597_0134034 | 3300046542 | Bacteria | 1025 |
| 753 | Ga0495597_0153052 | 3300046542 | Bacteria | 945 |
| 754 | Ga0495597_0172321 | 3300046542 | Bacteria | 878 |
| 755 | Ga0495622_0000676 | 3300046557 | Bacteria | 19344 |
| 756 | Ga0495622_0001176 | 3300046557 | Bacteria | 13538 |
| 757 | Ga0495622_0002949 | 3300046557 | Bacteria | 8107 |
| 758 | Ga0495622_0018880 | 3300046557 | Bacteria | 3213 |
| 759 | Ga0495622_0059584 | 3300046557 | Bacteria | 1767 |
| 760 | Ga0495622_0095630 | 3300046557 | Bacteria | 1363 |
| 761 | Ga0495622_0111131 | 3300046557 | Bacteria | 1255 |
| 762 | Ga0495622_0146145 | 3300046557 | Bacteria | 1071 |
| 763 | Ga0495633_0000009 | 3300046558 | Bacteria | 293183 |
| 764 | Ga0495633_0000571 | 3300046558 | Bacteria | 35869 |
| 765 | Ga0495633_0000656 | 3300046558 | Bacteria | 31916 |
| 766 | Ga0495633_0019067 | 3300046558 | Bacteria | 3472 |
| 767 | Ga0495633_0079737 | 3300046558 | Bacteria | 1524 |
| 768 | Ga0495656_0028652 | 3300046615 | Bacteria | 2235 |
| 769 | Ga0495668_0000732 | 3300046616 | Bacteria | 39331 |
| 770 | Ga0495668_0055195 | 3300046616 | Bacteria | 2194 |
| 771 | Ga0495668_0131696 | 3300046616 | Bacteria | 1368 |
| 772 | Ga0495668_0263722 | 3300046616 | Bacteria | 943 |
| 773 | Ga0495634_0001522 | 3300046642 | Bacteria | 20497 |
| 774 | Ga0495611_0000016 | 3300046648 | Bacteria | 129593 |
| 775 | Ga0495611_0001351 | 3300046648 | Bacteria | 12402 |
| 776 | Ga0495611_0003958 | 3300046648 | Bacteria | 6444 |
| 777 | Ga0495611_0008920 | 3300046648 | Bacteria | 4242 |
| 778 | Ga0495625_0002733 | 3300046660 | Bacteria | 18697 |
| 779 | Ga0495625_0003014 | 3300046660 | Bacteria | 17347 |
| 780 | Ga0495625_0003863 | 3300046660 | Bacteria | 14477 |
| 781 | Ga0495625_0004081 | 3300046660 | Bacteria | 13941 |
| 782 | Ga0495625_0012034 | 3300046660 | Bacteria | 7023 |
| 783 | Ga0495625_0013745 | 3300046660 | Bacteria | 6490 |
| 784 | Ga0495625_0018840 | 3300046660 | Bacteria | 5374 |
| 785 | Ga0495625_0168253 | 3300046660 | Bacteria | 1465 |
| 786 | Ga0495635_0000983 | 3300046663 | Bacteria | 18785 |
| 787 | Ga0495635_0023127 | 3300046663 | Bacteria | 4330 |
| 788 | Ga0495659_0000077 | 3300046664 | Bacteria | 42000 |
| 789 | Ga0495661_0000001 | 3300046665 | Bacteria | 898372 |
| 790 | Ga0495661_0000011 | 3300046665 | Bacteria | 277997 |
| 791 | Ga0495661_0000029 | 3300046665 | Bacteria | 173899 |
| 792 | Ga0495661_0003807 | 3300046665 | Bacteria | 11042 |
| 793 | Ga0495661_0007031 | 3300046665 | Bacteria | 7868 |
| 794 | Ga0495661_0011184 | 3300046665 | Bacteria | 6090 |
| 795 | Ga0495661_0020002 | 3300046665 | Bacteria | 4377 |
| 796 | Ga0495661_0034227 | 3300046665 | Bacteria | 3197 |
| 797 | Ga0495661_0035823 | 3300046665 | Bacteria | 3111 |
| 798 | Ga0495588_0017994 | 3300046674 | Bacteria | 3440 |
| 799 | Ga0495623_0003928 | 3300046679 | Bacteria | 9802 |
| 800 | Ga0495646_0000414 | 3300046680 | Bacteria | 22554 |
| 801 | Ga0495658_0133364 | 3300046683 | Bacteria | 1514 |
| 802 | Ga0495613_0009565 | 3300046689 | Bacteria | 7200 |
| 803 | Ga0495613_0113470 | 3300046689 | Bacteria | 1951 |
| 804 | Ga0495670_0000373 | 3300046691 | Bacteria | 21412 |
| 805 | Ga0495670_0000395 | 3300046691 | Bacteria | 20827 |
| 806 | Ga0495670_0000563 | 3300046691 | Bacteria | 17690 |
| 807 | Ga0495670_0001267 | 3300046691 | Bacteria | 12345 |
| 808 | Ga0495670_0019743 | 3300046691 | Bacteria | 3321 |
| 809 | Ga0495671_0000141 | 3300046692 | Bacteria | 63480 |
| 810 | Ga0495671_0000171 | 3300046692 | Bacteria | 57447 |
| 811 | Ga0495671_0000324 | 3300046692 | Bacteria | 40091 |
| 812 | Ga0495671_0000785 | 3300046692 | Bacteria | 22817 |
| 813 | Ga0495671_0002246 | 3300046692 | Bacteria | 12279 |
| 814 | Ga0495671_0002489 | 3300046692 | Bacteria | 11605 |
| 815 | Ga0495671_0009284 | 3300046692 | Bacteria | 5498 |
| 816 | Ga0495671_0015352 | 3300046692 | Bacteria | 4106 |
| 817 | Ga0495671_0016168 | 3300046692 | Bacteria | 3989 |
| 818 | Ga0495671_0022278 | 3300046692 | Bacteria | 3321 |
| 819 | Ga0495671_0029587 | 3300046692 | Bacteria | 2811 |
| 820 | Ga0495671_0030134 | 3300046692 | Bacteria | 2781 |
| 821 | Ga0495671_0035004 | 3300046692 | Bacteria | 2552 |
| 822 | Ga0495671_0055184 | 3300046692 | Bacteria | 1968 |
| 823 | Ga0495671_0101716 | 3300046692 | Bacteria | 1404 |
| 824 | Ga0495649_0000109 | 3300046694 | Bacteria | 72797 |
| 825 | Ga0495649_0003158 | 3300046694 | Bacteria | 11259 |
| 826 | Ga0495649_0007664 | 3300046694 | Bacteria | 6555 |
| 827 | Ga0495649_0008372 | 3300046694 | Bacteria | 6223 |
| 828 | Ga0495649_0014437 | 3300046694 | Bacteria | 4527 |
| 829 | Ga0495649_0019373 | 3300046694 | Bacteria | 3824 |
| 830 | Ga0495649_0032100 | 3300046694 | Bacteria | 2895 |
| 831 | Ga0495649_0032228 | 3300046694 | Bacteria | 2888 |
| 832 | Ga0495649_0039208 | 3300046694 | Bacteria | 2597 |
| 833 | Ga0495649_0052466 | 3300046694 | Bacteria | 2209 |
| 834 | Ga0495649_0064000 | 3300046694 | Bacteria | 1975 |
| 835 | Ga0495589_0000234 | 3300046794 | Bacteria | 46522 |
| 836 | Ga0495589_0000251 | 3300046794 | Bacteria | 43879 |
| 837 | Ga0495589_0000448 | 3300046794 | Bacteria | 30373 |
| 838 | Ga0495589_0009774 | 3300046794 | Bacteria | 4981 |
| 839 | Ga0495589_0013282 | 3300046794 | Bacteria | 4250 |
| 840 | Ga0495589_0013906 | 3300046794 | Bacteria | 4150 |
| 841 | Ga0495589_0016201 | 3300046794 | Bacteria | 3830 |
| 842 | Ga0495589_0031020 | 3300046794 | Bacteria | 2691 |
| 843 | Ga0495600_0339222 | 3300046809 | Bacteria | 942 |
| 844 | Ga0495660_0000876 | 3300046810 | Bacteria | 22242 |
| 845 | Ga0495660_0001193 | 3300046810 | Bacteria | 18236 |
| 846 | Ga0495660_0002216 | 3300046810 | Bacteria | 12514 |
| 847 | Ga0495660_0006833 | 3300046810 | Bacteria | 6724 |
| 848 | Ga0495660_0019752 | 3300046810 | Bacteria | 3866 |
| 849 | Ga0495660_0022562 | 3300046810 | Bacteria | 3593 |
| 850 | Ga0495660_0041553 | 3300046810 | Bacteria | 2545 |
| 851 | Ga0495660_0108570 | 3300046810 | Bacteria | 1418 |
| 852 | Ga0495660_0109801 | 3300046810 | Bacteria | 1408 |
| 853 | Ga0495581_0007024 | 3300047315 | Bacteria | 6526 |
| 854 | Ga0495604_0000559 | 3300047317 | Bacteria | 32736 |
| 855 | Ga0495604_0009001 | 3300047317 | Bacteria | 7896 |
| 856 | Ga0495636_0000899 | 3300047318 | Bacteria | 11042 |
| 857 | Ga0495674_0010426 | 3300047319 | Bacteria | 8800 |
| 858 | Ga0495672_0000210 | 3300047320 | Bacteria | 83349 |
| 859 | Ga0495672_0000796 | 3300047320 | Bacteria | 34103 |
| 860 | Ga0495672_0001891 | 3300047320 | Bacteria | 19913 |
| 861 | Ga0495672_0003926 | 3300047320 | Bacteria | 12475 |
| 862 | Ga0495672_0005049 | 3300047320 | Bacteria | 10550 |
| 863 | Ga0495672_0014284 | 3300047320 | Bacteria | 5444 |
| 864 | Ga0495672_0020951 | 3300047320 | Bacteria | 4272 |
| 865 | Ga0495672_0027957 | 3300047320 | Bacteria | 3576 |
| 866 | Ga0495672_0029012 | 3300047320 | Bacteria | 3491 |
| 867 | Ga0495672_0031558 | 3300047320 | Bacteria | 3306 |
| 868 | Ga0495672_0061979 | 3300047320 | Bacteria | 2153 |
| 869 | Ga0495672_0104020 | 3300047320 | Bacteria | 1535 |
| 870 | Ga0495676_0000001 | 3300047321 | Bacteria | 624167 |
| 871 | Ga0495676_0000572 | 3300047321 | Bacteria | 30227 |
| 872 | Ga0495676_0000985 | 3300047321 | Bacteria | 23912 |
| 873 | Ga0495680_0027877 | 3300047322 | Bacteria | 4634 |
| 874 | Ga0495680_0079138 | 3300047322 | Bacteria | 2486 |
| 875 | Ga0495683_0000037 | 3300047323 | Bacteria | 140632 |
| 876 | Ga0495683_0000042 | 3300047323 | Bacteria | 137528 |
| 877 | Ga0495683_0000111 | 3300047323 | Bacteria | 83676 |
| 878 | Ga0495683_0006727 | 3300047323 | Bacteria | 6263 |
| 879 | Ga0495683_0009353 | 3300047323 | Bacteria | 5220 |
| 880 | Ga0495683_0037417 | 3300047323 | Bacteria | 2460 |
| 881 | Ga0495683_0044004 | 3300047323 | Bacteria | 2245 |
| 882 | Ga0495683_0138236 | 3300047323 | Bacteria | 1143 |
| 883 | Ga0495683_0164316 | 3300047323 | Bacteria | 1024 |
| 884 | Ga0495687_010838 | 3300047443 | Bacteria | 4953 |
| 885 | Ga0495687_180251 | 3300047443 | Bacteria | 690 |
| 886 | Ga0495675_0029362 | 3300047444 | Bacteria | 3506 |
| 887 | Ga0495675_0066734 | 3300047444 | Bacteria | 2274 |
| 888 | Ga0495675_0161283 | 3300047444 | Bacteria | 1380 |
| 889 | Ga0495679_000015 | 3300047446 | Bacteria | 287256 |
| 890 | Ga0495679_000060 | 3300047446 | Bacteria | 109240 |
| 891 | Ga0495679_000064 | 3300047446 | Bacteria | 102509 |
| 892 | Ga0495679_000974 | 3300047446 | Bacteria | 17665 |
| 893 | Ga0495679_002792 | 3300047446 | Bacteria | 8684 |
| 894 | Ga0495679_003450 | 3300047446 | Bacteria | 7594 |
| 895 | Ga0495679_008712 | 3300047446 | Bacteria | 4104 |
| 896 | Ga0495679_036353 | 3300047446 | Bacteria | 1555 |
| 897 | Ga0495679_056549 | 3300047446 | Bacteria | 1162 |
| 898 | Ga0495685_009249 | 3300047447 | Bacteria | 3286 |
| 899 | Ga0495673_0000093 | 3300047469 | Bacteria | 185841 |
| 900 | Ga0495673_0000339 | 3300047469 | Bacteria | 59974 |
| 901 | Ga0495673_0001677 | 3300047469 | Bacteria | 17028 |
| 902 | Ga0495673_0001690 | 3300047469 | Bacteria | 16952 |
| 903 | Ga0495673_0001966 | 3300047469 | Bacteria | 15215 |
| 904 | Ga0495673_0004914 | 3300047469 | Bacteria | 8231 |
| 905 | Ga0495673_0007217 | 3300047469 | Bacteria | 6422 |
| 906 | Ga0495673_0008463 | 3300047469 | Bacteria | 5783 |
| 907 | Ga0495673_0010394 | 3300047469 | Bacteria | 5065 |
| 908 | Ga0495673_0019005 | 3300047469 | Bacteria | 3450 |
| 909 | Ga0495673_0021726 | 3300047469 | Bacteria | 3161 |
| 910 | Ga0495673_0062235 | 3300047469 | Bacteria | 1595 |
| 911 | Ga0495673_0075450 | 3300047469 | Bacteria | 1408 |
| 912 | Ga0495681_0000027 | 3300047470 | Bacteria | 141884 |
| 913 | Ga0495681_0000029 | 3300047470 | Bacteria | 134816 |
| 914 | Ga0495681_0000446 | 3300047470 | Bacteria | 31565 |
| 915 | Ga0495681_0002127 | 3300047470 | Bacteria | 14384 |
| 916 | Ga0495681_0002714 | 3300047470 | Bacteria | 12520 |
| 917 | Ga0495681_0003007 | 3300047470 | Bacteria | 11865 |
| 918 | Ga0495681_0003666 | 3300047470 | Bacteria | 10665 |
| 919 | Ga0495681_0004766 | 3300047470 | Bacteria | 9189 |
| 920 | Ga0495681_0005171 | 3300047470 | Bacteria | 8778 |
| 921 | Ga0495681_0005800 | 3300047470 | Bacteria | 8204 |
| 922 | Ga0495681_0007858 | 3300047470 | Bacteria | 6745 |
| 923 | Ga0495681_0010319 | 3300047470 | Bacteria | 5657 |
| 924 | Ga0495681_0019602 | 3300047470 | Bacteria | 3687 |
| 925 | Ga0495681_0041755 | 3300047470 | Bacteria | 2225 |
| 926 | Ga0495681_0067495 | 3300047470 | Bacteria | 1629 |
| 927 | Ga0495681_0104050 | 3300047470 | Bacteria | 1237 |
| 928 | Ga0495684_0014123 | 3300047471 | Bacteria | 6143 |
| 929 | Ga0495686_0000816 | 3300047472 | Bacteria | 40191 |
| 930 | Ga0495686_0001441 | 3300047472 | Bacteria | 25958 |
| 931 | Ga0495686_0005737 | 3300047472 | Bacteria | 9705 |
| 932 | Ga0495686_0007165 | 3300047472 | Bacteria | 8394 |
| 933 | Ga0495686_0051251 | 3300047472 | Bacteria | 2590 |
| 934 | Ga0495686_0100020 | 3300047472 | Bacteria | 1750 |
| 935 | Ga0495686_0100704 | 3300047472 | Bacteria | 1742 |
| 936 | Ga0495593_0001685 | 3300047673 | Bacteria | 13103 |
| 937 | Ga0495593_0032810 | 3300047673 | Bacteria | 2829 |
| 938 | Ga0495626_0000012 | 3300048091 | Bacteria | 258483 |
| 939 | Ga0495626_0000072 | 3300048091 | Bacteria | 134289 |
| 940 | Ga0495626_0000244 | 3300048091 | Bacteria | 63113 |
| 941 | Ga0495626_0000340 | 3300048091 | Bacteria | 49123 |
| 942 | Ga0495626_0000651 | 3300048091 | Bacteria | 33467 |
| 943 | Ga0495626_0015946 | 3300048091 | Bacteria | 3833 |
| 944 | Ga0495626_0020852 | 3300048091 | Bacteria | 3260 |
| 945 | Ga0495626_0114754 | 3300048091 | Bacteria | 1163 |
| 946 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 947 | Ga0496102_0008777 | 3300048905 | Bacteria | 8668 |
| 948 | Ga0496103_0085736 | 3300048906 | Bacteria | 1985 |
| 949 | Ga0496105_0141115 | 3300048908 | Bacteria | 1983 |
| 950 | Ga0496110_0016783 | 3300048913 | Bacteria | 6118 |
| 951 | Ga0496110_0210089 | 3300048913 | Bacteria | 1769 |
| 952 | Ga0496110_0292823 | 3300048913 | Bacteria | 1483 |
| 953 | Ga0496110_0923813 | 3300048913 | Bacteria | 779 |
| 954 | Ga0496111_0109636 | 3300048914 | Bacteria | 2032 |
| 955 | Ga0496111_0198650 | 3300048914 | Bacteria | 1491 |
| 956 | Ga0496116_0000697 | 3300048919 | Bacteria | 43533 |
| 957 | Ga0496116_0002982 | 3300048919 | Bacteria | 17203 |
| 958 | Ga0496116_0015222 | 3300048919 | Bacteria | 6092 |
| 959 | Ga0496116_0022132 | 3300048919 | Bacteria | 4776 |
| 960 | Ga0496116_0046944 | 3300048919 | Bacteria | 2911 |
| 961 | Ga0496117_0001093 | 3300048920 | Bacteria | 40952 |
| 962 | Ga0496117_0005893 | 3300048920 | Bacteria | 12663 |
| 963 | Ga0496117_0018770 | 3300048920 | Bacteria | 5712 |
| 964 | Ga0496118_0018132 | 3300048921 | Bacteria | 6366 |
| 965 | Ga0496118_0022197 | 3300048921 | Bacteria | 5559 |
| 966 | Ga0496119_0000086 | 3300048922 | Bacteria | 137053 |
| 967 | Ga0496119_0028309 | 3300048922 | Bacteria | 3827 |
| 968 | Ga0496120_0000130 | 3300048923 | Bacteria | 127368 |
| 969 | Ga0496121_0001263 | 3300048924 | Bacteria | 43703 |
| 970 | Ga0496121_0215892 | 3300048924 | Bacteria | 1355 |
| 971 | Ga0496121_0222138 | 3300048924 | Bacteria | 1330 |
| 972 | Ga0496122_0003361 | 3300048925 | Bacteria | 21087 |
| 973 | Ga0496122_0010190 | 3300048925 | Bacteria | 9740 |
| 974 | Ga0496122_0041006 | 3300048925 | Bacteria | 3669 |
| 975 | Ga0496122_0088144 | 3300048925 | Bacteria | 2128 |
| 976 | Ga0496122_0185175 | 3300048925 | Bacteria | 1236 |
| 977 | Ga0496123_0039802 | 3300048926 | Bacteria | 3283 |
| 978 | Ga0496123_0058461 | 3300048926 | Bacteria | 2500 |
| 979 | Ga0496123_0099789 | 3300048926 | Bacteria | 1694 |
| 980 | Ga0496124_0000047 | 3300048927 | Bacteria | 285554 |
| 981 | Ga0496124_0004248 | 3300048927 | Bacteria | 16859 |
| 982 | Ga0496124_0007750 | 3300048927 | Bacteria | 11344 |
| 983 | Ga0496124_0014485 | 3300048927 | Bacteria | 7624 |
| 984 | Ga0496124_0020742 | 3300048927 | Bacteria | 6065 |
| 985 | Ga0496124_0025442 | 3300048927 | Bacteria | 5361 |
| 986 | Ga0496124_0045681 | 3300048927 | Bacteria | 3754 |
| 987 | Ga0496124_0146923 | 3300048927 | Bacteria | 1854 |
| 988 | Ga0496125_0010352 | 3300048928 | Bacteria | 9435 |
| 989 | Ga0496125_0018094 | 3300048928 | Bacteria | 6697 |
| 990 | Ga0496125_0029276 | 3300048928 | Bacteria | 4953 |
| 991 | Ga0496125_0064848 | 3300048928 | Bacteria | 2899 |
| 992 | Ga0496125_0124374 | 3300048928 | Bacteria | 1831 |
| 993 | Ga0496125_0341934 | 3300048928 | Bacteria | 898 |
| 994 | Ga0496126_0003862 | 3300048929 | Bacteria | 18507 |
| 995 | Ga0496126_0005970 | 3300048929 | Bacteria | 13695 |
| 996 | Ga0496126_0115299 | 3300048929 | Bacteria | 2336 |
| 997 | Ga0495678_000009 | 3300049459 | Bacteria | 373806 |
| 998 | Ga0495678_000011 | 3300049459 | Bacteria | 335512 |
