F492469

General Info

Members Datasets Scaffolds Average Seq Length
1275 503 1128 223

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0008238|Ga0495638_0008238_1906_2607
Length 233
Sequence MAMRRGNRIMSFFDTLQDATRQERHELFNLPIIVDALEGKVSLESYQAFLTQAYYHVRHTVPLMMACGARLPQRLEWLRKAVCEYIEDEYGHEQWVLNDIQACGGDPDAVRDGRPSLPIELMVSFLYDLIARDNPVGLFGMVNVLEGTSIALATHAATSIRDRLKLPQSAFSYLSSHGSLDIEHMQTYRQLMNKLHDPDDQAAVIHASKVVYRLYTEMFRGLPRNGEKLHASV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231006 Pseudomonas sp. GM17 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231021 Pseudomonas sp. GM78 Isolate Nodule
14 2511231022 Pseudomonas sp. GM79 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
17 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
18 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
19 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
20 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
21 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
22 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
23 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
24 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
25 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
26 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
27 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
28 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
29 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
30 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
31 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
32 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
33 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
34 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
35 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
36 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
37 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
38 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
39 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
40 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
41 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
42 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
43 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
44 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
45 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
46 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
47 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
48 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
49 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
50 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
51 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
52 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
53 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
54 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
55 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
56 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
57 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
58 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
59 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
60 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
61 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
62 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
63 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
64 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
65 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
66 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
67 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
68 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
69 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
70 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
71 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
72 2773857670 Pseudomonas sp. 478 Isolate Unclassified
73 2784132072 Pseudomonas sp. 460 Isolate Unclassified
74 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
75 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
76 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
77 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
78 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
79 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
80 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
81 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
82 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
83 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
84 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
85 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
86 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
87 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
88 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
89 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
90 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
91 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
92 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
93 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
94 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
95 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
96 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
97 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
98 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
99 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
100 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
101 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
102 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
103 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
104 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
105 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
106 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
107 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
108 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
109 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
110 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
111 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
112 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
113 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
114 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
115 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
116 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
117 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
118 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
119 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
120 2952252522 Salinicola sp. DM10 Isolate Unclassified
121 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
122 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
123 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
124 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
125 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
126 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
127 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
128 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
129 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
130 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
131 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
132 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
133 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
134 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
135 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
136 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
137 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
138 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
139 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
140 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
141 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
142 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
143 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
144 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
145 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
146 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
147 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
148 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
149 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
150 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
151 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
152 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
153 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
154 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
155 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
156 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
157 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
158 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
159 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
160 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
161 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
162 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
163 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
164 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
165 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
166 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
167 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
168 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
169 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
170 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
171 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
172 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
173 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
174 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
175 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
176 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
177 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
180 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
181 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
182 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
184 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
185 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
186 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
187 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
188 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
189 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
190 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
191 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
192 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
193 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
194 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
195 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
196 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
197 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
198 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
199 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
200 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
201 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
202 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
203 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
204 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
205 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
206 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
207 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
208 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
209 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
210 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
211 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
212 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
213 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
214 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
220 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
221 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
224 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
225 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
226 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
227 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
271 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
272 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
275 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
281 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
282 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
283 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
284 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
285 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
286 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
287 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
288 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
289 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
290 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
291 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
292 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
293 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
299 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
300 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
301 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
302 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
305 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
306 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
307 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
308 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
309 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
310 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
311 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
312 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
313 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
314 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
315 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
316 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
317 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
318 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
319 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
320 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
321 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
322 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
323 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
324 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
325 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
326 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
327 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
328 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
329 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
330 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
331 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
332 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
333 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
334 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
335 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
336 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
337 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
338 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
339 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
340 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
344 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
345 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
346 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
347 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
348 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
355 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
356 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
366 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
367 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
368 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
369 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
370 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
371 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
372 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
373 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
374 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
375 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
376 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
380 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
381 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
382 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
383 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
384 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
385 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
386 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
387 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
390 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
394 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
395 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
401 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
402 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
403 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
404 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
405 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
406 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
407 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
408 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
409 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
410 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
411 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
412 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
413 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
414 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
415 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
420 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
434 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
452 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
453 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
454 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
460 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
461 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
465 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
469 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
473 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
474 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
475 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
476 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
477 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
478 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
481 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
482 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
483 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
484 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