| 999 | Ga0495678_000485 | 3300049459 | Bacteria | 39446 |
| 1000 | Ga0495678_000707 | 3300049459 | Bacteria | 30373 |
| 1001 | Ga0495678_003056 | 3300049459 | Bacteria | 10627 |
| 1002 | Ga0495678_003070 | 3300049459 | Bacteria | 10596 |
| 1003 | Ga0495678_004617 | 3300049459 | Bacteria | 7905 |
| 1004 | Ga0495678_010366 | 3300049459 | Bacteria | 4536 |
| 1005 | Ga0495678_011349 | 3300049459 | Bacteria | 4268 |
| 1006 | Ga0495678_027553 | 3300049459 | Bacteria | 2410 |
| 1007 | Ga0495682_0000071 | 3300049460 | Bacteria | 93349 |
| 1008 | Ga0495682_0000709 | 3300049460 | Bacteria | 21844 |
| 1009 | Ga0501031_0037603 | 3300049568 | Bacteria | 3159 |
| 1010 | Ga0501031_0069145 | 3300049568 | Bacteria | 2300 |
| 1011 | Ga0501032_0032906 | 3300049569 | Bacteria | 3553 |
| 1012 | Ga0501033_0000969 | 3300049570 | Bacteria | 26048 |
| 1013 | Ga0501033_0467589 | 3300049570 | Bacteria | 875 |
| 1014 | Ga0501034_0000003 | 3300049571 | Bacteria | 471748 |
| 1015 | Ga0501034_0000275 | 3300049571 | Bacteria | 92805 |
| 1016 | Ga0501034_0096454 | 3300049571 | Bacteria | 2953 |
| 1017 | Ga0501036_0004776 | 3300049572 | Bacteria | 10943 |
| 1018 | Ga0501036_0088299 | 3300049572 | Bacteria | 2620 |
| 1019 | Ga0501036_0293862 | 3300049572 | Bacteria | 1359 |
| 1020 | Ga0501036_0372968 | 3300049572 | Bacteria | 1191 |
| 1021 | Ga0501038_0004135 | 3300049574 | Bacteria | 13511 |
| 1022 | Ga0501038_0017766 | 3300049574 | Bacteria | 6429 |
| 1023 | Ga0501038_0394117 | 3300049574 | Bacteria | 1072 |
| 1024 | Ga0501038_0493360 | 3300049574 | Bacteria | 937 |
| 1025 | Ga0501039_0000053 | 3300049575 | Bacteria | 94861 |
| 1026 | Ga0501039_0008307 | 3300049575 | Bacteria | 7911 |
| 1027 | Ga0501039_0031542 | 3300049575 | Bacteria | 4086 |
| 1028 | Ga0501039_0125835 | 3300049575 | Bacteria | 2010 |
| 1029 | Ga0501039_0217723 | 3300049575 | Bacteria | 1501 |
| 1030 | Ga0501039_0221580 | 3300049575 | Bacteria | 1487 |
| 1031 | Ga0501039_0276853 | 3300049575 | Bacteria | 1319 |
| 1032 | Ga0501040_0003435 | 3300049576 | Bacteria | 10226 |
| 1033 | Ga0501040_0035217 | 3300049576 | Bacteria | 3394 |
| 1034 | Ga0501040_0040334 | 3300049576 | Bacteria | 3177 |
| 1035 | Ga0501040_0164117 | 3300049576 | Bacteria | 1571 |
| 1036 | Ga0501040_0209964 | 3300049576 | Bacteria | 1384 |
| 1037 | Ga0501041_0000066 | 3300049577 | Bacteria | 39606 |
| 1038 | Ga0501041_0017023 | 3300049577 | Bacteria | 4325 |
| 1039 | Ga0501041_0041248 | 3300049577 | Bacteria | 2803 |
| 1040 | Ga0501042_0031363 | 3300049578 | Bacteria | 3759 |
| 1041 | Ga0501042_0079068 | 3300049578 | Bacteria | 2355 |
| 1042 | Ga0501042_0140113 | 3300049578 | Bacteria | 1744 |
| 1043 | Ga0501042_0149922 | 3300049578 | Bacteria | 1681 |
| 1044 | Ga0501042_0356778 | 3300049578 | Bacteria | 1058 |
| 1045 | Ga0501046_0000927 | 3300049580 | Bacteria | 28785 |
| 1046 | Ga0501046_0071810 | 3300049580 | Bacteria | 2688 |
| 1047 | Ga0501046_0115867 | 3300049580 | Bacteria | 2043 |
| 1048 | Ga0501046_0497252 | 3300049580 | Bacteria | 874 |
| 1049 | Ga0501047_0082765 | 3300049581 | Bacteria | 3085 |
| 1050 | Ga0501048_0000221 | 3300049582 | Bacteria | 37331 |
| 1051 | Ga0501048_0055627 | 3300049582 | Bacteria | 2808 |
| 1052 | Ga0501048_0197774 | 3300049582 | Bacteria | 1425 |
| 1053 | Ga0501068_0007404 | 3300049584 | Bacteria | 6077 |
| 1054 | Ga0501068_0038019 | 3300049584 | Bacteria | 2882 |
| 1055 | Ga0501071_0001262 | 3300049587 | Bacteria | 14342 |
| 1056 | Ga0501071_0029242 | 3300049587 | Bacteria | 3888 |
| 1057 | Ga0501071_0258703 | 3300049587 | Bacteria | 1314 |
| 1058 | Ga0501071_0401295 | 3300049587 | Bacteria | 1047 |
| 1059 | Ga0501072_0000105 | 3300049588 | Bacteria | 62421 |
| 1060 | Ga0501072_0010513 | 3300049588 | Bacteria | 7047 |
| 1061 | Ga0501072_0013608 | 3300049588 | Bacteria | 6229 |
| 1062 | Ga0501072_0046099 | 3300049588 | Bacteria | 3430 |
| 1063 | Ga0501072_0159857 | 3300049588 | Bacteria | 1797 |
| 1064 | Ga0501072_0353543 | 3300049588 | Bacteria | 1166 |
| 1065 | Ga0501072_0530306 | 3300049588 | Bacteria | 930 |
| 1066 | Ga0501074_0027924 | 3300049590 | Bacteria | 4090 |
| 1067 | Ga0501074_0110725 | 3300049590 | Bacteria | 1965 |
| 1068 | Ga0501074_0122338 | 3300049590 | Bacteria | 1861 |
| 1069 | Ga0501075_0001570 | 3300049591 | Bacteria | 14931 |
| 1070 | Ga0501075_0002056 | 3300049591 | Bacteria | 13320 |
| 1071 | Ga0501075_0063036 | 3300049591 | Bacteria | 2795 |
| 1072 | Ga0501075_0253005 | 3300049591 | Bacteria | 1343 |
| 1073 | Ga0501076_0002055 | 3300049592 | Bacteria | 13788 |
| 1074 | Ga0501076_0003744 | 3300049592 | Bacteria | 10690 |
| 1075 | Ga0501076_0145000 | 3300049592 | Bacteria | 1930 |
| 1076 | Ga0501076_0205395 | 3300049592 | Bacteria | 1609 |
| 1077 | Ga0501076_0727295 | 3300049592 | Bacteria | 819 |
| 1078 | Ga0501077_0000154 | 3300049593 | Bacteria | 38428 |
| 1079 | Ga0501077_0045047 | 3300049593 | Bacteria | 2802 |
| 1080 | Ga0501222_009074 | 3300049662 | Bacteria | 1316 |
| 1081 | Ga0501079_0001492 | 3300049741 | Bacteria | 16563 |
| 1082 | Ga0501079_0005056 | 3300049741 | Bacteria | 9790 |
| 1083 | Ga0501079_0095884 | 3300049741 | Bacteria | 2299 |
| 1084 | Ga0501079_0324347 | 3300049741 | Bacteria | 1206 |
| 1085 | Ga0501080_0018328 | 3300049742 | Bacteria | 6479 |
| 1086 | Ga0501081_0000630 | 3300049743 | Bacteria | 20114 |
| 1087 | Ga0501081_0011713 | 3300049743 | Bacteria | 5740 |
| 1088 | Ga0501081_0051193 | 3300049743 | Bacteria | 2848 |
| 1089 | Ga0501081_0170281 | 3300049743 | Bacteria | 1572 |
| 1090 | Ga0501081_0201216 | 3300049743 | Bacteria | 1444 |
| 1091 | Ga0501083_0027575 | 3300049744 | Bacteria | 3919 |
| 1092 | Ga0501083_0263849 | 3300049744 | Bacteria | 1120 |
| 1093 | Ga0501265_001431 | 3300049762 | Bacteria | 2705 |
| 1094 | Ga0501275_000169 | 3300049772 | Bacteria | 7475 |
| 1095 | Ga0501282_013452 | 3300049778 | Bacteria | 886 |
| 1096 | Ga0501035_0160164 | 3300049822 | Bacteria | 1949 |
| 1097 | Ga0501045_0000451 | 3300049824 | Bacteria | 25372 |
| 1098 | Ga0501045_0037692 | 3300049824 | Bacteria | 3515 |
| 1099 | Ga0501045_0068120 | 3300049824 | Bacteria | 2614 |
| 1100 | Ga0501045_0126348 | 3300049824 | Bacteria | 1900 |
| 1101 | Ga0501226_000007 | 3300049853 | Bacteria | 227827 |
| 1102 | nmdc:mga03683_20590_c1 | 3300050489 | Bacteria | 2533 |
| 1103 | nmdc:mga00v17_376756_c1 | 3300050491 | Bacteria | 923 |
| 1104 | nmdc:mga00v17_44145_c1 | 3300050491 | Bacteria | 2687 |
| 1105 | nmdc:mga00v17_45937_c1 | 3300050491 | Bacteria | 2641 |
| 1106 | nmdc:mga09592_263119_c1 | 3300050508 | Bacteria | 1496 |
| 1107 | nmdc:mga09592_40386_c1 | 3300050508 | Bacteria | 3920 |
| 1108 | nmdc:mga0qj67_29192_c1 | 3300050509 | Bacteria | 4283 |
| 1109 | nmdc:mga0qj67_85155_c1 | 3300050509 | Bacteria | 2535 |
| 1110 | nmdc:mga06r32_36532_c1 | 3300050510 | Bacteria | 4643 |
| 1111 | nmdc:mga06r32_690_c1 | 3300050510 | Bacteria | 29444 |
| 1112 | nmdc:mga08y16_37071_c1 | 3300050511 | Bacteria | 5120 |
| 1113 | nmdc:mga08y16_830555_c1 | 3300050511 | Unclassified | 915 |
| 1114 | nmdc:mga08x19_107900_c1 | 3300050514 | Bacteria | 1854 |
| 1115 | nmdc:mga0sz30_30318_c1 | 3300050516 | Bacteria | 2234 |
| 1116 | Ga0500610_0188454 | 3300053079 | Bacteria | 1004 |
| 1117 | Ga0500659_0000004 | 3300053135 | Bacteria | 99715 |
| 1118 | Ga0500568_0000504 | 3300053139 | Bacteria | 28743 |
| 1119 | Ga0500573_0006243 | 3300053140 | Bacteria | 6431 |
| 1120 | Ga0501084_0000671 | 3300054114 | Bacteria | 26137 |
| 1121 | Ga0501084_0008454 | 3300054114 | Bacteria | 8510 |
| 1122 | Ga0501084_0075142 | 3300054114 | Bacteria | 2831 |
| 1123 | Ga0590077_024857 | 3300059426 | Bacteria | 1288 |
| 1124 | Ga0501082_0008513 | 3300060353 | Bacteria | 8846 |
| 1125 | Ga0501082_0024222 | 3300060353 | Bacteria | 5234 |
| 1126 | Ga0501082_0130689 | 3300060353 | Bacteria | 2179 |
| 1127 | Ga0530510_0001614 | 3300061734 | Bacteria | 15223 |
| 1128 | Ga0530510_0028930 | 3300061734 | Bacteria | 3974 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042001 | Ga0439441_069068 | Ga0439441_069068_192_725 | 176 |
| 2 | 3300027665 | Ga0209983_1036744 | Ga0209983_10367441 | 184 |
| 3 | iso_pu_bacteria | 2511231022 | 2511362767 | 187 |
| 4 | 3300047443 | Ga0495687_180251 | Ga0495687_180251_96_677 | 193 |
| 5 | 3300049570 | Ga0501033_0467589 | Ga0501033_0467589_36_695 | 198 |
| 6 | 3300042125 | Ga0450923_007230 | Ga0450923_007230_311_919 | 200 |
| 7 | 3300042530 | Ga0450916_000452 | Ga0450916_000452_2895_3509 | 202 |
| 8 | 3300048928 | Ga0496125_0124374 | Ga0496125_0124374_1199_1807 | 202 |
| 9 | 3300049743 | Ga0501081_0201216 | Ga0501081_0201216_496_1125 | 203 |
| 10 | 3300048920 | Ga0496117_0018770 | Ga0496117_0018770_20_643 | 207 |
| 11 | 3300009148 | Ga0105243_10002867 | Ga0105243_100028675 | 210 |
| 12 | 3300015265 | Ga0182005_1010131 | Ga0182005_10101314 | 210 |
| 13 | 3300025935 | Ga0207709_10056469 | Ga0207709_100564692 | 210 |
| 14 | 3300048921 | Ga0496118_0022197 | Ga0496118_0022197_4390_5067 | 210 |
| 15 | 3300048929 | Ga0496126_0005970 | Ga0496126_0005970_5721_6398 | 210 |
| 16 | 3300025728 | Ga0207655_1017660 | Ga0207655_10176602 | 212 |
| 17 | 3300046517 | Ga0495630_0560957 | Ga0495630_0560957_18_662 | 212 |
| 18 | 3300005336 | Ga0070680_100014625 | Ga0070680_1000146252 | 213 |
| 19 | 3300005345 | Ga0070692_10014293 | Ga0070692_100142932 | 213 |
| 20 | 3300005440 | Ga0070705_100018250 | Ga0070705_1000182504 | 213 |
| 21 | 3300005444 | Ga0070694_100010869 | Ga0070694_1000108697 | 213 |
| 22 | 3300005471 | Ga0070698_100544295 | Ga0070698_1005442952 | 213 |
| 23 | 3300005545 | Ga0070695_100094224 | Ga0070695_1000942242 | 213 |
| 24 | 3300005546 | Ga0070696_100100258 | Ga0070696_1001002582 | 213 |
| 25 | 3300006844 | Ga0075428_100127125 | Ga0075428_1001271252 | 213 |
| 26 | 3300006846 | Ga0075430_100009781 | Ga0075430_1000097813 | 213 |
| 27 | 3300006846 | Ga0075430_100012611 | Ga0075430_1000126114 | 213 |
| 28 | 3300006847 | Ga0075431_100014326 | Ga0075431_1000143268 | 213 |
| 29 | 3300006880 | Ga0075429_100017386 | Ga0075429_1000173864 | 213 |
| 30 | 3300009147 | Ga0114129_10128597 | Ga0114129_101285975 | 213 |
| 31 | 3300025917 | Ga0207660_10014715 | Ga0207660_100147155 | 213 |
| 32 | 3300027471 | Ga0209995_1007422 | Ga0209995_10074223 | 213 |
| 33 | 3300027695 | Ga0209966_1013396 | Ga0209966_10133963 | 213 |
| 34 | 3300031548 | Ga0307408_100125860 | Ga0307408_1001258602 | 213 |
| 35 | 3300041410 | Ga0439461_0006726 | Ga0439461_0006726_411_1058 | 213 |
| 36 | 3300042001 | Ga0439441_000448 | Ga0439441_000448_3560_4204 | 213 |
| 37 | 3300042014 | Ga0439457_035433 | Ga0439457_035433_197_841 | 213 |
| 38 | 3300042435 | Ga0439434_0000831 | Ga0439434_0000831_4385_5032 | 213 |
| 39 | 3300042436 | Ga0439435_0000108 | Ga0439435_0000108_4637_5281 | 213 |
| 40 | 3300042436 | Ga0439435_0001905 | Ga0439435_0001905_984_1631 | 213 |
| 41 | 3300042437 | Ga0439444_0013238 | Ga0439444_0013238_704_1348 | 213 |
| 42 | 3300042461 | Ga0439460_0013355 | Ga0439460_0013355_1204_1848 | 213 |
| 43 | 3300042461 | Ga0439460_0014794 | Ga0439460_0014794_105_749 | 213 |
| 44 | 3300049568 | Ga0501031_0037603 | Ga0501031_0037603_1545_2204 | 213 |
| 45 | 3300049568 | Ga0501031_0069145 | Ga0501031_0069145_1625_2284 | 213 |
| 46 | 3300049569 | Ga0501032_0032906 | Ga0501032_0032906_640_1299 | 213 |
| 47 | 3300049570 | Ga0501033_0000969 | Ga0501033_0000969_11617_12276 | 213 |
| 48 | 3300049572 | Ga0501036_0004776 | Ga0501036_0004776_9747_10406 | 213 |
| 49 | 3300049572 | Ga0501036_0088299 | Ga0501036_0088299_1524_2168 | 213 |
| 50 | 3300049572 | Ga0501036_0293862 | Ga0501036_0293862_236_880 | 213 |
| 51 | 3300049572 | Ga0501036_0372968 | Ga0501036_0372968_507_1151 | 213 |
| 52 | 3300049574 | Ga0501038_0004135 | Ga0501038_0004135_10720_11379 | 213 |
| 53 | 3300049575 | Ga0501039_0000053 | Ga0501039_0000053_16204_16863 | 213 |
| 54 | 3300049575 | Ga0501039_0008307 | Ga0501039_0008307_4082_4726 | 213 |
| 55 | 3300049575 | Ga0501039_0031542 | Ga0501039_0031542_1512_2156 | 213 |
| 56 | 3300049575 | Ga0501039_0125835 | Ga0501039_0125835_648_1292 | 213 |
| 57 | 3300049575 | Ga0501039_0221580 | Ga0501039_0221580_670_1314 | 213 |
| 58 | 3300049575 | Ga0501039_0276853 | Ga0501039_0276853_128_772 | 213 |
| 59 | 3300049576 | Ga0501040_0003435 | Ga0501040_0003435_6845_7504 | 213 |
| 60 | 3300049576 | Ga0501040_0035217 | Ga0501040_0035217_1153_1797 | 213 |
| 61 | 3300049576 | Ga0501040_0040334 | Ga0501040_0040334_1965_2609 | 213 |
| 62 | 3300049576 | Ga0501040_0209964 | Ga0501040_0209964_310_954 | 213 |
| 63 | 3300049577 | Ga0501041_0000066 | Ga0501041_0000066_25193_25852 | 213 |
| 64 | 3300049577 | Ga0501041_0017023 | Ga0501041_0017023_231_875 | 213 |
| 65 | 3300049577 | Ga0501041_0041248 | Ga0501041_0041248_1197_1841 | 213 |
| 66 | 3300049578 | Ga0501042_0031363 | Ga0501042_0031363_2541_3200 | 213 |
| 67 | 3300049578 | Ga0501042_0079068 | Ga0501042_0079068_1229_1873 | 213 |
| 68 | 3300049578 | Ga0501042_0140113 | Ga0501042_0140113_424_1083 | 213 |
| 69 | 3300049578 | Ga0501042_0149922 | Ga0501042_0149922_273_917 | 213 |
| 70 | 3300049580 | Ga0501046_0000927 | Ga0501046_0000927_17350_18009 | 213 |
| 71 | 3300049580 | Ga0501046_0071810 | Ga0501046_0071810_1206_1850 | 213 |
| 72 | 3300049580 | Ga0501046_0115867 | Ga0501046_0115867_468_1127 | 213 |
| 73 | 3300049580 | Ga0501046_0497252 | Ga0501046_0497252_74_718 | 213 |
| 74 | 3300049581 | Ga0501047_0082765 | Ga0501047_0082765_119_778 | 213 |
| 75 | 3300049582 | Ga0501048_0000221 | Ga0501048_0000221_33736_34395 | 213 |
| 76 | 3300049582 | Ga0501048_0055627 | Ga0501048_0055627_868_1512 | 213 |
| 77 | 3300049582 | Ga0501048_0197774 | Ga0501048_0197774_436_1080 | 213 |
| 78 | 3300049584 | Ga0501068_0007404 | Ga0501068_0007404_729_1388 | 213 |
| 79 | 3300049587 | Ga0501071_0001262 | Ga0501071_0001262_12954_13613 | 213 |
| 80 | 3300049587 | Ga0501071_0258703 | Ga0501071_0258703_642_1286 | 213 |
| 81 | 3300049587 | Ga0501071_0401295 | Ga0501071_0401295_30_689 | 213 |
| 82 | 3300049588 | Ga0501072_0000105 | Ga0501072_0000105_16138_16797 | 213 |
| 83 | 3300049588 | Ga0501072_0013608 | Ga0501072_0013608_125_769 | 213 |
| 84 | 3300049588 | Ga0501072_0046099 | Ga0501072_0046099_708_1367 | 213 |
| 85 | 3300049588 | Ga0501072_0353543 | Ga0501072_0353543_461_1105 | 213 |
| 86 | 3300049588 | Ga0501072_0530306 | Ga0501072_0530306_237_881 | 213 |
| 87 | 3300049590 | Ga0501074_0027924 | Ga0501074_0027924_324_983 | 213 |
| 88 | 3300049590 | Ga0501074_0122338 | Ga0501074_0122338_771_1415 | 213 |
| 89 | 3300049591 | Ga0501075_0001570 | Ga0501075_0001570_1274_1918 | 213 |
| 90 | 3300049591 | Ga0501075_0002056 | Ga0501075_0002056_2723_3382 | 213 |
| 91 | 3300049591 | Ga0501075_0063036 | Ga0501075_0063036_1897_2541 | 213 |
| 92 | 3300049592 | Ga0501076_0002055 | Ga0501076_0002055_5653_6312 | 213 |
| 93 | 3300049592 | Ga0501076_0003744 | Ga0501076_0003744_6687_7331 | 213 |
| 94 | 3300049592 | Ga0501076_0145000 | Ga0501076_0145000_564_1223 | 213 |
| 95 | 3300049593 | Ga0501077_0000154 | Ga0501077_0000154_9441_10100 | 213 |
| 96 | 3300049593 | Ga0501077_0045047 | Ga0501077_0045047_780_1424 | 213 |
| 97 | 3300049741 | Ga0501079_0001492 | Ga0501079_0001492_13773_14432 | 213 |
| 98 | 3300049741 | Ga0501079_0005056 | Ga0501079_0005056_5424_6068 | 213 |
| 99 | 3300049743 | Ga0501081_0000630 | Ga0501081_0000630_12611_13270 | 213 |
| 100 | 3300049743 | Ga0501081_0011713 | Ga0501081_0011713_3186_3830 | 213 |
| 101 | 3300049743 | Ga0501081_0051193 | Ga0501081_0051193_1420_2064 | 213 |
| 102 | 3300049744 | Ga0501083_0027575 | Ga0501083_0027575_576_1235 | 213 |
| 103 | 3300049744 | Ga0501083_0263849 | Ga0501083_0263849_47_691 | 213 |
| 104 | 3300049822 | Ga0501035_0160164 | Ga0501035_0160164_322_966 | 213 |
| 105 | 3300049824 | Ga0501045_0000451 | Ga0501045_0000451_6845_7504 | 213 |
| 106 | 3300049824 | Ga0501045_0037692 | Ga0501045_0037692_2102_2761 | 213 |
| 107 | 3300049824 | Ga0501045_0068120 | Ga0501045_0068120_318_962 | 213 |
| 108 | 3300049824 | Ga0501045_0126348 | Ga0501045_0126348_134_778 | 213 |
| 109 | 3300050508 | nmdc:mga09592_40386_c1 | nmdc:mga09592_40386_c1_519_1163 | 213 |
| 110 | 3300050509 | nmdc:mga0qj67_29192_c1 | nmdc:mga0qj67_29192_c1_181_840 | 213 |
| 111 | 3300050510 | nmdc:mga06r32_36532_c1 | nmdc:mga06r32_36532_c1_1335_1979 | 213 |
| 112 | 3300054114 | Ga0501084_0000671 | Ga0501084_0000671_16172_16831 | 213 |
| 113 | 3300054114 | Ga0501084_0008454 | Ga0501084_0008454_5412_6056 | 213 |
| 114 | 3300054114 | Ga0501084_0075142 | Ga0501084_0075142_1132_1791 | 213 |
| 115 | 3300059426 | Ga0590077_024857 | Ga0590077_024857_23_667 | 213 |
| 116 | 3300060353 | Ga0501082_0008513 | Ga0501082_0008513_2078_2737 | 213 |
| 117 | 3300060353 | Ga0501082_0024222 | Ga0501082_0024222_1089_1733 | 213 |
| 118 | 3300060353 | Ga0501082_0130689 | Ga0501082_0130689_708_1367 | 213 |
| 119 | 3300061734 | Ga0530510_0001614 | Ga0530510_0001614_3128_3772 | 213 |
| 120 | 3300061734 | Ga0530510_0028930 | Ga0530510_0028930_2269_2928 | 213 |
| 121 | iso_pu_bacteria | 2600254954 | 2600446923 | 213 |
| 122 | iso_pu_bacteria | 2600255389 | 2602010186 | 213 |
| 123 | iso_pu_bacteria | 2823421272 | 2823422709 | 213 |
| 124 | iso_pu_bacteria | 2919493220 | 2919493933 | 213 |
| 125 | iso_pu_bacteria | 2919543075 | 2919545814 | 213 |
| 126 | iso_pu_bacteria | 2923525760 | 2923527526 | 213 |
| 127 | iso_pu_bacteria | 8034962539 | 8034966151 | 213 |
| 128 | 3300035398 | Ga0316574_0002215 | Ga0316574_0002215_2493_3146 | 214 |
| 129 | 3300036647 | Ga0316582_0010867 | Ga0316582_0010867_2863_3516 | 214 |
| 130 | 3300031727 | Ga0316576_10009168 | Ga0316576_100091684 | 215 |
| 131 | 3300031728 | Ga0316578_10029071 | Ga0316578_100290712 | 215 |
| 132 | 3300032002 | Ga0307416_100293500 | Ga0307416_1002935002 | 215 |
| 133 | iso_pu_bacteria | 2643221581 | 2643914663 | 216 |
| 134 | iso_pu_bacteria | 2808606379 | 2808942540 | 216 |
| 135 | iso_pu_bacteria | 2842391507 | 2842392255 | 216 |
| 136 | iso_pu_bacteria | 2852684882 | 2852687069 | 216 |
| 137 | iso_pu_bacteria | 2923516293 | 2923517119 | 216 |
| 138 | iso_pu_bacteria | 2990196909 | 2990198397 | 216 |
| 139 | iso_pu_bacteria | 8021622325 | 8021624947 | 216 |
| 140 | iso_pu_bacteria | 8021626552 | 8021626790 | 216 |
| 141 | iso_pu_bacteria | 8021648035 | 8021650056 | 216 |
| 142 | 3300031548 | Ga0307408_100000047 | Ga0307408_10000004789 | 217 |
| 143 | 3300042439 | Ga0439464_0000770 | Ga0439464_0000770_2432_3091 | 217 |
| 144 | iso_pu_bacteria | 2728369097 | 2729145016 | 217 |
| 145 | iso_pu_bacteria | 640427133 | 640486867 | 217 |
| 146 | iso_pu_bacteria | 651053060 | 651174723 | 217 |
| 147 | 3300031616 | Ga0307508_10078052 | Ga0307508_100780522 | 218 |
| 148 | 3300036647 | Ga0316582_0058437 | Ga0316582_0058437_43_699 | 218 |
| 149 | 3300036712 | Ga0316584_0114042 | Ga0316584_0114042_1058_1714 | 218 |
| 150 | 3300049574 | Ga0501038_0017766 | Ga0501038_0017766_4171_4827 | 218 |
| 151 | iso_pu_bacteria | 2984568884 | 2984569972 | 218 |
| 152 | 3300005334 | Ga0068869_100432542 | Ga0068869_1004325422 | 219 |
| 153 | 3300005335 | Ga0070666_10011793 | Ga0070666_100117935 | 219 |
| 154 | 3300005344 | Ga0070661_100011542 | Ga0070661_1000115422 | 219 |
| 155 | 3300005347 | Ga0070668_100001244 | Ga0070668_10000124410 | 219 |
| 156 | 3300005355 | Ga0070671_100205240 | Ga0070671_1002052402 | 219 |
| 157 | 3300005455 | Ga0070663_100009462 | Ga0070663_1000094627 | 219 |
| 158 | 3300005539 | Ga0068853_100608259 | Ga0068853_1006082592 | 219 |
| 159 | 3300005563 | Ga0068855_100059513 | Ga0068855_1000595133 | 219 |
| 160 | 3300005564 | Ga0070664_100014557 | Ga0070664_1000145575 | 219 |
| 161 | 3300005577 | Ga0068857_100219116 | Ga0068857_1002191162 | 219 |
| 162 | 3300005614 | Ga0068856_100005484 | Ga0068856_1000054847 | 219 |
| 163 | 3300005616 | Ga0068852_100016445 | Ga0068852_1000164452 | 219 |
| 164 | 3300005617 | Ga0068859_100724752 | Ga0068859_1007247522 | 219 |
| 165 | 3300005618 | Ga0068864_100101506 | Ga0068864_1001015061 | 219 |
| 166 | 3300005841 | Ga0068863_100112621 | Ga0068863_1001126212 | 219 |
| 167 | 3300005842 | Ga0068858_100018150 | Ga0068858_1000181507 | 219 |
| 168 | 3300005843 | Ga0068860_100049041 | Ga0068860_1000490416 | 219 |
| 169 | 3300006237 | Ga0097621_100229426 | Ga0097621_1002294262 | 219 |
| 170 | 3300006358 | Ga0068871_100084532 | Ga0068871_1000845322 | 219 |
| 171 | 3300006881 | Ga0068865_100006683 | Ga0068865_1000066836 | 219 |
| 172 | 3300006931 | Ga0097620_100724861 | Ga0097620_1007248612 | 219 |
| 173 | 3300009093 | Ga0105240_10186568 | Ga0105240_101865683 | 219 |
| 174 | 3300009093 | Ga0105240_10890075 | Ga0105240_108900752 | 219 |
| 175 | 3300009101 | Ga0105247_10112543 | Ga0105247_101125432 | 219 |
| 176 | 3300009177 | Ga0105248_10043825 | Ga0105248_100438256 | 219 |
| 177 | 3300009545 | Ga0105237_10177519 | Ga0105237_101775193 | 219 |
| 178 | 3300009551 | Ga0105238_10192285 | Ga0105238_101922852 | 219 |
| 179 | 3300010375 | Ga0105239_10037499 | Ga0105239_100374996 | 219 |
| 180 | 3300013296 | Ga0157374_10037667 | Ga0157374_100376675 | 219 |
| 181 | 3300013307 | Ga0157372_10026527 | Ga0157372_100265274 | 219 |
| 182 | 3300014325 | Ga0163163_10104001 | Ga0163163_101040012 | 219 |
| 183 | 3300025900 | Ga0207710_10114076 | Ga0207710_101140762 | 219 |
| 184 | 3300025903 | Ga0207680_10400830 | Ga0207680_104008302 | 219 |
| 185 | 3300025904 | Ga0207647_10067925 | Ga0207647_100679251 | 219 |
| 186 | 3300025931 | Ga0207644_10030980 | Ga0207644_100309803 | 219 |
| 187 | 3300025941 | Ga0207711_10594429 | Ga0207711_105944292 | 219 |
| 188 | 3300025942 | Ga0207689_10123987 | Ga0207689_101239874 | 219 |
| 189 | 3300025949 | Ga0207667_10698138 | Ga0207667_106981382 | 219 |
| 190 | 3300025960 | Ga0207651_10413336 | Ga0207651_104133361 | 219 |
| 191 | 3300025972 | Ga0207668_10000866 | Ga0207668_100008669 | 219 |
| 192 | 3300026023 | Ga0207677_10116517 | Ga0207677_101165173 | 219 |
| 193 | 3300026035 | Ga0207703_10127412 | Ga0207703_101274123 | 219 |
| 194 | 3300026041 | Ga0207639_10170170 | Ga0207639_101701702 | 219 |
| 195 | 3300026067 | Ga0207678_10014112 | Ga0207678_100141127 | 219 |
| 196 | 3300026088 | Ga0207641_10059699 | Ga0207641_100596994 | 219 |
| 197 | 3300026116 | Ga0207674_10014157 | Ga0207674_100141572 | 219 |
| 198 | 3300026142 | Ga0207698_10083754 | Ga0207698_100837542 | 219 |
| 199 | 3300028381 | Ga0268264_10183688 | Ga0268264_101836882 | 219 |
| 200 | 3300028653 | Ga0265323_10011964 | Ga0265323_100119645 | 219 |
| 201 | 3300031344 | Ga0265316_10029947 | Ga0265316_100299474 | 219 |
| 202 | 3300031344 | Ga0265316_10062393 | Ga0265316_100623931 | 219 |
| 203 | 3300031344 | Ga0265316_10096499 | Ga0265316_100964993 | 219 |
| 204 | 3300031344 | Ga0265316_10100443 | Ga0265316_101004433 | 219 |
| 205 | 3300031616 | Ga0307508_10203368 | Ga0307508_102033682 | 219 |
| 206 | 3300031711 | Ga0265314_10182434 | Ga0265314_101824342 | 219 |
| 207 | 3300032133 | Ga0316583_10001608 | Ga0316583_100016088 | 219 |
| 208 | 3300035092 | Ga0373952_0000171 | Ga0373952_0000171_4728_5387 | 219 |
| 209 | 3300035116 | Ga0373945_0141493 | Ga0373945_0141493_34_693 | 219 |
| 210 | 3300035121 | Ga0373960_0003863 | Ga0373960_0003863_1047_1706 | 219 |
| 211 | 3300041411 | Ga0439466_0002518 | Ga0439466_0002518_4586_5251 | 219 |
| 212 | 3300044712 | Ga0453684_0002778 | Ga0453684_0002778_6348_7007 | 219 |
| 213 | 3300045051 | Ga0451576_0084912 | Ga0451576_0084912_428_1087 | 219 |
| 214 | 3300048928 | Ga0496125_0341934 | Ga0496125_0341934_184_843 | 219 |
| 215 | 3300053139 | Ga0500568_0000504 | Ga0500568_0000504_24465_25124 | 219 |
| 216 | iso_pu_bacteria | 8055878733 | 8055882996 | 219 |
| 217 | 2162886007 | SwRhRL2b_contig_1398382 | SwRhRL2b_0147.00006300 | 220 |
| 218 | 3300003781 | Ga0055536_1004947 | Ga0055536_10049474 | 220 |
| 219 | 3300005289 | Ga0065704_10070749 | Ga0065704_100707496 | 220 |
| 220 | 3300005548 | Ga0070665_100217303 | Ga0070665_1002173032 | 220 |
| 221 | 3300006846 | Ga0075430_100096463 | Ga0075430_1000964632 | 220 |
| 222 | 3300006847 | Ga0075431_100005495 | Ga0075431_10000549515 | 220 |
| 223 | 3300009177 | Ga0105248_10725386 | Ga0105248_107253862 | 220 |
| 224 | 3300025292 | Ga0209676_1000068 | Ga0209676_1000068254 | 220 |
| 225 | 3300025292 | Ga0209676_1021986 | Ga0209676_10219862 | 220 |
| 226 | 3300025298 | Ga0209050_1048449 | Ga0209050_10484492 | 220 |
| 227 | 3300042156 | Ga0439446_0000066 | Ga0439446_0000066_14631_15299 | 220 |
| 228 | 3300046499 | Ga0495594_0307820 | Ga0495594_0307820_95_763 | 220 |
| 229 | 3300047322 | Ga0495680_0079138 | Ga0495680_0079138_1503_2171 | 220 |
| 230 | 3300048925 | Ga0496122_0041006 | Ga0496122_0041006_962_1657 | 220 |
| 231 | 3300048926 | Ga0496123_0058461 | Ga0496123_0058461_972_1667 | 220 |
| 232 | 3300048928 | Ga0496125_0018094 | Ga0496125_0018094_149_823 | 220 |
| 233 | 3300049571 | Ga0501034_0000275 | Ga0501034_0000275_48100_48774 | 220 |
| 234 | 3300049762 | Ga0501265_001431 | Ga0501265_001431_573_1316 | 220 |
| 235 | 3300049772 | Ga0501275_000169 | Ga0501275_000169_2968_3711 | 220 |
| 236 | 3300050509 | nmdc:mga0qj67_85155_c1 | nmdc:mga0qj67_85155_c1_402_1067 | 220 |
| 237 | 3300050510 | nmdc:mga06r32_690_c1 | nmdc:mga06r32_690_c1_21932_22597 | 220 |
| 238 | iso_pu_bacteria | 2510065053 | 2510282939 | 220 |
| 239 | iso_pu_bacteria | 2510065055 | 2510293613 | 220 |
| 240 | iso_pu_bacteria | 2510065058 | 2510310781 | 220 |
| 241 | iso_pu_bacteria | 2511231006 | 2511265462 | 220 |
| 242 | iso_pu_bacteria | 2511231008 | 2511278231 | 220 |
| 243 | iso_pu_bacteria | 2511231012 | 2511304116 | 220 |
| 244 | iso_pu_bacteria | 2511231018 | 2511337894 | 220 |
| 245 | iso_pu_bacteria | 2511231019 | 2511343808 | 220 |
| 246 | iso_pu_bacteria | 2511231021 | 2511357712 | 220 |
| 247 | iso_pu_bacteria | 2511231031 | 2511411906 | 220 |
| 248 | iso_pu_bacteria | 2511231156 | 2511825067 | 220 |
| 249 | iso_pu_bacteria | 2512047018 | 2512327282 | 220 |
| 250 | iso_pu_bacteria | 2554235231 | 2555248493 | 220 |
| 251 | iso_pu_bacteria | 2582580891 | 2583792473 | 220 |
| 252 | iso_pu_bacteria | 2599185155 | 2599330257 | 220 |
| 253 | iso_pu_bacteria | 2599185188 | 2599501586 | 220 |
| 254 | iso_pu_bacteria | 2599185212 | 2599611760 | 220 |
| 255 | iso_pu_bacteria | 2599185248 | 2599768906 | 220 |
| 256 | iso_pu_bacteria | 2599185288 | 2599881389 | 220 |
| 257 | iso_pu_bacteria | 2599185289 | 2599884690 | 220 |
| 258 | iso_pu_bacteria | 2599185291 | 2599896131 | 220 |
| 259 | iso_pu_bacteria | 2599185300 | 2599931493 | 220 |
| 260 | iso_pu_bacteria | 2599185302 | 2599945165 | 220 |
| 261 | iso_pu_bacteria | 2599185304 | 2599955483 | 220 |
| 262 | iso_pu_bacteria | 2599185305 | 2599958017 | 220 |
| 263 | iso_pu_bacteria | 2599185306 | 2599968614 | 220 |
| 264 | iso_pu_bacteria | 2599185307 | 2599971213 | 220 |
| 265 | iso_pu_bacteria | 2599185308 | 2599979806 | 220 |
| 266 | iso_pu_bacteria | 2599185309 | 2599984340 | 220 |
| 267 | iso_pu_bacteria | 2599185310 | 2599990489 | 220 |
| 268 | iso_pu_bacteria | 2599185312 | 2600001570 | 220 |
| 269 | iso_pu_bacteria | 2599185313 | 2600003895 | 220 |
| 270 | iso_pu_bacteria | 2599185314 | 2600013618 | 220 |
| 271 | iso_pu_bacteria | 2599185315 | 2600015740 | 220 |
| 272 | iso_pu_bacteria | 2599185318 | 2600034027 | 220 |
| 273 | iso_pu_bacteria | 2599185319 | 2600040454 | 220 |
| 274 | iso_pu_bacteria | 2599185320 | 2600049148 | 220 |
| 275 | iso_pu_bacteria | 2599185321 | 2600050947 | 220 |
| 276 | iso_pu_bacteria | 2599185322 | 2600058612 | 220 |
| 277 | iso_pu_bacteria | 2599185323 | 2600063458 | 220 |
| 278 | iso_pu_bacteria | 2599185324 | 2600069017 | 220 |
| 279 | iso_pu_bacteria | 2619619299 | 2621299648 | 220 |
| 280 | iso_pu_bacteria | 2623620443 | 2624481303 | 220 |
| 281 | iso_pu_bacteria | 2623620446 | 2624492699 | 220 |
| 282 | iso_pu_bacteria | 2643221565 | 2643842136 | 220 |
| 283 | iso_pu_bacteria | 2643221589 | 2643954535 | 220 |
| 284 | iso_pu_bacteria | 2643221602 | 2644023344 | 220 |
| 285 | iso_pu_bacteria | 2643221650 | 2644281189 | 220 |
| 286 | iso_pu_bacteria | 2651869719 | 2652548166 | 220 |
| 287 | iso_pu_bacteria | 2667528170 | 2671088825 | 220 |
| 288 | iso_pu_bacteria | 2713897149 | 2715755806 | 220 |
| 289 | iso_pu_bacteria | 2738541265 | 2738669648 | 220 |
| 290 | iso_pu_bacteria | 2738541271 | 2738687774 | 220 |
| 291 | iso_pu_bacteria | 2738541282 | 2738748041 | 220 |
| 292 | iso_pu_bacteria | 2738541294 | 2738806905 | 220 |
| 293 | iso_pu_bacteria | 2738541303 | 2738857083 | 220 |
| 294 | iso_pu_bacteria | 2738541309 | 2738894265 | 220 |
| 295 | iso_pu_bacteria | 2738543004 | 2739197431 | 220 |
| 296 | iso_pu_bacteria | 2738543016 | 2739263791 | 220 |
| 297 | iso_pu_bacteria | 2738543020 | 2739287577 | 220 |
| 298 | iso_pu_bacteria | 2738543021 | 2739292890 | 220 |
| 299 | iso_pu_bacteria | 2738543025 | 2739315334 | 220 |
| 300 | iso_pu_bacteria | 2773857670 | 2774123626 | 220 |
| 301 | iso_pu_bacteria | 2784132072 | 2784317207 | 220 |
| 302 | iso_pu_bacteria | 2791355520 | 2794597938 | 220 |
| 303 | iso_pu_bacteria | 2806310737 | 2807408006 | 220 |
| 304 | iso_pu_bacteria | 2806310745 | 2807456309 | 220 |
| 305 | iso_pu_bacteria | 2808606373 | 2808904457 | 220 |
| 306 | iso_pu_bacteria | 2808606377 | 2808932765 | 220 |
| 307 | iso_pu_bacteria | 2808606381 | 2808954845 | 220 |
| 308 | iso_pu_bacteria | 2808606382 | 2808956215 | 220 |
| 309 | iso_pu_bacteria | 2808606385 | 2808979728 | 220 |