485 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
486 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
487 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
488 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
489 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
490 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
491 8052494512 Pseudomonas putida LD6 Isolate Unclassified
492 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
493 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
494 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
495 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
496 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
497 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
498 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
499 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
500 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
501 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
502 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
503 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.47
Metatranscriptomes 0
Isolates 11.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 4.55
Nodule 1.65
Rhizoplane 3.22
Rhizosphere 82.98
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_51 2124908027 Bacteria 27969
2 SwRhRL2b_contig_1371190 2162886007 Bacteria 6871
3 SwRhRL2b_contig_1398382 2162886007 Bacteria 4323
4 SwRhRL2b_contig_2863385 2162886007 Bacteria 4353
5 SwRhRL2b_contig_3602964 2162886007 Bacteria 4606
6 MRS1b_contig_6654047 2162886011 Bacteria 3204
7 MBSR1b_contig_14104337 2162886012 Unclassified 1224
8 MBSR1b_contig_2013439 2162886012 Bacteria 1804
9 MBSR1b_contig_7046176 2162886012 Bacteria 1569
10 Ga0055525_1006818 3300003759 Bacteria 966
11 Ga0055526_1002931 3300003771 Bacteria 11184
12 Ga0055524_1003743 3300003775 Bacteria 7262
13 Ga0055536_1000025 3300003781 Bacteria 183172
14 Ga0055536_1000037 3300003781 Bacteria 138437
15 Ga0055536_1004947 3300003781 Bacteria 6637
16 Ga0055536_1040265 3300003781 Bacteria 1114
17 Ga0055534_1001147 3300003784 Bacteria 11209
18 Ga0055534_1028430 3300003784 Bacteria 876
19 Ga0055530_10000007 3300003791 Bacteria 183172
20 Ga0055530_10000320 3300003791 Bacteria 43510
21 Ga0055530_10000621 3300003791 Bacteria 30767
22 Ga0055530_10001019 3300003791 Bacteria 22405
23 Ga0055530_10008962 3300003791 Bacteria 3917
24 Ga0055540_1000025 3300003792 Bacteria 197801
25 Ga0055540_1000729 3300003792 Bacteria 22405
26 Ga0055540_1000990 3300003792 Bacteria 18352
27 Ga0055531_10000585 3300003794 Bacteria 31831
28 Ga0065714_10000222 3300005288 Bacteria 7687
29 Ga0065714_10002603 3300005288 Bacteria 16794
30 Ga0065714_10003536 3300005288 Bacteria 6802
31 Ga0065714_10005770 3300005288 Bacteria 6942
32 Ga0065714_10012118 3300005288 Bacteria 2136
33 Ga0065714_10012484 3300005288 Bacteria 3393
34 Ga0065714_10064853 3300005288 Bacteria 16996
35 Ga0065714_10065246 3300005288 Bacteria 11484
36 Ga0065714_10069398 3300005288 Bacteria 4245
37 Ga0065714_10071297 3300005288 Bacteria 3610
38 Ga0065714_10073329 3300005288 Bacteria 3204
39 Ga0065714_10159950 3300005288 Bacteria 1045
40 Ga0065704_10000555 3300005289 Bacteria 20066
41 Ga0065704_10001427 3300005289 Bacteria 13125
42 Ga0065704_10070749 3300005289 Bacteria 16750
43 Ga0065704_10077367 3300005289 Bacteria 4754
44 Ga0065704_10084659 3300005289 Bacteria 3310
45 Ga0065704_10241941 3300005289 Bacteria 1013
46 Ga0065704_10331112 3300005289 Bacteria 837
47 Ga0065712_10002972 3300005290 Bacteria 5702
48 Ga0065712_10067857 3300005290 Bacteria 25214
49 Ga0065715_10009061 3300005293 Bacteria 4799
50 Ga0070670_100000079 3300005331 Bacteria 92916
51 Ga0070670_100001054 3300005331 Bacteria 21894
52 Ga0070670_100045437 3300005331 Bacteria 3776
53 Ga0070670_100103194 3300005331 Bacteria 2456
54 Ga0068869_100432542 3300005334 Bacteria 1088
55 Ga0070666_10011793 3300005335 Bacteria 5494
56 Ga0070680_100014625 3300005336 Bacteria 6138
57 Ga0070661_100001004 3300005344 Bacteria 20032
58 Ga0070661_100011542 3300005344 Bacteria 6155
59 Ga0070692_10014293 3300005345 Bacteria 3725
60 Ga0070668_100001244 3300005347 Bacteria 18179
61 Ga0070668_100006258 3300005347 Bacteria 8815
62 Ga0070669_100050193 3300005353 Bacteria 3047
63 Ga0070669_100084129 3300005353 Bacteria 2373
64 Ga0070675_100019354 3300005354 Bacteria 5424
65 Ga0070675_100035489 3300005354 Unclassified 4052
66 Ga0070671_100205240 3300005355 Bacteria 1671
67 Ga0070688_100369696 3300005365 Unclassified 1054
68 Ga0070667_100031180 3300005367 Bacteria 4445
69 Ga0070705_100018250 3300005440 Bacteria 3675
70 Ga0070700_100176345 3300005441 Bacteria 1484
71 Ga0070694_100010869 3300005444 Bacteria 5632
72 Ga0070663_100009462 3300005455 Bacteria 6035
73 Ga0070678_100520271 3300005456 Unclassified 1052
74 Ga0070662_100067167 3300005457 Bacteria 2633
75 Ga0070698_100544295 3300005471 Bacteria 1100
76 Ga0068853_100608259 3300005539 Bacteria 1038
77 Ga0070672_100630325 3300005543 Unclassified 935
78 Ga0070695_100094224 3300005545 Bacteria 2005
79 Ga0070696_100100258 3300005546 Bacteria 2074
80 Ga0070665_100027248 3300005548 Bacteria 5755
81 Ga0070665_100064152 3300005548 Bacteria 3683
82 Ga0070665_100217303 3300005548 Bacteria 1912
83 Ga0070704_100087426 3300005549 Bacteria 2313
84 Ga0068855_100059513 3300005563 Bacteria 4469
85 Ga0070664_100001292 3300005564 Bacteria 20032
86 Ga0070664_100014557 3300005564 Bacteria 6417
87 Ga0068857_100219116 3300005577 Bacteria 1738
88 Ga0068857_100223848 3300005577 Bacteria 1719
89 Ga0068856_100005484 3300005614 Bacteria 12501
90 Ga0068852_100016445 3300005616 Bacteria 5770
91 Ga0068859_100724752 3300005617 Bacteria 1084
92 Ga0068864_100101506 3300005618 Bacteria 2552
93 Ga0068864_100183681 3300005618 Bacteria 1913
94 Ga0068870_10010401 3300005840 Unclassified 4274
95 Ga0068863_100112621 3300005841 Bacteria 2591
96 Ga0068863_100533439 3300005841 Bacteria 1158
97 Ga0068858_100018150 3300005842 Bacteria 6590
98 Ga0068860_100049041 3300005843 Bacteria 4024
99 Ga0068860_100819355 3300005843 Unclassified 944
100 Ga0068862_100109262 3300005844 Bacteria 2426
101 Ga0075364_10054755 3300006051 Bacteria 2609
102 Ga0075364_10079676 3300006051 Bacteria 2164
103 Ga0075364_10104434 3300006051 Bacteria 1887
104 Ga0075364_10266995 3300006051 Bacteria 1163
105 Ga0075364_10483289 3300006051 Bacteria 847
106 Ga0075432_10000121 3300006058 Bacteria 17497
107 Ga0075432_10001179 3300006058 Bacteria 8376
108 Ga0075432_10007880 3300006058 Bacteria 3632
109 Ga0075432_10009488 3300006058 Bacteria 3314
110 Ga0075432_10013725 3300006058 Bacteria 2755
111 Ga0075432_10092655 3300006058 Bacteria 1108
112 Ga0075432_10207738 3300006058 Bacteria 777
113 Ga0075362_10019840 3300006177 Bacteria 2801
114 Ga0075362_10245620 3300006177 Bacteria 880
115 Ga0075369_10067944 3300006186 Bacteria 1566
116 Ga0097621_100229426 3300006237 Bacteria 1620
117 Ga0097621_100555393 3300006237 Unclassified 1045
118 Ga0068871_100084532 3300006358 Bacteria 2633
119 Ga0075428_100127125 3300006844 Bacteria 2773
120 Ga0075430_100009781 3300006846 Bacteria 8110
121 Ga0075430_100012611 3300006846 Bacteria 7197
122 Ga0075430_100096463 3300006846 Bacteria 2471
123 Ga0075431_100005495 3300006847 Bacteria 12513
124 Ga0075431_100014326 3300006847 Bacteria 8019
125 Ga0075429_100017386 3300006880 Bacteria 6217
126 Ga0075429_100072638 3300006880 Bacteria 2996
127 Ga0068865_100006683 3300006881 Bacteria 7053
128 Ga0068865_100237600 3300006881 Bacteria 1432
129 Ga0075436_100056214 3300006914 Bacteria 2718
130 Ga0097620_100724861 3300006931 Bacteria 1084
131 Ga0099823_1000001 3300006944 Bacteria 216833
132 Ga0079104_1000085 3300006946 Bacteria 136289
133 Ga0079104_1000245 3300006946 Bacteria 72407
134 Ga0079104_1008099 3300006946 Bacteria 3723
135 Ga0099826_10000365 3300006948 Bacteria 20892
136 Ga0105251_10000001 3300009011 Bacteria 466643
137 Ga0105251_10001168 3300009011 Bacteria 22786
138 Ga0105251_10001289 3300009011 Bacteria 21676
139 Ga0105251_10002617 3300009011 Bacteria 13912
140 Ga0105251_10005442 3300009011 Bacteria 8317
141 Ga0105251_10058790 3300009011 Bacteria 1815
142 Ga0105251_10064855 3300009011 Bacteria 1711
143 Ga0105251_10193305 3300009011 Bacteria 917
144 Ga0105244_10000806 3300009036 Bacteria 26610
145 Ga0105244_10000914 3300009036 Bacteria 24937
146 Ga0105244_10000938 3300009036 Bacteria 24575
147 Ga0105244_10001369 3300009036 Bacteria 19810
148 Ga0105244_10011979 3300009036 Bacteria 5158
149 Ga0105244_10015608 3300009036 Bacteria 4352
150 Ga0105244_10025248 3300009036 Bacteria 3232
151 Ga0105244_10047865 3300009036 Bacteria 2190
152 Ga0105244_10057992 3300009036 Bacteria 1956
153 Ga0105244_10059458 3300009036 Bacteria 1927
154 Ga0105244_10065107 3300009036 Bacteria 1827
155 Ga0105244_10082793 3300009036 Bacteria 1586
156 Ga0105244_10169378 3300009036 Bacteria 1040
157 Ga0105244_10193456 3300009036 Bacteria 961
158 Ga0105250_10002103 3300009092 Bacteria 10224
159 Ga0105250_10002655 3300009092 Bacteria 8867
160 Ga0105250_10007126 3300009092 Bacteria 4826
161 Ga0105240_10186568 3300009093 Bacteria 2442
162 Ga0105240_10890075 3300009093 Bacteria 958
163 Ga0111539_10265555 3300009094 Bacteria 1998
164 Ga0105247_10112543 3300009101 Bacteria 1754
165 Ga0114129_10128597 3300009147 Bacteria 3481
166 Ga0105243_10000230 3300009148 Bacteria 64559
167 Ga0105243_10002867 3300009148 Bacteria 14298
168 Ga0105243_10011221 3300009148 Bacteria 6778
169 Ga0105243_10681108 3300009148 Bacteria 1000
170 Ga0105242_10001326 3300009176 Bacteria 19534
171 Ga0105248_10043825 3300009177 Bacteria 5018
172 Ga0105248_10725386 3300009177 Bacteria 1121
173 Ga0105237_10000937 3300009545 Bacteria 39281
174 Ga0105237_10177519 3300009545 Bacteria 2130
175 Ga0105238_10192285 3300009551 Bacteria 2017
176 Ga0105249_10026653 3300009553 Bacteria 5211
177 Ga0105239_10037499 3300010375 Bacteria 5312
178 Ga0105246_10000047 3300011119 Bacteria 47128
179 Ga0105246_10047044 3300011119 Bacteria 2944
180 Ga0157345_1000005 3300012498 Bacteria 78097
181 Ga0157373_10000409 3300013100 Bacteria 34480
182 Ga0157373_10000598 3300013100 Bacteria 28031
183 Ga0157373_10000845 3300013100 Bacteria 23804
184 Ga0157373_10003727 3300013100 Bacteria 11530
185 Ga0157373_10004523 3300013100 Bacteria 10457
186 Ga0157373_10061079 3300013100 Bacteria 2669
187 Ga0157371_10000535 3300013102 Bacteria 45229
188 Ga0157370_10014974 3300013104 Bacteria 7907
189 Ga0157370_10023243 3300013104 Bacteria 6157
190 Ga0157370_10100923 3300013104 Bacteria 2703
191 Ga0157370_10180973 3300013104 Bacteria 1959
192 Ga0157370_10217427 3300013104 Bacteria 1770
193 Ga0157369_10002178 3300013105 Bacteria 23587
194 Ga0157369_10003376 3300013105 Bacteria 18972
195 Ga0157374_10037667 3300013296 Bacteria 4441
196 Ga0163162_10016024 3300013306 Bacteria 7325
197 Ga0163162_10198059 3300013306 Unclassified 2137
198 Ga0163162_10388684 3300013306 Bacteria 1528
199 Ga0157372_10006552 3300013307 Bacteria 12388
200 Ga0157372_10026527 3300013307 Bacteria 6304
201 Ga0157372_10065042 3300013307 Bacteria 4094
202 Ga0157375_10002189 3300013308 Bacteria 16893
203 Ga0157375_10025389 3300013308 Bacteria 5505
204 Ga0157375_10056866 3300013308 Bacteria 3865
205 Ga0163163_10104001 3300014325 Bacteria 2864
206 Ga0163163_10148815 3300014325 Bacteria 2386
207 Ga0157380_10000547 3300014326 Bacteria 23134
208 Ga0157380_10004385 3300014326 Bacteria 9781
209 Ga0157380_10071701 3300014326 Unclassified 2803
210 Ga0157380_10108487 3300014326 Unclassified 2327
211 Ga0182008_10000449 3300014497 Bacteria 31373
212 Ga0182008_10001226 3300014497 Bacteria 17694
213 Ga0182008_10001820 3300014497 Bacteria 13894
214 Ga0182008_10004720 3300014497 Bacteria 7902
215 Ga0182008_10013526 3300014497 Bacteria 4291
216 Ga0182008_10026759 3300014497 Bacteria 2924
217 Ga0182008_10029382 3300014497 Bacteria 2778
218 Ga0157377_10216381 3300014745 Unclassified 1224
219 Ga0157379_10596819 3300014968 Unclassified 1030
220 Ga0182006_1000099 3300015261 Bacteria 98453
221 Ga0182006_1000607 3300015261 Bacteria 25961
222 Ga0182006_1003156 3300015261 Bacteria 8614
223 Ga0182006_1004677 3300015261 Bacteria 6702
224 Ga0182006_1008171 3300015261 Bacteria 4749
225 Ga0182006_1022998 3300015261 Bacteria 2584
226 Ga0182007_10000130 3300015262 Bacteria 53164
227 Ga0182007_10000379 3300015262 Bacteria 28020
228 Ga0182007_10077788 3300015262 Bacteria 1088
229 Ga0182005_1000208 3300015265 Bacteria 39222
230 Ga0182005_1001653 3300015265 Bacteria 8673
231 Ga0182005_1010131 3300015265 Bacteria 2716
232 Ga0182005_1010980 3300015265 Bacteria 2593
233 Ga0182005_1014213 3300015265 Bacteria 2230
234 Ga0182005_1014215 3300015265 Bacteria 2230
235 Ga0182005_1023764 3300015265 Bacteria 1674
236 Ga0182005_1028502 3300015265 Bacteria 1522
237 Ga0182005_1118122 3300015265 Bacteria 753
238 Ga0163161_10000236 3300017792 Bacteria 50548
239 Ga0163161_10000813 3300017792 Bacteria 24473
240 Ga0163161_10001902 3300017792 Bacteria 15246
241 Ga0163161_10024615 3300017792 Bacteria 4254
242 Ga0209563_100648 3300025230 Bacteria 11181
243 Ga0209565_1001320 3300025263 Bacteria 11384
244 Ga0209675_1001584 3300025291 Bacteria 12867
245 Ga0209675_1001855 3300025291 Bacteria 11471
246 Ga0209676_1000002 3300025292 Bacteria 1732948
247 Ga0209676_1000003 3300025292 Bacteria 1454178
248 Ga0209676_1000068 3300025292 Bacteria 314068
249 Ga0209676_1001013 3300025292 Bacteria 32853
250 Ga0209676_1021986 3300025292 Bacteria 2125
251 Ga0209676_1028919 3300025292 Bacteria 1718
252 Ga0209564_1003298 3300025295 Bacteria 11215
253 Ga0209050_1000004 3300025298 Bacteria 1600040
254 Ga0209050_1000006 3300025298 Bacteria 1359702
255 Ga0209050_1000013 3300025298 Bacteria 811408
256 Ga0209050_1000383 3300025298 Bacteria 83450
257 Ga0209050_1000782 3300025298 Bacteria 45306
258 Ga0209050_1048449 3300025298 Bacteria 1098
259 Ga0209256_1003993 3300025299 Bacteria 9671
260 Ga0209051_1000001 3300025303 Bacteria 1732974
261 Ga0209051_1000006 3300025303 Bacteria 1015785
262 Ga0209051_1000007 3300025303 Bacteria 811408
263 Ga0209051_1004486 3300025303 Bacteria 8584
264 Ga0209257_1000056 3300025304 Bacteria 403132
265 Ga0207696_1000016 3300025711 Bacteria 502467
266 Ga0207696_1005875 3300025711 Bacteria 5032
267 Ga0207696_1006185 3300025711 Bacteria 4865
268 Ga0207696_1008566 3300025711 Bacteria 3892
269 Ga0207696_1026560 3300025711 Bacteria 1791
270 Ga0207696_1030704 3300025711 Bacteria 1630
271 Ga0207655_1000070 3300025728 Bacteria 239196
272 Ga0207655_1000287 3300025728 Bacteria 77056
273 Ga0207655_1001371 3300025728 Bacteria 22824
274 Ga0207655_1003372 3300025728 Bacteria 11943
275 Ga0207655_1004780 3300025728 Bacteria 9447
276 Ga0207655_1015434 3300025728 Bacteria 4246
277 Ga0207655_1017660 3300025728 Bacteria 3836
278 Ga0207655_1023783 3300025728 Bacteria 3025
279 Ga0207655_1025112 3300025728 Bacteria 2900
280 Ga0207655_1029251 3300025728 Bacteria 2583
281 Ga0207655_1068749 3300025728 Bacteria 1327
282 Ga0207655_1081852 3300025728 Bacteria 1162
283 Ga0207655_1104984 3300025728 Bacteria 965
284 Ga0207713_1000268 3300025735 Bacteria 64095
285 Ga0207713_1000774 3300025735 Bacteria 29524
286 Ga0207713_1001306 3300025735 Bacteria 20453
287 Ga0207713_1001375 3300025735 Bacteria 19748
288 Ga0207713_1006880 3300025735 Bacteria 6840
289 Ga0207713_1009175 3300025735 Bacteria 5603
290 Ga0207713_1009217 3300025735 Bacteria 5590
291 Ga0207713_1014040 3300025735 Bacteria 4184
292 Ga0207713_1040707 3300025735 Bacteria 1947
293 Ga0207713_1054695 3300025735 Bacteria 1563
294 Ga0207710_10114076 3300025900 Bacteria 1285
295 Ga0207688_10112727 3300025901 Bacteria 1580
296 Ga0207680_10400830 3300025903 Bacteria 969
297 Ga0207647_10067925 3300025904 Bacteria 2158
298 Ga0207645_10017381 3300025907 Bacteria 4748
299 Ga0207643_10023040 3300025908 Bacteria 3432
300 Ga0207671_10001472 3300025914 Bacteria 27195
301 Ga0207660_10014715 3300025917 Bacteria 5153
302 Ga0207649_10000818 3300025920 Bacteria 20019
303 Ga0207650_10001079 3300025925 Bacteria 20203
304 Ga0207650_10002898 3300025925 Bacteria 11840
305 Ga0207650_10041412 3300025925 Bacteria 3375
306 Ga0207659_10004554 3300025926 Bacteria 8382
307 Ga0207659_10212090 3300025926 Bacteria 1552
308 Ga0207644_10030980 3300025931 Bacteria 3725
309 Ga0207706_10064186 3300025933 Unclassified 3233
310 Ga0207709_10000014 3300025935 Bacteria 526302
311 Ga0207709_10056469 3300025935 Bacteria 2430
312 Ga0207709_10095532 3300025935 Bacteria 1953
313 Ga0207711_10594429 3300025941 Bacteria 1032
314 Ga0207689_10123987 3300025942 Bacteria 2125
315 Ga0207679_10000818 3300025945 Bacteria 20047
316 Ga0207667_10698138 3300025949 Bacteria 1017
317 Ga0207651_10413336 3300025960 Bacteria 1150
318 Ga0207668_10000866 3300025972 Bacteria 18274
319 Ga0207668_10002134 3300025972 Bacteria 11544
320 Ga0207677_10116517 3300026023 Bacteria 2000
321 Ga0207703_10127412 3300026035 Bacteria 2194
322 Ga0207639_10170170 3300026041 Bacteria 1844
323 Ga0207678_10014112 3300026067 Bacteria 7026
324 Ga0207708_10124035 3300026075 Unclassified 2015
325 Ga0207641_10059699 3300026088 Bacteria 3248
326 Ga0207648_10205801 3300026089 Bacteria 1746
327 Ga0207676_10241605 3300026095 Bacteria 1620
328 Ga0207676_10401223 3300026095 Unclassified 1281
329 Ga0207674_10014157 3300026116 Bacteria 8815
330 Ga0207675_100050770 3300026118 Bacteria 3871
331 Ga0207698_10083754 3300026142 Bacteria 2582
332 Ga0209281_1000009 3300027111 Bacteria 771717
333 Ga0209281_1000046 3300027111 Bacteria 327042
334 Ga0209281_1002511 3300027111 Bacteria 7222
335 Ga0209281_1007690 3300027111 Bacteria 2684
336 Ga0209389_1000007 3300027296 Bacteria 227459
337 Ga0209995_1007422 3300027471 Bacteria 1767
338 Ga0209983_1036744 3300027665 Bacteria 1054
339 Ga0209282_1050167 3300027666 Bacteria 2401
340 Ga0209966_1013396 3300027695 Bacteria 1518
341 Ga0207428_10017115 3300027907 Bacteria 6228
342 Ga0207428_10017815 3300027907 Bacteria 6091
343 Ga0207428_10019253 3300027907 Bacteria 5820
344 Ga0207428_10034208 3300027907 Bacteria 4167
345 Ga0207428_10123299 3300027907 Bacteria 1985
346 Ga0207428_10225764 3300027907 Bacteria 1403
347 Ga0207428_10259779 3300027907 Bacteria 1294
348 Ga0268266_10048863 3300028379 Bacteria 3627
349 Ga0268266_10050083 3300028379 Bacteria 3583
350 Ga0268265_10007470 3300028380 Bacteria 7381
351 Ga0268264_10183688 3300028381 Bacteria 1901
352 Ga0268264_10523369 3300028381 Unclassified 1160
353 Ga0265323_10011964 3300028653 Bacteria 3487
354 Ga0307511_10062589 3300030521 Bacteria 2822
355 Ga0316178_1106511 3300030735 Bacteria 11740
356 Ga0316183_1170431 3300030742 Bacteria 1509
357 Ga0265316_10029947 3300031344 Bacteria 4469
358 Ga0265316_10062393 3300031344 Bacteria 2892
359 Ga0265316_10096499 3300031344 Bacteria 2251
360 Ga0265316_10100443 3300031344 Bacteria 2199
361 Ga0307408_100000047 3300031548 Bacteria 166310
362 Ga0307408_100003404 3300031548 Bacteria 10909
363 Ga0307408_100005033 3300031548 Bacteria 8863
364 Ga0307408_100009387 3300031548 Bacteria 6446
365 Ga0307408_100095499 3300031548 Bacteria 2253
366 Ga0307408_100125860 3300031548 Bacteria 1993
367 Ga0307408_100270503 3300031548 Bacteria 1410
368 Ga0307508_10078052 3300031616 Bacteria 2891
369 Ga0307508_10176152 3300031616 Bacteria 1742
370 Ga0307508_10203368 3300031616 Bacteria 1581