| 310 | iso_pu_bacteria | 2808606388 | 2808995448 | 220 |
| 311 | iso_pu_bacteria | 2811994881 | 2812370060 | 220 |
| 312 | iso_pu_bacteria | 2816332298 | 2817491000 | 220 |
| 313 | iso_pu_bacteria | 2818991456 | 2819657822 | 220 |
| 314 | iso_pu_bacteria | 2825651385 | 2825652154 | 220 |
| 315 | iso_pu_bacteria | 2826581358 | 2826586057 | 220 |
| 316 | iso_pu_bacteria | 2834028612 | 2834029888 | 220 |
| 317 | iso_pu_bacteria | 2842815866 | 2842819095 | 220 |
| 318 | iso_pu_bacteria | 2842849001 | 2842853370 | 220 |
| 319 | iso_pu_bacteria | 2842854478 | 2842858571 | 220 |
| 320 | iso_pu_bacteria | 2844665904 | 2844670002 | 220 |
| 321 | iso_pu_bacteria | 2852612431 | 2852614515 | 220 |
| 322 | iso_pu_bacteria | 2852667396 | 2852667747 | 220 |
| 323 | iso_pu_bacteria | 2860339153 | 2860345530 | 220 |
| 324 | iso_pu_bacteria | 2878029506 | 2878033258 | 220 |
| 325 | iso_pu_bacteria | 2880230671 | 2880234017 | 220 |
| 326 | iso_pu_bacteria | 2908446538 | 2908449665 | 220 |
| 327 | iso_pu_bacteria | 2912963787 | 2912966553 | 220 |
| 328 | iso_pu_bacteria | 2913036834 | 2913040166 | 220 |
| 329 | iso_pu_bacteria | 2917832318 | 2917836868 | 220 |
| 330 | iso_pu_bacteria | 2919155634 | 2919158500 | 220 |
| 331 | iso_pu_bacteria | 2919385768 | 2919390363 | 220 |
| 332 | iso_pu_bacteria | 2919456309 | 2919456314 | 220 |
| 333 | iso_pu_bacteria | 2919481497 | 2919483192 | 220 |
| 334 | iso_pu_bacteria | 2919697872 | 2919702606 | 220 |
| 335 | iso_pu_bacteria | 2923519811 | 2923524146 | 220 |
| 336 | iso_pu_bacteria | 2923586266 | 2923588270 | 220 |
| 337 | iso_pu_bacteria | 2931369376 | 2931375015 | 220 |
| 338 | iso_pu_bacteria | 2931396565 | 2931402719 | 220 |
| 339 | iso_pu_bacteria | 2947233263 | 2947233588 | 220 |
| 340 | iso_pu_bacteria | 2952252522 | 2952253712 | 220 |
| 341 | iso_pu_bacteria | 2974298342 | 2974302569 | 220 |
| 342 | iso_pu_bacteria | 2984499530 | 2984499846 | 220 |
| 343 | iso_pu_bacteria | 2988728565 | 2988728990 | 220 |
| 344 | iso_pu_bacteria | 3007511990 | 3007514658 | 220 |
| 345 | iso_pu_bacteria | 3007803356 | 3007804448 | 220 |
| 346 | iso_pu_bacteria | 3007872151 | 3007875114 | 220 |
| 347 | iso_pu_bacteria | 8011350971 | 8011351956 | 220 |
| 348 | iso_pu_bacteria | 8015687852 | 8015690852 | 220 |
| 349 | iso_pu_bacteria | 8019775933 | 8019781091 | 220 |
| 350 | iso_pu_bacteria | 8029995093 | 8029998083 | 220 |
| 351 | iso_pu_bacteria | 8052494512 | 8052497744 | 220 |
| 352 | iso_pu_bacteria | 8054285046 | 8054291256 | 220 |
| 353 | iso_pu_bacteria | 8054503363 | 8054506346 | 220 |
| 354 | iso_pu_bacteria | 8054929484 | 8054931568 | 220 |
| 355 | iso_pu_bacteria | 8055770955 | 8055774023 | 220 |
| 356 | iso_pu_bacteria | 8056125926 | 8056129043 | 220 |
| 357 | iso_pu_bacteria | 8056131705 | 8056134760 | 220 |
| 358 | iso_pu_bacteria | 8056143049 | 8056145949 | 220 |
| 359 | iso_pu_bacteria | 8056166840 | 8056168508 | 220 |
| 360 | iso_pu_bacteria | 8056172158 | 8056173902 | 220 |
| 361 | iso_pu_bacteria | 8056177738 | 8056177742 | 220 |
| 362 | iso_pu_bacteria | 8056569372 | 8056571049 | 220 |
| 363 | 3300031691 | Ga0316579_10009679 | Ga0316579_100096795 | 221 |
| 364 | 3300031733 | Ga0316577_10076554 | Ga0316577_100765542 | 221 |
| 365 | 3300036647 | Ga0316582_0088112 | Ga0316582_0088112_891_1556 | 221 |
| 366 | 3300036712 | Ga0316584_0223231 | Ga0316584_0223231_225_890 | 221 |
| 367 | 3300037588 | Ga0316581_0096076 | Ga0316581_0096076_37_702 | 221 |
| 368 | 3300042876 | Ga0451577_0004262 | Ga0451577_0004262_164_829 | 221 |
| 369 | 3300049575 | Ga0501039_0217723 | Ga0501039_0217723_647_1321 | 221 |
| 370 | 3300049584 | Ga0501068_0038019 | Ga0501068_0038019_1643_2317 | 221 |
| 371 | 3300049587 | Ga0501071_0029242 | Ga0501071_0029242_2353_3027 | 221 |
| 372 | 3300049588 | Ga0501072_0010513 | Ga0501072_0010513_1009_1683 | 221 |
| 373 | 3300049590 | Ga0501074_0110725 | Ga0501074_0110725_224_898 | 221 |
| 374 | 3300049592 | Ga0501076_0205395 | Ga0501076_0205395_556_1230 | 221 |
| 375 | 3300049741 | Ga0501079_0095884 | Ga0501079_0095884_384_1058 | 221 |
| 376 | 3300049742 | Ga0501080_0018328 | Ga0501080_0018328_3092_3766 | 221 |
| 377 | 3300049743 | Ga0501081_0170281 | Ga0501081_0170281_46_720 | 221 |
| 378 | 2162886012 | MBSR1b_contig_14104337 | MBSR1b_0157.00003410 | 222 |
| 379 | 2162886012 | MBSR1b_contig_2013439 | MBSR1b_0236.00006620 | 222 |
| 380 | 2162886012 | MBSR1b_contig_7046176 | MBSR1b_0835.00006310 | 222 |
| 381 | 3300005331 | Ga0070670_100045437 | Ga0070670_1000454374 | 222 |
| 382 | 3300005331 | Ga0070670_100103194 | Ga0070670_1001031943 | 222 |
| 383 | 3300005347 | Ga0070668_100006258 | Ga0070668_1000062583 | 222 |
| 384 | 3300005353 | Ga0070669_100084129 | Ga0070669_1000841292 | 222 |
| 385 | 3300005354 | Ga0070675_100019354 | Ga0070675_1000193544 | 222 |
| 386 | 3300005354 | Ga0070675_100035489 | Ga0070675_1000354893 | 222 |
| 387 | 3300005365 | Ga0070688_100369696 | Ga0070688_1003696962 | 222 |
| 388 | 3300005367 | Ga0070667_100031180 | Ga0070667_1000311805 | 222 |
| 389 | 3300005441 | Ga0070700_100176345 | Ga0070700_1001763452 | 222 |
| 390 | 3300005456 | Ga0070678_100520271 | Ga0070678_1005202712 | 222 |
| 391 | 3300005457 | Ga0070662_100067167 | Ga0070662_1000671674 | 222 |
| 392 | 3300005543 | Ga0070672_100630325 | Ga0070672_1006303252 | 222 |
| 393 | 3300005548 | Ga0070665_100064152 | Ga0070665_1000641524 | 222 |
| 394 | 3300005577 | Ga0068857_100223848 | Ga0068857_1002238482 | 222 |
| 395 | 3300005618 | Ga0068864_100183681 | Ga0068864_1001836812 | 222 |
| 396 | 3300005840 | Ga0068870_10010401 | Ga0068870_100104015 | 222 |
| 397 | 3300005841 | Ga0068863_100533439 | Ga0068863_1005334392 | 222 |
| 398 | 3300005843 | Ga0068860_100819355 | Ga0068860_1008193551 | 222 |
| 399 | 3300005844 | Ga0068862_100109262 | Ga0068862_1001092622 | 222 |
| 400 | 3300006237 | Ga0097621_100555393 | Ga0097621_1005553932 | 222 |
| 401 | 3300006880 | Ga0075429_100072638 | Ga0075429_1000726383 | 222 |
| 402 | 3300006881 | Ga0068865_100237600 | Ga0068865_1002376002 | 222 |
| 403 | 3300009094 | Ga0111539_10265555 | Ga0111539_102655552 | 222 |
| 404 | 3300009553 | Ga0105249_10026653 | Ga0105249_100266535 | 222 |
| 405 | 3300013306 | Ga0163162_10198059 | Ga0163162_101980591 | 222 |
| 406 | 3300013308 | Ga0157375_10025389 | Ga0157375_100253891 | 222 |
| 407 | 3300014325 | Ga0163163_10148815 | Ga0163163_101488152 | 222 |
| 408 | 3300014326 | Ga0157380_10071701 | Ga0157380_100717013 | 222 |
| 409 | 3300014326 | Ga0157380_10108487 | Ga0157380_101084872 | 222 |
| 410 | 3300014745 | Ga0157377_10216381 | Ga0157377_102163812 | 222 |
| 411 | 3300014968 | Ga0157379_10596819 | Ga0157379_105968192 | 222 |
| 412 | 3300025901 | Ga0207688_10112727 | Ga0207688_101127272 | 222 |
| 413 | 3300025907 | Ga0207645_10017381 | Ga0207645_100173812 | 222 |
| 414 | 3300025908 | Ga0207643_10023040 | Ga0207643_100230404 | 222 |
| 415 | 3300025925 | Ga0207650_10041412 | Ga0207650_100414123 | 222 |
| 416 | 3300025926 | Ga0207659_10004554 | Ga0207659_100045544 | 222 |
| 417 | 3300025926 | Ga0207659_10212090 | Ga0207659_102120902 | 222 |
| 418 | 3300025933 | Ga0207706_10064186 | Ga0207706_100641864 | 222 |
| 419 | 3300025972 | Ga0207668_10002134 | Ga0207668_100021349 | 222 |
| 420 | 3300026075 | Ga0207708_10124035 | Ga0207708_101240352 | 222 |
| 421 | 3300026089 | Ga0207648_10205801 | Ga0207648_102058012 | 222 |
| 422 | 3300026095 | Ga0207676_10241605 | Ga0207676_102416052 | 222 |
| 423 | 3300026095 | Ga0207676_10401223 | Ga0207676_104012232 | 222 |
| 424 | 3300026118 | Ga0207675_100050770 | Ga0207675_1000507704 | 222 |
| 425 | 3300027907 | Ga0207428_10019253 | Ga0207428_100192533 | 222 |
| 426 | 3300027907 | Ga0207428_10225764 | Ga0207428_102257642 | 222 |
| 427 | 3300028379 | Ga0268266_10048863 | Ga0268266_100488632 | 222 |
| 428 | 3300028380 | Ga0268265_10007470 | Ga0268265_100074707 | 222 |
| 429 | 3300028381 | Ga0268264_10523369 | Ga0268264_105233692 | 222 |
| 430 | 3300041404 | Ga0439436_0024245 | Ga0439436_0024245_1019_1693 | 222 |
| 431 | 3300041405 | Ga0439438_000395 | Ga0439438_000395_17614_18288 | 222 |
| 432 | 3300041407 | Ga0439447_003573 | Ga0439447_003573_98_772 | 222 |
| 433 | 3300041411 | Ga0439466_0004909 | Ga0439466_0004909_2979_3653 | 222 |
| 434 | 3300042006 | Ga0439432_018715 | Ga0439432_018715_556_1230 | 222 |
| 435 | 3300042010 | Ga0439452_004509 | Ga0439452_004509_1087_1761 | 222 |
| 436 | 3300042121 | Ga0450919_010242 | Ga0450919_010242_144_818 | 222 |
| 437 | 3300042125 | Ga0450923_004694 | Ga0450923_004694_885_1571 | 222 |
| 438 | 3300042156 | Ga0439446_0024885 | Ga0439446_0024885_788_1462 | 222 |
| 439 | 3300044712 | Ga0453684_0333204 | Ga0453684_0333204_498_1175 | 222 |
| 440 | 3300046453 | Ga0495627_000140 | Ga0495627_000140_14507_15190 | 222 |
| 441 | 3300046471 | Ga0495650_0015875 | Ga0495650_0015875_1322_2005 | 222 |
| 442 | 3300046492 | Ga0495585_0000333 | Ga0495585_0000333_11176_11853 | 222 |
| 443 | 3300046518 | Ga0495631_0000479 | Ga0495631_0000479_14275_14958 | 222 |
| 444 | 3300046519 | Ga0495632_0011430 | Ga0495632_0011430_3152_3835 | 222 |
| 445 | 3300046530 | Ga0495654_0000561 | Ga0495654_0000561_13148_13831 | 222 |
| 446 | 3300046665 | Ga0495661_0000011 | Ga0495661_0000011_229732_230409 | 222 |
| 447 | 3300046692 | Ga0495671_0002489 | Ga0495671_0002489_6368_7051 | 222 |
| 448 | 3300047320 | Ga0495672_0001891 | Ga0495672_0001891_15696_16379 | 222 |
| 449 | 3300048913 | Ga0496110_0923813 | Ga0496110_0923813_78_749 | 222 |
| 450 | 3300049571 | Ga0501034_0096454 | Ga0501034_0096454_2182_2856 | 222 |
| 451 | 3300049574 | Ga0501038_0394117 | Ga0501038_0394117_372_1052 | 222 |
| 452 | 3300049574 | Ga0501038_0493360 | Ga0501038_0493360_28_714 | 222 |
| 453 | 3300049576 | Ga0501040_0164117 | Ga0501040_0164117_813_1499 | 222 |
| 454 | 3300049578 | Ga0501042_0356778 | Ga0501042_0356778_267_953 | 222 |
| 455 | 3300049588 | Ga0501072_0159857 | Ga0501072_0159857_273_959 | 222 |
| 456 | 3300049591 | Ga0501075_0253005 | Ga0501075_0253005_644_1330 | 222 |
| 457 | 3300049592 | Ga0501076_0727295 | Ga0501076_0727295_123_800 | 222 |
| 458 | 3300049741 | Ga0501079_0324347 | Ga0501079_0324347_230_916 | 222 |
| 459 | 3300049778 | Ga0501282_013452 | Ga0501282_013452_126_794 | 222 |
| 460 | 3300050508 | nmdc:mga09592_263119_c1 | nmdc:mga09592_263119_c1_139_816 | 222 |
| 461 | 3300050511 | nmdc:mga08y16_37071_c1 | nmdc:mga08y16_37071_c1_377_1054 | 222 |
| 462 | 3300050511 | nmdc:mga08y16_830555_c1 | nmdc:mga08y16_830555_c1_158_835 | 222 |
| 463 | 3300003771 | Ga0055526_1002931 | Ga0055526_10029318 | 223 |
| 464 | 3300003775 | Ga0055524_1003743 | Ga0055524_10037435 | 223 |
| 465 | 3300003784 | Ga0055534_1001147 | Ga0055534_10011478 | 223 |
| 466 | 3300003791 | Ga0055530_10000621 | Ga0055530_100006219 | 223 |
| 467 | 3300005289 | Ga0065704_10241941 | Ga0065704_102419412 | 223 |
| 468 | 3300005549 | Ga0070704_100087426 | Ga0070704_1000874262 | 223 |
| 469 | 3300014326 | Ga0157380_10000547 | Ga0157380_1000054714 | 223 |
| 470 | 3300014326 | Ga0157380_10004385 | Ga0157380_100043857 | 223 |
| 471 | 3300025263 | Ga0209565_1001320 | Ga0209565_10013207 | 223 |
| 472 | 3300025291 | Ga0209675_1001584 | Ga0209675_10015848 | 223 |
| 473 | 3300025295 | Ga0209564_1003298 | Ga0209564_10032987 | 223 |
| 474 | 3300025298 | Ga0209050_1000383 | Ga0209050_100038365 | 223 |
| 475 | 3300025299 | Ga0209256_1003993 | Ga0209256_10039938 | 223 |
| 476 | 3300031616 | Ga0307508_10176152 | Ga0307508_101761522 | 223 |
| 477 | 3300031727 | Ga0316576_10213850 | Ga0316576_102138502 | 223 |
| 478 | 3300035398 | Ga0316574_0010594 | Ga0316574_0010594_2803_3492 | 223 |
| 479 | 3300042013 | Ga0439456_013271 | Ga0439456_013271_700_1371 | 223 |
| 480 | 3300042439 | Ga0439464_0075656 | Ga0439464_0075656_62_748 | 223 |
| 481 | 3300046471 | Ga0495650_0000077 | Ga0495650_0000077_39268_39942 | 223 |
| 482 | 3300047469 | Ga0495673_0062235 | Ga0495673_0062235_470_1144 | 223 |
| 483 | 3300049459 | Ga0495678_000009 | Ga0495678_000009_183389_184063 | 223 |
| 484 | 3300049459 | Ga0495678_000485 | Ga0495678_000485_16973_17647 | 223 |
| 485 | 2124908027 | MRS2a_Contig_51 | MRS2a_00392550 | 224 |
| 486 | 2162886007 | SwRhRL2b_contig_1371190 | SwRhRL2b_0284.00002470 | 224 |
| 487 | 2162886007 | SwRhRL2b_contig_2863385 | SwRhRL2b_0320.00005080 | 224 |
| 488 | 2162886007 | SwRhRL2b_contig_3602964 | SwRhRL2b_0958.00006470 | 224 |
| 489 | 2162886011 | MRS1b_contig_6654047 | MRS1b_0766.00001810 | 224 |
| 490 | 3300003759 | Ga0055525_1006818 | Ga0055525_10068182 | 224 |
| 491 | 3300003781 | Ga0055536_1000025 | Ga0055536_100002580 | 224 |
| 492 | 3300003781 | Ga0055536_1000037 | Ga0055536_100003716 | 224 |
| 493 | 3300003781 | Ga0055536_1040265 | Ga0055536_10402652 | 224 |
| 494 | 3300003784 | Ga0055534_1028430 | Ga0055534_10284302 | 224 |
| 495 | 3300003791 | Ga0055530_10000007 | Ga0055530_1000000780 | 224 |
| 496 | 3300003791 | Ga0055530_10000320 | Ga0055530_1000032036 | 224 |
| 497 | 3300003791 | Ga0055530_10001019 | Ga0055530_1000101910 | 224 |
| 498 | 3300003791 | Ga0055530_10008962 | Ga0055530_100089622 | 224 |
| 499 | 3300003792 | Ga0055540_1000025 | Ga0055540_1000025149 | 224 |
| 500 | 3300003792 | Ga0055540_1000729 | Ga0055540_100072910 | 224 |
| 501 | 3300003792 | Ga0055540_1000990 | Ga0055540_10009905 | 224 |
| 502 | 3300003794 | Ga0055531_10000585 | Ga0055531_1000058521 | 224 |
| 503 | 3300005288 | Ga0065714_10000222 | Ga0065714_100002225 | 224 |
| 504 | 3300005288 | Ga0065714_10002603 | Ga0065714_1000260315 | 224 |
| 505 | 3300005288 | Ga0065714_10003536 | Ga0065714_100035364 | 224 |
| 506 | 3300005288 | Ga0065714_10005770 | Ga0065714_100057706 | 224 |
| 507 | 3300005288 | Ga0065714_10012118 | Ga0065714_100121183 | 224 |
| 508 | 3300005288 | Ga0065714_10012484 | Ga0065714_100124842 | 224 |
| 509 | 3300005288 | Ga0065714_10064853 | Ga0065714_1006485311 | 224 |
| 510 | 3300005288 | Ga0065714_10065246 | Ga0065714_1006524612 | 224 |
| 511 | 3300005288 | Ga0065714_10069398 | Ga0065714_100693982 | 224 |
| 512 | 3300005288 | Ga0065714_10071297 | Ga0065714_100712972 | 224 |
| 513 | 3300005288 | Ga0065714_10073329 | Ga0065714_100733291 | 224 |
| 514 | 3300005288 | Ga0065714_10159950 | Ga0065714_101599501 | 224 |
| 515 | 3300005289 | Ga0065704_10000555 | Ga0065704_1000055512 | 224 |
| 516 | 3300005289 | Ga0065704_10001427 | Ga0065704_1000142715 | 224 |
| 517 | 3300005289 | Ga0065704_10077367 | Ga0065704_100773675 | 224 |
| 518 | 3300005289 | Ga0065704_10084659 | Ga0065704_100846594 | 224 |
| 519 | 3300005289 | Ga0065704_10331112 | Ga0065704_103311121 | 224 |
| 520 | 3300005290 | Ga0065712_10002972 | Ga0065712_100029722 | 224 |
| 521 | 3300005290 | Ga0065712_10067857 | Ga0065712_100678575 | 224 |
| 522 | 3300005293 | Ga0065715_10009061 | Ga0065715_100090613 | 224 |
| 523 | 3300005331 | Ga0070670_100000079 | Ga0070670_10000007925 | 224 |
| 524 | 3300005331 | Ga0070670_100001054 | Ga0070670_1000010546 | 224 |
| 525 | 3300005344 | Ga0070661_100001004 | Ga0070661_10000100412 | 224 |
| 526 | 3300005353 | Ga0070669_100050193 | Ga0070669_1000501932 | 224 |
| 527 | 3300005548 | Ga0070665_100027248 | Ga0070665_1000272484 | 224 |
| 528 | 3300005564 | Ga0070664_100001292 | Ga0070664_10000129210 | 224 |
| 529 | 3300006051 | Ga0075364_10054755 | Ga0075364_100547552 | 224 |
| 530 | 3300006051 | Ga0075364_10079676 | Ga0075364_100796763 | 224 |
| 531 | 3300006051 | Ga0075364_10104434 | Ga0075364_101044342 | 224 |
| 532 | 3300006051 | Ga0075364_10266995 | Ga0075364_102669951 | 224 |
| 533 | 3300006051 | Ga0075364_10483289 | Ga0075364_104832892 | 224 |
| 534 | 3300006058 | Ga0075432_10000121 | Ga0075432_100001216 | 224 |
| 535 | 3300006058 | Ga0075432_10001179 | Ga0075432_100011797 | 224 |
| 536 | 3300006058 | Ga0075432_10007880 | Ga0075432_100078804 | 224 |
| 537 | 3300006058 | Ga0075432_10009488 | Ga0075432_100094882 | 224 |
| 538 | 3300006058 | Ga0075432_10013725 | Ga0075432_100137254 | 224 |
| 539 | 3300006058 | Ga0075432_10092655 | Ga0075432_100926552 | 224 |
| 540 | 3300006058 | Ga0075432_10207738 | Ga0075432_102077382 | 224 |
| 541 | 3300006177 | Ga0075362_10019840 | Ga0075362_100198402 | 224 |
| 542 | 3300006177 | Ga0075362_10245620 | Ga0075362_102456201 | 224 |
| 543 | 3300006186 | Ga0075369_10067944 | Ga0075369_100679442 | 224 |
| 544 | 3300006914 | Ga0075436_100056214 | Ga0075436_1000562143 | 224 |
| 545 | 3300006944 | Ga0099823_1000001 | Ga0099823_1000001112 | 224 |
| 546 | 3300006946 | Ga0079104_1000085 | Ga0079104_1000085101 | 224 |
| 547 | 3300006946 | Ga0079104_1000245 | Ga0079104_100024563 | 224 |
| 548 | 3300006946 | Ga0079104_1008099 | Ga0079104_10080993 | 224 |
| 549 | 3300006948 | Ga0099826_10000365 | Ga0099826_100003653 | 224 |
| 550 | 3300009011 | Ga0105251_10000001 | Ga0105251_10000001396 | 224 |
| 551 | 3300009011 | Ga0105251_10001168 | Ga0105251_100011685 | 224 |
| 552 | 3300009011 | Ga0105251_10001289 | Ga0105251_100012898 | 224 |
| 553 | 3300009011 | Ga0105251_10002617 | Ga0105251_1000261711 | 224 |
| 554 | 3300009011 | Ga0105251_10005442 | Ga0105251_100054425 | 224 |
| 555 | 3300009011 | Ga0105251_10058790 | Ga0105251_100587902 | 224 |
| 556 | 3300009011 | Ga0105251_10064855 | Ga0105251_100648552 | 224 |
| 557 | 3300009011 | Ga0105251_10193305 | Ga0105251_101933052 | 224 |
| 558 | 3300009036 | Ga0105244_10000806 | Ga0105244_1000080614 | 224 |
| 559 | 3300009036 | Ga0105244_10000914 | Ga0105244_1000091410 | 224 |
| 560 | 3300009036 | Ga0105244_10000938 | Ga0105244_100009386 | 224 |
| 561 | 3300009036 | Ga0105244_10001369 | Ga0105244_1000136910 | 224 |
| 562 | 3300009036 | Ga0105244_10011979 | Ga0105244_100119795 | 224 |
| 563 | 3300009036 | Ga0105244_10015608 | Ga0105244_100156083 | 224 |
| 564 | 3300009036 | Ga0105244_10025248 | Ga0105244_100252485 | 224 |
| 565 | 3300009036 | Ga0105244_10047865 | Ga0105244_100478653 | 224 |
| 566 | 3300009036 | Ga0105244_10057992 | Ga0105244_100579921 | 224 |
| 567 | 3300009036 | Ga0105244_10059458 | Ga0105244_100594582 | 224 |
| 568 | 3300009036 | Ga0105244_10065107 | Ga0105244_100651072 | 224 |
| 569 | 3300009036 | Ga0105244_10082793 | Ga0105244_100827932 | 224 |
| 570 | 3300009036 | Ga0105244_10169378 | Ga0105244_101693781 | 224 |
| 571 | 3300009036 | Ga0105244_10193456 | Ga0105244_101934562 | 224 |
| 572 | 3300009092 | Ga0105250_10002103 | Ga0105250_1000210313 | 224 |
| 573 | 3300009092 | Ga0105250_10002655 | Ga0105250_100026554 | 224 |
| 574 | 3300009092 | Ga0105250_10007126 | Ga0105250_100071262 | 224 |
| 575 | 3300009148 | Ga0105243_10000230 | Ga0105243_1000023052 | 224 |
| 576 | 3300009148 | Ga0105243_10011221 | Ga0105243_100112219 | 224 |
| 577 | 3300009148 | Ga0105243_10681108 | Ga0105243_106811082 | 224 |
| 578 | 3300009176 | Ga0105242_10001326 | Ga0105242_100013269 | 224 |
| 579 | 3300009545 | Ga0105237_10000937 | Ga0105237_1000093722 | 224 |
| 580 | 3300011119 | Ga0105246_10000047 | Ga0105246_1000004737 | 224 |
| 581 | 3300011119 | Ga0105246_10047044 | Ga0105246_100470442 | 224 |
| 582 | 3300012498 | Ga0157345_1000005 | Ga0157345_100000521 | 224 |
| 583 | 3300013100 | Ga0157373_10000409 | Ga0157373_1000040926 | 224 |
| 584 | 3300013100 | Ga0157373_10000598 | Ga0157373_1000059819 | 224 |
| 585 | 3300013100 | Ga0157373_10000845 | Ga0157373_1000084517 | 224 |
| 586 | 3300013100 | Ga0157373_10003727 | Ga0157373_100037275 | 224 |
| 587 | 3300013100 | Ga0157373_10004523 | Ga0157373_1000452311 | 224 |
| 588 | 3300013100 | Ga0157373_10061079 | Ga0157373_100610792 | 224 |
| 589 | 3300013102 | Ga0157371_10000535 | Ga0157371_1000053519 | 224 |
| 590 | 3300013104 | Ga0157370_10014974 | Ga0157370_100149744 | 224 |
| 591 | 3300013104 | Ga0157370_10023243 | Ga0157370_100232435 | 224 |
| 592 | 3300013104 | Ga0157370_10100923 | Ga0157370_101009234 | 224 |
| 593 | 3300013104 | Ga0157370_10180973 | Ga0157370_101809732 | 224 |
| 594 | 3300013104 | Ga0157370_10217427 | Ga0157370_102174272 | 224 |
| 595 | 3300013105 | Ga0157369_10002178 | Ga0157369_100021787 | 224 |
| 596 | 3300013105 | Ga0157369_10003376 | Ga0157369_1000337612 | 224 |
| 597 | 3300013306 | Ga0163162_10016024 | Ga0163162_100160246 | 224 |
| 598 | 3300013306 | Ga0163162_10388684 | Ga0163162_103886842 | 224 |
| 599 | 3300013307 | Ga0157372_10006552 | Ga0157372_100065529 | 224 |
| 600 | 3300013307 | Ga0157372_10065042 | Ga0157372_100650422 | 224 |
| 601 | 3300013308 | Ga0157375_10002189 | Ga0157375_100021899 | 224 |
| 602 | 3300013308 | Ga0157375_10056866 | Ga0157375_100568665 | 224 |
| 603 | 3300014497 | Ga0182008_10000449 | Ga0182008_1000044932 | 224 |
| 604 | 3300014497 | Ga0182008_10001226 | Ga0182008_100012263 | 224 |
| 605 | 3300014497 | Ga0182008_10001820 | Ga0182008_100018204 | 224 |
| 606 | 3300014497 | Ga0182008_10004720 | Ga0182008_100047208 | 224 |
| 607 | 3300014497 | Ga0182008_10013526 | Ga0182008_100135265 | 224 |
| 608 | 3300014497 | Ga0182008_10026759 | Ga0182008_100267593 | 224 |
| 609 | 3300014497 | Ga0182008_10029382 | Ga0182008_100293822 | 224 |
| 610 | 3300015261 | Ga0182006_1000099 | Ga0182006_100009939 | 224 |
| 611 | 3300015261 | Ga0182006_1000607 | Ga0182006_100060720 | 224 |
| 612 | 3300015261 | Ga0182006_1003156 | Ga0182006_10031565 | 224 |
| 613 | 3300015261 | Ga0182006_1004677 | Ga0182006_10046773 | 224 |
| 614 | 3300015261 | Ga0182006_1008171 | Ga0182006_10081712 | 224 |
| 615 | 3300015261 | Ga0182006_1022998 | Ga0182006_10229982 | 224 |
| 616 | 3300015262 | Ga0182007_10000130 | Ga0182007_1000013023 | 224 |
| 617 | 3300015262 | Ga0182007_10000379 | Ga0182007_1000037912 | 224 |
| 618 | 3300015262 | Ga0182007_10077788 | Ga0182007_100777881 | 224 |
| 619 | 3300015265 | Ga0182005_1000208 | Ga0182005_100020837 | 224 |
| 620 | 3300015265 | Ga0182005_1001653 | Ga0182005_10016536 | 224 |
| 621 | 3300015265 | Ga0182005_1010980 | Ga0182005_10109803 | 224 |
| 622 | 3300015265 | Ga0182005_1014213 | Ga0182005_10142132 | 224 |
| 623 | 3300015265 | Ga0182005_1014215 | Ga0182005_10142152 | 224 |
| 624 | 3300015265 | Ga0182005_1023764 | Ga0182005_10237642 | 224 |
| 625 | 3300015265 | Ga0182005_1028502 | Ga0182005_10285022 | 224 |
| 626 | 3300015265 | Ga0182005_1118122 | Ga0182005_11181221 | 224 |
| 627 | 3300017792 | Ga0163161_10000236 | Ga0163161_1000023621 | 224 |
| 628 | 3300017792 | Ga0163161_10000813 | Ga0163161_1000081321 | 224 |
| 629 | 3300017792 | Ga0163161_10001902 | Ga0163161_100019025 | 224 |
| 630 | 3300017792 | Ga0163161_10024615 | Ga0163161_100246152 | 224 |
| 631 | 3300025230 | Ga0209563_100648 | Ga0209563_1006482 | 224 |
| 632 | 3300025291 | Ga0209675_1001855 | Ga0209675_10018552 | 224 |
| 633 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002562 | 224 |
| 634 | 3300025292 | Ga0209676_1000003 | Ga0209676_1000003619 | 224 |
| 635 | 3300025292 | Ga0209676_1001013 | Ga0209676_100101315 | 224 |
| 636 | 3300025292 | Ga0209676_1028919 | Ga0209676_10289192 | 224 |
| 637 | 3300025298 | Ga0209050_1000004 | Ga0209050_1000004601 | 224 |
| 638 | 3300025298 | Ga0209050_1000006 | Ga0209050_10000061008 | 224 |
| 639 | 3300025298 | Ga0209050_1000013 | Ga0209050_1000013559 | 224 |
| 640 | 3300025298 | Ga0209050_1000782 | Ga0209050_100078227 | 224 |
| 641 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001562 | 224 |
| 642 | 3300025303 | Ga0209051_1000006 | Ga0209051_1000006374 | 224 |
| 643 | 3300025303 | Ga0209051_1000007 | Ga0209051_1000007559 | 224 |
| 644 | 3300025303 | Ga0209051_1004486 | Ga0209051_10044865 | 224 |
| 645 | 3300025304 | Ga0209257_1000056 | Ga0209257_1000056231 | 224 |
| 646 | 3300025711 | Ga0207696_1000016 | Ga0207696_1000016126 | 224 |
| 647 | 3300025711 | Ga0207696_1005875 | Ga0207696_10058755 | 224 |
| 648 | 3300025711 | Ga0207696_1006185 | Ga0207696_10061852 | 224 |
| 649 | 3300025711 | Ga0207696_1008566 | Ga0207696_10085662 | 224 |
| 650 | 3300025711 | Ga0207696_1026560 | Ga0207696_10265602 | 224 |
| 651 | 3300025711 | Ga0207696_1030704 | Ga0207696_10307042 | 224 |
| 652 | 3300025728 | Ga0207655_1000070 | Ga0207655_1000070163 | 224 |
| 653 | 3300025728 | Ga0207655_1000287 | Ga0207655_100028749 | 224 |
| 654 | 3300025728 | Ga0207655_1001371 | Ga0207655_10013718 | 224 |
| 655 | 3300025728 | Ga0207655_1003372 | Ga0207655_100337211 | 224 |
| 656 | 3300025728 | Ga0207655_1004780 | Ga0207655_10047807 | 224 |
| 657 | 3300025728 | Ga0207655_1015434 | Ga0207655_10154341 | 224 |
| 658 | 3300025728 | Ga0207655_1023783 | Ga0207655_10237832 | 224 |
| 659 | 3300025728 | Ga0207655_1025112 | Ga0207655_10251122 | 224 |
| 660 | 3300025728 | Ga0207655_1029251 | Ga0207655_10292514 | 224 |
| 661 | 3300025728 | Ga0207655_1068749 | Ga0207655_10687492 | 224 |
| 662 | 3300025728 | Ga0207655_1081852 | Ga0207655_10818522 | 224 |
| 663 | 3300025728 | Ga0207655_1104984 | Ga0207655_11049842 | 224 |
| 664 | 3300025735 | Ga0207713_1000268 | Ga0207713_100026816 | 224 |
| 665 | 3300025735 | Ga0207713_1000774 | Ga0207713_100077419 | 224 |
| 666 | 3300025735 | Ga0207713_1001306 | Ga0207713_100130614 | 224 |
| 667 | 3300025735 | Ga0207713_1001375 | Ga0207713_100137516 | 224 |
| 668 | 3300025735 | Ga0207713_1006880 | Ga0207713_10068805 | 224 |
| 669 | 3300025735 | Ga0207713_1009175 | Ga0207713_10091752 | 224 |
| 670 | 3300025735 | Ga0207713_1009217 | Ga0207713_10092175 | 224 |
| 671 | 3300025735 | Ga0207713_1014040 | Ga0207713_10140403 | 224 |
| 672 | 3300025735 | Ga0207713_1040707 | Ga0207713_10407072 | 224 |
| 673 | 3300025735 | Ga0207713_1054695 | Ga0207713_10546952 | 224 |
| 674 | 3300025914 | Ga0207671_10001472 | Ga0207671_100014729 | 224 |
| 675 | 3300025920 | Ga0207649_10000818 | Ga0207649_1000081821 | 224 |
| 676 | 3300025925 | Ga0207650_10001079 | Ga0207650_1000107917 | 224 |
| 677 | 3300025925 | Ga0207650_10002898 | Ga0207650_100028985 | 224 |
| 678 | 3300025935 | Ga0207709_10000014 | Ga0207709_10000014151 | 224 |
| 679 | 3300025935 | Ga0207709_10095532 | Ga0207709_100955322 | 224 |
| 680 | 3300025945 | Ga0207679_10000818 | Ga0207679_1000081810 | 224 |
| 681 | 3300027111 | Ga0209281_1000009 | Ga0209281_1000009344 | 224 |
| 682 | 3300027111 | Ga0209281_1000046 | Ga0209281_100004657 | 224 |
| 683 | 3300027111 | Ga0209281_1002511 | Ga0209281_10025118 | 224 |
| 684 | 3300027111 | Ga0209281_1007690 | Ga0209281_10076902 | 224 |
| 685 | 3300027296 | Ga0209389_1000007 | Ga0209389_1000007123 | 224 |
| 686 | 3300027666 | Ga0209282_1050167 | Ga0209282_10501672 | 224 |
| 687 | 3300027907 | Ga0207428_10017115 | Ga0207428_100171156 | 224 |
| 688 | 3300027907 | Ga0207428_10017815 | Ga0207428_100178157 | 224 |
| 689 | 3300027907 | Ga0207428_10034208 | Ga0207428_100342082 | 224 |
| 690 | 3300027907 | Ga0207428_10123299 | Ga0207428_101232992 | 224 |
| 691 | 3300027907 | Ga0207428_10259779 | Ga0207428_102597792 | 224 |
| 692 | 3300028379 | Ga0268266_10050083 | Ga0268266_100500833 | 224 |
| 693 | 3300030521 | Ga0307511_10062589 | Ga0307511_100625893 | 224 |
| 694 | 3300030735 | Ga0316178_1106511 | Ga0316178_110651111 | 224 |
| 695 | 3300030742 | Ga0316183_1170431 | Ga0316183_11704312 | 224 |
| 696 | 3300031548 | Ga0307408_100003404 | Ga0307408_1000034047 | 224 |
| 697 | 3300031548 | Ga0307408_100005033 | Ga0307408_1000050335 | 224 |
| 698 | 3300031548 | Ga0307408_100009387 | Ga0307408_1000093874 | 224 |
| 699 | 3300031548 | Ga0307408_100095499 | Ga0307408_1000954992 | 224 |
| 700 | 3300031548 | Ga0307408_100270503 | Ga0307408_1002705032 | 224 |
| 701 | 3300031727 | Ga0316576_10157736 | Ga0316576_101577362 | 224 |
| 702 | 3300031728 | Ga0316578_10023883 | Ga0316578_100238833 | 224 |
| 703 | 3300031731 | Ga0307405_10000422 | Ga0307405_100004225 | 224 |
| 704 | 3300031731 | Ga0307405_10010749 | Ga0307405_100107495 | 224 |
| 705 | 3300031731 | Ga0307405_10383751 | Ga0307405_103837512 | 224 |
| 706 | 3300031824 | Ga0307413_10095851 | Ga0307413_100958513 | 224 |
| 707 | 3300031824 | Ga0307413_10159791 | Ga0307413_101597911 | 224 |
| 708 | 3300031901 | Ga0307406_10011073 | Ga0307406_100110735 | 224 |
| 709 | 3300031911 | Ga0307412_10002369 | Ga0307412_1000236911 | 224 |
| 710 | 3300031911 | Ga0307412_10022250 | Ga0307412_100222503 | 224 |
| 711 | 3300031911 | Ga0307412_10037205 | Ga0307412_100372053 | 224 |
| 712 | 3300032004 | Ga0307414_10028655 | Ga0307414_100286555 | 224 |
| 713 | 3300032004 | Ga0307414_10058324 | Ga0307414_100583243 | 224 |
| 714 | 3300032004 | Ga0307414_10207854 | Ga0307414_102078542 | 224 |
| 715 | 3300032005 | Ga0307411_10024420 | Ga0307411_100244203 | 224 |
| 716 | 3300033180 | Ga0307510_10001358 | Ga0307510_100013589 | 224 |
| 717 | 3300041405 | Ga0439438_000008 | Ga0439438_000008_124128_124802 | 224 |
| 718 | 3300041405 | Ga0439438_000048 | Ga0439438_000048_4654_5328 | 224 |
| 719 | 3300041405 | Ga0439438_002317 | Ga0439438_002317_4213_4887 | 224 |
| 720 | 3300041405 | Ga0439438_003069 | Ga0439438_003069_4172_4846 | 224 |
| 721 | 3300041405 | Ga0439438_003967 | Ga0439438_003967_3721_4395 | 224 |
| 722 | 3300041405 | Ga0439438_020350 | Ga0439438_020350_588_1262 | 224 |
| 723 | 3300041407 | Ga0439447_000490 | Ga0439447_000490_7911_8585 | 224 |
| 724 | 3300041407 | Ga0439447_000765 | Ga0439447_000765_208_882 | 224 |
| 725 | 3300041407 | Ga0439447_004724 | Ga0439447_004724_1377_2051 | 224 |
| 726 | 3300041411 | Ga0439466_0000188 | Ga0439466_0000188_147_821 | 224 |
| 727 | 3300041411 | Ga0439466_0008059 | Ga0439466_0008059_1949_2623 | 224 |
| 728 | 3300041411 | Ga0439466_0012018 | Ga0439466_0012018_365_1039 | 224 |
| 729 | 3300041411 | Ga0439466_0012559 | Ga0439466_0012559_2392_3066 | 224 |
| 730 | 3300041411 | Ga0439466_0064276 | Ga0439466_0064276_402_1076 | 224 |