371 Ga0316579_10009679 3300031691 Bacteria 4057
372 Ga0265314_10182434 3300031711 Bacteria 1256
373 Ga0316576_10009168 3300031727 Bacteria 6375
374 Ga0316576_10157736 3300031727 Bacteria 1711
375 Ga0316576_10213850 3300031727 Bacteria 1451
376 Ga0316578_10023883 3300031728 Bacteria 3425
377 Ga0316578_10029071 3300031728 Bacteria 3135
378 Ga0307405_10000422 3300031731 Bacteria 15864
379 Ga0307405_10010749 3300031731 Bacteria 4758
380 Ga0307405_10383751 3300031731 Bacteria 1094
381 Ga0316577_10076554 3300031733 Bacteria 1868
382 Ga0307413_10095851 3300031824 Bacteria 1946
383 Ga0307413_10159791 3300031824 Bacteria 1581
384 Ga0307406_10011073 3300031901 Bacteria 5108
385 Ga0307412_10002369 3300031911 Bacteria 10459
386 Ga0307412_10022250 3300031911 Bacteria 3883
387 Ga0307412_10037205 3300031911 Bacteria 3125
388 Ga0307416_100293500 3300032002 Bacteria 1611
389 Ga0307414_10028655 3300032004 Bacteria 3614
390 Ga0307414_10058324 3300032004 Bacteria 2719
391 Ga0307414_10207854 3300032004 Bacteria 1597
392 Ga0307411_10024420 3300032005 Bacteria 3603
393 Ga0316583_10001608 3300032133 Bacteria 7629
394 Ga0307510_10001358 3300033180 Bacteria 26701
395 Ga0373952_0000171 3300035092 Bacteria 9988
396 Ga0373945_0141493 3300035116 Bacteria 970
397 Ga0373960_0003863 3300035121 Bacteria 3410
398 Ga0316574_0002215 3300035398 Bacteria 9667
399 Ga0316574_0010594 3300035398 Bacteria 5215
400 Ga0316582_0010867 3300036647 Bacteria 5007
401 Ga0316582_0058437 3300036647 Bacteria 2466
402 Ga0316582_0088112 3300036647 Bacteria 2038
403 Ga0316584_0114042 3300036712 Bacteria 2022
404 Ga0316584_0223231 3300036712 Bacteria 1383
405 Ga0316581_0096076 3300037588 Bacteria 912
406 Ga0439436_0024245 3300041404 Bacteria 1791
407 Ga0439438_000008 3300041405 Bacteria 178072
408 Ga0439438_000048 3300041405 Bacteria 58674
409 Ga0439438_000395 3300041405 Bacteria 19478
410 Ga0439438_002317 3300041405 Bacteria 8146
411 Ga0439438_003069 3300041405 Bacteria 6868
412 Ga0439438_003967 3300041405 Bacteria 5823
413 Ga0439438_020350 3300041405 Bacteria 1863
414 Ga0439447_000490 3300041407 Bacteria 14702
415 Ga0439447_000765 3300041407 Bacteria 11888
416 Ga0439447_003573 3300041407 Bacteria 5508
417 Ga0439447_004724 3300041407 Bacteria 4641
418 Ga0439461_0006726 3300041410 Bacteria 2009
419 Ga0439466_0000188 3300041411 Bacteria 24642
420 Ga0439466_0002518 3300041411 Bacteria 7166
421 Ga0439466_0004909 3300041411 Bacteria 5140
422 Ga0439466_0008059 3300041411 Bacteria 3971
423 Ga0439466_0012018 3300041411 Bacteria 3196
424 Ga0439466_0012559 3300041411 Bacteria 3118
425 Ga0439466_0064276 3300041411 Bacteria 1176
426 Ga0439431_0000014 3300041997 Bacteria 30148
427 Ga0439441_000448 3300042001 Bacteria 4406
428 Ga0439441_069068 3300042001 Bacteria 755
429 Ga0439432_000051 3300042006 Bacteria 36464
430 Ga0439432_000847 3300042006 Bacteria 11460
431 Ga0439432_003061 3300042006 Bacteria 6226
432 Ga0439432_006757 3300042006 Bacteria 4084
433 Ga0439432_018715 3300042006 Bacteria 2312
434 Ga0439432_059967 3300042006 Bacteria 1174
435 Ga0439451_001530 3300042009 Bacteria 4575
436 Ga0439451_006063 3300042009 Bacteria 2470
437 Ga0439451_006614 3300042009 Bacteria 2367
438 Ga0439452_000043 3300042010 Bacteria 132609
439 Ga0439452_000053 3300042010 Bacteria 113190
440 Ga0439452_004509 3300042010 Bacteria 4658
441 Ga0439452_007002 3300042010 Bacteria 3485
442 Ga0439456_001801 3300042013 Bacteria 4322
443 Ga0439456_006597 3300042013 Bacteria 2375
444 Ga0439456_013271 3300042013 Bacteria 1714
445 Ga0439456_020437 3300042013 Bacteria 1396
446 Ga0439457_035433 3300042014 Bacteria 1110
447 Ga0439463_000359 3300042016 Bacteria 12684
448 Ga0439463_006594 3300042016 Bacteria 2874
449 Ga0439463_021408 3300042016 Bacteria 1614
450 Ga0450911_000009 3300042115 Bacteria 162968
451 Ga0450911_000510 3300042115 Bacteria 12299
452 Ga0450911_001101 3300042115 Bacteria 6752
453 Ga0450919_010242 3300042121 Bacteria 1073
454 Ga0450922_001118 3300042124 Bacteria 2663
455 Ga0450923_004694 3300042125 Bacteria 2158
456 Ga0450923_007230 3300042125 Bacteria 1869
457 Ga0450900_000709 3300042136 Bacteria 2825
458 Ga0450902_041111 3300042137 Bacteria 787
459 Ga0450903_002877 3300042138 Bacteria 3010
460 Ga0450903_003555 3300042138 Bacteria 2692
461 Ga0450905_000799 3300042142 Bacteria 3892
462 Ga0450906_003015 3300042145 Bacteria 3654
463 Ga0450907_000120 3300042146 Bacteria 30093
464 Ga0450910_000572 3300042147 Bacteria 4377
465 Ga0450910_007604 3300042147 Bacteria 1513
466 Ga0439446_0000066 3300042156 Bacteria 16983
467 Ga0439446_0009231 3300042156 Bacteria 2635
468 Ga0439446_0024885 3300042156 Bacteria 1710
469 Ga0439446_0031787 3300042156 Bacteria 1528
470 Ga0439434_0000831 3300042435 Bacteria 8910
471 Ga0439434_0001508 3300042435 Bacteria 6702
472 Ga0439434_0024151 3300042435 Bacteria 1833
473 Ga0439435_0000108 3300042436 Bacteria 10573
474 Ga0439435_0001905 3300042436 Bacteria 4001
475 Ga0439444_0013238 3300042437 Bacteria 1364
476 Ga0439464_0000770 3300042439 Bacteria 6979
477 Ga0439464_0012303 3300042439 Bacteria 2277
478 Ga0439464_0023797 3300042439 Bacteria 1692
479 Ga0439464_0075656 3300042439 Bacteria 1000
480 Ga0439460_0013355 3300042461 Bacteria 2147
481 Ga0439460_0014794 3300042461 Bacteria 2055
482 Ga0439460_0026357 3300042461 Bacteria 1625
483 Ga0450916_000452 3300042530 Bacteria 3535
484 Ga0451577_0004262 3300042876 Bacteria 15214
485 Ga0451577_0007024 3300042876 Bacteria 11104
486 Ga0439440_0002062 3300042993 Bacteria 3748
487 Ga0439440_0008036 3300042993 Bacteria 2156
488 Ga0439440_0030147 3300042993 Bacteria 1276
489 Ga0453684_0002778 3300044712 Bacteria 41417
490 Ga0453684_0333204 3300044712 Bacteria 1715
491 Ga0451576_0084912 3300045051 Bacteria 3293
492 Ga0495617_000263 3300046452 Bacteria 30333
493 Ga0495617_001790 3300046452 Bacteria 9164
494 Ga0495617_001945 3300046452 Bacteria 8668
495 Ga0495617_006314 3300046452 Bacteria 4163
496 Ga0495617_007955 3300046452 Bacteria 3665
497 Ga0495617_026788 3300046452 Bacteria 1941
498 Ga0495617_038440 3300046452 Bacteria 1601
499 Ga0495617_096457 3300046452 Bacteria 962
500 Ga0495617_108589 3300046452 Bacteria 898
501 Ga0495627_000039 3300046453 Bacteria 197253
502 Ga0495627_000140 3300046453 Bacteria 86227
503 Ga0495627_000203 3300046453 Bacteria 64485
504 Ga0495627_003143 3300046453 Bacteria 7459
505 Ga0495627_003323 3300046453 Bacteria 7153
506 Ga0495627_006275 3300046453 Bacteria 4672
507 Ga0495627_018494 3300046453 Bacteria 2348
508 Ga0495627_020609 3300046453 Bacteria 2195
509 Ga0495627_024236 3300046453 Bacteria 1979
510 Ga0495627_038820 3300046453 Bacteria 1471
511 Ga0495603_0026163 3300046455 Bacteria 3526
512 Ga0495590_0000235 3300046457 Bacteria 30406
513 Ga0495590_0001793 3300046457 Bacteria 9110
514 Ga0495590_0009342 3300046457 Bacteria 3719
515 Ga0495590_0011308 3300046457 Bacteria 3339
516 Ga0495591_000116 3300046458 Bacteria 92275
517 Ga0495591_000138 3300046458 Bacteria 78836
518 Ga0495591_000162 3300046458 Bacteria 71164
519 Ga0495591_000749 3300046458 Bacteria 23491
520 Ga0495591_002613 3300046458 Bacteria 9883
521 Ga0495591_004348 3300046458 Bacteria 6977
522 Ga0495591_004502 3300046458 Bacteria 6790
523 Ga0495591_004931 3300046458 Bacteria 6335
524 Ga0495591_005726 3300046458 Bacteria 5669
525 Ga0495591_006991 3300046458 Bacteria 4873
526 Ga0495591_013509 3300046458 Bacteria 2980
527 Ga0495638_0000196 3300046460 Bacteria 87444
528 Ga0495638_0000298 3300046460 Bacteria 64005
529 Ga0495638_0001043 3300046460 Bacteria 27399
530 Ga0495638_0003321 3300046460 Bacteria 12688
531 Ga0495638_0005270 3300046460 Bacteria 9660
532 Ga0495638_0008238 3300046460 Bacteria 7406
533 Ga0495638_0016482 3300046460 Bacteria 4948
534 Ga0495638_0017286 3300046460 Bacteria 4813
535 Ga0495638_0099766 3300046460 Bacteria 1737
536 Ga0495653_0001940 3300046463 Bacteria 16269
537 Ga0495653_0008459 3300046463 Bacteria 8438
538 Ga0495653_0068879 3300046463 Bacteria 2652
539 Ga0495653_0174142 3300046463 Bacteria 1482
540 Ga0495653_0229955 3300046463 Bacteria 1241
541 Ga0495650_0000077 3300046471 Bacteria 245511
542 Ga0495650_0001734 3300046471 Bacteria 19931
543 Ga0495650_0002021 3300046471 Bacteria 17769
544 Ga0495650_0002403 3300046471 Bacteria 15277
545 Ga0495650_0004530 3300046471 Bacteria 9490
546 Ga0495650_0008010 3300046471 Bacteria 6247
547 Ga0495650_0015875 3300046471 Bacteria 3844
548 Ga0495650_0020041 3300046471 Bacteria 3272
549 Ga0495650_0021794 3300046471 Bacteria 3084
550 Ga0495650_0023322 3300046471 Bacteria 2948
551 Ga0495650_0026329 3300046471 Bacteria 2707
552 Ga0495582_0005980 3300046473 Bacteria 6782
553 Ga0495605_0000002 3300046474 Bacteria 522417
554 Ga0495605_0000047 3300046474 Bacteria 171270
555 Ga0495605_0000279 3300046474 Bacteria 57152
556 Ga0495605_0000810 3300046474 Bacteria 22320
557 Ga0495605_0001142 3300046474 Bacteria 17614
558 Ga0495605_0001334 3300046474 Bacteria 16321
559 Ga0495605_0002151 3300046474 Bacteria 12315
560 Ga0495605_0006683 3300046474 Bacteria 6604
561 Ga0495605_0008450 3300046474 Bacteria 5819
562 Ga0495605_0013545 3300046474 Bacteria 4488
563 Ga0495605_0105906 3300046474 Bacteria 1288
564 Ga0495605_0151892 3300046474 Bacteria 1033
565 Ga0495605_0173453 3300046474 Bacteria 951
566 Ga0495639_0000059 3300046475 Bacteria 49016
567 Ga0495639_0017743 3300046475 Bacteria 3092
568 Ga0495584_0000579 3300046491 Bacteria 24738
569 Ga0495584_0002024 3300046491 Bacteria 11648
570 Ga0495584_0003053 3300046491 Bacteria 9298
571 Ga0495584_0019991 3300046491 Bacteria 3401
572 Ga0495584_0027799 3300046491 Bacteria 2866
573 Ga0495584_0028337 3300046491 Bacteria 2837
574 Ga0495584_0028993 3300046491 Bacteria 2805
575 Ga0495584_0029615 3300046491 Bacteria 2775
576 Ga0495584_0039340 3300046491 Bacteria 2388
577 Ga0495585_0000202 3300046492 Bacteria 62078
578 Ga0495585_0000333 3300046492 Bacteria 45988
579 Ga0495585_0000372 3300046492 Bacteria 43337
580 Ga0495585_0000622 3300046492 Bacteria 32989
581 Ga0495585_0007020 3300046492 Bacteria 6934
582 Ga0495585_0014085 3300046492 Bacteria 4669
583 Ga0495585_0036694 3300046492 Bacteria 2762
584 Ga0495585_0054670 3300046492 Bacteria 2206
585 Ga0495585_0078162 3300046492 Bacteria 1795
586 Ga0495594_0007594 3300046499 Bacteria 5580
587 Ga0495594_0036652 3300046499 Bacteria 2675
588 Ga0495594_0040160 3300046499 Bacteria 2559
589 Ga0495594_0307820 3300046499 Bacteria 903
590 Ga0495596_0000049 3300046500 Bacteria 87906
591 Ga0495596_0002506 3300046500 Bacteria 9838
592 Ga0495596_0108880 3300046500 Bacteria 1075
593 Ga0495607_0000043 3300046501 Bacteria 127616
594 Ga0495607_0000503 3300046501 Bacteria 39144
595 Ga0495607_0000770 3300046501 Bacteria 30744
596 Ga0495607_0002404 3300046501 Bacteria 15274
597 Ga0495607_0002730 3300046501 Bacteria 14079
598 Ga0495607_0003453 3300046501 Bacteria 12100
599 Ga0495607_0007340 3300046501 Bacteria 7638
600 Ga0495607_0012487 3300046501 Bacteria 5604
601 Ga0495607_0013496 3300046501 Bacteria 5351
602 Ga0495607_0023397 3300046501 Bacteria 3868
603 Ga0495607_0047363 3300046501 Bacteria 2519
604 Ga0495607_0049644 3300046501 Bacteria 2445
605 Ga0495607_0089212 3300046501 Bacteria 1674
606 Ga0495607_0104685 3300046501 Bacteria 1509
607 Ga0495607_0114963 3300046501 Bacteria 1421
608 Ga0495583_0000012 3300046506 Bacteria 324839
609 Ga0495583_0000528 3300046506 Bacteria 54010
610 Ga0495583_0000534 3300046506 Bacteria 53761
611 Ga0495583_0001642 3300046506 Bacteria 21784
612 Ga0495583_0002701 3300046506 Bacteria 14740
613 Ga0495583_0005647 3300046506 Bacteria 8425
614 Ga0495583_0012000 3300046506 Bacteria 4935
615 Ga0495606_0000207 3300046507 Bacteria 103669
616 Ga0495606_0001383 3300046507 Bacteria 32778
617 Ga0495606_0001516 3300046507 Bacteria 30798
618 Ga0495606_0001673 3300046507 Bacteria 28701
619 Ga0495606_0003190 3300046507 Bacteria 17683
620 Ga0495606_0004547 3300046507 Bacteria 13790
621 Ga0495606_0040858 3300046507 Bacteria 3113
622 Ga0495606_0042512 3300046507 Bacteria 3038
623 Ga0495606_0053208 3300046507 Bacteria 2627
624 Ga0495606_0059862 3300046507 Bacteria 2441
625 Ga0495606_0127326 3300046507 Bacteria 1517
626 Ga0495610_0002360 3300046512 Bacteria 15955
627 Ga0495610_0004087 3300046512 Bacteria 10939
628 Ga0495610_0006715 3300046512 Bacteria 7826
629 Ga0495610_0009393 3300046512 Bacteria 6190
630 Ga0495610_0009485 3300046512 Bacteria 6148
631 Ga0495610_0013198 3300046512 Bacteria 4920
632 Ga0495610_0024883 3300046512 Bacteria 3224
633 Ga0495610_0029643 3300046512 Bacteria 2878
634 Ga0495610_0090327 3300046512 Bacteria 1389
635 Ga0495610_0098211 3300046512 Bacteria 1315
636 Ga0495616_0001576 3300046513 Bacteria 15673
637 Ga0495616_0002736 3300046513 Bacteria 11540
638 Ga0495616_0016240 3300046513 Bacteria 4124
639 Ga0495616_0020170 3300046513 Bacteria 3630
640 Ga0495616_0034760 3300046513 Bacteria 2614
641 Ga0495616_0040210 3300046513 Bacteria 2390
642 Ga0495616_0042257 3300046513 Bacteria 2321
643 Ga0495616_0049796 3300046513 Bacteria 2097
644 Ga0495616_0050793 3300046513 Bacteria 2071
645 Ga0495620_0000010 3300046515 Bacteria 173604
646 Ga0495620_0000062 3300046515 Bacteria 93605
647 Ga0495620_0000855 3300046515 Bacteria 18810
648 Ga0495620_0000898 3300046515 Bacteria 18251
649 Ga0495620_0002748 3300046515 Bacteria 10135
650 Ga0495620_0003212 3300046515 Bacteria 9384
651 Ga0495620_0004920 3300046515 Bacteria 7493
652 Ga0495620_0015431 3300046515 Bacteria 3858
653 Ga0495620_0078137 3300046515 Bacteria 1342
654 Ga0495630_0003718 3300046517 Bacteria 10634
655 Ga0495630_0018138 3300046517 Bacteria 5167
656 Ga0495630_0429250 3300046517 Bacteria 1012
657 Ga0495630_0560957 3300046517 Unclassified 876
658 Ga0495631_0000002 3300046518 Bacteria 178694
659 Ga0495631_0000255 3300046518 Bacteria 36934
660 Ga0495631_0000479 3300046518 Bacteria 26745
661 Ga0495631_0005450 3300046518 Bacteria 6655
662 Ga0495631_0006994 3300046518 Bacteria 5775
663 Ga0495631_0008780 3300046518 Bacteria 5078
664 Ga0495631_0019680 3300046518 Bacteria 3164
665 Ga0495631_0179071 3300046518 Bacteria 908
666 Ga0495632_0000232 3300046519 Bacteria 55806
667 Ga0495632_0001723 3300046519 Bacteria 17774
668 Ga0495632_0003247 3300046519 Bacteria 11654
669 Ga0495632_0003257 3300046519 Bacteria 11625
670 Ga0495632_0008066 3300046519 Bacteria 6525
671 Ga0495632_0010340 3300046519 Bacteria 5535
672 Ga0495632_0011430 3300046519 Bacteria 5179
673 Ga0495632_0016203 3300046519 Bacteria 4152
674 Ga0495632_0016206 3300046519 Bacteria 4152
675 Ga0495632_0052108 3300046519 Bacteria 2012
676 Ga0495637_0000044 3300046520 Bacteria 111531
677 Ga0495637_0000127 3300046520 Bacteria 56837
678 Ga0495637_0002779 3300046520 Bacteria 9495
679 Ga0495637_0002832 3300046520 Bacteria 9403
680 Ga0495637_0003064 3300046520 Bacteria 8924
681 Ga0495637_0003435 3300046520 Bacteria 8412
682 Ga0495637_0004013 3300046520 Bacteria 7680
683 Ga0495637_0004709 3300046520 Bacteria 7041
684 Ga0495637_0005030 3300046520 Bacteria 6794
685 Ga0495637_0015510 3300046520 Bacteria 3573
686 Ga0495637_0026580 3300046520 Bacteria 2595
687 Ga0495637_0031028 3300046520 Bacteria 2366
688 Ga0495637_0035786 3300046520 Bacteria 2166
689 Ga0495643_0000049 3300046522 Bacteria 212242
690 Ga0495643_0000284 3300046522 Bacteria 72435
691 Ga0495643_0002169 3300046522 Bacteria 16068
692 Ga0495643_0003292 3300046522 Bacteria 11932
693 Ga0495643_0010678 3300046522 Bacteria 5641
694 Ga0495643_0013147 3300046522 Bacteria 4967
695 Ga0495643_0014053 3300046522 Bacteria 4774
696 Ga0495643_0030427 3300046522 Bacteria 3014
697 Ga0495643_0057520 3300046522 Bacteria 2072
698 Ga0495643_0107566 3300046522 Bacteria 1421
699 Ga0495644_0000159 3300046523 Bacteria 32152
700 Ga0495644_0000878 3300046523 Bacteria 12434
701 Ga0495644_0003676 3300046523 Bacteria 6036
702 Ga0495644_0045069 3300046523 Bacteria 1658
703 Ga0495644_0105559 3300046523 Bacteria 1067
704 Ga0495644_0111793 3300046523 Bacteria 1036
705 Ga0495648_0000337 3300046524 Bacteria 51818
706 Ga0495648_0001764 3300046524 Bacteria 20892
707 Ga0495648_0002321 3300046524 Bacteria 17712
708 Ga0495648_0002415 3300046524 Bacteria 17319
709 Ga0495648_0003859 3300046524 Bacteria 12999
710 Ga0495648_0004627 3300046524 Bacteria 11687
711 Ga0495648_0005118 3300046524 Bacteria 10985
712 Ga0495648_0015063 3300046524 Bacteria 5631
713 Ga0495648_0067018 3300046524 Bacteria 2101
714 Ga0495648_0104675 3300046524 Bacteria 1553
715 Ga0495666_0001016 3300046526 Bacteria 13312
716 Ga0495666_0084302 3300046526 Bacteria 1501
717 Ga0495666_0144543 3300046526 Bacteria 1107
718 Ga0495654_0000157 3300046530 Bacteria 67490
719 Ga0495654_0000197 3300046530 Bacteria 58733
720 Ga0495654_0000312 3300046530 Bacteria 42611
721 Ga0495654_0000350 3300046530 Bacteria 39799
722 Ga0495654_0000561 3300046530 Bacteria 30020
723 Ga0495654_0000851 3300046530 Bacteria 23130
724 Ga0495654_0004135 3300046530 Bacteria 8706
725 Ga0495654_0006790 3300046530 Bacteria 6463
726 Ga0495654_0012024 3300046530 Bacteria 4664
727 Ga0495654_0012774 3300046530 Bacteria 4507
728 Ga0495654_0013179 3300046530 Bacteria 4428
729 Ga0495654_0084028 3300046530 Bacteria 1487
730 Ga0495654_0094385 3300046530 Bacteria 1384
731 Ga0495654_0103854 3300046530 Bacteria 1304
732 Ga0495654_0243632 3300046530 Bacteria 751
733 Ga0495586_0009415 3300046535 Bacteria 5198
734 Ga0495587_0000089 3300046536 Bacteria 70764
735 Ga0495587_0007118 3300046536 Bacteria 7257
736 Ga0495609_0000008 3300046538 Bacteria 383025
737 Ga0495609_0000358 3300046538 Bacteria 39792
738 Ga0495609_0001094 3300046538 Bacteria 18849
739 Ga0495609_0001600 3300046538 Bacteria 14800
740 Ga0495609_0003087 3300046538 Bacteria 9763
741 Ga0495609_0003417 3300046538 Bacteria 9106
742 Ga0495609_0021168 3300046538 Bacteria 3000
743 Ga0495609_0025066 3300046538 Bacteria 2735
744 Ga0495609_0121162 3300046538 Bacteria 1124
745 Ga0495597_0001188 3300046542 Bacteria 19515
746 Ga0495597_0001323 3300046542 Bacteria 18107
747 Ga0495597_0001929 3300046542 Bacteria 14004
748 Ga0495597_0003566 3300046542 Bacteria 8980
749 Ga0495597_0004046 3300046542 Bacteria 8212
750 Ga0495597_0007169 3300046542 Bacteria 5690
751 Ga0495597_0048542 3300046542 Bacteria 1877
752 Ga0495597_0134034 3300046542 Bacteria 1025
753 Ga0495597_0153052 3300046542 Bacteria 945
754 Ga0495597_0172321 3300046542 Bacteria 878
755 Ga0495622_0000676 3300046557 Bacteria 19344
756 Ga0495622_0001176 3300046557 Bacteria 13538
757 Ga0495622_0002949 3300046557 Bacteria 8107
758 Ga0495622_0018880 3300046557 Bacteria 3213
759 Ga0495622_0059584 3300046557 Bacteria 1767
760 Ga0495622_0095630 3300046557 Bacteria 1363
761 Ga0495622_0111131 3300046557 Bacteria 1255
762 Ga0495622_0146145 3300046557 Bacteria 1071
763 Ga0495633_0000009 3300046558 Bacteria 293183
764 Ga0495633_0000571 3300046558 Bacteria 35869
765 Ga0495633_0000656 3300046558 Bacteria 31916
766 Ga0495633_0019067 3300046558 Bacteria 3472
767 Ga0495633_0079737 3300046558 Bacteria 1524
768 Ga0495656_0028652 3300046615 Bacteria 2235
769 Ga0495668_0000732 3300046616 Bacteria 39331
770 Ga0495668_0055195 3300046616 Bacteria 2194
771 Ga0495668_0131696 3300046616 Bacteria 1368
772 Ga0495668_0263722 3300046616 Bacteria 943
773 Ga0495634_0001522 3300046642 Bacteria 20497
774 Ga0495611_0000016 3300046648 Bacteria 129593
775 Ga0495611_0001351 3300046648 Bacteria 12402
776 Ga0495611_0003958 3300046648 Bacteria 6444