| 731 | 3300041997 | Ga0439431_0000014 | Ga0439431_0000014_3606_4280 | 224 |
| 732 | 3300042006 | Ga0439432_000051 | Ga0439432_000051_32346_33020 | 224 |
| 733 | 3300042006 | Ga0439432_000847 | Ga0439432_000847_5630_6310 | 224 |
| 734 | 3300042006 | Ga0439432_003061 | Ga0439432_003061_1152_1826 | 224 |
| 735 | 3300042006 | Ga0439432_006757 | Ga0439432_006757_224_898 | 224 |
| 736 | 3300042006 | Ga0439432_059967 | Ga0439432_059967_458_1132 | 224 |
| 737 | 3300042009 | Ga0439451_001530 | Ga0439451_001530_387_1079 | 224 |
| 738 | 3300042009 | Ga0439451_006063 | Ga0439451_006063_1763_2437 | 224 |
| 739 | 3300042009 | Ga0439451_006614 | Ga0439451_006614_1125_1817 | 224 |
| 740 | 3300042010 | Ga0439452_000043 | Ga0439452_000043_56273_56947 | 224 |
| 741 | 3300042010 | Ga0439452_000053 | Ga0439452_000053_172_846 | 224 |
| 742 | 3300042010 | Ga0439452_007002 | Ga0439452_007002_1322_1996 | 224 |
| 743 | 3300042013 | Ga0439456_001801 | Ga0439456_001801_3428_4102 | 224 |
| 744 | 3300042013 | Ga0439456_006597 | Ga0439456_006597_1606_2280 | 224 |
| 745 | 3300042013 | Ga0439456_020437 | Ga0439456_020437_130_804 | 224 |
| 746 | 3300042016 | Ga0439463_000359 | Ga0439463_000359_8237_8926 | 224 |
| 747 | 3300042016 | Ga0439463_006594 | Ga0439463_006594_706_1380 | 224 |
| 748 | 3300042016 | Ga0439463_021408 | Ga0439463_021408_285_959 | 224 |
| 749 | 3300042115 | Ga0450911_000009 | Ga0450911_000009_91592_92266 | 224 |
| 750 | 3300042115 | Ga0450911_000510 | Ga0450911_000510_9696_10370 | 224 |
| 751 | 3300042115 | Ga0450911_001101 | Ga0450911_001101_23_697 | 224 |
| 752 | 3300042124 | Ga0450922_001118 | Ga0450922_001118_1428_2102 | 224 |
| 753 | 3300042136 | Ga0450900_000709 | Ga0450900_000709_1140_1820 | 224 |
| 754 | 3300042137 | Ga0450902_041111 | Ga0450902_041111_18_692 | 224 |
| 755 | 3300042138 | Ga0450903_002877 | Ga0450903_002877_2145_2819 | 224 |
| 756 | 3300042138 | Ga0450903_003555 | Ga0450903_003555_55_729 | 224 |
| 757 | 3300042142 | Ga0450905_000799 | Ga0450905_000799_2722_3402 | 224 |
| 758 | 3300042145 | Ga0450906_003015 | Ga0450906_003015_2806_3480 | 224 |
| 759 | 3300042146 | Ga0450907_000120 | Ga0450907_000120_11940_12614 | 224 |
| 760 | 3300042147 | Ga0450910_000572 | Ga0450910_000572_3044_3718 | 224 |
| 761 | 3300042147 | Ga0450910_007604 | Ga0450910_007604_319_993 | 224 |
| 762 | 3300042156 | Ga0439446_0009231 | Ga0439446_0009231_1489_2163 | 224 |
| 763 | 3300042156 | Ga0439446_0031787 | Ga0439446_0031787_160_834 | 224 |
| 764 | 3300042435 | Ga0439434_0001508 | Ga0439434_0001508_1838_2512 | 224 |
| 765 | 3300042435 | Ga0439434_0024151 | Ga0439434_0024151_892_1566 | 224 |
| 766 | 3300042439 | Ga0439464_0012303 | Ga0439464_0012303_331_1020 | 224 |
| 767 | 3300042439 | Ga0439464_0023797 | Ga0439464_0023797_946_1626 | 224 |
| 768 | 3300042461 | Ga0439460_0026357 | Ga0439460_0026357_404_1078 | 224 |
| 769 | 3300042876 | Ga0451577_0007024 | Ga0451577_0007024_4806_5486 | 224 |
| 770 | 3300042993 | Ga0439440_0002062 | Ga0439440_0002062_2202_2876 | 224 |
| 771 | 3300042993 | Ga0439440_0008036 | Ga0439440_0008036_714_1388 | 224 |
| 772 | 3300042993 | Ga0439440_0030147 | Ga0439440_0030147_326_1000 | 224 |
| 773 | 3300046452 | Ga0495617_000263 | Ga0495617_000263_21694_22368 | 224 |
| 774 | 3300046452 | Ga0495617_001790 | Ga0495617_001790_4858_5532 | 224 |
| 775 | 3300046452 | Ga0495617_001945 | Ga0495617_001945_3758_4432 | 224 |
| 776 | 3300046452 | Ga0495617_006314 | Ga0495617_006314_3343_4017 | 224 |
| 777 | 3300046452 | Ga0495617_007955 | Ga0495617_007955_858_1547 | 224 |
| 778 | 3300046452 | Ga0495617_026788 | Ga0495617_026788_936_1610 | 224 |
| 779 | 3300046452 | Ga0495617_038440 | Ga0495617_038440_761_1435 | 224 |
| 780 | 3300046452 | Ga0495617_096457 | Ga0495617_096457_11_685 | 224 |
| 781 | 3300046452 | Ga0495617_108589 | Ga0495617_108589_118_792 | 224 |
| 782 | 3300046453 | Ga0495627_000039 | Ga0495627_000039_87077_87751 | 224 |
| 783 | 3300046453 | Ga0495627_000203 | Ga0495627_000203_21097_21771 | 224 |
| 784 | 3300046453 | Ga0495627_003143 | Ga0495627_003143_3121_3795 | 224 |
| 785 | 3300046453 | Ga0495627_003323 | Ga0495627_003323_5371_6045 | 224 |
| 786 | 3300046453 | Ga0495627_006275 | Ga0495627_006275_1504_2178 | 224 |
| 787 | 3300046453 | Ga0495627_018494 | Ga0495627_018494_1443_2117 | 224 |
| 788 | 3300046453 | Ga0495627_020609 | Ga0495627_020609_413_1087 | 224 |
| 789 | 3300046453 | Ga0495627_024236 | Ga0495627_024236_124_813 | 224 |
| 790 | 3300046453 | Ga0495627_038820 | Ga0495627_038820_662_1336 | 224 |
| 791 | 3300046455 | Ga0495603_0026163 | Ga0495603_0026163_599_1273 | 224 |
| 792 | 3300046457 | Ga0495590_0000235 | Ga0495590_0000235_9974_10648 | 224 |
| 793 | 3300046457 | Ga0495590_0001793 | Ga0495590_0001793_5740_6414 | 224 |
| 794 | 3300046457 | Ga0495590_0009342 | Ga0495590_0009342_1453_2127 | 224 |
| 795 | 3300046457 | Ga0495590_0011308 | Ga0495590_0011308_2484_3158 | 224 |
| 796 | 3300046458 | Ga0495591_000116 | Ga0495591_000116_59524_60213 | 224 |
| 797 | 3300046458 | Ga0495591_000138 | Ga0495591_000138_20768_21442 | 224 |
| 798 | 3300046458 | Ga0495591_000162 | Ga0495591_000162_53808_54497 | 224 |
| 799 | 3300046458 | Ga0495591_000749 | Ga0495591_000749_6436_7110 | 224 |
| 800 | 3300046458 | Ga0495591_002613 | Ga0495591_002613_57_731 | 224 |
| 801 | 3300046458 | Ga0495591_004348 | Ga0495591_004348_4498_5172 | 224 |
| 802 | 3300046458 | Ga0495591_004502 | Ga0495591_004502_1945_2619 | 224 |
| 803 | 3300046458 | Ga0495591_004931 | Ga0495591_004931_1426_2100 | 224 |
| 804 | 3300046458 | Ga0495591_005726 | Ga0495591_005726_4526_5200 | 224 |
| 805 | 3300046458 | Ga0495591_006991 | Ga0495591_006991_4177_4851 | 224 |
| 806 | 3300046458 | Ga0495591_013509 | Ga0495591_013509_627_1316 | 224 |
| 807 | 3300046460 | Ga0495638_0000196 | Ga0495638_0000196_73976_74650 | 224 |
| 808 | 3300046460 | Ga0495638_0000298 | Ga0495638_0000298_14373_15047 | 224 |
| 809 | 3300046460 | Ga0495638_0001043 | Ga0495638_0001043_22314_22988 | 224 |
| 810 | 3300046460 | Ga0495638_0003321 | Ga0495638_0003321_6635_7309 | 224 |
| 811 | 3300046460 | Ga0495638_0005270 | Ga0495638_0005270_885_1559 | 224 |
| 812 | 3300046460 | Ga0495638_0008238 | Ga0495638_0008238_1906_2607 | 224 |
| 813 | 3300046460 | Ga0495638_0016482 | Ga0495638_0016482_1729_2403 | 224 |
| 814 | 3300046460 | Ga0495638_0017286 | Ga0495638_0017286_2497_3171 | 224 |
| 815 | 3300046460 | Ga0495638_0099766 | Ga0495638_0099766_235_909 | 224 |
| 816 | 3300046463 | Ga0495653_0001940 | Ga0495653_0001940_634_1308 | 224 |
| 817 | 3300046463 | Ga0495653_0008459 | Ga0495653_0008459_566_1240 | 224 |
| 818 | 3300046463 | Ga0495653_0068879 | Ga0495653_0068879_441_1115 | 224 |
| 819 | 3300046463 | Ga0495653_0174142 | Ga0495653_0174142_151_825 | 224 |
| 820 | 3300046463 | Ga0495653_0229955 | Ga0495653_0229955_130_804 | 224 |
| 821 | 3300046471 | Ga0495650_0001734 | Ga0495650_0001734_17422_18096 | 224 |
| 822 | 3300046471 | Ga0495650_0002021 | Ga0495650_0002021_11705_12379 | 224 |
| 823 | 3300046471 | Ga0495650_0002403 | Ga0495650_0002403_1067_1741 | 224 |
| 824 | 3300046471 | Ga0495650_0004530 | Ga0495650_0004530_6951_7640 | 224 |
| 825 | 3300046471 | Ga0495650_0008010 | Ga0495650_0008010_1851_2540 | 224 |
| 826 | 3300046471 | Ga0495650_0020041 | Ga0495650_0020041_251_925 | 224 |
| 827 | 3300046471 | Ga0495650_0021794 | Ga0495650_0021794_357_1031 | 224 |
| 828 | 3300046471 | Ga0495650_0023322 | Ga0495650_0023322_1003_1692 | 224 |
| 829 | 3300046471 | Ga0495650_0026329 | Ga0495650_0026329_1050_1724 | 224 |
| 830 | 3300046473 | Ga0495582_0005980 | Ga0495582_0005980_2350_3024 | 224 |
| 831 | 3300046474 | Ga0495605_0000002 | Ga0495605_0000002_152642_153331 | 224 |
| 832 | 3300046474 | Ga0495605_0000047 | Ga0495605_0000047_28264_28953 | 224 |
| 833 | 3300046474 | Ga0495605_0000279 | Ga0495605_0000279_15485_16174 | 224 |
| 834 | 3300046474 | Ga0495605_0000810 | Ga0495605_0000810_14482_15156 | 224 |
| 835 | 3300046474 | Ga0495605_0001142 | Ga0495605_0001142_2007_2696 | 224 |
| 836 | 3300046474 | Ga0495605_0001334 | Ga0495605_0001334_3759_4433 | 224 |
| 837 | 3300046474 | Ga0495605_0002151 | Ga0495605_0002151_3338_4027 | 224 |
| 838 | 3300046474 | Ga0495605_0006683 | Ga0495605_0006683_4317_4991 | 224 |
| 839 | 3300046474 | Ga0495605_0008450 | Ga0495605_0008450_3710_4399 | 224 |
| 840 | 3300046474 | Ga0495605_0013545 | Ga0495605_0013545_1504_2178 | 224 |
| 841 | 3300046474 | Ga0495605_0105906 | Ga0495605_0105906_212_886 | 224 |
| 842 | 3300046474 | Ga0495605_0151892 | Ga0495605_0151892_334_1008 | 224 |
| 843 | 3300046474 | Ga0495605_0173453 | Ga0495605_0173453_257_931 | 224 |
| 844 | 3300046475 | Ga0495639_0000059 | Ga0495639_0000059_21142_21816 | 224 |
| 845 | 3300046475 | Ga0495639_0017743 | Ga0495639_0017743_2086_2760 | 224 |
| 846 | 3300046491 | Ga0495584_0000579 | Ga0495584_0000579_14077_14766 | 224 |
| 847 | 3300046491 | Ga0495584_0002024 | Ga0495584_0002024_7850_8524 | 224 |
| 848 | 3300046491 | Ga0495584_0003053 | Ga0495584_0003053_4632_5306 | 224 |
| 849 | 3300046491 | Ga0495584_0019991 | Ga0495584_0019991_126_800 | 224 |
| 850 | 3300046491 | Ga0495584_0027799 | Ga0495584_0027799_1719_2393 | 224 |
| 851 | 3300046491 | Ga0495584_0028337 | Ga0495584_0028337_1937_2611 | 224 |
| 852 | 3300046491 | Ga0495584_0028993 | Ga0495584_0028993_58_732 | 224 |
| 853 | 3300046491 | Ga0495584_0029615 | Ga0495584_0029615_1302_1976 | 224 |
| 854 | 3300046491 | Ga0495584_0039340 | Ga0495584_0039340_752_1426 | 224 |
| 855 | 3300046492 | Ga0495585_0000202 | Ga0495585_0000202_53931_54605 | 224 |
| 856 | 3300046492 | Ga0495585_0000372 | Ga0495585_0000372_39496_40170 | 224 |
| 857 | 3300046492 | Ga0495585_0000622 | Ga0495585_0000622_14260_14934 | 224 |
| 858 | 3300046492 | Ga0495585_0007020 | Ga0495585_0007020_3560_4234 | 224 |
| 859 | 3300046492 | Ga0495585_0014085 | Ga0495585_0014085_142_816 | 224 |
| 860 | 3300046492 | Ga0495585_0036694 | Ga0495585_0036694_967_1641 | 224 |
| 861 | 3300046492 | Ga0495585_0054670 | Ga0495585_0054670_400_1074 | 224 |
| 862 | 3300046492 | Ga0495585_0078162 | Ga0495585_0078162_681_1355 | 224 |
| 863 | 3300046499 | Ga0495594_0007594 | Ga0495594_0007594_3803_4492 | 224 |
| 864 | 3300046499 | Ga0495594_0036652 | Ga0495594_0036652_322_996 | 224 |
| 865 | 3300046499 | Ga0495594_0040160 | Ga0495594_0040160_1046_1720 | 224 |
| 866 | 3300046500 | Ga0495596_0000049 | Ga0495596_0000049_52022_52696 | 224 |
| 867 | 3300046500 | Ga0495596_0002506 | Ga0495596_0002506_660_1349 | 224 |
| 868 | 3300046500 | Ga0495596_0108880 | Ga0495596_0108880_96_770 | 224 |
| 869 | 3300046501 | Ga0495607_0000043 | Ga0495607_0000043_70906_71595 | 224 |
| 870 | 3300046501 | Ga0495607_0000503 | Ga0495607_0000503_23148_23837 | 224 |
| 871 | 3300046501 | Ga0495607_0000770 | Ga0495607_0000770_22099_22773 | 224 |
| 872 | 3300046501 | Ga0495607_0002404 | Ga0495607_0002404_7494_8168 | 224 |
| 873 | 3300046501 | Ga0495607_0002730 | Ga0495607_0002730_1075_1749 | 224 |
| 874 | 3300046501 | Ga0495607_0003453 | Ga0495607_0003453_5025_5699 | 224 |
| 875 | 3300046501 | Ga0495607_0007340 | Ga0495607_0007340_5149_5823 | 224 |
| 876 | 3300046501 | Ga0495607_0012487 | Ga0495607_0012487_2402_3076 | 224 |
| 877 | 3300046501 | Ga0495607_0013496 | Ga0495607_0013496_250_939 | 224 |
| 878 | 3300046501 | Ga0495607_0023397 | Ga0495607_0023397_1430_2104 | 224 |
| 879 | 3300046501 | Ga0495607_0047363 | Ga0495607_0047363_1816_2490 | 224 |
| 880 | 3300046501 | Ga0495607_0049644 | Ga0495607_0049644_1425_2099 | 224 |
| 881 | 3300046501 | Ga0495607_0089212 | Ga0495607_0089212_646_1320 | 224 |
| 882 | 3300046501 | Ga0495607_0104685 | Ga0495607_0104685_398_1072 | 224 |
| 883 | 3300046501 | Ga0495607_0114963 | Ga0495607_0114963_64_753 | 224 |
| 884 | 3300046506 | Ga0495583_0000012 | Ga0495583_0000012_279488_280177 | 224 |
| 885 | 3300046506 | Ga0495583_0000528 | Ga0495583_0000528_17621_18310 | 224 |
| 886 | 3300046506 | Ga0495583_0000534 | Ga0495583_0000534_1090_1779 | 224 |
| 887 | 3300046506 | Ga0495583_0001642 | Ga0495583_0001642_5384_6058 | 224 |
| 888 | 3300046506 | Ga0495583_0002701 | Ga0495583_0002701_3825_4514 | 224 |
| 889 | 3300046506 | Ga0495583_0005647 | Ga0495583_0005647_4032_4706 | 224 |
| 890 | 3300046506 | Ga0495583_0012000 | Ga0495583_0012000_4061_4735 | 224 |
| 891 | 3300046507 | Ga0495606_0000207 | Ga0495606_0000207_30449_31138 | 224 |
| 892 | 3300046507 | Ga0495606_0001383 | Ga0495606_0001383_25142_25816 | 224 |
| 893 | 3300046507 | Ga0495606_0001516 | Ga0495606_0001516_29442_30116 | 224 |
| 894 | 3300046507 | Ga0495606_0001673 | Ga0495606_0001673_18951_19625 | 224 |
| 895 | 3300046507 | Ga0495606_0003190 | Ga0495606_0003190_12103_12777 | 224 |
| 896 | 3300046507 | Ga0495606_0004547 | Ga0495606_0004547_1734_2408 | 224 |
| 897 | 3300046507 | Ga0495606_0040858 | Ga0495606_0040858_1531_2205 | 224 |
| 898 | 3300046507 | Ga0495606_0042512 | Ga0495606_0042512_2117_2791 | 224 |
| 899 | 3300046507 | Ga0495606_0053208 | Ga0495606_0053208_1539_2213 | 224 |
| 900 | 3300046507 | Ga0495606_0059862 | Ga0495606_0059862_784_1458 | 224 |
| 901 | 3300046507 | Ga0495606_0127326 | Ga0495606_0127326_683_1357 | 224 |
| 902 | 3300046512 | Ga0495610_0002360 | Ga0495610_0002360_7778_8467 | 224 |
| 903 | 3300046512 | Ga0495610_0004087 | Ga0495610_0004087_6538_7212 | 224 |
| 904 | 3300046512 | Ga0495610_0006715 | Ga0495610_0006715_4136_4810 | 224 |
| 905 | 3300046512 | Ga0495610_0009393 | Ga0495610_0009393_1487_2161 | 224 |
| 906 | 3300046512 | Ga0495610_0009485 | Ga0495610_0009485_3220_3894 | 224 |
| 907 | 3300046512 | Ga0495610_0013198 | Ga0495610_0013198_4007_4681 | 224 |
| 908 | 3300046512 | Ga0495610_0024883 | Ga0495610_0024883_1722_2396 | 224 |
| 909 | 3300046512 | Ga0495610_0029643 | Ga0495610_0029643_1927_2601 | 224 |
| 910 | 3300046512 | Ga0495610_0090327 | Ga0495610_0090327_310_984 | 224 |
| 911 | 3300046512 | Ga0495610_0098211 | Ga0495610_0098211_124_813 | 224 |
| 912 | 3300046513 | Ga0495616_0001576 | Ga0495616_0001576_9974_10648 | 224 |
| 913 | 3300046513 | Ga0495616_0002736 | Ga0495616_0002736_5822_6496 | 224 |
| 914 | 3300046513 | Ga0495616_0016240 | Ga0495616_0016240_1291_1965 | 224 |
| 915 | 3300046513 | Ga0495616_0020170 | Ga0495616_0020170_1279_1953 | 224 |
| 916 | 3300046513 | Ga0495616_0034760 | Ga0495616_0034760_1524_2198 | 224 |
| 917 | 3300046513 | Ga0495616_0040210 | Ga0495616_0040210_163_837 | 224 |
| 918 | 3300046513 | Ga0495616_0042257 | Ga0495616_0042257_1331_2005 | 224 |
| 919 | 3300046513 | Ga0495616_0049796 | Ga0495616_0049796_62_736 | 224 |
| 920 | 3300046513 | Ga0495616_0050793 | Ga0495616_0050793_75_749 | 224 |
| 921 | 3300046515 | Ga0495620_0000010 | Ga0495620_0000010_56916_57605 | 224 |
| 922 | 3300046515 | Ga0495620_0000062 | Ga0495620_0000062_60194_60883 | 224 |
| 923 | 3300046515 | Ga0495620_0000855 | Ga0495620_0000855_15846_16520 | 224 |
| 924 | 3300046515 | Ga0495620_0000898 | Ga0495620_0000898_14460_15134 | 224 |
| 925 | 3300046515 | Ga0495620_0002748 | Ga0495620_0002748_1525_2214 | 224 |
| 926 | 3300046515 | Ga0495620_0003212 | Ga0495620_0003212_2796_3470 | 224 |
| 927 | 3300046515 | Ga0495620_0004920 | Ga0495620_0004920_3255_3929 | 224 |
| 928 | 3300046515 | Ga0495620_0015431 | Ga0495620_0015431_1819_2493 | 224 |
| 929 | 3300046515 | Ga0495620_0078137 | Ga0495620_0078137_17_706 | 224 |
| 930 | 3300046517 | Ga0495630_0003718 | Ga0495630_0003718_3539_4213 | 224 |
| 931 | 3300046517 | Ga0495630_0018138 | Ga0495630_0018138_3849_4523 | 224 |
| 932 | 3300046517 | Ga0495630_0429250 | Ga0495630_0429250_192_866 | 224 |
| 933 | 3300046518 | Ga0495631_0000002 | Ga0495631_0000002_54626_55300 | 224 |
| 934 | 3300046518 | Ga0495631_0000255 | Ga0495631_0000255_9256_9930 | 224 |
| 935 | 3300046518 | Ga0495631_0005450 | Ga0495631_0005450_5796_6470 | 224 |
| 936 | 3300046518 | Ga0495631_0006994 | Ga0495631_0006994_3369_4058 | 224 |
| 937 | 3300046518 | Ga0495631_0008780 | Ga0495631_0008780_2412_3086 | 224 |
| 938 | 3300046518 | Ga0495631_0019680 | Ga0495631_0019680_1850_2539 | 224 |
| 939 | 3300046518 | Ga0495631_0179071 | Ga0495631_0179071_178_867 | 224 |
| 940 | 3300046519 | Ga0495632_0000232 | Ga0495632_0000232_36165_36845 | 224 |
| 941 | 3300046519 | Ga0495632_0001723 | Ga0495632_0001723_10718_11392 | 224 |
| 942 | 3300046519 | Ga0495632_0003247 | Ga0495632_0003247_7019_7708 | 224 |
| 943 | 3300046519 | Ga0495632_0003257 | Ga0495632_0003257_1544_2218 | 224 |
| 944 | 3300046519 | Ga0495632_0008066 | Ga0495632_0008066_3785_4459 | 224 |
| 945 | 3300046519 | Ga0495632_0010340 | Ga0495632_0010340_2542_3216 | 224 |
| 946 | 3300046519 | Ga0495632_0016203 | Ga0495632_0016203_2696_3385 | 224 |
| 947 | 3300046519 | Ga0495632_0016206 | Ga0495632_0016206_2248_2922 | 224 |
| 948 | 3300046519 | Ga0495632_0052108 | Ga0495632_0052108_129_803 | 224 |
| 949 | 3300046520 | Ga0495637_0000044 | Ga0495637_0000044_25133_25807 | 224 |
| 950 | 3300046520 | Ga0495637_0000127 | Ga0495637_0000127_36461_37150 | 224 |
| 951 | 3300046520 | Ga0495637_0002779 | Ga0495637_0002779_1977_2651 | 224 |
| 952 | 3300046520 | Ga0495637_0002832 | Ga0495637_0002832_1331_2005 | 224 |
| 953 | 3300046520 | Ga0495637_0003064 | Ga0495637_0003064_7391_8065 | 224 |
| 954 | 3300046520 | Ga0495637_0003435 | Ga0495637_0003435_7122_7796 | 224 |
| 955 | 3300046520 | Ga0495637_0004013 | Ga0495637_0004013_5388_6062 | 224 |
| 956 | 3300046520 | Ga0495637_0004709 | Ga0495637_0004709_2554_3228 | 224 |
| 957 | 3300046520 | Ga0495637_0005030 | Ga0495637_0005030_2356_3030 | 224 |
| 958 | 3300046520 | Ga0495637_0015510 | Ga0495637_0015510_1227_1901 | 224 |
| 959 | 3300046520 | Ga0495637_0026580 | Ga0495637_0026580_1840_2514 | 224 |
| 960 | 3300046520 | Ga0495637_0031028 | Ga0495637_0031028_1057_1731 | 224 |
| 961 | 3300046520 | Ga0495637_0035786 | Ga0495637_0035786_50_724 | 224 |
| 962 | 3300046522 | Ga0495643_0000049 | Ga0495643_0000049_129993_130673 | 224 |
| 963 | 3300046522 | Ga0495643_0000284 | Ga0495643_0000284_42675_43355 | 224 |
| 964 | 3300046522 | Ga0495643_0002169 | Ga0495643_0002169_14303_14977 | 224 |
| 965 | 3300046522 | Ga0495643_0003292 | Ga0495643_0003292_5051_5743 | 224 |
| 966 | 3300046522 | Ga0495643_0010678 | Ga0495643_0010678_4819_5493 | 224 |
| 967 | 3300046522 | Ga0495643_0013147 | Ga0495643_0013147_928_1602 | 224 |
| 968 | 3300046522 | Ga0495643_0014053 | Ga0495643_0014053_1364_2053 | 224 |
| 969 | 3300046522 | Ga0495643_0030427 | Ga0495643_0030427_1749_2423 | 224 |
| 970 | 3300046522 | Ga0495643_0057520 | Ga0495643_0057520_1246_1920 | 224 |
| 971 | 3300046522 | Ga0495643_0107566 | Ga0495643_0107566_35_709 | 224 |
| 972 | 3300046523 | Ga0495644_0000159 | Ga0495644_0000159_18674_19348 | 224 |
| 973 | 3300046523 | Ga0495644_0000878 | Ga0495644_0000878_8024_8698 | 224 |
| 974 | 3300046523 | Ga0495644_0003676 | Ga0495644_0003676_4959_5633 | 224 |
| 975 | 3300046523 | Ga0495644_0045069 | Ga0495644_0045069_378_1052 | 224 |
| 976 | 3300046523 | Ga0495644_0105559 | Ga0495644_0105559_198_887 | 224 |
| 977 | 3300046523 | Ga0495644_0111793 | Ga0495644_0111793_214_888 | 224 |
| 978 | 3300046524 | Ga0495648_0000337 | Ga0495648_0000337_30474_31148 | 224 |
| 979 | 3300046524 | Ga0495648_0001764 | Ga0495648_0001764_5244_5918 | 224 |
| 980 | 3300046524 | Ga0495648_0002321 | Ga0495648_0002321_8791_9480 | 224 |
| 981 | 3300046524 | Ga0495648_0002415 | Ga0495648_0002415_1360_2034 | 224 |
| 982 | 3300046524 | Ga0495648_0003859 | Ga0495648_0003859_2376_3065 | 224 |
| 983 | 3300046524 | Ga0495648_0004627 | Ga0495648_0004627_6436_7110 | 224 |
| 984 | 3300046524 | Ga0495648_0005118 | Ga0495648_0005118_4061_4735 | 224 |
| 985 | 3300046524 | Ga0495648_0015063 | Ga0495648_0015063_3627_4301 | 224 |
| 986 | 3300046524 | Ga0495648_0067018 | Ga0495648_0067018_1371_2045 | 224 |
| 987 | 3300046524 | Ga0495648_0104675 | Ga0495648_0104675_424_1098 | 224 |
| 988 | 3300046526 | Ga0495666_0001016 | Ga0495666_0001016_4002_4676 | 224 |
| 989 | 3300046526 | Ga0495666_0084302 | Ga0495666_0084302_258_932 | 224 |
| 990 | 3300046526 | Ga0495666_0144543 | Ga0495666_0144543_164_838 | 224 |
| 991 | 3300046530 | Ga0495654_0000157 | Ga0495654_0000157_63147_63836 | 224 |
| 992 | 3300046530 | Ga0495654_0000197 | Ga0495654_0000197_38822_39496 | 224 |
| 993 | 3300046530 | Ga0495654_0000312 | Ga0495654_0000312_39778_40467 | 224 |
| 994 | 3300046530 | Ga0495654_0000350 | Ga0495654_0000350_32044_32733 | 224 |
| 995 | 3300046530 | Ga0495654_0000851 | Ga0495654_0000851_7394_8068 | 224 |
| 996 | 3300046530 | Ga0495654_0004135 | Ga0495654_0004135_2115_2789 | 224 |
| 997 | 3300046530 | Ga0495654_0006790 | Ga0495654_0006790_2899_3573 | 224 |
| 998 | 3300046530 | Ga0495654_0012024 | Ga0495654_0012024_750_1424 | 224 |
| 999 | 3300046530 | Ga0495654_0012774 | Ga0495654_0012774_2847_3521 | 224 |
| 1000 | 3300046530 | Ga0495654_0013179 | Ga0495654_0013179_1493_2167 | 224 |
| 1001 | 3300046530 | Ga0495654_0084028 | Ga0495654_0084028_456_1130 | 224 |
| 1002 | 3300046530 | Ga0495654_0094385 | Ga0495654_0094385_67_741 | 224 |
| 1003 | 3300046530 | Ga0495654_0103854 | Ga0495654_0103854_185_859 | 224 |
| 1004 | 3300046530 | Ga0495654_0243632 | Ga0495654_0243632_15_695 | 224 |
| 1005 | 3300046535 | Ga0495586_0009415 | Ga0495586_0009415_4326_5000 | 224 |
| 1006 | 3300046536 | Ga0495587_0000089 | Ga0495587_0000089_52137_52811 | 224 |
| 1007 | 3300046536 | Ga0495587_0007118 | Ga0495587_0007118_2910_3584 | 224 |
| 1008 | 3300046538 | Ga0495609_0000008 | Ga0495609_0000008_113929_114618 | 224 |
| 1009 | 3300046538 | Ga0495609_0000358 | Ga0495609_0000358_32037_32726 | 224 |
| 1010 | 3300046538 | Ga0495609_0001094 | Ga0495609_0001094_16837_17511 | 224 |
| 1011 | 3300046538 | Ga0495609_0001600 | Ga0495609_0001600_3838_4524 | 224 |
| 1012 | 3300046538 | Ga0495609_0003087 | Ga0495609_0003087_1121_1810 | 224 |
| 1013 | 3300046538 | Ga0495609_0003417 | Ga0495609_0003417_3439_4113 | 224 |
| 1014 | 3300046538 | Ga0495609_0021168 | Ga0495609_0021168_782_1456 | 224 |
| 1015 | 3300046538 | Ga0495609_0025066 | Ga0495609_0025066_1642_2331 | 224 |
| 1016 | 3300046538 | Ga0495609_0121162 | Ga0495609_0121162_319_993 | 224 |
| 1017 | 3300046542 | Ga0495597_0001188 | Ga0495597_0001188_1456_2130 | 224 |
| 1018 | 3300046542 | Ga0495597_0001323 | Ga0495597_0001323_8248_8922 | 224 |
| 1019 | 3300046542 | Ga0495597_0001929 | Ga0495597_0001929_1186_1860 | 224 |
| 1020 | 3300046542 | Ga0495597_0003566 | Ga0495597_0003566_3645_4319 | 224 |
| 1021 | 3300046542 | Ga0495597_0004046 | Ga0495597_0004046_6035_6709 | 224 |
| 1022 | 3300046542 | Ga0495597_0007169 | Ga0495597_0007169_3723_4412 | 224 |
| 1023 | 3300046542 | Ga0495597_0048542 | Ga0495597_0048542_1053_1727 | 224 |
| 1024 | 3300046542 | Ga0495597_0134034 | Ga0495597_0134034_151_825 | 224 |
| 1025 | 3300046542 | Ga0495597_0153052 | Ga0495597_0153052_96_785 | 224 |
| 1026 | 3300046542 | Ga0495597_0172321 | Ga0495597_0172321_29_703 | 224 |
| 1027 | 3300046557 | Ga0495622_0000676 | Ga0495622_0000676_9387_10061 | 224 |
| 1028 | 3300046557 | Ga0495622_0001176 | Ga0495622_0001176_11539_12213 | 224 |
| 1029 | 3300046557 | Ga0495622_0002949 | Ga0495622_0002949_4145_4819 | 224 |
| 1030 | 3300046557 | Ga0495622_0018880 | Ga0495622_0018880_1482_2171 | 224 |
| 1031 | 3300046557 | Ga0495622_0059584 | Ga0495622_0059584_852_1526 | 224 |
| 1032 | 3300046557 | Ga0495622_0095630 | Ga0495622_0095630_528_1202 | 224 |
| 1033 | 3300046557 | Ga0495622_0111131 | Ga0495622_0111131_15_689 | 224 |
| 1034 | 3300046557 | Ga0495622_0146145 | Ga0495622_0146145_68_742 | 224 |
| 1035 | 3300046558 | Ga0495633_0000009 | Ga0495633_0000009_134732_135421 | 224 |
| 1036 | 3300046558 | Ga0495633_0000571 | Ga0495633_0000571_27030_27704 | 224 |
| 1037 | 3300046558 | Ga0495633_0000656 | Ga0495633_0000656_18139_18813 | 224 |
| 1038 | 3300046558 | Ga0495633_0019067 | Ga0495633_0019067_269_943 | 224 |
| 1039 | 3300046558 | Ga0495633_0079737 | Ga0495633_0079737_188_862 | 224 |
| 1040 | 3300046615 | Ga0495656_0028652 | Ga0495656_0028652_960_1634 | 224 |
| 1041 | 3300046616 | Ga0495668_0000732 | Ga0495668_0000732_28435_29109 | 224 |
| 1042 | 3300046616 | Ga0495668_0055195 | Ga0495668_0055195_1311_1985 | 224 |
| 1043 | 3300046616 | Ga0495668_0131696 | Ga0495668_0131696_614_1303 | 224 |
| 1044 | 3300046616 | Ga0495668_0263722 | Ga0495668_0263722_182_856 | 224 |
| 1045 | 3300046642 | Ga0495634_0001522 | Ga0495634_0001522_4392_5066 | 224 |
| 1046 | 3300046648 | Ga0495611_0000016 | Ga0495611_0000016_19649_20323 | 224 |
| 1047 | 3300046648 | Ga0495611_0001351 | Ga0495611_0001351_96_785 | 224 |
| 1048 | 3300046648 | Ga0495611_0003958 | Ga0495611_0003958_1605_2279 | 224 |
| 1049 | 3300046648 | Ga0495611_0008920 | Ga0495611_0008920_1546_2220 | 224 |
| 1050 | 3300046660 | Ga0495625_0002733 | Ga0495625_0002733_3054_3728 | 224 |
| 1051 | 3300046660 | Ga0495625_0003014 | Ga0495625_0003014_13594_14268 | 224 |
| 1052 | 3300046660 | Ga0495625_0003863 | Ga0495625_0003863_3857_4531 | 224 |
| 1053 | 3300046660 | Ga0495625_0004081 | Ga0495625_0004081_5081_5755 | 224 |
| 1054 | 3300046660 | Ga0495625_0012034 | Ga0495625_0012034_5198_5887 | 224 |
| 1055 | 3300046660 | Ga0495625_0013745 | Ga0495625_0013745_3052_3726 | 224 |
| 1056 | 3300046660 | Ga0495625_0018840 | Ga0495625_0018840_3710_4384 | 224 |
| 1057 | 3300046660 | Ga0495625_0168253 | Ga0495625_0168253_211_885 | 224 |
| 1058 | 3300046663 | Ga0495635_0000983 | Ga0495635_0000983_5659_6333 | 224 |
| 1059 | 3300046663 | Ga0495635_0023127 | Ga0495635_0023127_630_1304 | 224 |
| 1060 | 3300046664 | Ga0495659_0000077 | Ga0495659_0000077_21103_21777 | 224 |
| 1061 | 3300046665 | Ga0495661_0000001 | Ga0495661_0000001_864359_865048 | 224 |
| 1062 | 3300046665 | Ga0495661_0000029 | Ga0495661_0000029_145477_146166 | 224 |
| 1063 | 3300046665 | Ga0495661_0003807 | Ga0495661_0003807_5941_6630 | 224 |
| 1064 | 3300046665 | Ga0495661_0007031 | Ga0495661_0007031_6838_7512 | 224 |
| 1065 | 3300046665 | Ga0495661_0011184 | Ga0495661_0011184_3066_3740 | 224 |
| 1066 | 3300046665 | Ga0495661_0020002 | Ga0495661_0020002_2019_2693 | 224 |
| 1067 | 3300046665 | Ga0495661_0034227 | Ga0495661_0034227_1114_1788 | 224 |
| 1068 | 3300046665 | Ga0495661_0035823 | Ga0495661_0035823_1347_2021 | 224 |
| 1069 | 3300046674 | Ga0495588_0017994 | Ga0495588_0017994_1067_1741 | 224 |
| 1070 | 3300046679 | Ga0495623_0003928 | Ga0495623_0003928_7101_7775 | 224 |
| 1071 | 3300046680 | Ga0495646_0000414 | Ga0495646_0000414_11721_12395 | 224 |
| 1072 | 3300046683 | Ga0495658_0133364 | Ga0495658_0133364_422_1111 | 224 |
| 1073 | 3300046689 | Ga0495613_0009565 | Ga0495613_0009565_2633_3307 | 224 |
| 1074 | 3300046689 | Ga0495613_0113470 | Ga0495613_0113470_1132_1806 | 224 |
| 1075 | 3300046691 | Ga0495670_0000373 | Ga0495670_0000373_3558_4232 | 224 |
| 1076 | 3300046691 | Ga0495670_0000395 | Ga0495670_0000395_13280_13954 | 224 |
| 1077 | 3300046691 | Ga0495670_0000563 | Ga0495670_0000563_10136_10810 | 224 |
| 1078 | 3300046691 | Ga0495670_0001267 | Ga0495670_0001267_1701_2375 | 224 |
| 1079 | 3300046691 | Ga0495670_0019743 | Ga0495670_0019743_571_1245 | 224 |
| 1080 | 3300046692 | Ga0495671_0000141 | Ga0495671_0000141_55790_56479 | 224 |
| 1081 | 3300046692 | Ga0495671_0000171 | Ga0495671_0000171_44155_44835 | 224 |
| 1082 | 3300046692 | Ga0495671_0000324 | Ga0495671_0000324_23554_24228 | 224 |
| 1083 | 3300046692 | Ga0495671_0000785 | Ga0495671_0000785_8722_9396 | 224 |
| 1084 | 3300046692 | Ga0495671_0002246 | Ga0495671_0002246_1203_1877 | 224 |
| 1085 | 3300046692 | Ga0495671_0009284 | Ga0495671_0009284_3516_4190 | 224 |
| 1086 | 3300046692 | Ga0495671_0015352 | Ga0495671_0015352_1833_2522 | 224 |
| 1087 | 3300046692 | Ga0495671_0016168 | Ga0495671_0016168_2931_3605 | 224 |
| 1088 | 3300046692 | Ga0495671_0022278 | Ga0495671_0022278_1671_2360 | 224 |
| 1089 | 3300046692 | Ga0495671_0029587 | Ga0495671_0029587_1866_2540 | 224 |
| 1090 | 3300046692 | Ga0495671_0030134 | Ga0495671_0030134_1854_2528 | 224 |
| 1091 | 3300046692 | Ga0495671_0035004 | Ga0495671_0035004_445_1119 | 224 |
| 1092 | 3300046692 | Ga0495671_0055184 | Ga0495671_0055184_14_688 | 224 |
| 1093 | 3300046692 | Ga0495671_0101716 | Ga0495671_0101716_456_1130 | 224 |
| 1094 | 3300046694 | Ga0495649_0000109 | Ga0495649_0000109_59379_60053 | 224 |
| 1095 | 3300046694 | Ga0495649_0003158 | Ga0495649_0003158_4429_5103 | 224 |
| 1096 | 3300046694 | Ga0495649_0007664 | Ga0495649_0007664_1995_2669 | 224 |
| 1097 | 3300046694 | Ga0495649_0008372 | Ga0495649_0008372_3508_4182 | 224 |
| 1098 | 3300046694 | Ga0495649_0014437 | Ga0495649_0014437_92_766 | 224 |
| 1099 | 3300046694 | Ga0495649_0019373 | Ga0495649_0019373_1154_1834 | 224 |
| 1100 | 3300046694 | Ga0495649_0032100 | Ga0495649_0032100_958_1632 | 224 |
| 1101 | 3300046694 | Ga0495649_0032228 | Ga0495649_0032228_1762_2436 | 224 |
| 1102 | 3300046694 | Ga0495649_0039208 | Ga0495649_0039208_256_930 | 224 |
| 1103 | 3300046694 | Ga0495649_0052466 | Ga0495649_0052466_728_1402 | 224 |
| 1104 | 3300046694 | Ga0495649_0064000 | Ga0495649_0064000_370_1044 | 224 |
| 1105 | 3300046794 | Ga0495589_0000234 | Ga0495589_0000234_2908_3582 | 224 |
| 1106 | 3300046794 | Ga0495589_0000251 | Ga0495589_0000251_43067_43756 | 224 |
| 1107 | 3300046794 | Ga0495589_0000448 | Ga0495589_0000448_7228_7902 | 224 |
| 1108 | 3300046794 | Ga0495589_0009774 | Ga0495589_0009774_1555_2229 | 224 |
| 1109 | 3300046794 | Ga0495589_0013282 | Ga0495589_0013282_3331_4005 | 224 |
| 1110 | 3300046794 | Ga0495589_0013906 | Ga0495589_0013906_2602_3276 | 224 |