777 Ga0495611_0008920 3300046648 Bacteria 4242
778 Ga0495625_0002733 3300046660 Bacteria 18697
779 Ga0495625_0003014 3300046660 Bacteria 17347
780 Ga0495625_0003863 3300046660 Bacteria 14477
781 Ga0495625_0004081 3300046660 Bacteria 13941
782 Ga0495625_0012034 3300046660 Bacteria 7023
783 Ga0495625_0013745 3300046660 Bacteria 6490
784 Ga0495625_0018840 3300046660 Bacteria 5374
785 Ga0495625_0168253 3300046660 Bacteria 1465
786 Ga0495635_0000983 3300046663 Bacteria 18785
787 Ga0495635_0023127 3300046663 Bacteria 4330
788 Ga0495659_0000077 3300046664 Bacteria 42000
789 Ga0495661_0000001 3300046665 Bacteria 898372
790 Ga0495661_0000011 3300046665 Bacteria 277997
791 Ga0495661_0000029 3300046665 Bacteria 173899
792 Ga0495661_0003807 3300046665 Bacteria 11042
793 Ga0495661_0007031 3300046665 Bacteria 7868
794 Ga0495661_0011184 3300046665 Bacteria 6090
795 Ga0495661_0020002 3300046665 Bacteria 4377
796 Ga0495661_0034227 3300046665 Bacteria 3197
797 Ga0495661_0035823 3300046665 Bacteria 3111
798 Ga0495588_0017994 3300046674 Bacteria 3440
799 Ga0495623_0003928 3300046679 Bacteria 9802
800 Ga0495646_0000414 3300046680 Bacteria 22554
801 Ga0495658_0133364 3300046683 Bacteria 1514
802 Ga0495613_0009565 3300046689 Bacteria 7200
803 Ga0495613_0113470 3300046689 Bacteria 1951
804 Ga0495670_0000373 3300046691 Bacteria 21412
805 Ga0495670_0000395 3300046691 Bacteria 20827
806 Ga0495670_0000563 3300046691 Bacteria 17690
807 Ga0495670_0001267 3300046691 Bacteria 12345
808 Ga0495670_0019743 3300046691 Bacteria 3321
809 Ga0495671_0000141 3300046692 Bacteria 63480
810 Ga0495671_0000171 3300046692 Bacteria 57447
811 Ga0495671_0000324 3300046692 Bacteria 40091
812 Ga0495671_0000785 3300046692 Bacteria 22817
813 Ga0495671_0002246 3300046692 Bacteria 12279
814 Ga0495671_0002489 3300046692 Bacteria 11605
815 Ga0495671_0009284 3300046692 Bacteria 5498
816 Ga0495671_0015352 3300046692 Bacteria 4106
817 Ga0495671_0016168 3300046692 Bacteria 3989
818 Ga0495671_0022278 3300046692 Bacteria 3321
819 Ga0495671_0029587 3300046692 Bacteria 2811
820 Ga0495671_0030134 3300046692 Bacteria 2781
821 Ga0495671_0035004 3300046692 Bacteria 2552
822 Ga0495671_0055184 3300046692 Bacteria 1968
823 Ga0495671_0101716 3300046692 Bacteria 1404
824 Ga0495649_0000109 3300046694 Bacteria 72797
825 Ga0495649_0003158 3300046694 Bacteria 11259
826 Ga0495649_0007664 3300046694 Bacteria 6555
827 Ga0495649_0008372 3300046694 Bacteria 6223
828 Ga0495649_0014437 3300046694 Bacteria 4527
829 Ga0495649_0019373 3300046694 Bacteria 3824
830 Ga0495649_0032100 3300046694 Bacteria 2895
831 Ga0495649_0032228 3300046694 Bacteria 2888
832 Ga0495649_0039208 3300046694 Bacteria 2597
833 Ga0495649_0052466 3300046694 Bacteria 2209
834 Ga0495649_0064000 3300046694 Bacteria 1975
835 Ga0495589_0000234 3300046794 Bacteria 46522
836 Ga0495589_0000251 3300046794 Bacteria 43879
837 Ga0495589_0000448 3300046794 Bacteria 30373
838 Ga0495589_0009774 3300046794 Bacteria 4981
839 Ga0495589_0013282 3300046794 Bacteria 4250
840 Ga0495589_0013906 3300046794 Bacteria 4150
841 Ga0495589_0016201 3300046794 Bacteria 3830
842 Ga0495589_0031020 3300046794 Bacteria 2691
843 Ga0495600_0339222 3300046809 Bacteria 942
844 Ga0495660_0000876 3300046810 Bacteria 22242
845 Ga0495660_0001193 3300046810 Bacteria 18236
846 Ga0495660_0002216 3300046810 Bacteria 12514
847 Ga0495660_0006833 3300046810 Bacteria 6724
848 Ga0495660_0019752 3300046810 Bacteria 3866
849 Ga0495660_0022562 3300046810 Bacteria 3593
850 Ga0495660_0041553 3300046810 Bacteria 2545
851 Ga0495660_0108570 3300046810 Bacteria 1418
852 Ga0495660_0109801 3300046810 Bacteria 1408
853 Ga0495581_0007024 3300047315 Bacteria 6526
854 Ga0495604_0000559 3300047317 Bacteria 32736
855 Ga0495604_0009001 3300047317 Bacteria 7896
856 Ga0495636_0000899 3300047318 Bacteria 11042
857 Ga0495674_0010426 3300047319 Bacteria 8800
858 Ga0495672_0000210 3300047320 Bacteria 83349
859 Ga0495672_0000796 3300047320 Bacteria 34103
860 Ga0495672_0001891 3300047320 Bacteria 19913
861 Ga0495672_0003926 3300047320 Bacteria 12475
862 Ga0495672_0005049 3300047320 Bacteria 10550
863 Ga0495672_0014284 3300047320 Bacteria 5444
864 Ga0495672_0020951 3300047320 Bacteria 4272
865 Ga0495672_0027957 3300047320 Bacteria 3576
866 Ga0495672_0029012 3300047320 Bacteria 3491
867 Ga0495672_0031558 3300047320 Bacteria 3306
868 Ga0495672_0061979 3300047320 Bacteria 2153
869 Ga0495672_0104020 3300047320 Bacteria 1535
870 Ga0495676_0000001 3300047321 Bacteria 624167
871 Ga0495676_0000572 3300047321 Bacteria 30227
872 Ga0495676_0000985 3300047321 Bacteria 23912
873 Ga0495680_0027877 3300047322 Bacteria 4634
874 Ga0495680_0079138 3300047322 Bacteria 2486
875 Ga0495683_0000037 3300047323 Bacteria 140632
876 Ga0495683_0000042 3300047323 Bacteria 137528
877 Ga0495683_0000111 3300047323 Bacteria 83676
878 Ga0495683_0006727 3300047323 Bacteria 6263
879 Ga0495683_0009353 3300047323 Bacteria 5220
880 Ga0495683_0037417 3300047323 Bacteria 2460
881 Ga0495683_0044004 3300047323 Bacteria 2245
882 Ga0495683_0138236 3300047323 Bacteria 1143
883 Ga0495683_0164316 3300047323 Bacteria 1024
884 Ga0495687_010838 3300047443 Bacteria 4953
885 Ga0495687_180251 3300047443 Bacteria 690
886 Ga0495675_0029362 3300047444 Bacteria 3506
887 Ga0495675_0066734 3300047444 Bacteria 2274
888 Ga0495675_0161283 3300047444 Bacteria 1380
889 Ga0495679_000015 3300047446 Bacteria 287256
890 Ga0495679_000060 3300047446 Bacteria 109240
891 Ga0495679_000064 3300047446 Bacteria 102509
892 Ga0495679_000974 3300047446 Bacteria 17665
893 Ga0495679_002792 3300047446 Bacteria 8684
894 Ga0495679_003450 3300047446 Bacteria 7594
895 Ga0495679_008712 3300047446 Bacteria 4104
896 Ga0495679_036353 3300047446 Bacteria 1555
897 Ga0495679_056549 3300047446 Bacteria 1162
898 Ga0495685_009249 3300047447 Bacteria 3286
899 Ga0495673_0000093 3300047469 Bacteria 185841
900 Ga0495673_0000339 3300047469 Bacteria 59974
901 Ga0495673_0001677 3300047469 Bacteria 17028
902 Ga0495673_0001690 3300047469 Bacteria 16952
903 Ga0495673_0001966 3300047469 Bacteria 15215
904 Ga0495673_0004914 3300047469 Bacteria 8231
905 Ga0495673_0007217 3300047469 Bacteria 6422
906 Ga0495673_0008463 3300047469 Bacteria 5783
907 Ga0495673_0010394 3300047469 Bacteria 5065
908 Ga0495673_0019005 3300047469 Bacteria 3450
909 Ga0495673_0021726 3300047469 Bacteria 3161
910 Ga0495673_0062235 3300047469 Bacteria 1595
911 Ga0495673_0075450 3300047469 Bacteria 1408
912 Ga0495681_0000027 3300047470 Bacteria 141884
913 Ga0495681_0000029 3300047470 Bacteria 134816
914 Ga0495681_0000446 3300047470 Bacteria 31565
915 Ga0495681_0002127 3300047470 Bacteria 14384
916 Ga0495681_0002714 3300047470 Bacteria 12520
917 Ga0495681_0003007 3300047470 Bacteria 11865
918 Ga0495681_0003666 3300047470 Bacteria 10665
919 Ga0495681_0004766 3300047470 Bacteria 9189
920 Ga0495681_0005171 3300047470 Bacteria 8778
921 Ga0495681_0005800 3300047470 Bacteria 8204
922 Ga0495681_0007858 3300047470 Bacteria 6745
923 Ga0495681_0010319 3300047470 Bacteria 5657
924 Ga0495681_0019602 3300047470 Bacteria 3687
925 Ga0495681_0041755 3300047470 Bacteria 2225
926 Ga0495681_0067495 3300047470 Bacteria 1629
927 Ga0495681_0104050 3300047470 Bacteria 1237
928 Ga0495684_0014123 3300047471 Bacteria 6143
929 Ga0495686_0000816 3300047472 Bacteria 40191
930 Ga0495686_0001441 3300047472 Bacteria 25958
931 Ga0495686_0005737 3300047472 Bacteria 9705
932 Ga0495686_0007165 3300047472 Bacteria 8394
933 Ga0495686_0051251 3300047472 Bacteria 2590
934 Ga0495686_0100020 3300047472 Bacteria 1750
935 Ga0495686_0100704 3300047472 Bacteria 1742
936 Ga0495593_0001685 3300047673 Bacteria 13103
937 Ga0495593_0032810 3300047673 Bacteria 2829
938 Ga0495626_0000012 3300048091 Bacteria 258483
939 Ga0495626_0000072 3300048091 Bacteria 134289
940 Ga0495626_0000244 3300048091 Bacteria 63113
941 Ga0495626_0000340 3300048091 Bacteria 49123
942 Ga0495626_0000651 3300048091 Bacteria 33467
943 Ga0495626_0015946 3300048091 Bacteria 3833
944 Ga0495626_0020852 3300048091 Bacteria 3260
945 Ga0495626_0114754 3300048091 Bacteria 1163
946 Ga0496102_0000038 3300048905 Bacteria 198844
947 Ga0496102_0008777 3300048905 Bacteria 8668
948 Ga0496103_0085736 3300048906 Bacteria 1985
949 Ga0496105_0141115 3300048908 Bacteria 1983
950 Ga0496110_0016783 3300048913 Bacteria 6118
951 Ga0496110_0210089 3300048913 Bacteria 1769
952 Ga0496110_0292823 3300048913 Bacteria 1483
953 Ga0496110_0923813 3300048913 Bacteria 779
954 Ga0496111_0109636 3300048914 Bacteria 2032
955 Ga0496111_0198650 3300048914 Bacteria 1491
956 Ga0496116_0000697 3300048919 Bacteria 43533
957 Ga0496116_0002982 3300048919 Bacteria 17203
958 Ga0496116_0015222 3300048919 Bacteria 6092
959 Ga0496116_0022132 3300048919 Bacteria 4776
960 Ga0496116_0046944 3300048919 Bacteria 2911
961 Ga0496117_0001093 3300048920 Bacteria 40952
962 Ga0496117_0005893 3300048920 Bacteria 12663
963 Ga0496117_0018770 3300048920 Bacteria 5712
964 Ga0496118_0018132 3300048921 Bacteria 6366
965 Ga0496118_0022197 3300048921 Bacteria 5559
966 Ga0496119_0000086 3300048922 Bacteria 137053
967 Ga0496119_0028309 3300048922 Bacteria 3827
968 Ga0496120_0000130 3300048923 Bacteria 127368
969 Ga0496121_0001263 3300048924 Bacteria 43703
970 Ga0496121_0215892 3300048924 Bacteria 1355
971 Ga0496121_0222138 3300048924 Bacteria 1330
972 Ga0496122_0003361 3300048925 Bacteria 21087
973 Ga0496122_0010190 3300048925 Bacteria 9740
974 Ga0496122_0041006 3300048925 Bacteria 3669
975 Ga0496122_0088144 3300048925 Bacteria 2128
976 Ga0496122_0185175 3300048925 Bacteria 1236
977 Ga0496123_0039802 3300048926 Bacteria 3283
978 Ga0496123_0058461 3300048926 Bacteria 2500
979 Ga0496123_0099789 3300048926 Bacteria 1694
980 Ga0496124_0000047 3300048927 Bacteria 285554
981 Ga0496124_0004248 3300048927 Bacteria 16859
982 Ga0496124_0007750 3300048927 Bacteria 11344
983 Ga0496124_0014485 3300048927 Bacteria 7624
984 Ga0496124_0020742 3300048927 Bacteria 6065
985 Ga0496124_0025442 3300048927 Bacteria 5361
986 Ga0496124_0045681 3300048927 Bacteria 3754
987 Ga0496124_0146923 3300048927 Bacteria 1854
988 Ga0496125_0010352 3300048928 Bacteria 9435
989 Ga0496125_0018094 3300048928 Bacteria 6697
990 Ga0496125_0029276 3300048928 Bacteria 4953
991 Ga0496125_0064848 3300048928 Bacteria 2899
992 Ga0496125_0124374 3300048928 Bacteria 1831
993 Ga0496125_0341934 3300048928 Bacteria 898
994 Ga0496126_0003862 3300048929 Bacteria 18507
995 Ga0496126_0005970 3300048929 Bacteria 13695
996 Ga0496126_0115299 3300048929 Bacteria 2336
997 Ga0495678_000009 3300049459 Bacteria 373806
998 Ga0495678_000011 3300049459 Bacteria 335512
999 Ga0495678_000485 3300049459 Bacteria 39446
1000 Ga0495678_000707 3300049459 Bacteria 30373
1001 Ga0495678_003056 3300049459 Bacteria 10627
1002 Ga0495678_003070 3300049459 Bacteria 10596
1003 Ga0495678_004617 3300049459 Bacteria 7905
1004 Ga0495678_010366 3300049459 Bacteria 4536
1005 Ga0495678_011349 3300049459 Bacteria 4268
1006 Ga0495678_027553 3300049459 Bacteria 2410
1007 Ga0495682_0000071 3300049460 Bacteria 93349
1008 Ga0495682_0000709 3300049460 Bacteria 21844
1009 Ga0501031_0037603 3300049568 Bacteria 3159
1010 Ga0501031_0069145 3300049568 Bacteria 2300
1011 Ga0501032_0032906 3300049569 Bacteria 3553
1012 Ga0501033_0000969 3300049570 Bacteria 26048
1013 Ga0501033_0467589 3300049570 Bacteria 875
1014 Ga0501034_0000003 3300049571 Bacteria 471748
1015 Ga0501034_0000275 3300049571 Bacteria 92805
1016 Ga0501034_0096454 3300049571 Bacteria 2953
1017 Ga0501036_0004776 3300049572 Bacteria 10943
1018 Ga0501036_0088299 3300049572 Bacteria 2620
1019 Ga0501036_0293862 3300049572 Bacteria 1359
1020 Ga0501036_0372968 3300049572 Bacteria 1191
1021 Ga0501038_0004135 3300049574 Bacteria 13511
1022 Ga0501038_0017766 3300049574 Bacteria 6429
1023 Ga0501038_0394117 3300049574 Bacteria 1072
1024 Ga0501038_0493360 3300049574 Bacteria 937
1025 Ga0501039_0000053 3300049575 Bacteria 94861
1026 Ga0501039_0008307 3300049575 Bacteria 7911
1027 Ga0501039_0031542 3300049575 Bacteria 4086
1028 Ga0501039_0125835 3300049575 Bacteria 2010
1029 Ga0501039_0217723 3300049575 Bacteria 1501
1030 Ga0501039_0221580 3300049575 Bacteria 1487
1031 Ga0501039_0276853 3300049575 Bacteria 1319
1032 Ga0501040_0003435 3300049576 Bacteria 10226
1033 Ga0501040_0035217 3300049576 Bacteria 3394
1034 Ga0501040_0040334 3300049576 Bacteria 3177
1035 Ga0501040_0164117 3300049576 Bacteria 1571
1036 Ga0501040_0209964 3300049576 Bacteria 1384
1037 Ga0501041_0000066 3300049577 Bacteria 39606
1038 Ga0501041_0017023 3300049577 Bacteria 4325
1039 Ga0501041_0041248 3300049577 Bacteria 2803
1040 Ga0501042_0031363 3300049578 Bacteria 3759
1041 Ga0501042_0079068 3300049578 Bacteria 2355
1042 Ga0501042_0140113 3300049578 Bacteria 1744
1043 Ga0501042_0149922 3300049578 Bacteria 1681
1044 Ga0501042_0356778 3300049578 Bacteria 1058
1045 Ga0501046_0000927 3300049580 Bacteria 28785
1046 Ga0501046_0071810 3300049580 Bacteria 2688
1047 Ga0501046_0115867 3300049580 Bacteria 2043
1048 Ga0501046_0497252 3300049580 Bacteria 874
1049 Ga0501047_0082765 3300049581 Bacteria 3085
1050 Ga0501048_0000221 3300049582 Bacteria 37331
1051 Ga0501048_0055627 3300049582 Bacteria 2808
1052 Ga0501048_0197774 3300049582 Bacteria 1425
1053 Ga0501068_0007404 3300049584 Bacteria 6077
1054 Ga0501068_0038019 3300049584 Bacteria 2882
1055 Ga0501071_0001262 3300049587 Bacteria 14342
1056 Ga0501071_0029242 3300049587 Bacteria 3888
1057 Ga0501071_0258703 3300049587 Bacteria 1314
1058 Ga0501071_0401295 3300049587 Bacteria 1047
1059 Ga0501072_0000105 3300049588 Bacteria 62421
1060 Ga0501072_0010513 3300049588 Bacteria 7047
1061 Ga0501072_0013608 3300049588 Bacteria 6229
1062 Ga0501072_0046099 3300049588 Bacteria 3430
1063 Ga0501072_0159857 3300049588 Bacteria 1797
1064 Ga0501072_0353543 3300049588 Bacteria 1166
1065 Ga0501072_0530306 3300049588 Bacteria 930
1066 Ga0501074_0027924 3300049590 Bacteria 4090
1067 Ga0501074_0110725 3300049590 Bacteria 1965
1068 Ga0501074_0122338 3300049590 Bacteria 1861
1069 Ga0501075_0001570 3300049591 Bacteria 14931
1070 Ga0501075_0002056 3300049591 Bacteria 13320
1071 Ga0501075_0063036 3300049591 Bacteria 2795
1072 Ga0501075_0253005 3300049591 Bacteria 1343
1073 Ga0501076_0002055 3300049592 Bacteria 13788
1074 Ga0501076_0003744 3300049592 Bacteria 10690
1075 Ga0501076_0145000 3300049592 Bacteria 1930
1076 Ga0501076_0205395 3300049592 Bacteria 1609
1077 Ga0501076_0727295 3300049592 Bacteria 819
1078 Ga0501077_0000154 3300049593 Bacteria 38428
1079 Ga0501077_0045047 3300049593 Bacteria 2802
1080 Ga0501222_009074 3300049662 Bacteria 1316
1081 Ga0501079_0001492 3300049741 Bacteria 16563
1082 Ga0501079_0005056 3300049741 Bacteria 9790
1083 Ga0501079_0095884 3300049741 Bacteria 2299
1084 Ga0501079_0324347 3300049741 Bacteria 1206
1085 Ga0501080_0018328 3300049742 Bacteria 6479
1086 Ga0501081_0000630 3300049743 Bacteria 20114
1087 Ga0501081_0011713 3300049743 Bacteria 5740
1088 Ga0501081_0051193 3300049743 Bacteria 2848
1089 Ga0501081_0170281 3300049743 Bacteria 1572
1090 Ga0501081_0201216 3300049743 Bacteria 1444
1091 Ga0501083_0027575 3300049744 Bacteria 3919
1092 Ga0501083_0263849 3300049744 Bacteria 1120
1093 Ga0501265_001431 3300049762 Bacteria 2705
1094 Ga0501275_000169 3300049772 Bacteria 7475
1095 Ga0501282_013452 3300049778 Bacteria 886
1096 Ga0501035_0160164 3300049822 Bacteria 1949
1097 Ga0501045_0000451 3300049824 Bacteria 25372
1098 Ga0501045_0037692 3300049824 Bacteria 3515
1099 Ga0501045_0068120 3300049824 Bacteria 2614
1100 Ga0501045_0126348 3300049824 Bacteria 1900
1101 Ga0501226_000007 3300049853 Bacteria 227827
1102 nmdc:mga03683_20590_c1 3300050489 Bacteria 2533
1103 nmdc:mga00v17_376756_c1 3300050491 Bacteria 923
1104 nmdc:mga00v17_44145_c1 3300050491 Bacteria 2687
1105 nmdc:mga00v17_45937_c1 3300050491 Bacteria 2641
1106 nmdc:mga09592_263119_c1 3300050508 Bacteria 1496
1107 nmdc:mga09592_40386_c1 3300050508 Bacteria 3920
1108 nmdc:mga0qj67_29192_c1 3300050509 Bacteria 4283
1109 nmdc:mga0qj67_85155_c1 3300050509 Bacteria 2535
1110 nmdc:mga06r32_36532_c1 3300050510 Bacteria 4643
1111 nmdc:mga06r32_690_c1 3300050510 Bacteria 29444
1112 nmdc:mga08y16_37071_c1 3300050511 Bacteria 5120
1113 nmdc:mga08y16_830555_c1 3300050511 Unclassified 915
1114 nmdc:mga08x19_107900_c1 3300050514 Bacteria 1854
1115 nmdc:mga0sz30_30318_c1 3300050516 Bacteria 2234
1116 Ga0500610_0188454 3300053079 Bacteria 1004
1117 Ga0500659_0000004 3300053135 Bacteria 99715
1118 Ga0500568_0000504 3300053139 Bacteria 28743
1119 Ga0500573_0006243 3300053140 Bacteria 6431
1120 Ga0501084_0000671 3300054114 Bacteria 26137
1121 Ga0501084_0008454 3300054114 Bacteria 8510
1122 Ga0501084_0075142 3300054114 Bacteria 2831
1123 Ga0590077_024857 3300059426 Bacteria 1288
1124 Ga0501082_0008513 3300060353 Bacteria 8846
1125 Ga0501082_0024222 3300060353 Bacteria 5234
1126 Ga0501082_0130689 3300060353 Bacteria 2179
1127 Ga0530510_0001614 3300061734 Bacteria 15223
1128 Ga0530510_0028930 3300061734 Bacteria 3974

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042001 Ga0439441_069068 Ga0439441_069068_192_725 176
2 3300027665 Ga0209983_1036744 Ga0209983_10367441 184
3 iso_pu_bacteria 2511231022 2511362767 187
4 3300047443 Ga0495687_180251 Ga0495687_180251_96_677 193
5 3300049570 Ga0501033_0467589 Ga0501033_0467589_36_695 198
6 3300042125 Ga0450923_007230 Ga0450923_007230_311_919 200
7 3300042530 Ga0450916_000452 Ga0450916_000452_2895_3509 202
8 3300048928 Ga0496125_0124374 Ga0496125_0124374_1199_1807 202
9 3300049743 Ga0501081_0201216 Ga0501081_0201216_496_1125 203
10 3300048920 Ga0496117_0018770 Ga0496117_0018770_20_643 207
11 3300009148 Ga0105243_10002867 Ga0105243_100028675 210
12 3300015265 Ga0182005_1010131 Ga0182005_10101314 210
13 3300025935 Ga0207709_10056469 Ga0207709_100564692 210
14 3300048921 Ga0496118_0022197 Ga0496118_0022197_4390_5067 210
15 3300048929 Ga0496126_0005970 Ga0496126_0005970_5721_6398 210
16 3300025728 Ga0207655_1017660 Ga0207655_10176602 212
17 3300046517 Ga0495630_0560957 Ga0495630_0560957_18_662 212
18 3300005336 Ga0070680_100014625 Ga0070680_1000146252 213
19 3300005345 Ga0070692_10014293 Ga0070692_100142932 213
20 3300005440 Ga0070705_100018250 Ga0070705_1000182504 213
21 3300005444 Ga0070694_100010869 Ga0070694_1000108697 213
22 3300005471 Ga0070698_100544295 Ga0070698_1005442952 213
23 3300005545 Ga0070695_100094224 Ga0070695_1000942242 213
24 3300005546 Ga0070696_100100258 Ga0070696_1001002582 213
25 3300006844 Ga0075428_100127125 Ga0075428_1001271252 213
26 3300006846 Ga0075430_100009781 Ga0075430_1000097813 213
27 3300006846 Ga0075430_100012611 Ga0075430_1000126114 213
28 3300006847 Ga0075431_100014326 Ga0075431_1000143268 213
29 3300006880 Ga0075429_100017386 Ga0075429_1000173864 213
30 3300009147 Ga0114129_10128597 Ga0114129_101285975 213
31 3300025917 Ga0207660_10014715 Ga0207660_100147155 213
32 3300027471 Ga0209995_1007422 Ga0209995_10074223 213
33 3300027695 Ga0209966_1013396 Ga0209966_10133963 213
34 3300031548 Ga0307408_100125860 Ga0307408_1001258602 213
35 3300041410 Ga0439461_0006726 Ga0439461_0006726_411_1058 213
36 3300042001 Ga0439441_000448 Ga0439441_000448_3560_4204 213
37 3300042014 Ga0439457_035433 Ga0439457_035433_197_841 213
38 3300042435 Ga0439434_0000831 Ga0439434_0000831_4385_5032 213
39 3300042436 Ga0439435_0000108 Ga0439435_0000108_4637_5281 213
40 3300042436 Ga0439435_0001905 Ga0439435_0001905_984_1631 213
41 3300042437 Ga0439444_0013238 Ga0439444_0013238_704_1348 213
42 3300042461 Ga0439460_0013355 Ga0439460_0013355_1204_1848 213
43 3300042461 Ga0439460_0014794 Ga0439460_0014794_105_749 213
44 3300049568 Ga0501031_0037603 Ga0501031_0037603_1545_2204 213
45 3300049568 Ga0501031_0069145 Ga0501031_0069145_1625_2284 213
46 3300049569 Ga0501032_0032906 Ga0501032_0032906_640_1299 213
47 3300049570 Ga0501033_0000969 Ga0501033_0000969_11617_12276 213
48 3300049572 Ga0501036_0004776 Ga0501036_0004776_9747_10406 213
49 3300049572 Ga0501036_0088299 Ga0501036_0088299_1524_2168 213
50 3300049572 Ga0501036_0293862 Ga0501036_0293862_236_880 213
51 3300049572 Ga0501036_0372968 Ga0501036_0372968_507_1151 213
52 3300049574 Ga0501038_0004135 Ga0501038_0004135_10720_11379 213
53 3300049575 Ga0501039_0000053 Ga0501039_0000053_16204_16863 213
54 3300049575 Ga0501039_0008307 Ga0501039_0008307_4082_4726 213
55 3300049575 Ga0501039_0031542 Ga0501039_0031542_1512_2156 213
56 3300049575 Ga0501039_0125835 Ga0501039_0125835_648_1292 213
57 3300049575 Ga0501039_0221580 Ga0501039_0221580_670_1314 213
58 3300049575 Ga0501039_0276853 Ga0501039_0276853_128_772 213
59 3300049576 Ga0501040_0003435 Ga0501040_0003435_6845_7504 213
60 3300049576 Ga0501040_0035217 Ga0501040_0035217_1153_1797 213
61 3300049576 Ga0501040_0040334 Ga0501040_0040334_1965_2609 213
62 3300049576 Ga0501040_0209964 Ga0501040_0209964_310_954 213
63 3300049577 Ga0501041_0000066 Ga0501041_0000066_25193_25852 213
64 3300049577 Ga0501041_0017023 Ga0501041_0017023_231_875 213
65 3300049577 Ga0501041_0041248 Ga0501041_0041248_1197_1841 213
66 3300049578 Ga0501042_0031363 Ga0501042_0031363_2541_3200 213
67 3300049578 Ga0501042_0079068 Ga0501042_0079068_1229_1873 213
68 3300049578 Ga0501042_0140113 Ga0501042_0140113_424_1083 213
69 3300049578 Ga0501042_0149922 Ga0501042_0149922_273_917 213
70 3300049580 Ga0501046_0000927 Ga0501046_0000927_17350_18009 213
71 3300049580 Ga0501046_0071810 Ga0501046_0071810_1206_1850 213
72 3300049580 Ga0501046_0115867 Ga0501046_0115867_468_1127 213
73 3300049580 Ga0501046_0497252 Ga0501046_0497252_74_718 213
74 3300049581 Ga0501047_0082765 Ga0501047_0082765_119_778 213
75 3300049582 Ga0501048_0000221 Ga0501048_0000221_33736_34395 213
76 3300049582 Ga0501048_0055627 Ga0501048_0055627_868_1512 213
77 3300049582 Ga0501048_0197774 Ga0501048_0197774_436_1080 213
78 3300049584 Ga0501068_0007404 Ga0501068_0007404_729_1388 213
79 3300049587 Ga0501071_0001262 Ga0501071_0001262_12954_13613 213
80 3300049587 Ga0501071_0258703 Ga0501071_0258703_642_1286 213
81 3300049587 Ga0501071_0401295 Ga0501071_0401295_30_689 213
82 3300049588 Ga0501072_0000105 Ga0501072_0000105_16138_16797 213
83 3300049588 Ga0501072_0013608 Ga0501072_0013608_125_769 213
84 3300049588 Ga0501072_0046099 Ga0501072_0046099_708_1367 213
85 3300049588 Ga0501072_0353543 Ga0501072_0353543_461_1105 213
86 3300049588 Ga0501072_0530306 Ga0501072_0530306_237_881 213
87 3300049590 Ga0501074_0027924 Ga0501074_0027924_324_983 213
88 3300049590 Ga0501074_0122338 Ga0501074_0122338_771_1415 213
89 3300049591 Ga0501075_0001570 Ga0501075_0001570_1274_1918 213
90 3300049591 Ga0501075_0002056 Ga0501075_0002056_2723_3382 213
91 3300049591 Ga0501075_0063036 Ga0501075_0063036_1897_2541 213
92 3300049592 Ga0501076_0002055 Ga0501076_0002055_5653_6312 213
93 3300049592 Ga0501076_0003744 Ga0501076_0003744_6687_7331 213
94 3300049592 Ga0501076_0145000 Ga0501076_0145000_564_1223 213
95 3300049593 Ga0501077_0000154 Ga0501077_0000154_9441_10100 213
96 3300049593 Ga0501077_0045047 Ga0501077_0045047_780_1424 213
97 3300049741 Ga0501079_0001492 Ga0501079_0001492_13773_14432 213
98 3300049741 Ga0501079_0005056 Ga0501079_0005056_5424_6068 213
99 3300049743 Ga0501081_0000630 Ga0501081_0000630_12611_13270 213
100 3300049743 Ga0501081_0011713 Ga0501081_0011713_3186_3830 213
101 3300049743 Ga0501081_0051193 Ga0501081_0051193_1420_2064 213
102 3300049744 Ga0501083_0027575 Ga0501083_0027575_576_1235 213
103 3300049744 Ga0501083_0263849 Ga0501083_0263849_47_691 213
104 3300049822 Ga0501035_0160164 Ga0501035_0160164_322_966 213
105 3300049824 Ga0501045_0000451 Ga0501045_0000451_6845_7504 213
106 3300049824 Ga0501045_0037692 Ga0501045_0037692_2102_2761 213
107 3300049824 Ga0501045_0068120 Ga0501045_0068120_318_962 213
108 3300049824 Ga0501045_0126348 Ga0501045_0126348_134_778 213
109 3300050508 nmdc:mga09592_40386_c1 nmdc:mga09592_40386_c1_519_1163 213
110 3300050509 nmdc:mga0qj67_29192_c1 nmdc:mga0qj67_29192_c1_181_840 213
111 3300050510 nmdc:mga06r32_36532_c1 nmdc:mga06r32_36532_c1_1335_1979 213
112 3300054114 Ga0501084_0000671 Ga0501084_0000671_16172_16831 213
113 3300054114 Ga0501084_0008454 Ga0501084_0008454_5412_6056 213
114 3300054114 Ga0501084_0075142 Ga0501084_0075142_1132_1791 213
115 3300059426 Ga0590077_024857 Ga0590077_024857_23_667 213
116 3300060353 Ga0501082_0008513 Ga0501082_0008513_2078_2737 213
117 3300060353 Ga0501082_0024222 Ga0501082_0024222_1089_1733 213
118 3300060353 Ga0501082_0130689 Ga0501082_0130689_708_1367 213
119 3300061734 Ga0530510_0001614 Ga0530510_0001614_3128_3772 213
120 3300061734 Ga0530510_0028930 Ga0530510_0028930_2269_2928 213
121 iso_pu_bacteria 2600254954 2600446923 213
122 iso_pu_bacteria 2600255389 2602010186 213
123 iso_pu_bacteria 2823421272 2823422709 213
124 iso_pu_bacteria 2919493220 2919493933 213
125 iso_pu_bacteria 2919543075 2919545814 213
126 iso_pu_bacteria 2923525760 2923527526 213
127 iso_pu_bacteria 8034962539 8034966151 213
128 3300035398 Ga0316574_0002215 Ga0316574_0002215_2493_3146 214
129 3300036647 Ga0316582_0010867 Ga0316582_0010867_2863_3516 214
130 3300031727 Ga0316576_10009168 Ga0316576_100091684 215
131 3300031728 Ga0316578_10029071 Ga0316578_100290712 215
132 3300032002 Ga0307416_100293500 Ga0307416_1002935002 215
133 iso_pu_bacteria 2643221581 2643914663 216
134 iso_pu_bacteria 2808606379 2808942540 216
135 iso_pu_bacteria 2842391507 2842392255 216
136 iso_pu_bacteria 2852684882 2852687069 216
137 iso_pu_bacteria 2923516293 2923517119 216
138 iso_pu_bacteria 2990196909 2990198397 216
139 iso_pu_bacteria 8021622325 8021624947 216
140 iso_pu_bacteria 8021626552 8021626790 216
141 iso_pu_bacteria 8021648035 8021650056 216
142 3300031548 Ga0307408_100000047 Ga0307408_10000004789 217
143 3300042439 Ga0439464_0000770 Ga0439464_0000770_2432_3091 217
144 iso_pu_bacteria 2728369097 2729145016 217
145 iso_pu_bacteria 640427133 640486867 217
146 iso_pu_bacteria 651053060 651174723 217
147 3300031616 Ga0307508_10078052 Ga0307508_100780522 218
148 3300036647 Ga0316582_0058437 Ga0316582_0058437_43_699 218
149 3300036712 Ga0316584_0114042 Ga0316584_0114042_1058_1714 218
150 3300049574 Ga0501038_0017766 Ga0501038_0017766_4171_4827 218
151 iso_pu_bacteria 2984568884 2984569972 218
152 3300005334 Ga0068869_100432542 Ga0068869_1004325422 219
153 3300005335 Ga0070666_10011793 Ga0070666_100117935 219
154 3300005344 Ga0070661_100011542 Ga0070661_1000115422 219
155 3300005347 Ga0070668_100001244 Ga0070668_10000124410 219
156 3300005355 Ga0070671_100205240 Ga0070671_1002052402 219
157 3300005455 Ga0070663_100009462 Ga0070663_1000094627 219
158 3300005539 Ga0068853_100608259 Ga0068853_1006082592 219
159 3300005563 Ga0068855_100059513 Ga0068855_1000595133 219
160 3300005564 Ga0070664_100014557 Ga0070664_1000145575 219
161 3300005577 Ga0068857_100219116 Ga0068857_1002191162 219
162 3300005614 Ga0068856_100005484 Ga0068856_1000054847 219
163 3300005616 Ga0068852_100016445 Ga0068852_1000164452 219
164 3300005617 Ga0068859_100724752 Ga0068859_1007247522 219
165 3300005618 Ga0068864_100101506 Ga0068864_1001015061 219
166 3300005841 Ga0068863_100112621 Ga0068863_1001126212 219
167 3300005842 Ga0068858_100018150 Ga0068858_1000181507 219
168 3300005843 Ga0068860_100049041 Ga0068860_1000490416 219
169 3300006237 Ga0097621_100229426 Ga0097621_1002294262 219
170 3300006358 Ga0068871_100084532 Ga0068871_1000845322 219
171 3300006881 Ga0068865_100006683 Ga0068865_1000066836 219
172 3300006931 Ga0097620_100724861 Ga0097620_1007248612 219
173 3300009093 Ga0105240_10186568 Ga0105240_101865683 219
174 3300009093 Ga0105240_10890075 Ga0105240_108900752 219
175 3300009101 Ga0105247_10112543 Ga0105247_101125432 219
176 3300009177 Ga0105248_10043825 Ga0105248_100438256 219
177 3300009545 Ga0105237_10177519 Ga0105237_101775193 219
178 3300009551 Ga0105238_10192285 Ga0105238_101922852 219
179 3300010375 Ga0105239_10037499 Ga0105239_100374996 219
180 3300013296 Ga0157374_10037667 Ga0157374_100376675 219
181 3300013307 Ga0157372_10026527 Ga0157372_100265274 219
182 3300014325 Ga0163163_10104001 Ga0163163_101040012 219
183 3300025900 Ga0207710_10114076 Ga0207710_101140762 219
184 3300025903 Ga0207680_10400830 Ga0207680_104008302 219
185 3300025904 Ga0207647_10067925 Ga0207647_100679251 219
186 3300025931 Ga0207644_10030980 Ga0207644_100309803 219
187 3300025941 Ga0207711_10594429 Ga0207711_105944292 219
188 3300025942 Ga0207689_10123987 Ga0207689_101239874 219
189 3300025949 Ga0207667_10698138 Ga0207667_106981382 219
190 3300025960 Ga0207651_10413336 Ga0207651_104133361 219
191 3300025972 Ga0207668_10000866 Ga0207668_100008669 219
192 3300026023 Ga0207677_10116517 Ga0207677_101165173 219
193 3300026035 Ga0207703_10127412 Ga0207703_101274123 219
194 3300026041 Ga0207639_10170170 Ga0207639_101701702 219
195 3300026067 Ga0207678_10014112 Ga0207678_100141127 219
196 3300026088 Ga0207641_10059699 Ga0207641_100596994 219
197 3300026116 Ga0207674_10014157 Ga0207674_100141572 219
198 3300026142 Ga0207698_10083754 Ga0207698_100837542 219
199 3300028381 Ga0268264_10183688 Ga0268264_101836882 219
200 3300028653 Ga0265323_10011964 Ga0265323_100119645 219
201 3300031344 Ga0265316_10029947 Ga0265316_100299474 219
202 3300031344 Ga0265316_10062393 Ga0265316_100623931 219
203 3300031344 Ga0265316_10096499 Ga0265316_100964993 219
204 3300031344 Ga0265316_10100443 Ga0265316_101004433 219
205 3300031616 Ga0307508_10203368 Ga0307508_102033682 219
206 3300031711 Ga0265314_10182434 Ga0265314_101824342 219
207 3300032133 Ga0316583_10001608 Ga0316583_100016088 219
208 3300035092 Ga0373952_0000171 Ga0373952_0000171_4728_5387 219
209 3300035116 Ga0373945_0141493 Ga0373945_0141493_34_693 219
210 3300035121 Ga0373960_0003863 Ga0373960_0003863_1047_1706 219
211 3300041411 Ga0439466_0002518 Ga0439466_0002518_4586_5251 219
212 3300044712 Ga0453684_0002778 Ga0453684_0002778_6348_7007 219
213 3300045051 Ga0451576_0084912 Ga0451576_0084912_428_1087 219
214 3300048928 Ga0496125_0341934 Ga0496125_0341934_184_843 219
215 3300053139 Ga0500568_0000504 Ga0500568_0000504_24465_25124 219
216 iso_pu_bacteria 8055878733 8055882996 219
217 2162886007 SwRhRL2b_contig_1398382 SwRhRL2b_0147.00006300 220
218 3300003781 Ga0055536_1004947 Ga0055536_10049474 220
219 3300005289 Ga0065704_10070749 Ga0065704_100707496 220
220 3300005548 Ga0070665_100217303 Ga0070665_1002173032 220
221 3300006846 Ga0075430_100096463 Ga0075430_1000964632 220
222 3300006847 Ga0075431_100005495 Ga0075431_10000549515 220
223 3300009177 Ga0105248_10725386 Ga0105248_107253862 220
224 3300025292 Ga0209676_1000068 Ga0209676_1000068254 220
225 3300025292 Ga0209676_1021986 Ga0209676_10219862 220
226 3300025298 Ga0209050_1048449 Ga0209050_10484492 220
227 3300042156 Ga0439446_0000066 Ga0439446_0000066_14631_15299 220
228 3300046499 Ga0495594_0307820 Ga0495594_0307820_95_763 220
229 3300047322 Ga0495680_0079138 Ga0495680_0079138_1503_2171 220
230 3300048925 Ga0496122_0041006 Ga0496122_0041006_962_1657 220
231 3300048926 Ga0496123_0058461 Ga0496123_0058461_972_1667 220
232 3300048928 Ga0496125_0018094 Ga0496125_0018094_149_823 220
233 3300049571 Ga0501034_0000275 Ga0501034_0000275_48100_48774 220
234 3300049762 Ga0501265_001431 Ga0501265_001431_573_1316 220
235 3300049772 Ga0501275_000169 Ga0501275_000169_2968_3711 220
236 3300050509 nmdc:mga0qj67_85155_c1 nmdc:mga0qj67_85155_c1_402_1067 220
237 3300050510 nmdc:mga06r32_690_c1 nmdc:mga06r32_690_c1_21932_22597 220
238 iso_pu_bacteria 2510065053 2510282939 220
239 iso_pu_bacteria 2510065055 2510293613 220
240 iso_pu_bacteria 2510065058 2510310781 220
241 iso_pu_bacteria 2511231006 2511265462 220
242 iso_pu_bacteria 2511231008 2511278231 220
243 iso_pu_bacteria 2511231012 2511304116 220
244 iso_pu_bacteria 2511231018 2511337894 220
245 iso_pu_bacteria 2511231019 2511343808 220
246 iso_pu_bacteria 2511231021 2511357712 220
247 iso_pu_bacteria 2511231031 2511411906 220
248 iso_pu_bacteria 2511231156 2511825067 220
249 iso_pu_bacteria 2512047018 2512327282 220
250 iso_pu_bacteria 2554235231 2555248493 220
251 iso_pu_bacteria 2582580891 2583792473 220
252 iso_pu_bacteria 2599185155 2599330257 220
253 iso_pu_bacteria 2599185188 2599501586 220
254 iso_pu_bacteria 2599185212 2599611760 220
255 iso_pu_bacteria 2599185248 2599768906 220
256 iso_pu_bacteria 2599185288 2599881389 220
257 iso_pu_bacteria 2599185289 2599884690 220
258 iso_pu_bacteria 2599185291 2599896131 220
259 iso_pu_bacteria 2599185300 2599931493 220
260 iso_pu_bacteria 2599185302 2599945165 220
261 iso_pu_bacteria 2599185304 2599955483 220
262 iso_pu_bacteria 2599185305 2599958017 220
263 iso_pu_bacteria 2599185306 2599968614 220
264 iso_pu_bacteria 2599185307 2599971213 220
265 iso_pu_bacteria 2599185308 2599979806 220
266 iso_pu_bacteria 2599185309 2599984340 220
267 iso_pu_bacteria 2599185310 2599990489 220
268 iso_pu_bacteria 2599185312 2600001570 220
269 iso_pu_bacteria 2599185313 2600003895 220
270 iso_pu_bacteria 2599185314 2600013618 220
271 iso_pu_bacteria 2599185315 2600015740 220
272 iso_pu_bacteria 2599185318 2600034027 220
273 iso_pu_bacteria 2599185319 2600040454 220
274 iso_pu_bacteria 2599185320 2600049148 220
275 iso_pu_bacteria 2599185321 2600050947 220
276 iso_pu_bacteria 2599185322 2600058612 220
277 iso_pu_bacteria 2599185323 2600063458 220
278 iso_pu_bacteria 2599185324 2600069017 220
279 iso_pu_bacteria 2619619299 2621299648 220
280 iso_pu_bacteria 2623620443 2624481303 220
281 iso_pu_bacteria 2623620446 2624492699 220
282 iso_pu_bacteria 2643221565 2643842136 220
283 iso_pu_bacteria 2643221589 2643954535 220
284 iso_pu_bacteria 2643221602 2644023344 220
285 iso_pu_bacteria 2643221650 2644281189 220
286 iso_pu_bacteria 2651869719 2652548166 220
287 iso_pu_bacteria 2667528170 2671088825 220
288 iso_pu_bacteria 2713897149 2715755806 220
289 iso_pu_bacteria 2738541265 2738669648 220
290 iso_pu_bacteria 2738541271 2738687774 220
291 iso_pu_bacteria 2738541282 2738748041 220
292 iso_pu_bacteria 2738541294 2738806905 220
293 iso_pu_bacteria 2738541303 2738857083 220
294 iso_pu_bacteria 2738541309 2738894265 220
295 iso_pu_bacteria 2738543004 2739197431 220
296 iso_pu_bacteria 2738543016 2739263791 220
297 iso_pu_bacteria 2738543020 2739287577 220
298 iso_pu_bacteria 2738543021 2739292890 220
299 iso_pu_bacteria 2738543025 2739315334 220
300 iso_pu_bacteria 2773857670 2774123626 220
301 iso_pu_bacteria 2784132072 2784317207 220
302 iso_pu_bacteria 2791355520 2794597938 220
303 iso_pu_bacteria 2806310737 2807408006 220
304 iso_pu_bacteria 2806310745 2807456309 220
305 iso_pu_bacteria 2808606373 2808904457 220
306 iso_pu_bacteria 2808606377 2808932765 220
307 iso_pu_bacteria 2808606381 2808954845 220
308 iso_pu_bacteria 2808606382 2808956215 220
309 iso_pu_bacteria 2808606385 2808979728 220
310 iso_pu_bacteria 2808606388 2808995448 220
311 iso_pu_bacteria 2811994881 2812370060 220
312 iso_pu_bacteria 2816332298 2817491000 220
313 iso_pu_bacteria 2818991456 2819657822 220
314 iso_pu_bacteria 2825651385 2825652154 220
315 iso_pu_bacteria 2826581358 2826586057 220
316 iso_pu_bacteria 2834028612 2834029888 220
317 iso_pu_bacteria 2842815866 2842819095 220
318 iso_pu_bacteria 2842849001 2842853370 220
319 iso_pu_bacteria 2842854478 2842858571 220
320 iso_pu_bacteria 2844665904 2844670002 220
321 iso_pu_bacteria 2852612431 2852614515 220
322 iso_pu_bacteria 2852667396 2852667747 220
323 iso_pu_bacteria 2860339153 2860345530 220
324 iso_pu_bacteria 2878029506 2878033258 220
325 iso_pu_bacteria 2880230671 2880234017 220
326 iso_pu_bacteria 2908446538 2908449665 220
327 iso_pu_bacteria 2912963787 2912966553 220
328 iso_pu_bacteria 2913036834 2913040166 220
329 iso_pu_bacteria 2917832318 2917836868 220
330 iso_pu_bacteria 2919155634 2919158500 220
331 iso_pu_bacteria 2919385768 2919390363 220
332 iso_pu_bacteria 2919456309 2919456314 220
333 iso_pu_bacteria 2919481497 2919483192 220
334 iso_pu_bacteria 2919697872 2919702606 220
335 iso_pu_bacteria 2923519811 2923524146 220
336 iso_pu_bacteria 2923586266 2923588270 220
337 iso_pu_bacteria 2931369376 2931375015 220
338 iso_pu_bacteria 2931396565 2931402719 220
339 iso_pu_bacteria 2947233263 2947233588 220
340 iso_pu_bacteria 2952252522 2952253712 220
341 iso_pu_bacteria 2974298342 2974302569 220
342 iso_pu_bacteria 2984499530 2984499846 220
343 iso_pu_bacteria 2988728565 2988728990 220
344 iso_pu_bacteria 3007511990 3007514658 220
345 iso_pu_bacteria 3007803356 3007804448 220
346 iso_pu_bacteria 3007872151 3007875114 220
347 iso_pu_bacteria 8011350971 8011351956 220
348 iso_pu_bacteria 8015687852 8015690852 220
349 iso_pu_bacteria 8019775933 8019781091 220
350 iso_pu_bacteria 8029995093 8029998083 220
351 iso_pu_bacteria 8052494512 8052497744 220
352 iso_pu_bacteria 8054285046 8054291256 220
353 iso_pu_bacteria 8054503363 8054506346 220
354 iso_pu_bacteria 8054929484 8054931568 220
355 iso_pu_bacteria 8055770955 8055774023 220
356 iso_pu_bacteria 8056125926 8056129043 220
357 iso_pu_bacteria 8056131705 8056134760 220
358 iso_pu_bacteria 8056143049 8056145949 220
359 iso_pu_bacteria 8056166840 8056168508 220
360 iso_pu_bacteria 8056172158 8056173902 220
361 iso_pu_bacteria 8056177738 8056177742 220
362 iso_pu_bacteria 8056569372 8056571049 220
363 3300031691 Ga0316579_10009679 Ga0316579_100096795 221
364 3300031733 Ga0316577_10076554 Ga0316577_100765542 221
365 3300036647 Ga0316582_0088112 Ga0316582_0088112_891_1556 221
366 3300036712 Ga0316584_0223231 Ga0316584_0223231_225_890 221
367 3300037588 Ga0316581_0096076 Ga0316581_0096076_37_702 221
368 3300042876 Ga0451577_0004262 Ga0451577_0004262_164_829 221
369 3300049575 Ga0501039_0217723 Ga0501039_0217723_647_1321 221
370 3300049584 Ga0501068_0038019 Ga0501068_0038019_1643_2317 221
371 3300049587 Ga0501071_0029242 Ga0501071_0029242_2353_3027 221
372 3300049588 Ga0501072_0010513 Ga0501072_0010513_1009_1683 221
373 3300049590 Ga0501074_0110725 Ga0501074_0110725_224_898 221
374 3300049592 Ga0501076_0205395 Ga0501076_0205395_556_1230 221
375 3300049741 Ga0501079_0095884 Ga0501079_0095884_384_1058 221
376 3300049742 Ga0501080_0018328 Ga0501080_0018328_3092_3766 221
377 3300049743 Ga0501081_0170281 Ga0501081_0170281_46_720 221
378 2162886012 MBSR1b_contig_14104337 MBSR1b_0157.00003410 222
379 2162886012 MBSR1b_contig_2013439 MBSR1b_0236.00006620 222
380 2162886012 MBSR1b_contig_7046176 MBSR1b_0835.00006310 222
381 3300005331 Ga0070670_100045437 Ga0070670_1000454374 222
382 3300005331 Ga0070670_100103194 Ga0070670_1001031943 222
383 3300005347 Ga0070668_100006258 Ga0070668_1000062583 222
384 3300005353 Ga0070669_100084129 Ga0070669_1000841292 222
385 3300005354 Ga0070675_100019354 Ga0070675_1000193544 222
386 3300005354 Ga0070675_100035489 Ga0070675_1000354893 222
387 3300005365 Ga0070688_100369696 Ga0070688_1003696962 222
388 3300005367 Ga0070667_100031180 Ga0070667_1000311805 222
389 3300005441 Ga0070700_100176345 Ga0070700_1001763452 222
390 3300005456 Ga0070678_100520271 Ga0070678_1005202712 222
391 3300005457 Ga0070662_100067167 Ga0070662_1000671674 222
392 3300005543 Ga0070672_100630325 Ga0070672_1006303252 222
393 3300005548 Ga0070665_100064152 Ga0070665_1000641524 222
394 3300005577 Ga0068857_100223848 Ga0068857_1002238482 222
395 3300005618 Ga0068864_100183681 Ga0068864_1001836812 222
396 3300005840 Ga0068870_10010401 Ga0068870_100104015 222
397 3300005841 Ga0068863_100533439 Ga0068863_1005334392 222
398 3300005843 Ga0068860_100819355 Ga0068860_1008193551 222
399 3300005844 Ga0068862_100109262 Ga0068862_1001092622 222
400 3300006237 Ga0097621_100555393 Ga0097621_1005553932 222
401 3300006880 Ga0075429_100072638 Ga0075429_1000726383 222
402 3300006881 Ga0068865_100237600 Ga0068865_1002376002 222
403 3300009094 Ga0111539_10265555 Ga0111539_102655552 222
404 3300009553 Ga0105249_10026653 Ga0105249_100266535 222
405 3300013306 Ga0163162_10198059 Ga0163162_101980591 222
406 3300013308 Ga0157375_10025389 Ga0157375_100253891 222
407 3300014325 Ga0163163_10148815 Ga0163163_101488152 222
408 3300014326 Ga0157380_10071701 Ga0157380_100717013 222
409 3300014326 Ga0157380_10108487 Ga0157380_101084872 222
410 3300014745 Ga0157377_10216381 Ga0157377_102163812 222
411 3300014968 Ga0157379_10596819 Ga0157379_105968192 222
412 3300025901 Ga0207688_10112727 Ga0207688_101127272 222
413 3300025907 Ga0207645_10017381 Ga0207645_100173812 222
414 3300025908 Ga0207643_10023040 Ga0207643_100230404 222
415 3300025925 Ga0207650_10041412 Ga0207650_100414123 222
416 3300025926 Ga0207659_10004554 Ga0207659_100045544 222
417 3300025926 Ga0207659_10212090 Ga0207659_102120902 222
418 3300025933 Ga0207706_10064186 Ga0207706_100641864 222
419 3300025972 Ga0207668_10002134 Ga0207668_100021349 222
420 3300026075 Ga0207708_10124035 Ga0207708_101240352 222
421 3300026089 Ga0207648_10205801 Ga0207648_102058012 222
422 3300026095 Ga0207676_10241605 Ga0207676_102416052 222
423 3300026095 Ga0207676_10401223 Ga0207676_104012232 222
424 3300026118 Ga0207675_100050770 Ga0207675_1000507704 222
425 3300027907 Ga0207428_10019253 Ga0207428_100192533 222
426 3300027907 Ga0207428_10225764 Ga0207428_102257642 222
427 3300028379 Ga0268266_10048863 Ga0268266_100488632 222
428 3300028380 Ga0268265_10007470 Ga0268265_100074707 222
429 3300028381 Ga0268264_10523369 Ga0268264_105233692 222
430 3300041404 Ga0439436_0024245 Ga0439436_0024245_1019_1693 222
431 3300041405 Ga0439438_000395 Ga0439438_000395_17614_18288 222
432 3300041407 Ga0439447_003573 Ga0439447_003573_98_772 222
433 3300041411 Ga0439466_0004909 Ga0439466_0004909_2979_3653 222
434 3300042006 Ga0439432_018715 Ga0439432_018715_556_1230 222
435 3300042010 Ga0439452_004509 Ga0439452_004509_1087_1761 222
436 3300042121 Ga0450919_010242 Ga0450919_010242_144_818 222
437 3300042125 Ga0450923_004694 Ga0450923_004694_885_1571 222
438 3300042156 Ga0439446_0024885 Ga0439446_0024885_788_1462 222
439 3300044712 Ga0453684_0333204 Ga0453684_0333204_498_1175 222
440 3300046453 Ga0495627_000140 Ga0495627_000140_14507_15190 222
441 3300046471 Ga0495650_0015875 Ga0495650_0015875_1322_2005 222
442 3300046492 Ga0495585_0000333 Ga0495585_0000333_11176_11853 222
443 3300046518 Ga0495631_0000479 Ga0495631_0000479_14275_14958 222
444 3300046519 Ga0495632_0011430 Ga0495632_0011430_3152_3835 222
445 3300046530 Ga0495654_0000561 Ga0495654_0000561_13148_13831 222
446 3300046665 Ga0495661_0000011 Ga0495661_0000011_229732_230409 222
447 3300046692 Ga0495671_0002489 Ga0495671_0002489_6368_7051 222
448 3300047320 Ga0495672_0001891 Ga0495672_0001891_15696_16379 222
449 3300048913 Ga0496110_0923813 Ga0496110_0923813_78_749 222
450 3300049571 Ga0501034_0096454 Ga0501034_0096454_2182_2856 222
451 3300049574 Ga0501038_0394117 Ga0501038_0394117_372_1052 222
452 3300049574 Ga0501038_0493360 Ga0501038_0493360_28_714 222
453 3300049576 Ga0501040_0164117 Ga0501040_0164117_813_1499 222
454 3300049578 Ga0501042_0356778 Ga0501042_0356778_267_953 222
455 3300049588 Ga0501072_0159857 Ga0501072_0159857_273_959 222
456 3300049591 Ga0501075_0253005 Ga0501075_0253005_644_1330 222
457 3300049592 Ga0501076_0727295 Ga0501076_0727295_123_800 222
458 3300049741 Ga0501079_0324347 Ga0501079_0324347_230_916 222
459 3300049778 Ga0501282_013452 Ga0501282_013452_126_794 222
460 3300050508 nmdc:mga09592_263119_c1 nmdc:mga09592_263119_c1_139_816 222
461 3300050511 nmdc:mga08y16_37071_c1 nmdc:mga08y16_37071_c1_377_1054 222
462 3300050511 nmdc:mga08y16_830555_c1 nmdc:mga08y16_830555_c1_158_835 222
463 3300003771 Ga0055526_1002931 Ga0055526_10029318 223
464 3300003775 Ga0055524_1003743 Ga0055524_10037435 223
465 3300003784 Ga0055534_1001147 Ga0055534_10011478 223
466 3300003791 Ga0055530_10000621 Ga0055530_100006219 223
467 3300005289 Ga0065704_10241941 Ga0065704_102419412 223
468 3300005549 Ga0070704_100087426 Ga0070704_1000874262 223
469 3300014326 Ga0157380_10000547 Ga0157380_1000054714 223
470 3300014326 Ga0157380_10004385 Ga0157380_100043857 223
471 3300025263 Ga0209565_1001320 Ga0209565_10013207 223
472 3300025291 Ga0209675_1001584 Ga0209675_10015848 223
473 3300025295 Ga0209564_1003298 Ga0209564_10032987 223
474 3300025298 Ga0209050_1000383 Ga0209050_100038365 223
475 3300025299 Ga0209256_1003993 Ga0209256_10039938 223
476 3300031616 Ga0307508_10176152 Ga0307508_101761522 223
477 3300031727 Ga0316576_10213850 Ga0316576_102138502 223
478 3300035398 Ga0316574_0010594 Ga0316574_0010594_2803_3492 223
479 3300042013 Ga0439456_013271 Ga0439456_013271_700_1371 223
480 3300042439 Ga0439464_0075656 Ga0439464_0075656_62_748 223
481 3300046471 Ga0495650_0000077 Ga0495650_0000077_39268_39942 223
482 3300047469 Ga0495673_0062235 Ga0495673_0062235_470_1144 223
483 3300049459 Ga0495678_000009 Ga0495678_000009_183389_184063 223
484 3300049459 Ga0495678_000485 Ga0495678_000485_16973_17647 223
485 2124908027 MRS2a_Contig_51 MRS2a_00392550 224
486 2162886007 SwRhRL2b_contig_1371190 SwRhRL2b_0284.00002470 224
487 2162886007 SwRhRL2b_contig_2863385 SwRhRL2b_0320.00005080 224
488 2162886007 SwRhRL2b_contig_3602964 SwRhRL2b_0958.00006470 224
489 2162886011 MRS1b_contig_6654047 MRS1b_0766.00001810 224
490 3300003759 Ga0055525_1006818 Ga0055525_10068182 224
491 3300003781 Ga0055536_1000025 Ga0055536_100002580 224
492 3300003781 Ga0055536_1000037 Ga0055536_100003716 224
493 3300003781 Ga0055536_1040265 Ga0055536_10402652 224
494 3300003784 Ga0055534_1028430 Ga0055534_10284302 224
495 3300003791 Ga0055530_10000007 Ga0055530_1000000780 224
496 3300003791 Ga0055530_10000320 Ga0055530_1000032036 224
497 3300003791 Ga0055530_10001019 Ga0055530_1000101910 224
498 3300003791 Ga0055530_10008962 Ga0055530_100089622 224
499 3300003792 Ga0055540_1000025 Ga0055540_1000025149 224
500 3300003792 Ga0055540_1000729 Ga0055540_100072910 224
501 3300003792 Ga0055540_1000990 Ga0055540_10009905 224
502 3300003794 Ga0055531_10000585 Ga0055531_1000058521 224
503 3300005288 Ga0065714_10000222 Ga0065714_100002225 224
504 3300005288 Ga0065714_10002603 Ga0065714_1000260315 224
505 3300005288 Ga0065714_10003536 Ga0065714_100035364 224
506 3300005288 Ga0065714_10005770 Ga0065714_100057706 224
507 3300005288 Ga0065714_10012118 Ga0065714_100121183 224
508 3300005288 Ga0065714_10012484 Ga0065714_100124842 224
509 3300005288 Ga0065714_10064853 Ga0065714_1006485311 224
510 3300005288 Ga0065714_10065246 Ga0065714_1006524612 224
511 3300005288 Ga0065714_10069398 Ga0065714_100693982 224
512 3300005288 Ga0065714_10071297 Ga0065714_100712972 224
513 3300005288 Ga0065714_10073329 Ga0065714_100733291 224
514 3300005288 Ga0065714_10159950 Ga0065714_101599501 224
515 3300005289 Ga0065704_10000555 Ga0065704_1000055512 224
516 3300005289 Ga0065704_10001427 Ga0065704_1000142715 224
517 3300005289 Ga0065704_10077367 Ga0065704_100773675 224
518 3300005289 Ga0065704_10084659 Ga0065704_100846594 224
519 3300005289 Ga0065704_10331112 Ga0065704_103311121 224
520 3300005290 Ga0065712_10002972 Ga0065712_100029722 224
521 3300005290 Ga0065712_10067857 Ga0065712_100678575 224
522 3300005293 Ga0065715_10009061 Ga0065715_100090613 224
523 3300005331 Ga0070670_100000079 Ga0070670_10000007925 224
524 3300005331 Ga0070670_100001054 Ga0070670_1000010546 224
525 3300005344 Ga0070661_100001004 Ga0070661_10000100412 224
526 3300005353 Ga0070669_100050193 Ga0070669_1000501932 224
527 3300005548 Ga0070665_100027248 Ga0070665_1000272484 224
528 3300005564 Ga0070664_100001292 Ga0070664_10000129210 224
529 3300006051 Ga0075364_10054755 Ga0075364_100547552 224
530 3300006051 Ga0075364_10079676 Ga0075364_100796763 224
531 3300006051 Ga0075364_10104434 Ga0075364_101044342 224
532 3300006051 Ga0075364_10266995 Ga0075364_102669951 224
533 3300006051 Ga0075364_10483289 Ga0075364_104832892 224
534 3300006058 Ga0075432_10000121 Ga0075432_100001216 224
535 3300006058 Ga0075432_10001179 Ga0075432_100011797 224
536 3300006058 Ga0075432_10007880 Ga0075432_100078804 224
537 3300006058 Ga0075432_10009488 Ga0075432_100094882 224
538 3300006058 Ga0075432_10013725 Ga0075432_100137254 224
539 3300006058 Ga0075432_10092655 Ga0075432_100926552 224
540 3300006058 Ga0075432_10207738 Ga0075432_102077382 224
541 3300006177 Ga0075362_10019840 Ga0075362_100198402 224
542 3300006177 Ga0075362_10245620 Ga0075362_102456201 224
543 3300006186 Ga0075369_10067944 Ga0075369_100679442 224
544 3300006914 Ga0075436_100056214 Ga0075436_1000562143 224
545 3300006944 Ga0099823_1000001 Ga0099823_1000001112 224
546 3300006946 Ga0079104_1000085 Ga0079104_1000085101 224
547 3300006946 Ga0079104_1000245 Ga0079104_100024563 224
548 3300006946 Ga0079104_1008099 Ga0079104_10080993 224
549 3300006948 Ga0099826_10000365 Ga0099826_100003653 224
550 3300009011 Ga0105251_10000001 Ga0105251_10000001396 224
551 3300009011 Ga0105251_10001168 Ga0105251_100011685 224
552 3300009011 Ga0105251_10001289 Ga0105251_100012898 224
553 3300009011 Ga0105251_10002617 Ga0105251_1000261711 224
554 3300009011 Ga0105251_10005442 Ga0105251_100054425 224
555 3300009011 Ga0105251_10058790 Ga0105251_100587902 224
556 3300009011 Ga0105251_10064855 Ga0105251_100648552 224
557 3300009011 Ga0105251_10193305 Ga0105251_101933052 224
558 3300009036 Ga0105244_10000806 Ga0105244_1000080614 224
559 3300009036 Ga0105244_10000914 Ga0105244_1000091410 224
560 3300009036 Ga0105244_10000938 Ga0105244_100009386 224
561 3300009036 Ga0105244_10001369 Ga0105244_1000136910 224
562 3300009036 Ga0105244_10011979 Ga0105244_100119795 224
563 3300009036 Ga0105244_10015608 Ga0105244_100156083 224
564 3300009036 Ga0105244_10025248 Ga0105244_100252485 224
565 3300009036 Ga0105244_10047865 Ga0105244_100478653 224
566 3300009036 Ga0105244_10057992 Ga0105244_100579921 224
567 3300009036 Ga0105244_10059458 Ga0105244_100594582 224
568 3300009036 Ga0105244_10065107 Ga0105244_100651072 224
569 3300009036 Ga0105244_10082793 Ga0105244_100827932 224
570 3300009036 Ga0105244_10169378 Ga0105244_101693781 224
571 3300009036 Ga0105244_10193456 Ga0105244_101934562 224
572 3300009092 Ga0105250_10002103 Ga0105250_1000210313 224
573 3300009092 Ga0105250_10002655 Ga0105250_100026554 224
574 3300009092 Ga0105250_10007126 Ga0105250_100071262 224
575 3300009148 Ga0105243_10000230 Ga0105243_1000023052 224
576 3300009148 Ga0105243_10011221 Ga0105243_100112219 224
577 3300009148 Ga0105243_10681108 Ga0105243_106811082 224
578 3300009176 Ga0105242_10001326 Ga0105242_100013269 224
579 3300009545 Ga0105237_10000937 Ga0105237_1000093722 224
580 3300011119 Ga0105246_10000047 Ga0105246_1000004737 224
581 3300011119 Ga0105246_10047044 Ga0105246_100470442 224
582 3300012498 Ga0157345_1000005 Ga0157345_100000521 224
583 3300013100 Ga0157373_10000409 Ga0157373_1000040926 224
584 3300013100 Ga0157373_10000598 Ga0157373_1000059819 224
585 3300013100 Ga0157373_10000845 Ga0157373_1000084517 224
586 3300013100 Ga0157373_10003727 Ga0157373_100037275 224
587 3300013100 Ga0157373_10004523 Ga0157373_1000452311 224
588 3300013100 Ga0157373_10061079 Ga0157373_100610792 224
589 3300013102 Ga0157371_10000535 Ga0157371_1000053519 224
590 3300013104 Ga0157370_10014974 Ga0157370_100149744 224
591 3300013104 Ga0157370_10023243 Ga0157370_100232435 224
592 3300013104 Ga0157370_10100923 Ga0157370_101009234 224
593 3300013104 Ga0157370_10180973 Ga0157370_101809732 224
594 3300013104 Ga0157370_10217427 Ga0157370_102174272 224
595 3300013105 Ga0157369_10002178 Ga0157369_100021787 224
596 3300013105 Ga0157369_10003376 Ga0157369_1000337612 224
597 3300013306 Ga0163162_10016024 Ga0163162_100160246 224
598 3300013306 Ga0163162_10388684 Ga0163162_103886842 224
599 3300013307 Ga0157372_10006552 Ga0157372_100065529 224
600 3300013307 Ga0157372_10065042 Ga0157372_100650422 224
601 3300013308 Ga0157375_10002189 Ga0157375_100021899 224
602 3300013308 Ga0157375_10056866 Ga0157375_100568665 224
603 3300014497 Ga0182008_10000449 Ga0182008_1000044932 224
604 3300014497 Ga0182008_10001226 Ga0182008_100012263 224
605 3300014497 Ga0182008_10001820 Ga0182008_100018204 224
606 3300014497 Ga0182008_10004720 Ga0182008_100047208 224
607 3300014497 Ga0182008_10013526 Ga0182008_100135265 224
608 3300014497 Ga0182008_10026759 Ga0182008_100267593 224
609 3300014497 Ga0182008_10029382 Ga0182008_100293822 224
610 3300015261 Ga0182006_1000099 Ga0182006_100009939 224
611 3300015261 Ga0182006_1000607 Ga0182006_100060720 224
612 3300015261 Ga0182006_1003156 Ga0182006_10031565 224
613 3300015261 Ga0182006_1004677 Ga0182006_10046773 224
614 3300015261 Ga0182006_1008171 Ga0182006_10081712 224
615 3300015261 Ga0182006_1022998 Ga0182006_10229982 224
616 3300015262 Ga0182007_10000130 Ga0182007_1000013023 224
617 3300015262 Ga0182007_10000379 Ga0182007_1000037912 224
618 3300015262 Ga0182007_10077788 Ga0182007_100777881 224
619 3300015265 Ga0182005_1000208 Ga0182005_100020837 224
620 3300015265 Ga0182005_1001653 Ga0182005_10016536 224
621 3300015265 Ga0182005_1010980 Ga0182005_10109803 224
622 3300015265 Ga0182005_1014213 Ga0182005_10142132 224
623 3300015265 Ga0182005_1014215 Ga0182005_10142152 224
624 3300015265 Ga0182005_1023764 Ga0182005_10237642 224
625 3300015265 Ga0182005_1028502 Ga0182005_10285022 224
626 3300015265 Ga0182005_1118122 Ga0182005_11181221 224
627 3300017792 Ga0163161_10000236 Ga0163161_1000023621 224
628 3300017792 Ga0163161_10000813 Ga0163161_1000081321 224
629 3300017792 Ga0163161_10001902 Ga0163161_100019025 224
630 3300017792 Ga0163161_10024615 Ga0163161_100246152 224
631 3300025230 Ga0209563_100648 Ga0209563_1006482 224
632 3300025291 Ga0209675_1001855 Ga0209675_10018552 224
633 3300025292 Ga0209676_1000002 Ga0209676_1000002562 224
634 3300025292 Ga0209676_1000003 Ga0209676_1000003619 224
635 3300025292 Ga0209676_1001013 Ga0209676_100101315 224
636 3300025292 Ga0209676_1028919 Ga0209676_10289192 224
637 3300025298 Ga0209050_1000004 Ga0209050_1000004601 224
638 3300025298 Ga0209050_1000006 Ga0209050_10000061008 224
639 3300025298 Ga0209050_1000013 Ga0209050_1000013559 224
640 3300025298 Ga0209050_1000782 Ga0209050_100078227 224
641 3300025303 Ga0209051_1000001 Ga0209051_1000001562 224
642 3300025303 Ga0209051_1000006 Ga0209051_1000006374 224
643 3300025303 Ga0209051_1000007 Ga0209051_1000007559 224
644 3300025303 Ga0209051_1004486 Ga0209051_10044865 224
645 3300025304 Ga0209257_1000056 Ga0209257_1000056231 224
646 3300025711 Ga0207696_1000016 Ga0207696_1000016126 224
647 3300025711 Ga0207696_1005875 Ga0207696_10058755 224
648 3300025711 Ga0207696_1006185 Ga0207696_10061852 224
649 3300025711 Ga0207696_1008566 Ga0207696_10085662 224
650 3300025711 Ga0207696_1026560 Ga0207696_10265602 224
651 3300025711 Ga0207696_1030704 Ga0207696_10307042 224
652 3300025728 Ga0207655_1000070 Ga0207655_1000070163 224
653 3300025728 Ga0207655_1000287 Ga0207655_100028749 224
654 3300025728 Ga0207655_1001371 Ga0207655_10013718 224
655 3300025728 Ga0207655_1003372 Ga0207655_100337211 224
656 3300025728 Ga0207655_1004780 Ga0207655_10047807 224
657 3300025728 Ga0207655_1015434 Ga0207655_10154341 224
658 3300025728 Ga0207655_1023783 Ga0207655_10237832 224
659 3300025728 Ga0207655_1025112 Ga0207655_10251122 224
660 3300025728 Ga0207655_1029251 Ga0207655_10292514 224
661 3300025728 Ga0207655_1068749 Ga0207655_10687492 224
662 3300025728 Ga0207655_1081852 Ga0207655_10818522 224
663 3300025728 Ga0207655_1104984 Ga0207655_11049842 224
664 3300025735 Ga0207713_1000268 Ga0207713_100026816 224
665 3300025735 Ga0207713_1000774 Ga0207713_100077419 224
666 3300025735 Ga0207713_1001306 Ga0207713_100130614 224
667 3300025735 Ga0207713_1001375 Ga0207713_100137516 224
668 3300025735 Ga0207713_1006880 Ga0207713_10068805 224
669 3300025735 Ga0207713_1009175 Ga0207713_10091752 224
670 3300025735 Ga0207713_1009217 Ga0207713_10092175 224
671 3300025735 Ga0207713_1014040 Ga0207713_10140403 224
672 3300025735 Ga0207713_1040707 Ga0207713_10407072 224
673 3300025735 Ga0207713_1054695 Ga0207713_10546952 224
674 3300025914 Ga0207671_10001472 Ga0207671_100014729 224
675 3300025920 Ga0207649_10000818 Ga0207649_1000081821 224
676 3300025925 Ga0207650_10001079 Ga0207650_1000107917 224
677 3300025925 Ga0207650_10002898 Ga0207650_100028985 224
678 3300025935 Ga0207709_10000014 Ga0207709_10000014151 224
679 3300025935 Ga0207709_10095532 Ga0207709_100955322 224
680 3300025945 Ga0207679_10000818 Ga0207679_1000081810 224
681 3300027111 Ga0209281_1000009 Ga0209281_1000009344 224
682 3300027111 Ga0209281_1000046 Ga0209281_100004657 224
683 3300027111 Ga0209281_1002511 Ga0209281_10025118 224
684 3300027111 Ga0209281_1007690 Ga0209281_10076902 224
685 3300027296 Ga0209389_1000007 Ga0209389_1000007123 224
686 3300027666 Ga0209282_1050167 Ga0209282_10501672 224
687 3300027907 Ga0207428_10017115 Ga0207428_100171156 224
688 3300027907 Ga0207428_10017815 Ga0207428_100178157 224
689 3300027907 Ga0207428_10034208 Ga0207428_100342082 224
690 3300027907 Ga0207428_10123299 Ga0207428_101232992 224
691 3300027907 Ga0207428_10259779 Ga0207428_102597792 224
692 3300028379 Ga0268266_10050083 Ga0268266_100500833 224
693 3300030521 Ga0307511_10062589 Ga0307511_100625893 224
694 3300030735 Ga0316178_1106511 Ga0316178_110651111 224
695 3300030742 Ga0316183_1170431 Ga0316183_11704312 224
696 3300031548 Ga0307408_100003404 Ga0307408_1000034047 224
697 3300031548 Ga0307408_100005033 Ga0307408_1000050335 224
698 3300031548 Ga0307408_100009387 Ga0307408_1000093874 224
699 3300031548 Ga0307408_100095499 Ga0307408_1000954992 224
700 3300031548 Ga0307408_100270503 Ga0307408_1002705032 224
701 3300031727 Ga0316576_10157736 Ga0316576_101577362 224
702 3300031728 Ga0316578_10023883 Ga0316578_100238833 224
703 3300031731 Ga0307405_10000422 Ga0307405_100004225 224
704 3300031731 Ga0307405_10010749 Ga0307405_100107495 224
705 3300031731 Ga0307405_10383751 Ga0307405_103837512 224
706 3300031824 Ga0307413_10095851 Ga0307413_100958513 224
707 3300031824 Ga0307413_10159791 Ga0307413_101597911 224
708 3300031901 Ga0307406_10011073 Ga0307406_100110735 224
709 3300031911 Ga0307412_10002369 Ga0307412_1000236911 224
710 3300031911 Ga0307412_10022250 Ga0307412_100222503 224
711 3300031911 Ga0307412_10037205 Ga0307412_100372053 224
712 3300032004 Ga0307414_10028655 Ga0307414_100286555 224
713 3300032004 Ga0307414_10058324 Ga0307414_100583243 224
714 3300032004 Ga0307414_10207854 Ga0307414_102078542 224
715 3300032005 Ga0307411_10024420 Ga0307411_100244203 224
716 3300033180 Ga0307510_10001358 Ga0307510_100013589 224
717 3300041405 Ga0439438_000008 Ga0439438_000008_124128_124802 224
718 3300041405 Ga0439438_000048 Ga0439438_000048_4654_5328 224
719 3300041405 Ga0439438_002317 Ga0439438_002317_4213_4887 224
720 3300041405 Ga0439438_003069 Ga0439438_003069_4172_4846 224
721 3300041405 Ga0439438_003967 Ga0439438_003967_3721_4395 224
722 3300041405 Ga0439438_020350 Ga0439438_020350_588_1262 224
723 3300041407 Ga0439447_000490 Ga0439447_000490_7911_8585 224
724 3300041407 Ga0439447_000765 Ga0439447_000765_208_882 224
725 3300041407 Ga0439447_004724 Ga0439447_004724_1377_2051 224
726 3300041411 Ga0439466_0000188 Ga0439466_0000188_147_821 224
727 3300041411 Ga0439466_0008059 Ga0439466_0008059_1949_2623 224
728 3300041411 Ga0439466_0012018 Ga0439466_0012018_365_1039 224
729 3300041411 Ga0439466_0012559 Ga0439466_0012559_2392_3066 224
730 3300041411 Ga0439466_0064276 Ga0439466_0064276_402_1076 224
731 3300041997 Ga0439431_0000014 Ga0439431_0000014_3606_4280 224
732 3300042006 Ga0439432_000051 Ga0439432_000051_32346_33020 224
733 3300042006 Ga0439432_000847 Ga0439432_000847_5630_6310 224
734 3300042006 Ga0439432_003061 Ga0439432_003061_1152_1826 224
735 3300042006 Ga0439432_006757 Ga0439432_006757_224_898 224
736 3300042006 Ga0439432_059967 Ga0439432_059967_458_1132 224
737 3300042009 Ga0439451_001530 Ga0439451_001530_387_1079 224
738 3300042009 Ga0439451_006063 Ga0439451_006063_1763_2437 224
739 3300042009 Ga0439451_006614 Ga0439451_006614_1125_1817 224
740 3300042010 Ga0439452_000043 Ga0439452_000043_56273_56947 224
741 3300042010 Ga0439452_000053 Ga0439452_000053_172_846 224
742 3300042010 Ga0439452_007002 Ga0439452_007002_1322_1996 224
743 3300042013 Ga0439456_001801 Ga0439456_001801_3428_4102 224
744 3300042013 Ga0439456_006597 Ga0439456_006597_1606_2280 224
745 3300042013 Ga0439456_020437 Ga0439456_020437_130_804 224
746 3300042016 Ga0439463_000359 Ga0439463_000359_8237_8926 224
747 3300042016 Ga0439463_006594 Ga0439463_006594_706_1380 224
748 3300042016 Ga0439463_021408 Ga0439463_021408_285_959 224
749 3300042115 Ga0450911_000009 Ga0450911_000009_91592_92266 224
750 3300042115 Ga0450911_000510 Ga0450911_000510_9696_10370 224
751 3300042115 Ga0450911_001101 Ga0450911_001101_23_697 224
752 3300042124 Ga0450922_001118 Ga0450922_001118_1428_2102 224
753 3300042136 Ga0450900_000709 Ga0450900_000709_1140_1820 224
754 3300042137 Ga0450902_041111 Ga0450902_041111_18_692 224
755 3300042138 Ga0450903_002877 Ga0450903_002877_2145_2819 224
756 3300042138 Ga0450903_003555 Ga0450903_003555_55_729 224
757 3300042142 Ga0450905_000799 Ga0450905_000799_2722_3402 224
758 3300042145 Ga0450906_003015 Ga0450906_003015_2806_3480 224
759 3300042146 Ga0450907_000120 Ga0450907_000120_11940_12614 224
760 3300042147 Ga0450910_000572 Ga0450910_000572_3044_3718 224
761 3300042147 Ga0450910_007604 Ga0450910_007604_319_993 224
762 3300042156 Ga0439446_0009231 Ga0439446_0009231_1489_2163 224
763 3300042156 Ga0439446_0031787 Ga0439446_0031787_160_834 224
764 3300042435 Ga0439434_0001508 Ga0439434_0001508_1838_2512 224
765 3300042435 Ga0439434_0024151 Ga0439434_0024151_892_1566 224
766 3300042439 Ga0439464_0012303 Ga0439464_0012303_331_1020 224
767 3300042439 Ga0439464_0023797 Ga0439464_0023797_946_1626 224
768 3300042461 Ga0439460_0026357 Ga0439460_0026357_404_1078 224
769 3300042876 Ga0451577_0007024 Ga0451577_0007024_4806_5486 224
770 3300042993 Ga0439440_0002062 Ga0439440_0002062_2202_2876 224
771 3300042993 Ga0439440_0008036 Ga0439440_0008036_714_1388 224
772 3300042993 Ga0439440_0030147 Ga0439440_0030147_326_1000 224
773 3300046452 Ga0495617_000263 Ga0495617_000263_21694_22368 224
774 3300046452 Ga0495617_001790 Ga0495617_001790_4858_5532 224
775 3300046452 Ga0495617_001945 Ga0495617_001945_3758_4432 224
776 3300046452 Ga0495617_006314 Ga0495617_006314_3343_4017 224
777 3300046452 Ga0495617_007955 Ga0495617_007955_858_1547 224
778 3300046452 Ga0495617_026788 Ga0495617_026788_936_1610 224
779 3300046452 Ga0495617_038440 Ga0495617_038440_761_1435 224
780 3300046452 Ga0495617_096457 Ga0495617_096457_11_685 224
781 3300046452 Ga0495617_108589 Ga0495617_108589_118_792 224
782 3300046453 Ga0495627_000039 Ga0495627_000039_87077_87751 224
783 3300046453 Ga0495627_000203 Ga0495627_000203_21097_21771 224
784 3300046453 Ga0495627_003143 Ga0495627_003143_3121_3795 224
785 3300046453 Ga0495627_003323 Ga0495627_003323_5371_6045 224
786 3300046453 Ga0495627_006275 Ga0495627_006275_1504_2178 224
787 3300046453 Ga0495627_018494 Ga0495627_018494_1443_2117 224
788 3300046453 Ga0495627_020609 Ga0495627_020609_413_1087 224
789 3300046453 Ga0495627_024236 Ga0495627_024236_124_813 224
790 3300046453 Ga0495627_038820 Ga0495627_038820_662_1336 224
791 3300046455 Ga0495603_0026163 Ga0495603_0026163_599_1273 224
792 3300046457 Ga0495590_0000235 Ga0495590_0000235_9974_10648 224
793 3300046457 Ga0495590_0001793 Ga0495590_0001793_5740_6414 224
794 3300046457 Ga0495590_0009342 Ga0495590_0009342_1453_2127 224
795 3300046457 Ga0495590_0011308 Ga0495590_0011308_2484_3158 224
796 3300046458 Ga0495591_000116 Ga0495591_000116_59524_60213 224
797 3300046458 Ga0495591_000138 Ga0495591_000138_20768_21442 224
798 3300046458 Ga0495591_000162 Ga0495591_000162_53808_54497 224
799 3300046458 Ga0495591_000749 Ga0495591_000749_6436_7110 224
800 3300046458 Ga0495591_002613 Ga0495591_002613_57_731 224
801 3300046458 Ga0495591_004348 Ga0495591_004348_4498_5172 224
802 3300046458 Ga0495591_004502 Ga0495591_004502_1945_2619 224
803 3300046458 Ga0495591_004931 Ga0495591_004931_1426_2100 224
804 3300046458 Ga0495591_005726 Ga0495591_005726_4526_5200 224
805 3300046458 Ga0495591_006991 Ga0495591_006991_4177_4851 224
806 3300046458 Ga0495591_013509 Ga0495591_013509_627_1316 224
807 3300046460 Ga0495638_0000196 Ga0495638_0000196_73976_74650 224
808 3300046460 Ga0495638_0000298 Ga0495638_0000298_14373_15047 224
809 3300046460 Ga0495638_0001043 Ga0495638_0001043_22314_22988 224
810 3300046460 Ga0495638_0003321 Ga0495638_0003321_6635_7309 224
811 3300046460 Ga0495638_0005270 Ga0495638_0005270_885_1559 224
812 3300046460 Ga0495638_0008238 Ga0495638_0008238_1906_2607 224
813 3300046460 Ga0495638_0016482 Ga0495638_0016482_1729_2403 224
814 3300046460 Ga0495638_0017286 Ga0495638_0017286_2497_3171 224
815 3300046460 Ga0495638_0099766 Ga0495638_0099766_235_909 224
816 3300046463 Ga0495653_0001940 Ga0495653_0001940_634_1308 224
817 3300046463 Ga0495653_0008459 Ga0495653_0008459_566_1240 224
818 3300046463 Ga0495653_0068879 Ga0495653_0068879_441_1115 224
819 3300046463 Ga0495653_0174142 Ga0495653_0174142_151_825 224
820 3300046463 Ga0495653_0229955 Ga0495653_0229955_130_804 224
821 3300046471 Ga0495650_0001734 Ga0495650_0001734_17422_18096 224
822 3300046471 Ga0495650_0002021 Ga0495650_0002021_11705_12379 224
823 3300046471 Ga0495650_0002403 Ga0495650_0002403_1067_1741 224
824 3300046471 Ga0495650_0004530 Ga0495650_0004530_6951_7640 224
825 3300046471 Ga0495650_0008010 Ga0495650_0008010_1851_2540 224
826 3300046471 Ga0495650_0020041 Ga0495650_0020041_251_925 224
827 3300046471 Ga0495650_0021794 Ga0495650_0021794_357_1031 224
828 3300046471 Ga0495650_0023322 Ga0495650_0023322_1003_1692 224
829 3300046471 Ga0495650_0026329 Ga0495650_0026329_1050_1724 224
830 3300046473 Ga0495582_0005980 Ga0495582_0005980_2350_3024 224
831 3300046474 Ga0495605_0000002 Ga0495605_0000002_152642_153331 224
832 3300046474 Ga0495605_0000047 Ga0495605_0000047_28264_28953 224
833 3300046474 Ga0495605_0000279 Ga0495605_0000279_15485_16174 224
834 3300046474 Ga0495605_0000810 Ga0495605_0000810_14482_15156 224
835 3300046474 Ga0495605_0001142 Ga0495605_0001142_2007_2696 224
836 3300046474 Ga0495605_0001334 Ga0495605_0001334_3759_4433 224
837 3300046474 Ga0495605_0002151 Ga0495605_0002151_3338_4027 224
838 3300046474 Ga0495605_0006683 Ga0495605_0006683_4317_4991 224
839 3300046474 Ga0495605_0008450 Ga0495605_0008450_3710_4399 224
840 3300046474 Ga0495605_0013545 Ga0495605_0013545_1504_2178 224
841 3300046474 Ga0495605_0105906 Ga0495605_0105906_212_886 224
842 3300046474 Ga0495605_0151892 Ga0495605_0151892_334_1008 224
843 3300046474 Ga0495605_0173453 Ga0495605_0173453_257_931 224
844 3300046475 Ga0495639_0000059 Ga0495639_0000059_21142_21816 224
845 3300046475 Ga0495639_0017743 Ga0495639_0017743_2086_2760 224
846 3300046491 Ga0495584_0000579 Ga0495584_0000579_14077_14766 224
847 3300046491 Ga0495584_0002024 Ga0495584_0002024_7850_8524 224
848 3300046491 Ga0495584_0003053 Ga0495584_0003053_4632_5306 224
849 3300046491 Ga0495584_0019991 Ga0495584_0019991_126_800 224
850 3300046491 Ga0495584_0027799 Ga0495584_0027799_1719_2393 224
851 3300046491 Ga0495584_0028337 Ga0495584_0028337_1937_2611 224
852 3300046491 Ga0495584_0028993 Ga0495584_0028993_58_732 224
853 3300046491 Ga0495584_0029615 Ga0495584_0029615_1302_1976 224
854 3300046491 Ga0495584_0039340 Ga0495584_0039340_752_1426 224
855 3300046492 Ga0495585_0000202 Ga0495585_0000202_53931_54605 224
856 3300046492 Ga0495585_0000372 Ga0495585_0000372_39496_40170 224
857 3300046492 Ga0495585_0000622 Ga0495585_0000622_14260_14934 224
858 3300046492 Ga0495585_0007020 Ga0495585_0007020_3560_4234 224
859 3300046492 Ga0495585_0014085 Ga0495585_0014085_142_816 224
860 3300046492 Ga0495585_0036694 Ga0495585_0036694_967_1641 224
861 3300046492 Ga0495585_0054670 Ga0495585_0054670_400_1074 224
862 3300046492 Ga0495585_0078162 Ga0495585_0078162_681_1355 224
863 3300046499 Ga0495594_0007594 Ga0495594_0007594_3803_4492 224
864 3300046499 Ga0495594_0036652 Ga0495594_0036652_322_996 224
865 3300046499 Ga0495594_0040160 Ga0495594_0040160_1046_1720 224
866 3300046500 Ga0495596_0000049 Ga0495596_0000049_52022_52696 224
867 3300046500 Ga0495596_0002506 Ga0495596_0002506_660_1349 224
868 3300046500 Ga0495596_0108880 Ga0495596_0108880_96_770 224
869 3300046501 Ga0495607_0000043 Ga0495607_0000043_70906_71595 224
870 3300046501 Ga0495607_0000503 Ga0495607_0000503_23148_23837 224
871 3300046501 Ga0495607_0000770 Ga0495607_0000770_22099_22773 224
872 3300046501 Ga0495607_0002404 Ga0495607_0002404_7494_8168 224
873 3300046501 Ga0495607_0002730 Ga0495607_0002730_1075_1749 224
874 3300046501 Ga0495607_0003453 Ga0495607_0003453_5025_5699 224
875 3300046501 Ga0495607_0007340 Ga0495607_0007340_5149_5823 224
876 3300046501 Ga0495607_0012487 Ga0495607_0012487_2402_3076 224
877 3300046501 Ga0495607_0013496 Ga0495607_0013496_250_939 224
878 3300046501 Ga0495607_0023397 Ga0495607_0023397_1430_2104 224
879 3300046501 Ga0495607_0047363 Ga0495607_0047363_1816_2490 224
880 3300046501 Ga0495607_0049644 Ga0495607_0049644_1425_2099 224
881 3300046501 Ga0495607_0089212 Ga0495607_0089212_646_1320 224
882 3300046501 Ga0495607_0104685 Ga0495607_0104685_398_1072 224
883 3300046501 Ga0495607_0114963 Ga0495607_0114963_64_753 224
884 3300046506 Ga0495583_0000012 Ga0495583_0000012_279488_280177 224
885 3300046506 Ga0495583_0000528 Ga0495583_0000528_17621_18310 224
886 3300046506 Ga0495583_0000534 Ga0495583_0000534_1090_1779 224
887 3300046506 Ga0495583_0001642 Ga0495583_0001642_5384_6058 224
888 3300046506 Ga0495583_0002701 Ga0495583_0002701_3825_4514 224
889 3300046506 Ga0495583_0005647 Ga0495583_0005647_4032_4706 224
890 3300046506 Ga0495583_0012000 Ga0495583_0012000_4061_4735 224
891 3300046507 Ga0495606_0000207 Ga0495606_0000207_30449_31138 224
892 3300046507 Ga0495606_0001383 Ga0495606_0001383_25142_25816 224
893 3300046507 Ga0495606_0001516 Ga0495606_0001516_29442_30116 224
894 3300046507 Ga0495606_0001673 Ga0495606_0001673_18951_19625 224
895 3300046507 Ga0495606_0003190 Ga0495606_0003190_12103_12777 224
896 3300046507 Ga0495606_0004547 Ga0495606_0004547_1734_2408 224
897 3300046507 Ga0495606_0040858 Ga0495606_0040858_1531_2205 224
898 3300046507 Ga0495606_0042512 Ga0495606_0042512_2117_2791 224
899 3300046507 Ga0495606_0053208 Ga0495606_0053208_1539_2213 224
900 3300046507 Ga0495606_0059862 Ga0495606_0059862_784_1458 224
901 3300046507 Ga0495606_0127326 Ga0495606_0127326_683_1357 224
902 3300046512 Ga0495610_0002360 Ga0495610_0002360_7778_8467 224
903 3300046512 Ga0495610_0004087 Ga0495610_0004087_6538_7212 224
904 3300046512 Ga0495610_0006715 Ga0495610_0006715_4136_4810 224
905 3300046512 Ga0495610_0009393 Ga0495610_0009393_1487_2161 224
906 3300046512 Ga0495610_0009485 Ga0495610_0009485_3220_3894 224
907 3300046512 Ga0495610_0013198 Ga0495610_0013198_4007_4681 224
908 3300046512 Ga0495610_0024883 Ga0495610_0024883_1722_2396 224
909 3300046512 Ga0495610_0029643 Ga0495610_0029643_1927_2601 224
910 3300046512 Ga0495610_0090327 Ga0495610_0090327_310_984 224
911 3300046512 Ga0495610_0098211 Ga0495610_0098211_124_813 224
912 3300046513 Ga0495616_0001576 Ga0495616_0001576_9974_10648 224
913 3300046513 Ga0495616_0002736 Ga0495616_0002736_5822_6496 224
914 3300046513 Ga0495616_0016240 Ga0495616_0016240_1291_1965 224
915 3300046513 Ga0495616_0020170 Ga0495616_0020170_1279_1953 224
916 3300046513 Ga0495616_0034760 Ga0495616_0034760_1524_2198 224
917 3300046513 Ga0495616_0040210 Ga0495616_0040210_163_837 224
918 3300046513 Ga0495616_0042257 Ga0495616_0042257_1331_2005 224
919 3300046513 Ga0495616_0049796 Ga0495616_0049796_62_736 224
920 3300046513 Ga0495616_0050793 Ga0495616_0050793_75_749 224
921 3300046515 Ga0495620_0000010 Ga0495620_0000010_56916_57605 224
922 3300046515 Ga0495620_0000062 Ga0495620_0000062_60194_60883 224
923 3300046515 Ga0495620_0000855 Ga0495620_0000855_15846_16520 224
924 3300046515 Ga0495620_0000898 Ga0495620_0000898_14460_15134 224
925 3300046515 Ga0495620_0002748 Ga0495620_0002748_1525_2214 224
926 3300046515 Ga0495620_0003212 Ga0495620_0003212_2796_3470 224
927 3300046515 Ga0495620_0004920 Ga0495620_0004920_3255_3929 224
928 3300046515 Ga0495620_0015431 Ga0495620_0015431_1819_2493 224
929 3300046515 Ga0495620_0078137 Ga0495620_0078137_17_706 224
930 3300046517 Ga0495630_0003718 Ga0495630_0003718_3539_4213 224
931 3300046517 Ga0495630_0018138 Ga0495630_0018138_3849_4523 224
932 3300046517 Ga0495630_0429250 Ga0495630_0429250_192_866 224
933 3300046518 Ga0495631_0000002 Ga0495631_0000002_54626_55300 224
934 3300046518 Ga0495631_0000255 Ga0495631_0000255_9256_9930 224
935 3300046518 Ga0495631_0005450 Ga0495631_0005450_5796_6470 224
936 3300046518 Ga0495631_0006994 Ga0495631_0006994_3369_4058 224
937 3300046518 Ga0495631_0008780 Ga0495631_0008780_2412_3086 224
938 3300046518 Ga0495631_0019680 Ga0495631_0019680_1850_2539 224
939 3300046518 Ga0495631_0179071 Ga0495631_0179071_178_867 224
940 3300046519 Ga0495632_0000232 Ga0495632_0000232_36165_36845 224
941 3300046519 Ga0495632_0001723 Ga0495632_0001723_10718_11392 224
942 3300046519 Ga0495632_0003247 Ga0495632_0003247_7019_7708 224
943 3300046519 Ga0495632_0003257 Ga0495632_0003257_1544_2218 224
944 3300046519 Ga0495632_0008066 Ga0495632_0008066_3785_4459 224
945 3300046519 Ga0495632_0010340 Ga0495632_0010340_2542_3216 224
946 3300046519 Ga0495632_0016203 Ga0495632_0016203_2696_3385 224
947 3300046519 Ga0495632_0016206 Ga0495632_0016206_2248_2922 224
948 3300046519 Ga0495632_0052108 Ga0495632_0052108_129_803 224
949 3300046520 Ga0495637_0000044 Ga0495637_0000044_25133_25807 224
950 3300046520 Ga0495637_0000127 Ga0495637_0000127_36461_37150 224
951 3300046520 Ga0495637_0002779 Ga0495637_0002779_1977_2651 224
952 3300046520 Ga0495637_0002832 Ga0495637_0002832_1331_2005 224
953 3300046520 Ga0495637_0003064 Ga0495637_0003064_7391_8065 224
954 3300046520 Ga0495637_0003435 Ga0495637_0003435_7122_7796 224
955 3300046520 Ga0495637_0004013 Ga0495637_0004013_5388_6062 224
956 3300046520 Ga0495637_0004709 Ga0495637_0004709_2554_3228 224
957 3300046520 Ga0495637_0005030 Ga0495637_0005030_2356_3030 224
958 3300046520 Ga0495637_0015510 Ga0495637_0015510_1227_1901 224
959 3300046520 Ga0495637_0026580 Ga0495637_0026580_1840_2514 224
960 3300046520 Ga0495637_0031028 Ga0495637_0031028_1057_1731 224
961 3300046520 Ga0495637_0035786 Ga0495637_0035786_50_724 224
962 3300046522 Ga0495643_0000049 Ga0495643_0000049_129993_130673 224
963 3300046522 Ga0495643_0000284 Ga0495643_0000284_42675_43355 224
964 3300046522 Ga0495643_0002169 Ga0495643_0002169_14303_14977 224
965 3300046522 Ga0495643_0003292 Ga0495643_0003292_5051_5743 224
966 3300046522 Ga0495643_0010678 Ga0495643_0010678_4819_5493 224
967 3300046522 Ga0495643_0013147 Ga0495643_0013147_928_1602 224
968 3300046522 Ga0495643_0014053 Ga0495643_0014053_1364_2053 224
969 3300046522 Ga0495643_0030427 Ga0495643_0030427_1749_2423 224
970 3300046522 Ga0495643_0057520 Ga0495643_0057520_1246_1920 224
971 3300046522 Ga0495643_0107566 Ga0495643_0107566_35_709 224
972 3300046523 Ga0495644_0000159 Ga0495644_0000159_18674_19348 224
973 3300046523 Ga0495644_0000878 Ga0495644_0000878_8024_8698 224
974 3300046523 Ga0495644_0003676 Ga0495644_0003676_4959_5633 224
975 3300046523 Ga0495644_0045069 Ga0495644_0045069_378_1052 224
976 3300046523 Ga0495644_0105559 Ga0495644_0105559_198_887 224
977 3300046523 Ga0495644_0111793 Ga0495644_0111793_214_888 224
978 3300046524 Ga0495648_0000337 Ga0495648_0000337_30474_31148 224
979 3300046524 Ga0495648_0001764 Ga0495648_0001764_5244_5918 224
980 3300046524 Ga0495648_0002321 Ga0495648_0002321_8791_9480 224
981 3300046524 Ga0495648_0002415 Ga0495648_0002415_1360_2034 224
982 3300046524 Ga0495648_0003859 Ga0495648_0003859_2376_3065 224
983 3300046524 Ga0495648_0004627 Ga0495648_0004627_6436_7110 224
984 3300046524 Ga0495648_0005118 Ga0495648_0005118_4061_4735 224
985 3300046524 Ga0495648_0015063 Ga0495648_0015063_3627_4301 224
986 3300046524 Ga0495648_0067018 Ga0495648_0067018_1371_2045 224
987 3300046524 Ga0495648_0104675 Ga0495648_0104675_424_1098 224
988 3300046526 Ga0495666_0001016 Ga0495666_0001016_4002_4676 224
989 3300046526 Ga0495666_0084302 Ga0495666_0084302_258_932 224
990 3300046526 Ga0495666_0144543 Ga0495666_0144543_164_838 224
991 3300046530 Ga0495654_0000157 Ga0495654_0000157_63147_63836 224
992 3300046530 Ga0495654_0000197 Ga0495654_0000197_38822_39496 224
993 3300046530 Ga0495654_0000312 Ga0495654_0000312_39778_40467 224
994 3300046530 Ga0495654_0000350 Ga0495654_0000350_32044_32733 224
995 3300046530 Ga0495654_0000851 Ga0495654_0000851_7394_8068 224
996 3300046530 Ga0495654_0004135 Ga0495654_0004135_2115_2789 224
997 3300046530 Ga0495654_0006790 Ga0495654_0006790_2899_3573 224
998 3300046530 Ga0495654_0012024 Ga0495654_0012024_750_1424 224
999 3300046530 Ga0495654_0012774 Ga0495654_0012774_2847_3521 224
1000 3300046530 Ga0495654_0013179 Ga0495654_0013179_1493_2167 224
1001 3300046530 Ga0495654_0084028 Ga0495654_0084028_456_1130 224
1002 3300046530 Ga0495654_0094385 Ga0495654_0094385_67_741 224
1003 3300046530 Ga0495654_0103854 Ga0495654_0103854_185_859 224
1004 3300046530 Ga0495654_0243632 Ga0495654_0243632_15_695 224
1005 3300046535 Ga0495586_0009415 Ga0495586_0009415_4326_5000 224
1006 3300046536 Ga0495587_0000089 Ga0495587_0000089_52137_52811 224
1007 3300046536 Ga0495587_0007118 Ga0495587_0007118_2910_3584 224
1008 3300046538 Ga0495609_0000008 Ga0495609_0000008_113929_114618 224
1009 3300046538 Ga0495609_0000358 Ga0495609_0000358_32037_32726 224
1010 3300046538 Ga0495609_0001094 Ga0495609_0001094_16837_17511 224
1011 3300046538 Ga0495609_0001600 Ga0495609_0001600_3838_4524 224
1012 3300046538 Ga0495609_0003087 Ga0495609_0003087_1121_1810 224
1013 3300046538 Ga0495609_0003417 Ga0495609_0003417_3439_4113 224
1014 3300046538 Ga0495609_0021168 Ga0495609_0021168_782_1456 224
1015 3300046538 Ga0495609_0025066 Ga0495609_0025066_1642_2331 224
1016 3300046538 Ga0495609_0121162 Ga0495609_0121162_319_993 224
1017 3300046542 Ga0495597_0001188 Ga0495597_0001188_1456_2130 224
1018 3300046542 Ga0495597_0001323 Ga0495597_0001323_8248_8922 224
1019 3300046542 Ga0495597_0001929 Ga0495597_0001929_1186_1860 224
1020 3300046542 Ga0495597_0003566 Ga0495597_0003566_3645_4319 224
1021 3300046542 Ga0495597_0004046 Ga0495597_0004046_6035_6709 224
1022 3300046542 Ga0495597_0007169 Ga0495597_0007169_3723_4412 224
1023 3300046542 Ga0495597_0048542 Ga0495597_0048542_1053_1727 224
1024 3300046542 Ga0495597_0134034 Ga0495597_0134034_151_825 224
1025 3300046542 Ga0495597_0153052 Ga0495597_0153052_96_785 224
1026 3300046542 Ga0495597_0172321 Ga0495597_0172321_29_703 224
1027 3300046557 Ga0495622_0000676 Ga0495622_0000676_9387_10061 224
1028 3300046557 Ga0495622_0001176 Ga0495622_0001176_11539_12213 224
1029 3300046557 Ga0495622_0002949 Ga0495622_0002949_4145_4819 224
1030 3300046557 Ga0495622_0018880 Ga0495622_0018880_1482_2171 224
1031 3300046557 Ga0495622_0059584 Ga0495622_0059584_852_1526 224
1032 3300046557 Ga0495622_0095630 Ga0495622_0095630_528_1202 224
1033 3300046557 Ga0495622_0111131 Ga0495622_0111131_15_689 224
1034 3300046557 Ga0495622_0146145 Ga0495622_0146145_68_742 224
1035 3300046558 Ga0495633_0000009 Ga0495633_0000009_134732_135421 224
1036 3300046558 Ga0495633_0000571 Ga0495633_0000571_27030_27704 224
1037 3300046558 Ga0495633_0000656 Ga0495633_0000656_18139_18813 224
1038 3300046558 Ga0495633_0019067 Ga0495633_0019067_269_943 224
1039 3300046558 Ga0495633_0079737 Ga0495633_0079737_188_862 224
1040 3300046615 Ga0495656_0028652 Ga0495656_0028652_960_1634 224
1041 3300046616 Ga0495668_0000732 Ga0495668_0000732_28435_29109 224
1042 3300046616 Ga0495668_0055195 Ga0495668_0055195_1311_1985 224
1043 3300046616 Ga0495668_0131696 Ga0495668_0131696_614_1303 224
1044 3300046616 Ga0495668_0263722 Ga0495668_0263722_182_856 224
1045 3300046642 Ga0495634_0001522 Ga0495634_0001522_4392_5066 224
1046 3300046648 Ga0495611_0000016 Ga0495611_0000016_19649_20323 224
1047 3300046648 Ga0495611_0001351 Ga0495611_0001351_96_785 224
1048 3300046648 Ga0495611_0003958 Ga0495611_0003958_1605_2279 224
1049 3300046648 Ga0495611_0008920 Ga0495611_0008920_1546_2220 224
1050 3300046660 Ga0495625_0002733 Ga0495625_0002733_3054_3728 224
1051 3300046660 Ga0495625_0003014 Ga0495625_0003014_13594_14268 224
1052 3300046660 Ga0495625_0003863 Ga0495625_0003863_3857_4531 224
1053 3300046660 Ga0495625_0004081 Ga0495625_0004081_5081_5755 224
1054 3300046660 Ga0495625_0012034 Ga0495625_0012034_5198_5887 224
1055 3300046660 Ga0495625_0013745 Ga0495625_0013745_3052_3726 224
1056 3300046660 Ga0495625_0018840 Ga0495625_0018840_3710_4384 224
1057 3300046660 Ga0495625_0168253 Ga0495625_0168253_211_885 224
1058 3300046663 Ga0495635_0000983 Ga0495635_0000983_5659_6333 224
1059 3300046663 Ga0495635_0023127 Ga0495635_0023127_630_1304 224
1060 3300046664 Ga0495659_0000077 Ga0495659_0000077_21103_21777 224
1061 3300046665 Ga0495661_0000001 Ga0495661_0000001_864359_865048 224
1062 3300046665 Ga0495661_0000029 Ga0495661_0000029_145477_146166 224
1063 3300046665 Ga0495661_0003807 Ga0495661_0003807_5941_6630 224
1064 3300046665 Ga0495661_0007031 Ga0495661_0007031_6838_7512 224
1065 3300046665 Ga0495661_0011184 Ga0495661_0011184_3066_3740 224
1066 3300046665 Ga0495661_0020002 Ga0495661_0020002_2019_2693 224
1067 3300046665 Ga0495661_0034227 Ga0495661_0034227_1114_1788 224
1068 3300046665 Ga0495661_0035823 Ga0495661_0035823_1347_2021 224
1069 3300046674 Ga0495588_0017994 Ga0495588_0017994_1067_1741 224
1070 3300046679 Ga0495623_0003928 Ga0495623_0003928_7101_7775 224
1071 3300046680 Ga0495646_0000414 Ga0495646_0000414_11721_12395 224
1072 3300046683 Ga0495658_0133364 Ga0495658_0133364_422_1111 224
1073 3300046689 Ga0495613_0009565 Ga0495613_0009565_2633_3307 224
1074 3300046689 Ga0495613_0113470 Ga0495613_0113470_1132_1806 224
1075 3300046691 Ga0495670_0000373 Ga0495670_0000373_3558_4232 224
1076 3300046691 Ga0495670_0000395 Ga0495670_0000395_13280_13954 224
1077 3300046691 Ga0495670_0000563 Ga0495670_0000563_10136_10810 224
1078 3300046691 Ga0495670_0001267 Ga0495670_0001267_1701_2375 224
1079 3300046691 Ga0495670_0019743 Ga0495670_0019743_571_1245 224
1080 3300046692 Ga0495671_0000141 Ga0495671_0000141_55790_56479 224
1081 3300046692 Ga0495671_0000171 Ga0495671_0000171_44155_44835 224
1082 3300046692 Ga0495671_0000324 Ga0495671_0000324_23554_24228 224
1083 3300046692 Ga0495671_0000785 Ga0495671_0000785_8722_9396 224
1084 3300046692 Ga0495671_0002246 Ga0495671_0002246_1203_1877 224
1085 3300046692 Ga0495671_0009284 Ga0495671_0009284_3516_4190 224
1086 3300046692 Ga0495671_0015352 Ga0495671_0015352_1833_2522 224
1087 3300046692 Ga0495671_0016168 Ga0495671_0016168_2931_3605 224
1088 3300046692 Ga0495671_0022278 Ga0495671_0022278_1671_2360 224
1089 3300046692 Ga0495671_0029587 Ga0495671_0029587_1866_2540 224
1090 3300046692 Ga0495671_0030134 Ga0495671_0030134_1854_2528 224
1091 3300046692 Ga0495671_0035004 Ga0495671_0035004_445_1119 224
1092 3300046692 Ga0495671_0055184 Ga0495671_0055184_14_688 224
1093 3300046692 Ga0495671_0101716 Ga0495671_0101716_456_1130 224
1094 3300046694 Ga0495649_0000109 Ga0495649_0000109_59379_60053 224
1095 3300046694 Ga0495649_0003158 Ga0495649_0003158_4429_5103 224
1096 3300046694 Ga0495649_0007664 Ga0495649_0007664_1995_2669 224
1097 3300046694 Ga0495649_0008372 Ga0495649_0008372_3508_4182 224
1098 3300046694 Ga0495649_0014437 Ga0495649_0014437_92_766 224
1099 3300046694 Ga0495649_0019373 Ga0495649_0019373_1154_1834 224
1100 3300046694 Ga0495649_0032100 Ga0495649_0032100_958_1632 224
1101 3300046694 Ga0495649_0032228 Ga0495649_0032228_1762_2436 224
1102 3300046694 Ga0495649_0039208 Ga0495649_0039208_256_930 224
1103 3300046694 Ga0495649_0052466 Ga0495649_0052466_728_1402 224
1104 3300046694 Ga0495649_0064000 Ga0495649_0064000_370_1044 224
1105 3300046794 Ga0495589_0000234 Ga0495589_0000234_2908_3582 224
1106 3300046794 Ga0495589_0000251 Ga0495589_0000251_43067_43756 224
1107 3300046794 Ga0495589_0000448 Ga0495589_0000448_7228_7902 224
1108 3300046794 Ga0495589_0009774 Ga0495589_0009774_1555_2229 224
1109 3300046794 Ga0495589_0013282 Ga0495589_0013282_3331_4005 224
1110 3300046794 Ga0495589_0013906 Ga0495589_0013906_2602_3276 224
1111 3300046794 Ga0495589_0016201 Ga0495589_0016201_1912_2586 224
1112 3300046794 Ga0495589_0031020 Ga0495589_0031020_1725_2399 224
1113 3300046809 Ga0495600_0339222 Ga0495600_0339222_53_727 224
1114 3300046810 Ga0495660_0000876 Ga0495660_0000876_17899_18588 224
1115 3300046810 Ga0495660_0001193 Ga0495660_0001193_4493_5182 224
1116 3300046810 Ga0495660_0002216 Ga0495660_0002216_4251_4925 224
1117 3300046810 Ga0495660_0006833 Ga0495660_0006833_1206_1880 224
1118 3300046810 Ga0495660_0019752 Ga0495660_0019752_3084_3758 224
1119 3300046810 Ga0495660_0022562 Ga0495660_0022562_1287_1961 224
1120 3300046810 Ga0495660_0041553 Ga0495660_0041553_549_1241 224
1121 3300046810 Ga0495660_0108570 Ga0495660_0108570_465_1154 224
1122 3300046810 Ga0495660_0109801 Ga0495660_0109801_28_702 224
1123 3300047315 Ga0495581_0007024 Ga0495581_0007024_1297_1971 224
1124 3300047317 Ga0495604_0000559 Ga0495604_0000559_18111_18785 224
1125 3300047317 Ga0495604_0009001 Ga0495604_0009001_5633_6307 224
1126 3300047318 Ga0495636_0000899 Ga0495636_0000899_6930_7604 224
1127 3300047319 Ga0495674_0010426 Ga0495674_0010426_3255_3929 224
1128 3300047320 Ga0495672_0000210 Ga0495672_0000210_14427_15101 224
1129 3300047320 Ga0495672_0000796 Ga0495672_0000796_30672_31346 224
1130 3300047320 Ga0495672_0003926 Ga0495672_0003926_9236_9910 224
1131 3300047320 Ga0495672_0005049 Ga0495672_0005049_6187_6861 224
1132 3300047320 Ga0495672_0014284 Ga0495672_0014284_1797_2486 224
1133 3300047320 Ga0495672_0020951 Ga0495672_0020951_3329_4003 224
1134 3300047320 Ga0495672_0027957 Ga0495672_0027957_1602_2291 224
1135 3300047320 Ga0495672_0029012 Ga0495672_0029012_2567_3241 224
1136 3300047320 Ga0495672_0031558 Ga0495672_0031558_603_1277 224
1137 3300047320 Ga0495672_0061979 Ga0495672_0061979_1295_1969 224
1138 3300047320 Ga0495672_0104020 Ga0495672_0104020_58_732 224
1139 3300047321 Ga0495676_0000001 Ga0495676_0000001_372405_373094 224
1140 3300047321 Ga0495676_0000572 Ga0495676_0000572_10858_11547 224
1141 3300047321 Ga0495676_0000985 Ga0495676_0000985_13531_14205 224
1142 3300047322 Ga0495680_0027877 Ga0495680_0027877_2784_3458 224
1143 3300047323 Ga0495683_0000037 Ga0495683_0000037_54960_55634 224
1144 3300047323 Ga0495683_0000042 Ga0495683_0000042_73239_73928 224
1145 3300047323 Ga0495683_0000111 Ga0495683_0000111_27509_28183 224
1146 3300047323 Ga0495683_0006727 Ga0495683_0006727_3595_4269 224
1147 3300047323 Ga0495683_0009353 Ga0495683_0009353_1942_2616 224
1148 3300047323 Ga0495683_0037417 Ga0495683_0037417_1472_2146 224
1149 3300047323 Ga0495683_0044004 Ga0495683_0044004_189_863 224
1150 3300047323 Ga0495683_0138236 Ga0495683_0138236_372_1046 224
1151 3300047323 Ga0495683_0164316 Ga0495683_0164316_102_776 224
1152 3300047443 Ga0495687_010838 Ga0495687_010838_657_1331 224
1153 3300047444 Ga0495675_0029362 Ga0495675_0029362_1450_2124 224
1154 3300047444 Ga0495675_0066734 Ga0495675_0066734_56_730 224
1155 3300047444 Ga0495675_0161283 Ga0495675_0161283_362_1036 224
1156 3300047446 Ga0495679_000015 Ga0495679_000015_120426_121115 224
1157 3300047446 Ga0495679_000060 Ga0495679_000060_64473_65162 224
1158 3300047446 Ga0495679_000064 Ga0495679_000064_60123_60797 224
1159 3300047446 Ga0495679_000974 Ga0495679_000974_12407_13081 224
1160 3300047446 Ga0495679_002792 Ga0495679_002792_741_1415 224
1161 3300047446 Ga0495679_003450 Ga0495679_003450_3409_4098 224
1162 3300047446 Ga0495679_008712 Ga0495679_008712_1098_1772 224
1163 3300047446 Ga0495679_036353 Ga0495679_036353_171_845 224
1164 3300047446 Ga0495679_056549 Ga0495679_056549_273_947 224
1165 3300047447 Ga0495685_009249 Ga0495685_009249_246_920 224
1166 3300047469 Ga0495673_0000093 Ga0495673_0000093_134816_135490 224
1167 3300047469 Ga0495673_0000339 Ga0495673_0000339_55647_56336 224
1168 3300047469 Ga0495673_0001677 Ga0495673_0001677_12886_13560 224
1169 3300047469 Ga0495673_0001690 Ga0495673_0001690_8243_8917 224
1170 3300047469 Ga0495673_0001966 Ga0495673_0001966_7973_8662 224
1171 3300047469 Ga0495673_0004914 Ga0495673_0004914_4675_5349 224
1172 3300047469 Ga0495673_0007217 Ga0495673_0007217_5711_6400 224
1173 3300047469 Ga0495673_0008463 Ga0495673_0008463_1101_1775 224
1174 3300047469 Ga0495673_0010394 Ga0495673_0010394_570_1256 224
1175 3300047469 Ga0495673_0019005 Ga0495673_0019005_1100_1774 224
1176 3300047469 Ga0495673_0021726 Ga0495673_0021726_690_1364 224
1177 3300047469 Ga0495673_0075450 Ga0495673_0075450_205_879 224
1178 3300047470 Ga0495681_0000027 Ga0495681_0000027_43039_43713 224
1179 3300047470 Ga0495681_0000029 Ga0495681_0000029_60582_61256 224
1180 3300047470 Ga0495681_0000446 Ga0495681_0000446_2250_2924 224
1181 3300047470 Ga0495681_0002127 Ga0495681_0002127_9489_10178 224
1182 3300047470 Ga0495681_0002714 Ga0495681_0002714_3368_4042 224
1183 3300047470 Ga0495681_0003007 Ga0495681_0003007_10901_11575 224
1184 3300047470 Ga0495681_0003666 Ga0495681_0003666_1523_2197 224
1185 3300047470 Ga0495681_0004766 Ga0495681_0004766_4851_5525 224
1186 3300047470 Ga0495681_0005171 Ga0495681_0005171_2194_2883 224
1187 3300047470 Ga0495681_0005800 Ga0495681_0005800_3235_3909 224
1188 3300047470 Ga0495681_0007858 Ga0495681_0007858_2831_3505 224
1189 3300047470 Ga0495681_0010319 Ga0495681_0010319_3176_3850 224
1190 3300047470 Ga0495681_0019602 Ga0495681_0019602_1749_2423 224
1191 3300047470 Ga0495681_0041755 Ga0495681_0041755_1140_1814 224
1192 3300047470 Ga0495681_0067495 Ga0495681_0067495_260_934 224
1193 3300047470 Ga0495681_0104050 Ga0495681_0104050_347_1021 224
1194 3300047471 Ga0495684_0014123 Ga0495684_0014123_4012_4686 224
1195 3300047472 Ga0495686_0000816 Ga0495686_0000816_32551_33240 224
1196 3300047472 Ga0495686_0001441 Ga0495686_0001441_21149_21823 224
1197 3300047472 Ga0495686_0005737 Ga0495686_0005737_7334_8008 224
1198 3300047472 Ga0495686_0007165 Ga0495686_0007165_6818_7492 224
1199 3300047472 Ga0495686_0051251 Ga0495686_0051251_219_893 224
1200 3300047472 Ga0495686_0100020 Ga0495686_0100020_1002_1682 224
1201 3300047472 Ga0495686_0100704 Ga0495686_0100704_862_1536 224
1202 3300047673 Ga0495593_0001685 Ga0495593_0001685_4544_5218 224
1203 3300047673 Ga0495593_0032810 Ga0495593_0032810_190_864 224
1204 3300048091 Ga0495626_0000012 Ga0495626_0000012_239347_240036 224
1205 3300048091 Ga0495626_0000072 Ga0495626_0000072_127443_128117 224
1206 3300048091 Ga0495626_0000244 Ga0495626_0000244_56192_56866 224
1207 3300048091 Ga0495626_0000340 Ga0495626_0000340_34174_34848 224
1208 3300048091 Ga0495626_0000651 Ga0495626_0000651_31893_32567 224
1209 3300048091 Ga0495626_0015946 Ga0495626_0015946_1411_2085 224
1210 3300048091 Ga0495626_0020852 Ga0495626_0020852_2557_3231 224
1211 3300048091 Ga0495626_0114754 Ga0495626_0114754_131_805 224
1212 3300048905 Ga0496102_0000038 Ga0496102_0000038_60466_61140 224
1213 3300048905 Ga0496102_0008777 Ga0496102_0008777_6907_7596 224
1214 3300048906 Ga0496103_0085736 Ga0496103_0085736_1227_1901 224
1215 3300048908 Ga0496105_0141115 Ga0496105_0141115_1255_1929 224
1216 3300048913 Ga0496110_0016783 Ga0496110_0016783_96_770 224
1217 3300048913 Ga0496110_0210089 Ga0496110_0210089_1059_1733 224
1218 3300048913 Ga0496110_0292823 Ga0496110_0292823_566_1255 224
1219 3300048914 Ga0496111_0109636 Ga0496111_0109636_997_1671 224
1220 3300048914 Ga0496111_0198650 Ga0496111_0198650_360_1049 224
1221 3300048919 Ga0496116_0000697 Ga0496116_0000697_16806_17480 224
1222 3300048919 Ga0496116_0002982 Ga0496116_0002982_11494_12168 224
1223 3300048919 Ga0496116_0015222 Ga0496116_0015222_1508_2182 224
1224 3300048919 Ga0496116_0022132 Ga0496116_0022132_398_1078 224
1225 3300048919 Ga0496116_0046944 Ga0496116_0046944_473_1147 224
1226 3300048920 Ga0496117_0001093 Ga0496117_0001093_3641_4321 224
1227 3300048920 Ga0496117_0005893 Ga0496117_0005893_10426_11100 224
1228 3300048921 Ga0496118_0018132 Ga0496118_0018132_3795_4469 224
1229 3300048922 Ga0496119_0000086 Ga0496119_0000086_9285_9965 224
1230 3300048922 Ga0496119_0028309 Ga0496119_0028309_2298_2987 224
1231 3300048923 Ga0496120_0000130 Ga0496120_0000130_17975_18655 224
1232 3300048924 Ga0496121_0001263 Ga0496121_0001263_37879_38568 224
1233 3300048924 Ga0496121_0215892 Ga0496121_0215892_396_1070 224
1234 3300048924 Ga0496121_0222138 Ga0496121_0222138_46_729 224
1235 3300048925 Ga0496122_0003361 Ga0496122_0003361_4737_5411 224
1236 3300048925 Ga0496122_0010190 Ga0496122_0010190_4150_4839 224
1237 3300048925 Ga0496122_0088144 Ga0496122_0088144_472_1146 224
1238 3300048925 Ga0496122_0185175 Ga0496122_0185175_463_1152 224
1239 3300048926 Ga0496123_0039802 Ga0496123_0039802_1413_2087 224
1240 3300048926 Ga0496123_0099789 Ga0496123_0099789_156_845 224
1241 3300048927 Ga0496124_0000047 Ga0496124_0000047_149374_150063 224
1242 3300048927 Ga0496124_0004248 Ga0496124_0004248_12373_13047 224
1243 3300048927 Ga0496124_0007750 Ga0496124_0007750_6122_6811 224
1244 3300048927 Ga0496124_0014485 Ga0496124_0014485_3185_3874 224
1245 3300048927 Ga0496124_0020742 Ga0496124_0020742_4261_4935 224
1246 3300048927 Ga0496124_0025442 Ga0496124_0025442_133_813 224
1247 3300048927 Ga0496124_0045681 Ga0496124_0045681_958_1632 224
1248 3300048927 Ga0496124_0146923 Ga0496124_0146923_850_1530 224
1249 3300048928 Ga0496125_0010352 Ga0496125_0010352_4910_5584 224
1250 3300048928 Ga0496125_0029276 Ga0496125_0029276_1267_1941 224
1251 3300048928 Ga0496125_0064848 Ga0496125_0064848_1878_2552 224
1252 3300048929 Ga0496126_0003862 Ga0496126_0003862_14524_15198 224
1253 3300048929 Ga0496126_0115299 Ga0496126_0115299_1505_2179 224
1254 3300049459 Ga0495678_000011 Ga0495678_000011_122902_123591 224
1255 3300049459 Ga0495678_000707 Ga0495678_000707_9231_9905 224
1256 3300049459 Ga0495678_003056 Ga0495678_003056_5991_6665 224
1257 3300049459 Ga0495678_003070 Ga0495678_003070_3321_4010 224
1258 3300049459 Ga0495678_004617 Ga0495678_004617_155_829 224
1259 3300049459 Ga0495678_010366 Ga0495678_010366_1587_2261 224
1260 3300049459 Ga0495678_011349 Ga0495678_011349_2910_3584 224
1261 3300049459 Ga0495678_027553 Ga0495678_027553_1364_2038 224
1262 3300049460 Ga0495682_0000071 Ga0495682_0000071_55530_56219 224
1263 3300049460 Ga0495682_0000709 Ga0495682_0000709_19812_20486 224
1264 3300049571 Ga0501034_0000003 Ga0501034_0000003_432509_433189 224
1265 3300049662 Ga0501222_009074 Ga0501222_009074_378_1052 224
1266 3300049853 Ga0501226_000007 Ga0501226_000007_209480_210160 224
1267 3300050489 nmdc:mga03683_20590_c1 nmdc:mga03683_20590_c1_551_1225 224
1268 3300050491 nmdc:mga00v17_376756_c1 nmdc:mga00v17_376756_c1_70_744 224
1269 3300050491 nmdc:mga00v17_44145_c1 nmdc:mga00v17_44145_c1_455_1129 224
1270 3300050491 nmdc:mga00v17_45937_c1 nmdc:mga00v17_45937_c1_1258_1932 224
1271 3300050514 nmdc:mga08x19_107900_c1 nmdc:mga08x19_107900_c1_401_1075 224
1272 3300050516 nmdc:mga0sz30_30318_c1 nmdc:mga0sz30_30318_c1_275_949 224
1273 3300053079 Ga0500610_0188454 Ga0500610_0188454_99_773 224
1274 3300053135 Ga0500659_0000004 Ga0500659_0000004_6655_7335 224
1275 3300053140 Ga0500573_0006243 Ga0500573_0006243_4608_5282 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

47

216

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.8596 3 210
3dde-assembly1.cif.gz_A crystal structure of a domain of unknown function with a heme oxygenase-like fold (sden_3740) from shewanella denitrificans os217 at 2.30 a resolution 0.8569 1 210
3oql-assembly1.cif.gz_A crystal structure of a tena homolog (pspto1738) from pseudomonas syringae pv. tomato str. dc3000 at 2.54 a resolution 0.8466 3 210
4wwj-assembly1.cif.gz_A unda, an oxygen-activating, non-heme iron dependent desaturase/decarboxylase 0.8449 3 210
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.8375 3 210
ID Description Score Start End Superfamily
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8551 3 210 1.20.910.10
3ddeB00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8462 4 210 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8365 3 210 1.20.910.10
3oqlC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8023 3 210 1.20.910.10
1we1D00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8014 1 210 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A2A2DQ96-F1-model_v4 Biliverdin-producing heme oxygenase 0.9902 1 213
AF-J2WYE0-F1-model_v4 Transcription activator 0.9885 1 184
AF-A0A1Y6J1M1-F1-model_v4 Heme oxygenase 0.9883 1 210
AF-R0CXG9-F1-model_v4 Biliverdin-producing heme oxygenase 0.9865 1 214
AF-A0A4Q6YC74-F1-model_v4 deleted 0.9858 1 213

Feature Viewer

pLDDT pTM Quality
90.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map