| 1111 | 3300046794 | Ga0495589_0016201 | Ga0495589_0016201_1912_2586 | 224 |
| 1112 | 3300046794 | Ga0495589_0031020 | Ga0495589_0031020_1725_2399 | 224 |
| 1113 | 3300046809 | Ga0495600_0339222 | Ga0495600_0339222_53_727 | 224 |
| 1114 | 3300046810 | Ga0495660_0000876 | Ga0495660_0000876_17899_18588 | 224 |
| 1115 | 3300046810 | Ga0495660_0001193 | Ga0495660_0001193_4493_5182 | 224 |
| 1116 | 3300046810 | Ga0495660_0002216 | Ga0495660_0002216_4251_4925 | 224 |
| 1117 | 3300046810 | Ga0495660_0006833 | Ga0495660_0006833_1206_1880 | 224 |
| 1118 | 3300046810 | Ga0495660_0019752 | Ga0495660_0019752_3084_3758 | 224 |
| 1119 | 3300046810 | Ga0495660_0022562 | Ga0495660_0022562_1287_1961 | 224 |
| 1120 | 3300046810 | Ga0495660_0041553 | Ga0495660_0041553_549_1241 | 224 |
| 1121 | 3300046810 | Ga0495660_0108570 | Ga0495660_0108570_465_1154 | 224 |
| 1122 | 3300046810 | Ga0495660_0109801 | Ga0495660_0109801_28_702 | 224 |
| 1123 | 3300047315 | Ga0495581_0007024 | Ga0495581_0007024_1297_1971 | 224 |
| 1124 | 3300047317 | Ga0495604_0000559 | Ga0495604_0000559_18111_18785 | 224 |
| 1125 | 3300047317 | Ga0495604_0009001 | Ga0495604_0009001_5633_6307 | 224 |
| 1126 | 3300047318 | Ga0495636_0000899 | Ga0495636_0000899_6930_7604 | 224 |
| 1127 | 3300047319 | Ga0495674_0010426 | Ga0495674_0010426_3255_3929 | 224 |
| 1128 | 3300047320 | Ga0495672_0000210 | Ga0495672_0000210_14427_15101 | 224 |
| 1129 | 3300047320 | Ga0495672_0000796 | Ga0495672_0000796_30672_31346 | 224 |
| 1130 | 3300047320 | Ga0495672_0003926 | Ga0495672_0003926_9236_9910 | 224 |
| 1131 | 3300047320 | Ga0495672_0005049 | Ga0495672_0005049_6187_6861 | 224 |
| 1132 | 3300047320 | Ga0495672_0014284 | Ga0495672_0014284_1797_2486 | 224 |
| 1133 | 3300047320 | Ga0495672_0020951 | Ga0495672_0020951_3329_4003 | 224 |
| 1134 | 3300047320 | Ga0495672_0027957 | Ga0495672_0027957_1602_2291 | 224 |
| 1135 | 3300047320 | Ga0495672_0029012 | Ga0495672_0029012_2567_3241 | 224 |
| 1136 | 3300047320 | Ga0495672_0031558 | Ga0495672_0031558_603_1277 | 224 |
| 1137 | 3300047320 | Ga0495672_0061979 | Ga0495672_0061979_1295_1969 | 224 |
| 1138 | 3300047320 | Ga0495672_0104020 | Ga0495672_0104020_58_732 | 224 |
| 1139 | 3300047321 | Ga0495676_0000001 | Ga0495676_0000001_372405_373094 | 224 |
| 1140 | 3300047321 | Ga0495676_0000572 | Ga0495676_0000572_10858_11547 | 224 |
| 1141 | 3300047321 | Ga0495676_0000985 | Ga0495676_0000985_13531_14205 | 224 |
| 1142 | 3300047322 | Ga0495680_0027877 | Ga0495680_0027877_2784_3458 | 224 |
| 1143 | 3300047323 | Ga0495683_0000037 | Ga0495683_0000037_54960_55634 | 224 |
| 1144 | 3300047323 | Ga0495683_0000042 | Ga0495683_0000042_73239_73928 | 224 |
| 1145 | 3300047323 | Ga0495683_0000111 | Ga0495683_0000111_27509_28183 | 224 |
| 1146 | 3300047323 | Ga0495683_0006727 | Ga0495683_0006727_3595_4269 | 224 |
| 1147 | 3300047323 | Ga0495683_0009353 | Ga0495683_0009353_1942_2616 | 224 |
| 1148 | 3300047323 | Ga0495683_0037417 | Ga0495683_0037417_1472_2146 | 224 |
| 1149 | 3300047323 | Ga0495683_0044004 | Ga0495683_0044004_189_863 | 224 |
| 1150 | 3300047323 | Ga0495683_0138236 | Ga0495683_0138236_372_1046 | 224 |
| 1151 | 3300047323 | Ga0495683_0164316 | Ga0495683_0164316_102_776 | 224 |
| 1152 | 3300047443 | Ga0495687_010838 | Ga0495687_010838_657_1331 | 224 |
| 1153 | 3300047444 | Ga0495675_0029362 | Ga0495675_0029362_1450_2124 | 224 |
| 1154 | 3300047444 | Ga0495675_0066734 | Ga0495675_0066734_56_730 | 224 |
| 1155 | 3300047444 | Ga0495675_0161283 | Ga0495675_0161283_362_1036 | 224 |
| 1156 | 3300047446 | Ga0495679_000015 | Ga0495679_000015_120426_121115 | 224 |
| 1157 | 3300047446 | Ga0495679_000060 | Ga0495679_000060_64473_65162 | 224 |
| 1158 | 3300047446 | Ga0495679_000064 | Ga0495679_000064_60123_60797 | 224 |
| 1159 | 3300047446 | Ga0495679_000974 | Ga0495679_000974_12407_13081 | 224 |
| 1160 | 3300047446 | Ga0495679_002792 | Ga0495679_002792_741_1415 | 224 |
| 1161 | 3300047446 | Ga0495679_003450 | Ga0495679_003450_3409_4098 | 224 |
| 1162 | 3300047446 | Ga0495679_008712 | Ga0495679_008712_1098_1772 | 224 |
| 1163 | 3300047446 | Ga0495679_036353 | Ga0495679_036353_171_845 | 224 |
| 1164 | 3300047446 | Ga0495679_056549 | Ga0495679_056549_273_947 | 224 |
| 1165 | 3300047447 | Ga0495685_009249 | Ga0495685_009249_246_920 | 224 |
| 1166 | 3300047469 | Ga0495673_0000093 | Ga0495673_0000093_134816_135490 | 224 |
| 1167 | 3300047469 | Ga0495673_0000339 | Ga0495673_0000339_55647_56336 | 224 |
| 1168 | 3300047469 | Ga0495673_0001677 | Ga0495673_0001677_12886_13560 | 224 |
| 1169 | 3300047469 | Ga0495673_0001690 | Ga0495673_0001690_8243_8917 | 224 |
| 1170 | 3300047469 | Ga0495673_0001966 | Ga0495673_0001966_7973_8662 | 224 |
| 1171 | 3300047469 | Ga0495673_0004914 | Ga0495673_0004914_4675_5349 | 224 |
| 1172 | 3300047469 | Ga0495673_0007217 | Ga0495673_0007217_5711_6400 | 224 |
| 1173 | 3300047469 | Ga0495673_0008463 | Ga0495673_0008463_1101_1775 | 224 |
| 1174 | 3300047469 | Ga0495673_0010394 | Ga0495673_0010394_570_1256 | 224 |
| 1175 | 3300047469 | Ga0495673_0019005 | Ga0495673_0019005_1100_1774 | 224 |
| 1176 | 3300047469 | Ga0495673_0021726 | Ga0495673_0021726_690_1364 | 224 |
| 1177 | 3300047469 | Ga0495673_0075450 | Ga0495673_0075450_205_879 | 224 |
| 1178 | 3300047470 | Ga0495681_0000027 | Ga0495681_0000027_43039_43713 | 224 |
| 1179 | 3300047470 | Ga0495681_0000029 | Ga0495681_0000029_60582_61256 | 224 |
| 1180 | 3300047470 | Ga0495681_0000446 | Ga0495681_0000446_2250_2924 | 224 |
| 1181 | 3300047470 | Ga0495681_0002127 | Ga0495681_0002127_9489_10178 | 224 |
| 1182 | 3300047470 | Ga0495681_0002714 | Ga0495681_0002714_3368_4042 | 224 |
| 1183 | 3300047470 | Ga0495681_0003007 | Ga0495681_0003007_10901_11575 | 224 |
| 1184 | 3300047470 | Ga0495681_0003666 | Ga0495681_0003666_1523_2197 | 224 |
| 1185 | 3300047470 | Ga0495681_0004766 | Ga0495681_0004766_4851_5525 | 224 |
| 1186 | 3300047470 | Ga0495681_0005171 | Ga0495681_0005171_2194_2883 | 224 |
| 1187 | 3300047470 | Ga0495681_0005800 | Ga0495681_0005800_3235_3909 | 224 |
| 1188 | 3300047470 | Ga0495681_0007858 | Ga0495681_0007858_2831_3505 | 224 |
| 1189 | 3300047470 | Ga0495681_0010319 | Ga0495681_0010319_3176_3850 | 224 |
| 1190 | 3300047470 | Ga0495681_0019602 | Ga0495681_0019602_1749_2423 | 224 |
| 1191 | 3300047470 | Ga0495681_0041755 | Ga0495681_0041755_1140_1814 | 224 |
| 1192 | 3300047470 | Ga0495681_0067495 | Ga0495681_0067495_260_934 | 224 |
| 1193 | 3300047470 | Ga0495681_0104050 | Ga0495681_0104050_347_1021 | 224 |
| 1194 | 3300047471 | Ga0495684_0014123 | Ga0495684_0014123_4012_4686 | 224 |
| 1195 | 3300047472 | Ga0495686_0000816 | Ga0495686_0000816_32551_33240 | 224 |
| 1196 | 3300047472 | Ga0495686_0001441 | Ga0495686_0001441_21149_21823 | 224 |
| 1197 | 3300047472 | Ga0495686_0005737 | Ga0495686_0005737_7334_8008 | 224 |
| 1198 | 3300047472 | Ga0495686_0007165 | Ga0495686_0007165_6818_7492 | 224 |
| 1199 | 3300047472 | Ga0495686_0051251 | Ga0495686_0051251_219_893 | 224 |
| 1200 | 3300047472 | Ga0495686_0100020 | Ga0495686_0100020_1002_1682 | 224 |
| 1201 | 3300047472 | Ga0495686_0100704 | Ga0495686_0100704_862_1536 | 224 |
| 1202 | 3300047673 | Ga0495593_0001685 | Ga0495593_0001685_4544_5218 | 224 |
| 1203 | 3300047673 | Ga0495593_0032810 | Ga0495593_0032810_190_864 | 224 |
| 1204 | 3300048091 | Ga0495626_0000012 | Ga0495626_0000012_239347_240036 | 224 |
| 1205 | 3300048091 | Ga0495626_0000072 | Ga0495626_0000072_127443_128117 | 224 |
| 1206 | 3300048091 | Ga0495626_0000244 | Ga0495626_0000244_56192_56866 | 224 |
| 1207 | 3300048091 | Ga0495626_0000340 | Ga0495626_0000340_34174_34848 | 224 |
| 1208 | 3300048091 | Ga0495626_0000651 | Ga0495626_0000651_31893_32567 | 224 |
| 1209 | 3300048091 | Ga0495626_0015946 | Ga0495626_0015946_1411_2085 | 224 |
| 1210 | 3300048091 | Ga0495626_0020852 | Ga0495626_0020852_2557_3231 | 224 |
| 1211 | 3300048091 | Ga0495626_0114754 | Ga0495626_0114754_131_805 | 224 |
| 1212 | 3300048905 | Ga0496102_0000038 | Ga0496102_0000038_60466_61140 | 224 |
| 1213 | 3300048905 | Ga0496102_0008777 | Ga0496102_0008777_6907_7596 | 224 |
| 1214 | 3300048906 | Ga0496103_0085736 | Ga0496103_0085736_1227_1901 | 224 |
| 1215 | 3300048908 | Ga0496105_0141115 | Ga0496105_0141115_1255_1929 | 224 |
| 1216 | 3300048913 | Ga0496110_0016783 | Ga0496110_0016783_96_770 | 224 |
| 1217 | 3300048913 | Ga0496110_0210089 | Ga0496110_0210089_1059_1733 | 224 |
| 1218 | 3300048913 | Ga0496110_0292823 | Ga0496110_0292823_566_1255 | 224 |
| 1219 | 3300048914 | Ga0496111_0109636 | Ga0496111_0109636_997_1671 | 224 |
| 1220 | 3300048914 | Ga0496111_0198650 | Ga0496111_0198650_360_1049 | 224 |
| 1221 | 3300048919 | Ga0496116_0000697 | Ga0496116_0000697_16806_17480 | 224 |
| 1222 | 3300048919 | Ga0496116_0002982 | Ga0496116_0002982_11494_12168 | 224 |
| 1223 | 3300048919 | Ga0496116_0015222 | Ga0496116_0015222_1508_2182 | 224 |
| 1224 | 3300048919 | Ga0496116_0022132 | Ga0496116_0022132_398_1078 | 224 |
| 1225 | 3300048919 | Ga0496116_0046944 | Ga0496116_0046944_473_1147 | 224 |
| 1226 | 3300048920 | Ga0496117_0001093 | Ga0496117_0001093_3641_4321 | 224 |
| 1227 | 3300048920 | Ga0496117_0005893 | Ga0496117_0005893_10426_11100 | 224 |
| 1228 | 3300048921 | Ga0496118_0018132 | Ga0496118_0018132_3795_4469 | 224 |
| 1229 | 3300048922 | Ga0496119_0000086 | Ga0496119_0000086_9285_9965 | 224 |
| 1230 | 3300048922 | Ga0496119_0028309 | Ga0496119_0028309_2298_2987 | 224 |
| 1231 | 3300048923 | Ga0496120_0000130 | Ga0496120_0000130_17975_18655 | 224 |
| 1232 | 3300048924 | Ga0496121_0001263 | Ga0496121_0001263_37879_38568 | 224 |
| 1233 | 3300048924 | Ga0496121_0215892 | Ga0496121_0215892_396_1070 | 224 |
| 1234 | 3300048924 | Ga0496121_0222138 | Ga0496121_0222138_46_729 | 224 |
| 1235 | 3300048925 | Ga0496122_0003361 | Ga0496122_0003361_4737_5411 | 224 |
| 1236 | 3300048925 | Ga0496122_0010190 | Ga0496122_0010190_4150_4839 | 224 |
| 1237 | 3300048925 | Ga0496122_0088144 | Ga0496122_0088144_472_1146 | 224 |
| 1238 | 3300048925 | Ga0496122_0185175 | Ga0496122_0185175_463_1152 | 224 |
| 1239 | 3300048926 | Ga0496123_0039802 | Ga0496123_0039802_1413_2087 | 224 |
| 1240 | 3300048926 | Ga0496123_0099789 | Ga0496123_0099789_156_845 | 224 |
| 1241 | 3300048927 | Ga0496124_0000047 | Ga0496124_0000047_149374_150063 | 224 |
| 1242 | 3300048927 | Ga0496124_0004248 | Ga0496124_0004248_12373_13047 | 224 |
| 1243 | 3300048927 | Ga0496124_0007750 | Ga0496124_0007750_6122_6811 | 224 |
| 1244 | 3300048927 | Ga0496124_0014485 | Ga0496124_0014485_3185_3874 | 224 |
| 1245 | 3300048927 | Ga0496124_0020742 | Ga0496124_0020742_4261_4935 | 224 |
| 1246 | 3300048927 | Ga0496124_0025442 | Ga0496124_0025442_133_813 | 224 |
| 1247 | 3300048927 | Ga0496124_0045681 | Ga0496124_0045681_958_1632 | 224 |
| 1248 | 3300048927 | Ga0496124_0146923 | Ga0496124_0146923_850_1530 | 224 |
| 1249 | 3300048928 | Ga0496125_0010352 | Ga0496125_0010352_4910_5584 | 224 |
| 1250 | 3300048928 | Ga0496125_0029276 | Ga0496125_0029276_1267_1941 | 224 |
| 1251 | 3300048928 | Ga0496125_0064848 | Ga0496125_0064848_1878_2552 | 224 |
| 1252 | 3300048929 | Ga0496126_0003862 | Ga0496126_0003862_14524_15198 | 224 |
| 1253 | 3300048929 | Ga0496126_0115299 | Ga0496126_0115299_1505_2179 | 224 |
| 1254 | 3300049459 | Ga0495678_000011 | Ga0495678_000011_122902_123591 | 224 |
| 1255 | 3300049459 | Ga0495678_000707 | Ga0495678_000707_9231_9905 | 224 |
| 1256 | 3300049459 | Ga0495678_003056 | Ga0495678_003056_5991_6665 | 224 |
| 1257 | 3300049459 | Ga0495678_003070 | Ga0495678_003070_3321_4010 | 224 |
| 1258 | 3300049459 | Ga0495678_004617 | Ga0495678_004617_155_829 | 224 |
| 1259 | 3300049459 | Ga0495678_010366 | Ga0495678_010366_1587_2261 | 224 |
| 1260 | 3300049459 | Ga0495678_011349 | Ga0495678_011349_2910_3584 | 224 |
| 1261 | 3300049459 | Ga0495678_027553 | Ga0495678_027553_1364_2038 | 224 |
| 1262 | 3300049460 | Ga0495682_0000071 | Ga0495682_0000071_55530_56219 | 224 |
| 1263 | 3300049460 | Ga0495682_0000709 | Ga0495682_0000709_19812_20486 | 224 |
| 1264 | 3300049571 | Ga0501034_0000003 | Ga0501034_0000003_432509_433189 | 224 |
| 1265 | 3300049662 | Ga0501222_009074 | Ga0501222_009074_378_1052 | 224 |
| 1266 | 3300049853 | Ga0501226_000007 | Ga0501226_000007_209480_210160 | 224 |
| 1267 | 3300050489 | nmdc:mga03683_20590_c1 | nmdc:mga03683_20590_c1_551_1225 | 224 |
| 1268 | 3300050491 | nmdc:mga00v17_376756_c1 | nmdc:mga00v17_376756_c1_70_744 | 224 |
| 1269 | 3300050491 | nmdc:mga00v17_44145_c1 | nmdc:mga00v17_44145_c1_455_1129 | 224 |
| 1270 | 3300050491 | nmdc:mga00v17_45937_c1 | nmdc:mga00v17_45937_c1_1258_1932 | 224 |
| 1271 | 3300050514 | nmdc:mga08x19_107900_c1 | nmdc:mga08x19_107900_c1_401_1075 | 224 |
| 1272 | 3300050516 | nmdc:mga0sz30_30318_c1 | nmdc:mga0sz30_30318_c1_275_949 | 224 |
| 1273 | 3300053079 | Ga0500610_0188454 | Ga0500610_0188454_99_773 | 224 |
| 1274 | 3300053135 | Ga0500659_0000004 | Ga0500659_0000004_6655_7335 | 224 |
| 1275 | 3300053140 | Ga0500573_0006243 | Ga0500573_0006243_4608_5282 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rcw-assembly2.cif.gz_C-2 | crystal structure of ct610 from chlamydia trachomatis | 0.8596 | 3 | 210 |
| 3dde-assembly1.cif.gz_A | crystal structure of a domain of unknown function with a heme oxygenase-like fold (sden_3740) from shewanella denitrificans os217 at 2.30 a resolution | 0.8569 | 1 | 210 |
| 3oql-assembly1.cif.gz_A | crystal structure of a tena homolog (pspto1738) from pseudomonas syringae pv. tomato str. dc3000 at 2.54 a resolution | 0.8466 | 3 | 210 |
| 4wwj-assembly1.cif.gz_A | unda, an oxygen-activating, non-heme iron dependent desaturase/decarboxylase | 0.8449 | 3 | 210 |
| 1rcw-assembly2.cif.gz_C-2 | crystal structure of ct610 from chlamydia trachomatis | 0.8375 | 3 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rcwC00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8551 | 3 | 210 | 1.20.910.10 |
| 3ddeB00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8462 | 4 | 210 | 1.20.910.10 |
| 1rcwC00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8365 | 3 | 210 | 1.20.910.10 |
| 3oqlC00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8023 | 3 | 210 | 1.20.910.10 |
| 1we1D00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8014 | 1 | 210 | 1.20.910.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A2DQ96-F1-model_v4 | Biliverdin-producing heme oxygenase | 0.9902 | 1 | 213 |
|
| AF-J2WYE0-F1-model_v4 | Transcription activator | 0.9885 | 1 | 184 |
|
| AF-A0A1Y6J1M1-F1-model_v4 | Heme oxygenase | 0.9883 | 1 | 210 |
|
| AF-R0CXG9-F1-model_v4 | Biliverdin-producing heme oxygenase | 0.9865 | 1 | 214 |
|
| AF-A0A4Q6YC74-F1-model_v4 | deleted | 0.9858 | 1 | 213 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar