F492450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1274 | 325 | 2548 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_11096736|Ga0157380_110967361 |
| Length | 208 |
| Sequence | VTALPHDGSPNFKRSPLGQPYPYILRPMAESPVPLLRAHARHAPWNARGLAAHAAALVDSAGVKPTNASARAMPSARAVRFYVANGLLDRPEGAGTAATYGYRHLLQLLAIKIRQREGQTLDAIRQEMREVTGDALERRVATSLAPALSLQMDAIVPREGGVFTWRRLTIADGVEVHVRDDSPAARDDVLVTLRDAVRNALGPFDLGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003400 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM | Metagenome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 230 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.08 |
| Nodule | 0 |
| Rhizoplane | 1.02 |
| Rhizosphere | 98.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157380_11096736 | 3300014326 | Unclassified | 835 |
| 2 | JGI24737J22298_10085535 | 3300001990 | Bacteria | 937 |
| 3 | JGI24750J21931_1004366 | 3300002070 | Unclassified | 1712 |
| 4 | JGI25406J46586_10029214 | 3300003203 | Bacteria | 2090 |
| 5 | JGI26131J50246_101093 | 3300003400 | Unclassified | 831 |
| 6 | Ga0058861_11685109 | 3300004800 | Bacteria | 1443 |
| 7 | Ga0065712_10003350 | 3300005290 | Bacteria | 3965 |
| 8 | Ga0065707_10093585 | 3300005295 | Bacteria | 3607 |
| 9 | Ga0070658_10005818 | 3300005327 | Bacteria | 9989 |
| 10 | Ga0070658_10029742 | 3300005327 | Bacteria | 4389 |
| 11 | Ga0070658_10031731 | 3300005327 | Bacteria | 4244 |
| 12 | Ga0070658_10143682 | 3300005327 | Unclassified | 1994 |
| 13 | Ga0070676_10000168 | 3300005328 | Bacteria | 26560 |
| 14 | Ga0070676_10009237 | 3300005328 | Bacteria | 5328 |
| 15 | Ga0070676_10013900 | 3300005328 | Bacteria | 4416 |
| 16 | Ga0070676_10278890 | 3300005328 | Unclassified | 1125 |
| 17 | Ga0070676_10279142 | 3300005328 | Bacteria | 1125 |
| 18 | Ga0070683_100004732 | 3300005329 | Bacteria | 11256 |
| 19 | Ga0070683_100007250 | 3300005329 | Bacteria | 9355 |
| 20 | Ga0070683_100007752 | 3300005329 | Bacteria | 9091 |
| 21 | Ga0070683_100018870 | 3300005329 | Bacteria | 6118 |
| 22 | Ga0070683_100097593 | 3300005329 | Unclassified | 2764 |
| 23 | Ga0070683_100153771 | 3300005329 | Bacteria | 2181 |
| 24 | Ga0070683_100206937 | 3300005329 | Bacteria | 1864 |
| 25 | Ga0070683_100239151 | 3300005329 | Bacteria | 1727 |
| 26 | Ga0070683_100259336 | 3300005329 | Unclassified | 1653 |
| 27 | Ga0070683_100263494 | 3300005329 | Bacteria | 1639 |
| 28 | Ga0070683_100277344 | 3300005329 | Bacteria | 1595 |
| 29 | Ga0070683_100309519 | 3300005329 | Bacteria | 1503 |
| 30 | Ga0070683_100770203 | 3300005329 | Unclassified | 922 |
| 31 | Ga0070683_100849876 | 3300005329 | Unclassified | 875 |
| 32 | Ga0070683_101147633 | 3300005329 | Unclassified | 746 |
| 33 | Ga0070690_100002712 | 3300005330 | Bacteria | 9553 |
| 34 | Ga0070690_100024555 | 3300005330 | Unclassified | 3706 |
| 35 | Ga0070690_100123578 | 3300005330 | Bacteria | 1740 |
| 36 | Ga0070690_100135457 | 3300005330 | Unclassified | 1667 |
| 37 | Ga0070690_100240467 | 3300005330 | Bacteria | 1276 |
| 38 | Ga0070690_100955210 | 3300005330 | Unclassified | 673 |
| 39 | Ga0070670_100000138 | 3300005331 | Bacteria | 68361 |
| 40 | Ga0070670_100001486 | 3300005331 | Bacteria | 18896 |
| 41 | Ga0070670_100051467 | 3300005331 | Unclassified | 3537 |
| 42 | Ga0070670_100198696 | 3300005331 | Bacteria | 1742 |
| 43 | Ga0070670_100344293 | 3300005331 | Bacteria | 1309 |
| 44 | Ga0070670_100417374 | 3300005331 | Bacteria | 1186 |
| 45 | Ga0070670_100429364 | 3300005331 | Bacteria | 1169 |
| 46 | Ga0070670_100451992 | 3300005331 | Unclassified | 1139 |
| 47 | Ga0070670_100588373 | 3300005331 | Bacteria | 995 |
| 48 | Ga0070670_100654713 | 3300005331 | Bacteria | 942 |
| 49 | Ga0070670_101099126 | 3300005331 | Unclassified | 725 |
| 50 | Ga0070677_10301572 | 3300005333 | Bacteria | 814 |
| 51 | Ga0068869_100004073 | 3300005334 | Bacteria | 9047 |
| 52 | Ga0068869_100402581 | 3300005334 | Unclassified | 1126 |
| 53 | Ga0068869_100722209 | 3300005334 | Bacteria | 851 |
| 54 | Ga0070666_10211825 | 3300005335 | Unclassified | 1365 |
| 55 | Ga0070680_100000013 | 3300005336 | Bacteria | 93815 |
| 56 | Ga0070680_100036695 | 3300005336 | Bacteria | 3960 |
| 57 | Ga0070680_100046546 | 3300005336 | Bacteria | 3529 |
| 58 | Ga0070680_100055200 | 3300005336 | Bacteria | 3246 |
| 59 | Ga0070680_100110394 | 3300005336 | Bacteria | 2289 |
| 60 | Ga0070680_100258391 | 3300005336 | Bacteria | 1473 |
| 61 | Ga0070680_100528799 | 3300005336 | Bacteria | 1010 |
| 62 | Ga0070682_100002084 | 3300005337 | Bacteria | 11126 |
| 63 | Ga0070682_100194942 | 3300005337 | Bacteria | 1425 |
| 64 | Ga0070682_100367923 | 3300005337 | Unclassified | 1077 |
| 65 | Ga0070682_100617379 | 3300005337 | Unclassified | 858 |
| 66 | Ga0068868_100011253 | 3300005338 | Bacteria | 6516 |
| 67 | Ga0068868_100145280 | 3300005338 | Unclassified | 1950 |
| 68 | Ga0068868_100541855 | 3300005338 | Bacteria | 1024 |
| 69 | Ga0068868_100782096 | 3300005338 | Bacteria | 860 |
| 70 | Ga0070660_100006418 | 3300005339 | Bacteria | 8149 |
| 71 | Ga0070660_100008715 | 3300005339 | Bacteria | 7101 |
| 72 | Ga0070660_100010055 | 3300005339 | Bacteria | 6674 |
| 73 | Ga0070660_100030691 | 3300005339 | Bacteria | 4033 |
| 74 | Ga0070660_100158382 | 3300005339 | Unclassified | 1823 |
| 75 | Ga0070660_100516539 | 3300005339 | Bacteria | 994 |
| 76 | Ga0070660_100596882 | 3300005339 | Bacteria | 923 |
| 77 | Ga0070660_100720566 | 3300005339 | Bacteria | 837 |
| 78 | Ga0070689_100001539 | 3300005340 | Bacteria | 14709 |
| 79 | Ga0070689_100042354 | 3300005340 | Unclassified | 3496 |
| 80 | Ga0070689_100063153 | 3300005340 | Unclassified | 2882 |
| 81 | Ga0070689_100657579 | 3300005340 | Bacteria | 912 |
| 82 | Ga0070691_10037922 | 3300005341 | Bacteria | 2274 |
| 83 | Ga0070691_10046986 | 3300005341 | Unclassified | 2052 |
| 84 | Ga0070687_100001896 | 3300005343 | Bacteria | 7603 |
| 85 | Ga0070687_100009368 | 3300005343 | Bacteria | 4194 |
| 86 | Ga0070687_100034893 | 3300005343 | Bacteria | 2493 |
| 87 | Ga0070687_100311396 | 3300005343 | Unclassified | 1003 |
| 88 | Ga0070661_100000734 | 3300005344 | Bacteria | 23915 |
| 89 | Ga0070661_100001898 | 3300005344 | Bacteria | 14473 |
| 90 | Ga0070661_100004203 | 3300005344 | Bacteria | 9938 |
| 91 | Ga0070661_100015798 | 3300005344 | Bacteria | 5328 |
| 92 | Ga0070661_100045747 | 3300005344 | Unclassified | 3200 |
| 93 | Ga0070661_100084277 | 3300005344 | Unclassified | 2348 |
| 94 | Ga0070661_100106794 | 3300005344 | Bacteria | 2087 |
| 95 | Ga0070661_100143473 | 3300005344 | Bacteria | 1801 |
| 96 | Ga0070661_100297970 | 3300005344 | Bacteria | 1254 |
| 97 | Ga0070661_100326007 | 3300005344 | Bacteria | 1200 |
| 98 | Ga0070661_100338402 | 3300005344 | Unclassified | 1178 |
| 99 | Ga0070661_100420035 | 3300005344 | Unclassified | 1060 |
| 100 | Ga0070692_10005540 | 3300005345 | Bacteria | 5397 |
| 101 | Ga0070692_10039580 | 3300005345 | Unclassified | 2408 |
| 102 | Ga0070692_10436222 | 3300005345 | Bacteria | 835 |
| 103 | Ga0070668_100000678 | 3300005347 | Bacteria | 23171 |
| 104 | Ga0070668_100000880 | 3300005347 | Bacteria | 20888 |
| 105 | Ga0070668_100005111 | 3300005347 | Bacteria | 9720 |
| 106 | Ga0070668_100011973 | 3300005347 | Bacteria | 6462 |
| 107 | Ga0070668_100083128 | 3300005347 | Bacteria | 2513 |
| 108 | Ga0070668_100192247 | 3300005347 | Unclassified | 1672 |
| 109 | Ga0070668_100671785 | 3300005347 | Unclassified | 912 |
| 110 | Ga0070669_100000540 | 3300005353 | Bacteria | 28191 |
| 111 | Ga0070669_100001286 | 3300005353 | Bacteria | 18141 |
| 112 | Ga0070669_100004218 | 3300005353 | Bacteria | 10398 |
| 113 | Ga0070669_100085773 | 3300005353 | Unclassified | 2352 |
| 114 | Ga0070669_100266331 | 3300005353 | Bacteria | 1369 |
| 115 | Ga0070669_100616814 | 3300005353 | Bacteria | 910 |
| 116 | Ga0070675_100003493 | 3300005354 | Bacteria | 11919 |
| 117 | Ga0070675_100004393 | 3300005354 | Bacteria | 10756 |
| 118 | Ga0070675_100013137 | 3300005354 | Bacteria | 6507 |
| 119 | Ga0070675_100018476 | 3300005354 | Bacteria | 5550 |
| 120 | Ga0070675_100037481 | 3300005354 | Bacteria | 3949 |
| 121 | Ga0070675_100140455 | 3300005354 | Bacteria | 2064 |
| 122 | Ga0070671_100016516 | 3300005355 | Bacteria | 5966 |
| 123 | Ga0070671_100028426 | 3300005355 | Bacteria | 4604 |
| 124 | Ga0070671_100221814 | 3300005355 | Unclassified | 1604 |
| 125 | Ga0070671_100246747 | 3300005355 | Bacteria | 1516 |
| 126 | Ga0070671_100548826 | 3300005355 | Unclassified | 996 |
| 127 | Ga0070671_100698796 | 3300005355 | Bacteria | 879 |
| 128 | Ga0070671_101028813 | 3300005355 | Unclassified | 722 |
| 129 | Ga0070671_101353297 | 3300005355 | Bacteria | 628 |
| 130 | Ga0070674_100006253 | 3300005356 | Bacteria | 6932 |
| 131 | Ga0070674_100041356 | 3300005356 | Unclassified | 3123 |
| 132 | Ga0070674_100060234 | 3300005356 | Bacteria | 2645 |
| 133 | Ga0070674_100081882 | 3300005356 | Bacteria | 2308 |
| 134 | Ga0070674_100591296 | 3300005356 | Unclassified | 936 |
| 135 | Ga0070673_100027074 | 3300005364 | Bacteria | 4245 |
| 136 | Ga0070673_100035765 | 3300005364 | Bacteria | 3769 |
| 137 | Ga0070673_100065175 | 3300005364 | Bacteria | 2905 |
| 138 | Ga0070673_100168737 | 3300005364 | Unclassified | 1866 |
| 139 | Ga0070673_100482519 | 3300005364 | Bacteria | 1119 |
| 140 | Ga0070673_100551438 | 3300005364 | Bacteria | 1047 |
| 141 | Ga0070673_100599470 | 3300005364 | Unclassified | 1005 |
| 142 | Ga0070688_100015310 | 3300005365 | Bacteria | 4361 |
| 143 | Ga0070688_100019586 | 3300005365 | Bacteria | 3922 |
| 144 | Ga0070688_100042802 | 3300005365 | Unclassified | 2787 |
| 145 | Ga0070688_100050142 | 3300005365 | Unclassified | 2600 |
| 146 | Ga0070688_100217234 | 3300005365 | Bacteria | 1345 |
| 147 | Ga0070688_100632519 | 3300005365 | Bacteria | 822 |
| 148 | Ga0070659_100000291 | 3300005366 | Bacteria | 39272 |
| 149 | Ga0070659_100022506 | 3300005366 | Bacteria | 4812 |
| 150 | Ga0070659_100023399 | 3300005366 | Bacteria | 4727 |
| 151 | Ga0070659_100025696 | 3300005366 | Bacteria | 4527 |
| 152 | Ga0070659_100030949 | 3300005366 | Unclassified | 4143 |
| 153 | Ga0070659_100050493 | 3300005366 | Bacteria | 3269 |
| 154 | Ga0070659_100100147 | 3300005366 | Unclassified | 2332 |
| 155 | Ga0070659_100159350 | 3300005366 | Unclassified | 1844 |
| 156 | Ga0070659_100587685 | 3300005366 | Bacteria | 956 |
| 157 | Ga0070659_100666020 | 3300005366 | Bacteria | 898 |
| 158 | Ga0070659_100685672 | 3300005366 | Bacteria | 885 |
| 159 | Ga0070659_101068498 | 3300005366 | Bacteria | 710 |
| 160 | Ga0070659_101246451 | 3300005366 | Unclassified | 658 |
| 161 | Ga0070659_101394057 | 3300005366 | Unclassified | 623 |
| 162 | Ga0070667_100009570 | 3300005367 | Bacteria | 8033 |
| 163 | Ga0070667_100039501 | 3300005367 | Bacteria | 3955 |
| 164 | Ga0070667_100192006 | 3300005367 | Unclassified | 1809 |
| 165 | Ga0070667_100350136 | 3300005367 | Unclassified | 1337 |
| 166 | Ga0070667_100448702 | 3300005367 | Unclassified | 1178 |
| 167 | Ga0070667_100662772 | 3300005367 | Bacteria | 964 |
| 168 | Ga0070709_10042515 | 3300005434 | Bacteria | 2807 |
| 169 | Ga0070709_10100118 | 3300005434 | Unclassified | 1929 |
| 170 | Ga0070709_10358099 | 3300005434 | Unclassified | 1080 |
| 171 | Ga0070714_100003238 | 3300005435 | Bacteria | 12108 |
| 172 | Ga0070714_100003435 | 3300005435 | Bacteria | 11801 |
| 173 | Ga0070714_100004487 | 3300005435 | Bacteria | 10514 |
| 174 | Ga0070714_100117251 | 3300005435 | Bacteria | 2364 |
| 175 | Ga0070714_100169757 | 3300005435 | Bacteria | 1979 |
| 176 | Ga0070713_100000095 | 3300005436 | Bacteria | 56677 |
| 177 | Ga0070713_100147922 | 3300005436 | Bacteria | 2087 |
| 178 | Ga0070713_100746381 | 3300005436 | Bacteria | 936 |
| 179 | Ga0070713_101045853 | 3300005436 | Unclassified | 788 |
| 180 | Ga0070713_101286063 | 3300005436 | Bacteria | 709 |
| 181 | Ga0070710_10050893 | 3300005437 | Unclassified | 2324 |
| 182 | Ga0070710_10127599 | 3300005437 | Bacteria | 1547 |
| 183 | Ga0070710_10163231 | 3300005437 | Bacteria | 1383 |
| 184 | Ga0070701_10008887 | 3300005438 | Unclassified | 4371 |
| 185 | Ga0070701_10038757 | 3300005438 | Unclassified | 2414 |
| 186 | Ga0070701_10070552 | 3300005438 | Unclassified | 1867 |
| 187 | Ga0070701_10132471 | 3300005438 | Unclassified | 1418 |
| 188 | Ga0070701_10430996 | 3300005438 | Bacteria | 842 |
| 189 | Ga0070711_100064802 | 3300005439 | Bacteria | 2554 |
| 190 | Ga0070711_100210604 | 3300005439 | Bacteria | 1505 |
| 191 | Ga0070711_100441226 | 3300005439 | Bacteria | 1064 |
| 192 | Ga0070705_100084933 | 3300005440 | Bacteria | 1955 |
| 193 | Ga0070705_100573587 | 3300005440 | Bacteria | 869 |
| 194 | Ga0070700_100033729 | 3300005441 | Unclassified | 3085 |
| 195 | Ga0070700_100034857 | 3300005441 | Unclassified | 3042 |
| 196 | Ga0070700_100126567 | 3300005441 | Bacteria | 1719 |
| 197 | Ga0070700_100364241 | 3300005441 | Bacteria | 1076 |
| 198 | Ga0070700_100551161 | 3300005441 | Bacteria | 896 |
| 199 | Ga0070700_100840393 | 3300005441 | Unclassified | 743 |
| 200 | Ga0070694_100093933 | 3300005444 | Unclassified | 2109 |
| 201 | Ga0070694_100358805 | 3300005444 | Bacteria | 1131 |
| 202 | Ga0070694_100593170 | 3300005444 | Unclassified | 891 |
| 203 | Ga0070708_100326692 | 3300005445 | Bacteria | 1445 |
| 204 | Ga0070663_100043127 | 3300005455 | Unclassified | 3173 |
| 205 | Ga0070663_100109520 | 3300005455 | Bacteria | 2073 |
| 206 | Ga0070663_100142654 | 3300005455 | Bacteria | 1830 |
| 207 | Ga0070663_100266949 | 3300005455 | Bacteria | 1359 |
| 208 | Ga0070663_100343695 | 3300005455 | Bacteria | 1206 |
| 209 | Ga0070663_100441460 | 3300005455 | Bacteria | 1071 |
| 210 | Ga0070663_100494603 | 3300005455 | Bacteria | 1014 |
| 211 | Ga0070678_100260634 | 3300005456 | Unclassified | 1458 |
| 212 | Ga0070678_100650150 | 3300005456 | Unclassified | 946 |
| 213 | Ga0070678_100913111 | 3300005456 | Bacteria | 803 |
| 214 | Ga0070662_100004834 | 3300005457 | Bacteria | 8539 |
| 215 | Ga0070662_100010581 | 3300005457 | Bacteria | 6062 |
| 216 | Ga0070662_100016639 | 3300005457 | Bacteria | 4941 |
| 217 | Ga0070662_100017321 | 3300005457 | Bacteria | 4856 |
| 218 | Ga0070662_100017619 | 3300005457 | Bacteria | 4820 |
| 219 | Ga0070662_100075905 | 3300005457 | Unclassified | 2490 |
| 220 | Ga0070662_100270419 | 3300005457 | Bacteria | 1372 |
| 221 | Ga0070662_100850108 | 3300005457 | Bacteria | 777 |
| 222 | Ga0070681_10000279 | 3300005458 | Bacteria | 40944 |
| 223 | Ga0070681_10001401 | 3300005458 | Bacteria | 21138 |
| 224 | Ga0070681_10004777 | 3300005458 | Bacteria | 12985 |
| 225 | Ga0070681_10005847 | 3300005458 | Bacteria | 11909 |
| 226 | Ga0070681_10006833 | 3300005458 | Bacteria | 11109 |
| 227 | Ga0070681_10022331 | 3300005458 | Bacteria | 6354 |
| 228 | Ga0070681_10105390 | 3300005458 | Unclassified | 2761 |
| 229 | Ga0070681_10228503 | 3300005458 | Bacteria | 1775 |
| 230 | Ga0070681_10268833 | 3300005458 | Bacteria | 1616 |
| 231 | Ga0070681_10501665 | 3300005458 | Unclassified | 1127 |
| 232 | Ga0070681_10701899 | 3300005458 | Unclassified | 927 |
| 233 | Ga0068867_100002642 | 3300005459 | Bacteria | 12639 |
| 234 | Ga0068867_100008150 | 3300005459 | Bacteria | 7401 |
| 235 | Ga0068867_100919148 | 3300005459 | Bacteria | 788 |
| 236 | Ga0070685_10007422 | 3300005466 | Bacteria | 5611 |
| 237 | Ga0070685_10037107 | 3300005466 | Unclassified | 2758 |
| 238 | Ga0070685_10038452 | 3300005466 | Unclassified | 2713 |
| 239 | Ga0070706_100287132 | 3300005467 | Bacteria | 1535 |
| 240 | Ga0070707_100678577 | 3300005468 | Bacteria | 993 |
| 241 | Ga0070707_100925940 | 3300005468 | Unclassified | 836 |
| 242 | Ga0070698_100000313 | 3300005471 | Bacteria | 49238 |
| 243 | Ga0070698_100023878 | 3300005471 | Bacteria | 6384 |
| 244 | Ga0070698_100068253 | 3300005471 | Bacteria | 3573 |
| 245 | Ga0070698_100192394 | 3300005471 | Unclassified | 1977 |
| 246 | Ga0070699_100002608 | 3300005518 | Bacteria | 16105 |
| 247 | Ga0070699_100095470 | 3300005518 | Bacteria | 2603 |
| 248 | Ga0070699_100524160 | 3300005518 | Unclassified | 1077 |
| 249 | Ga0070699_100788300 | 3300005518 | Unclassified | 870 |
| 250 | Ga0070679_100000874 | 3300005530 | Bacteria | 26168 |
| 251 | Ga0070679_100000939 | 3300005530 | Bacteria | 25340 |
| 252 | Ga0070679_100001684 | 3300005530 | Bacteria | 19884 |
| 253 | Ga0070679_100009396 | 3300005530 | Bacteria | 9249 |
| 254 | Ga0070679_100016713 | 3300005530 | Bacteria | 7089 |
| 255 | Ga0070679_100019441 | 3300005530 | Bacteria | 6604 |
| 256 | Ga0070679_100021072 | 3300005530 | Bacteria | 6360 |
| 257 | Ga0070679_100041763 | 3300005530 | Bacteria | 4565 |
| 258 | Ga0070679_100046402 | 3300005530 | Bacteria | 4330 |
| 259 | Ga0070679_100062370 | 3300005530 | Unclassified | 3716 |
| 260 | Ga0070679_100080334 | 3300005530 | Bacteria | 3250 |
| 261 | Ga0070679_100081189 | 3300005530 | Unclassified | 3231 |
| 262 | Ga0070679_100090382 | 3300005530 | Unclassified | 3050 |
| 263 | Ga0070679_100141995 | 3300005530 | Bacteria | 2380 |
| 264 | Ga0070679_100167787 | 3300005530 | Unclassified | 2168 |
| 265 | Ga0070679_100365976 | 3300005530 | Bacteria | 1389 |
| 266 | Ga0070679_100410004 | 3300005530 | Bacteria | 1301 |
| 267 | Ga0070679_101486581 | 3300005530 | Bacteria | 624 |
| 268 | Ga0070684_100006545 | 3300005535 | Bacteria | 9020 |
| 269 | Ga0070684_100009374 | 3300005535 | Bacteria | 7707 |
| 270 | Ga0070684_100015982 | 3300005535 | Bacteria | 6130 |
| 271 | Ga0070684_100017108 | 3300005535 | Bacteria | 5944 |
| 272 | Ga0070684_100017490 | 3300005535 | Bacteria | 5888 |
| 273 | Ga0070684_100028570 | 3300005535 | Bacteria | 4719 |
| 274 | Ga0070684_100035828 | 3300005535 | Unclassified | 4250 |
| 275 | Ga0070684_100115789 | 3300005535 | Unclassified | 2407 |
| 276 | Ga0070684_100141729 | 3300005535 | Bacteria | 2174 |
| 277 | Ga0070684_100156339 | 3300005535 | Unclassified | 2068 |
| 278 | Ga0070684_100157973 | 3300005535 | Bacteria | 2056 |
| 279 | Ga0070684_100294621 | 3300005535 | Bacteria | 1488 |
| 280 | Ga0070684_100297055 | 3300005535 | Unclassified | 1482 |
| 281 | Ga0070684_100558413 | 3300005535 | Bacteria | 1063 |
| 282 | Ga0070684_100814249 | 3300005535 | Bacteria | 873 |
| 283 | Ga0070684_101253301 | 3300005535 | Unclassified | 698 |
| 284 | Ga0070697_100077357 | 3300005536 | Bacteria | 2736 |
| 285 | Ga0070697_100629957 | 3300005536 | Bacteria | 944 |
| 286 | Ga0070697_100801653 | 3300005536 | Unclassified | 833 |
| 287 | Ga0068853_100003657 | 3300005539 | Bacteria | 11792 |
| 288 | Ga0068853_100009729 | 3300005539 | Bacteria | 7755 |
| 289 | Ga0068853_100062682 | 3300005539 | Bacteria | 3218 |
| 290 | Ga0068853_100103828 | 3300005539 | Bacteria | 2516 |
| 291 | Ga0068853_100120338 | 3300005539 | Bacteria | 2341 |
| 292 | Ga0068853_100184630 | 3300005539 | Bacteria | 1892 |
| 293 | Ga0068853_101350388 | 3300005539 | Unclassified | 689 |
| 294 | Ga0070672_100009462 | 3300005543 | Bacteria | 6718 |
| 295 | Ga0070672_100014207 | 3300005543 | Bacteria | 5635 |
| 296 | Ga0070672_100017142 | 3300005543 | Bacteria | 5207 |
| 297 | Ga0070672_100028463 | 3300005543 | Unclassified | 4180 |
| 298 | Ga0070672_100149714 | 3300005543 | Unclassified | 1930 |
| 299 | Ga0070672_100169590 | 3300005543 | Unclassified | 1814 |
| 300 | Ga0070672_100452636 | 3300005543 | Bacteria | 1106 |
| 301 | Ga0070672_100542576 | 3300005543 | Bacteria | 1009 |
| 302 | Ga0070672_100613758 | 3300005543 | Unclassified | 948 |
| 303 | Ga0070672_100784309 | 3300005543 | Bacteria | 838 |
| 304 | Ga0070686_100364648 | 3300005544 | Bacteria | 1089 |
| 305 | Ga0070695_100434602 | 3300005545 | Unclassified | 1002 |
| 306 | Ga0070696_100000190 | 3300005546 | Bacteria | 36010 |
| 307 | Ga0070696_100251274 | 3300005546 | Unclassified | 1337 |
| 308 | Ga0070693_100002253 | 3300005547 | Bacteria | 8841 |
| 309 | Ga0070693_100003289 | 3300005547 | Bacteria | 7510 |
| 310 | Ga0070693_100003791 | 3300005547 | Bacteria | 7078 |
| 311 | Ga0070693_100225147 | 3300005547 | Unclassified | 1231 |
| 312 | Ga0070665_100312188 | 3300005548 | Unclassified | 1576 |
| 313 | Ga0070665_100315992 | 3300005548 | Unclassified | 1566 |
| 314 | Ga0070665_101228823 | 3300005548 | Bacteria | 760 |
| 315 | Ga0070704_100097734 | 3300005549 | Bacteria | 2204 |
| 316 | Ga0070704_100130152 | 3300005549 | Unclassified | 1949 |
| 317 | Ga0068855_100010233 | 3300005563 | Bacteria | 11306 |
| 318 | Ga0068855_100020223 | 3300005563 | Bacteria | 7991 |
| 319 | Ga0068855_100031164 | 3300005563 | Bacteria | 6370 |
| 320 | Ga0068855_100055811 | 3300005563 | Bacteria | 4637 |
| 321 | Ga0068855_100081061 | 3300005563 | Bacteria | 3762 |
| 322 | Ga0068855_100086592 | 3300005563 | Unclassified | 3623 |
| 323 | Ga0068855_101517613 | 3300005563 | Bacteria | 687 |
| 324 | Ga0070664_100005169 | 3300005564 | Bacteria | 10476 |
| 325 | Ga0070664_100005766 | 3300005564 | Bacteria | 9988 |
| 326 | Ga0070664_100011681 | 3300005564 | Bacteria | 7127 |
| 327 | Ga0070664_100016028 | 3300005564 | Bacteria | 6140 |
| 328 | Ga0070664_100022022 | 3300005564 | Bacteria | 5255 |
| 329 | Ga0070664_100032406 | 3300005564 | Unclassified | 4371 |
| 330 | Ga0070664_100038168 | 3300005564 | Bacteria | 4042 |
| 331 | Ga0070664_100072912 | 3300005564 | Unclassified | 2945 |
| 332 | Ga0070664_100076502 | 3300005564 | Bacteria | 2876 |
| 333 | Ga0070664_100081659 | 3300005564 | Unclassified | 2786 |
| 334 | Ga0070664_100132548 | 3300005564 | Bacteria | 2189 |
| 335 | Ga0070664_100165577 | 3300005564 | Bacteria | 1959 |
| 336 | Ga0070664_100693691 | 3300005564 | Unclassified | 948 |
| 337 | Ga0070664_101292195 | 3300005564 | Bacteria | 689 |
| 338 | Ga0068857_100000435 | 3300005577 | Bacteria | 29551 |
| 339 | Ga0068857_100000456 | 3300005577 | Bacteria | 29195 |
| 340 | Ga0068857_100011507 | 3300005577 | Bacteria | 7696 |
| 341 | Ga0068857_100024423 | 3300005577 | Bacteria | 5320 |
| 342 | Ga0068857_100061990 | 3300005577 | Bacteria | 3324 |
| 343 | Ga0068857_100152751 | 3300005577 | Unclassified | 2093 |
| 344 | Ga0068854_100005455 | 3300005578 | Bacteria | 8033 |
| 345 | Ga0068854_100046441 | 3300005578 | Bacteria | 3092 |
| 346 | Ga0068854_100053750 | 3300005578 | Unclassified | 2894 |
| 347 | Ga0068854_100500477 | 3300005578 | Bacteria | 1023 |
| 348 | Ga0068854_100668091 | 3300005578 | Unclassified | 894 |
| 349 | Ga0068856_100041180 | 3300005614 | Bacteria | 4538 |
| 350 | Ga0068856_100350449 | 3300005614 | Bacteria | 1495 |
| 351 | Ga0070702_100000053 | 3300005615 | Bacteria | 32512 |
| 352 | Ga0070702_100048828 | 3300005615 | Bacteria | 2411 |
| 353 | Ga0068852_100003960 | 3300005616 | Bacteria | 10406 |
| 354 | Ga0068852_100006328 | 3300005616 | Bacteria | 8544 |
| 355 | Ga0068852_100010182 | 3300005616 | Bacteria | 7008 |
| 356 | Ga0068852_100020736 | 3300005616 | Bacteria | 5229 |
| 357 | Ga0068852_100213334 | 3300005616 | Unclassified | 1832 |
| 358 | Ga0068852_100274856 | 3300005616 | Unclassified | 1622 |
| 359 | Ga0068852_100277016 | 3300005616 | Bacteria | 1616 |
| 360 | Ga0068852_100407162 | 3300005616 | Unclassified | 1339 |
| 361 | Ga0068852_100445217 | 3300005616 | Unclassified | 1281 |
| 362 | Ga0068852_100874609 | 3300005616 | Bacteria | 915 |
| 363 | Ga0068852_101001748 | 3300005616 | Bacteria | 854 |
| 364 | Ga0068852_101024439 | 3300005616 | Unclassified | 845 |
| 365 | Ga0068852_101376636 | 3300005616 | Bacteria | 727 |
| 366 | Ga0068859_100014164 | 3300005617 | Bacteria | 7997 |
| 367 | Ga0068859_100078645 | 3300005617 | Bacteria | 3339 |
| 368 | Ga0068859_100123299 | 3300005617 | Bacteria | 2659 |
| 369 | Ga0068859_100124815 | 3300005617 | Unclassified | 2642 |
| 370 | Ga0068859_100194473 | 3300005617 | Unclassified | 2113 |
| 371 | Ga0068859_100235850 | 3300005617 | Bacteria | 1918 |
| 372 | Ga0068859_100431363 | 3300005617 | Bacteria | 1414 |
| 373 | Ga0068859_102160041 | 3300005617 | Unclassified | 614 |
| 374 | Ga0068864_100004639 | 3300005618 | Bacteria | 11271 |
| 375 | Ga0068864_100081017 | 3300005618 | Unclassified | 2845 |
| 376 | Ga0068864_100110516 | 3300005618 | Bacteria | 2448 |
| 377 | Ga0068864_100120970 | 3300005618 | Unclassified | 2340 |
| 378 | Ga0068864_100235627 | 3300005618 | Unclassified | 1694 |
| 379 | Ga0068864_100527880 | 3300005618 | Bacteria | 1139 |
| 380 | Ga0068864_100652782 | 3300005618 | Bacteria | 1025 |
| 381 | Ga0068864_101089748 | 3300005618 | Unclassified | 795 |
| 382 | Ga0068861_100008798 | 3300005719 | Bacteria | 6954 |
| 383 | Ga0068861_100010924 | 3300005719 | Bacteria | 6308 |
| 384 | Ga0068861_101143242 | 3300005719 | Bacteria | 750 |
| 385 | Ga0068851_10062968 | 3300005834 | Unclassified | 1904 |
| 386 | Ga0068870_10000965 | 3300005840 | Bacteria | 11308 |
| 387 | Ga0068870_10005182 | 3300005840 | Bacteria | 5677 |
| 388 | Ga0068870_10059254 | 3300005840 | Unclassified | 2052 |
| 389 | Ga0068870_10164160 | 3300005840 | Bacteria | 1320 |
| 390 | Ga0068863_100001285 | 3300005841 | Bacteria | 25050 |
| 391 | Ga0068863_100006717 | 3300005841 | Bacteria | 11279 |
| 392 | Ga0068863_100210448 | 3300005841 | Bacteria | 1873 |
| 393 | Ga0068863_100269397 | 3300005841 | Bacteria | 1648 |
| 394 | Ga0068863_100269802 | 3300005841 | Unclassified | 1647 |
| 395 | Ga0068863_100303181 | 3300005841 | Unclassified | 1550 |
| 396 | Ga0068858_100088084 | 3300005842 | Unclassified | 2888 |
| 397 | Ga0068858_100140249 | 3300005842 | Unclassified | 2269 |
| 398 | Ga0068858_100513713 | 3300005842 | Bacteria | 1158 |
| 399 | Ga0068860_100003929 | 3300005843 | Bacteria | 15273 |
| 400 | Ga0068860_100023638 | 3300005843 | Bacteria | 5940 |
| 401 | Ga0068860_100167691 | 3300005843 | Bacteria | 2120 |
| 402 | Ga0068860_100379244 | 3300005843 | Bacteria | 1396 |
| 403 | Ga0068862_100000846 | 3300005844 | Bacteria | 30132 |
| 404 | Ga0068862_100009616 | 3300005844 | Bacteria | 7990 |
| 405 | Ga0068862_100062863 | 3300005844 | Unclassified | 3193 |
| 406 | Ga0068862_100123546 | 3300005844 | Unclassified | 2284 |
| 407 | Ga0081539_10000131 | 3300005985 | Bacteria | 176467 |
| 408 | Ga0081539_10007371 | 3300005985 | Bacteria | 10062 |
| 409 | Ga0081539_10163606 | 3300005985 | Bacteria | 1058 |
| 410 | Ga0070717_10002392 | 3300006028 | Bacteria | 13228 |
| 411 | Ga0070717_10140320 | 3300006028 | Unclassified | 2084 |
| 412 | Ga0070717_10244011 | 3300006028 | Bacteria | 1585 |
| 413 | Ga0070715_10428448 | 3300006163 | Unclassified | 742 |
| 414 | Ga0070712_100003513 | 3300006175 | Bacteria | 9645 |
| 415 | Ga0070712_100231385 | 3300006175 | Bacteria | 1468 |
| 416 | Ga0070712_101213635 | 3300006175 | Bacteria | 656 |
| 417 | Ga0097621_100017887 | 3300006237 | Bacteria | 5397 |
| 418 | Ga0097621_100331384 | 3300006237 | Unclassified | 1350 |
| 419 | Ga0068871_100015696 | 3300006358 | Bacteria | 5680 |
| 420 | Ga0068871_100025116 | 3300006358 | Unclassified | 4631 |
| 421 | Ga0075428_100597542 | 3300006844 | Unclassified | 1179 |
| 422 | Ga0075428_100673380 | 3300006844 | Bacteria | 1103 |
| 423 | Ga0075430_100009123 | 3300006846 | Bacteria | 8377 |
| 424 | Ga0075430_100016363 | 3300006846 | Bacteria | 6315 |
| 425 | Ga0075430_100020044 | 3300006846 | Bacteria | 5693 |
| 426 | Ga0075430_100032090 | 3300006846 | Bacteria | 4458 |
| 427 | Ga0075430_100058524 | 3300006846 | Bacteria | 3239 |
| 428 | Ga0075430_100061491 | 3300006846 | Bacteria | 3155 |
| 429 | Ga0075431_100012678 | 3300006847 | Bacteria | 8512 |
| 430 | Ga0075431_100015816 | 3300006847 | Bacteria | 7650 |
| 431 | Ga0075431_100132922 | 3300006847 | Bacteria | 2566 |
| 432 | Ga0075431_100238022 | 3300006847 | Bacteria | 1853 |
| 433 | Ga0075431_100353559 | 3300006847 | Unclassified | 1477 |
| 434 | Ga0075431_100356831 | 3300006847 | Bacteria | 1469 |
| 435 | Ga0075431_100485812 | 3300006847 | Bacteria | 1227 |
| 436 | Ga0075431_100507627 | 3300006847 | Bacteria | 1196 |
| 437 | Ga0075431_100920337 | 3300006847 | Bacteria | 843 |
| 438 | Ga0075433_10012329 | 3300006852 | Bacteria | 6898 |
| 439 | Ga0075433_10021411 | 3300006852 | Bacteria | 5421 |
| 440 | Ga0075434_100023582 | 3300006871 | Bacteria | 5999 |
| 441 | Ga0075434_100229404 | 3300006871 | Unclassified | 1876 |
| 442 | Ga0075434_100297142 | 3300006871 | Bacteria | 1635 |
| 443 | Ga0075434_100299681 | 3300006871 | Bacteria | 1628 |
| 444 | Ga0075434_100478628 | 3300006871 | Bacteria | 1266 |
| 445 | Ga0075429_100055347 | 3300006880 | Bacteria | 3452 |
| 446 | Ga0075429_100057297 | 3300006880 | Bacteria | 3392 |
| 447 | Ga0075429_100186631 | 3300006880 | Archaea | 1817 |
| 448 | Ga0075429_100218947 | 3300006880 | Bacteria | 1668 |
| 449 | Ga0075429_101094463 | 3300006880 | Bacteria | 696 |
| 450 | Ga0068865_100013918 | 3300006881 | Bacteria | 5101 |
| 451 | Ga0068865_100091177 | 3300006881 | Bacteria | 2211 |
| 452 | Ga0068865_100120636 | 3300006881 | Unclassified | 1949 |
| 453 | Ga0068865_100158155 | 3300006881 | Bacteria | 1726 |
| 454 | Ga0068865_100164652 | 3300006881 | Unclassified | 1695 |
| 455 | Ga0075436_100097699 | 3300006914 | Unclassified | 2043 |
| 456 | Ga0097620_100014165 | 3300006931 | Bacteria | 7997 |
| 457 | Ga0097620_100078642 | 3300006931 | Bacteria | 3339 |
| 458 | Ga0097620_100123299 | 3300006931 | Bacteria | 2659 |
| 459 | Ga0097620_100124814 | 3300006931 | Unclassified | 2642 |
| 460 | Ga0097620_100194478 | 3300006931 | Unclassified | 2113 |
| 461 | Ga0097620_100235866 | 3300006931 | Bacteria | 1918 |
| 462 | Ga0097620_100431368 | 3300006931 | Bacteria | 1414 |
| 463 | Ga0097620_100538649 | 3300006931 | Unclassified | 1262 |
| 464 | Ga0097620_102160021 | 3300006931 | Unclassified | 614 |
| 465 | Ga0075435_100017876 | 3300007076 | Bacteria | 5375 |
| 466 | Ga0075435_100170667 | 3300007076 | Bacteria | 1835 |
| 467 | Ga0105240_10012482 | 3300009093 | Bacteria | 11724 |
| 468 | Ga0105240_10064366 | 3300009093 | Bacteria | 4556 |
| 469 | Ga0105240_10576768 | 3300009093 | Unclassified | 1241 |
| 470 | Ga0111539_10007826 | 3300009094 | Bacteria | 13646 |
| 471 | Ga0111539_10058021 | 3300009094 | Bacteria | 4594 |
| 472 | Ga0111539_10070557 | 3300009094 | Unclassified | 4124 |
| 473 | Ga0111539_10400356 | 3300009094 | Archaea | 1599 |
| 474 | Ga0111539_10569533 | 3300009094 | Bacteria | 1319 |
| 475 | Ga0105245_10062208 | 3300009098 | Unclassified | 3368 |
| 476 | Ga0105245_10183517 | 3300009098 | Bacteria | 2000 |
| 477 | Ga0105245_10229360 | 3300009098 | Bacteria | 1795 |
| 478 | Ga0105245_10511613 | 3300009098 | Unclassified | 1218 |
| 479 | Ga0105245_10567189 | 3300009098 | Bacteria | 1158 |
| 480 | Ga0105245_11822974 | 3300009098 | Unclassified | 661 |
| 481 | Ga0105247_10489318 | 3300009101 | Unclassified | 894 |
| 482 | Ga0114129_10044841 | 3300009147 | Bacteria | 6219 |
| 483 | Ga0114129_10165608 | 3300009147 | Unclassified | 3017 |
| 484 | Ga0114129_11330570 | 3300009147 | Bacteria | 889 |
| 485 | Ga0105243_10033730 | 3300009148 | Bacteria | 3959 |
| 486 | Ga0105243_10108483 | 3300009148 | Unclassified | 2317 |
| 487 | Ga0105243_11120700 | 3300009148 | Unclassified | 796 |
| 488 | Ga0105241_10003074 | 3300009174 | Bacteria | 12448 |
| 489 | Ga0105241_10016968 | 3300009174 | Bacteria | 5344 |
| 490 | Ga0105241_10683380 | 3300009174 | Unclassified | 935 |
| 491 | Ga0105242_10008146 | 3300009176 | Bacteria | 8061 |
| 492 | Ga0105242_10009063 | 3300009176 | Bacteria | 7645 |
| 493 | Ga0105242_10180733 | 3300009176 | Unclassified | 1861 |
| 494 | Ga0105242_10335962 | 3300009176 | Unclassified | 1391 |
| 495 | Ga0105242_10438421 | 3300009176 | Unclassified | 1228 |
| 496 | Ga0105248_10013744 | 3300009177 | Bacteria | 8912 |
| 497 | Ga0105248_10029207 | 3300009177 | Bacteria | 6149 |
| 498 | Ga0105248_10039086 | 3300009177 | Bacteria | 5313 |
| 499 | Ga0105248_10039980 | 3300009177 | Bacteria | 5256 |
| 500 | Ga0105248_10093987 | 3300009177 | Bacteria | 3377 |
| 501 | Ga0105248_10223406 | 3300009177 | Bacteria | 2120 |
| 502 | Ga0105248_10401324 | 3300009177 | Unclassified | 1544 |
| 503 | Ga0105237_10002586 | 3300009545 | Bacteria | 22321 |
| 504 | Ga0105238_10114356 | 3300009551 | Bacteria | 2678 |
| 505 | Ga0105238_10174132 | 3300009551 | Unclassified | 2128 |
| 506 | Ga0105249_10000009 | 3300009553 | Bacteria | 313866 |
| 507 | Ga0105249_10000188 | 3300009553 | Bacteria | 71137 |
| 508 | Ga0105249_10001451 | 3300009553 | Bacteria | 20761 |
| 509 | Ga0105249_10114589 | 3300009553 | Bacteria | 2552 |
| 510 | Ga0105249_10482655 | 3300009553 | Unclassified | 1282 |
| 511 | Ga0105239_10003476 | 3300010375 | Bacteria | 19271 |
| 512 | Ga0105239_10027015 | 3300010375 | Bacteria | 6318 |
| 513 | Ga0105246_10000122 | 3300011119 | Bacteria | 35630 |
| 514 | Ga0105246_10154875 | 3300011119 | Bacteria | 1739 |
| 515 | Ga0105246_10181175 | 3300011119 | Bacteria | 1622 |
| 516 | Ga0105246_10358808 | 3300011119 | Bacteria | 1197 |
| 517 | Ga0157373_10010453 | 3300013100 | Bacteria | 6829 |
| 518 | Ga0157373_10028086 | 3300013100 | Bacteria | 4060 |
| 519 | Ga0157373_10182404 | 3300013100 | Bacteria | 1478 |
| 520 | Ga0157373_10465921 | 3300013100 | Bacteria | 910 |
| 521 | Ga0157371_10015191 | 3300013102 | Bacteria | 5781 |
| 522 | Ga0157371_10133327 | 3300013102 | Bacteria | 1768 |
| 523 | Ga0157371_10403280 | 3300013102 | Bacteria | 1001 |
| 524 | Ga0157371_10457612 | 3300013102 | Bacteria | 939 |
| 525 | Ga0157371_10661941 | 3300013102 | Unclassified | 780 |
| 526 | Ga0157371_10789946 | 3300013102 | Bacteria | 715 |
| 527 | Ga0157370_10008914 | 3300013104 | Bacteria | 10778 |
| 528 | Ga0157370_10019218 | 3300013104 | Bacteria | 6862 |
| 529 | Ga0157370_10246607 | 3300013104 | Bacteria | 1652 |
| 530 | Ga0157370_10247528 | 3300013104 | Bacteria | 1649 |
| 531 | Ga0157370_11298930 | 3300013104 | Unclassified | 656 |
| 532 | Ga0157369_10000582 | 3300013105 | Bacteria | 47689 |
| 533 | Ga0157369_10037773 | 3300013105 | Bacteria | 5286 |
| 534 | Ga0157369_10105420 | 3300013105 | Bacteria | 3001 |
| 535 | Ga0157369_10113710 | 3300013105 | Unclassified | 2875 |
| 536 | Ga0157369_10114898 | 3300013105 | Bacteria | 2858 |
| 537 | Ga0157369_10135130 | 3300013105 | Bacteria | 2611 |
| 538 | Ga0157369_10219900 | 3300013105 | Unclassified | 1988 |
| 539 | Ga0157369_10235381 | 3300013105 | Unclassified | 1914 |
| 540 | Ga0157369_10334468 | 3300013105 | Unclassified | 1573 |
| 541 | Ga0157369_10397740 | 3300013105 | Unclassified | 1429 |
| 542 | Ga0157369_10624052 | 3300013105 | Bacteria | 1112 |
| 543 | Ga0157369_10900436 | 3300013105 | Bacteria | 907 |
| 544 | Ga0157374_10006957 | 3300013296 | Bacteria | 9625 |
| 545 | Ga0157374_10107822 | 3300013296 | Unclassified | 2677 |
| 546 | Ga0157374_10473466 | 3300013296 | Bacteria | 1255 |
| 547 | Ga0157374_10775152 | 3300013296 | Unclassified | 974 |
| 548 | Ga0157378_10017585 | 3300013297 | Bacteria | 6278 |
| 549 | Ga0157378_10677819 | 3300013297 | Unclassified | 1049 |
| 550 | Ga0157378_10970890 | 3300013297 | Bacteria | 883 |
| 551 | Ga0163162_10000292 | 3300013306 | Bacteria | 45993 |
| 552 | Ga0163162_10050706 | 3300013306 | Bacteria | 4162 |
| 553 | Ga0163162_10138340 | 3300013306 | Unclassified | 2547 |
| 554 | Ga0163162_10278037 | 3300013306 | Bacteria | 1806 |
| 555 | Ga0163162_10341959 | 3300013306 | Bacteria | 1629 |
| 556 | Ga0157372_10002643 | 3300013307 | Bacteria | 19405 |
| 557 | Ga0157372_10003254 | 3300013307 | Bacteria | 17559 |
| 558 | Ga0157372_10014357 | 3300013307 | Bacteria | 8469 |
| 559 | Ga0157372_10024230 | 3300013307 | Bacteria | 6588 |
| 560 | Ga0157372_10038957 | 3300013307 | Bacteria | 5246 |
| 561 | Ga0157372_10041939 | 3300013307 | Bacteria | 5060 |
| 562 | Ga0157372_10053358 | 3300013307 | Bacteria | 4506 |
| 563 | Ga0157372_10057646 | 3300013307 | Bacteria | 4342 |
| 564 | Ga0157372_10263541 | 3300013307 | Unclassified | 2001 |
| 565 | Ga0157372_10318552 | 3300013307 | Unclassified | 1810 |
| 566 | Ga0157372_10340182 | 3300013307 | Bacteria | 1748 |
| 567 | Ga0157372_10346861 | 3300013307 | Bacteria | 1730 |
| 568 | Ga0157372_10366684 | 3300013307 | Bacteria | 1678 |
| 569 | Ga0157372_10455572 | 3300013307 | Unclassified | 1491 |
| 570 | Ga0157372_10804216 | 3300013307 | Bacteria | 1092 |
| 571 | Ga0157372_10844834 | 3300013307 | Bacteria | 1063 |
| 572 | Ga0157372_11195461 | 3300013307 | Bacteria | 879 |
| 573 | Ga0157372_11761233 | 3300013307 | Bacteria | 712 |
| 574 | Ga0157375_10010955 | 3300013308 | Bacteria | 7997 |
| 575 | Ga0157375_10026791 | 3300013308 | Bacteria | 5379 |
| 576 | Ga0157375_10032439 | 3300013308 | Bacteria | 4954 |
| 577 | Ga0157375_10035316 | 3300013308 | Bacteria | 4770 |
| 578 | Ga0157375_10063033 | 3300013308 | Bacteria | 3686 |
| 579 | Ga0157375_10099576 | 3300013308 | Unclassified | 2986 |
| 580 | Ga0157375_10107598 | 3300013308 | Unclassified | 2882 |
| 581 | Ga0157375_10118637 | 3300013308 | Bacteria | 2752 |
| 582 | Ga0157375_10815040 | 3300013308 | Unclassified | 1082 |
| 583 | Ga0163163_10203468 | 3300014325 | Bacteria | 2028 |
| 584 | Ga0163163_10298618 | 3300014325 | Bacteria | 1663 |
| 585 | Ga0163163_12136399 | 3300014325 | Bacteria | 619 |
| 586 | Ga0157380_10003058 | 3300014326 | Bacteria | 11409 |
| 587 | Ga0157380_10199527 | 3300014326 | Bacteria | 1774 |
| 588 | Ga0182008_10004406 | 3300014497 | Bacteria | 8236 |
| 589 | Ga0157377_10001140 | 3300014745 | Bacteria | 11259 |
| 590 | Ga0157377_10028239 | 3300014745 | Unclassified | 3018 |
| 591 | Ga0157377_10185395 | 3300014745 | Bacteria | 1311 |
| 592 | Ga0157377_10230167 | 3300014745 | Unclassified | 1191 |
| 593 | Ga0157377_10514332 | 3300014745 | Bacteria | 839 |
| 594 | Ga0157379_10000694 | 3300014968 | Bacteria | 27295 |
| 595 | Ga0157379_10330815 | 3300014968 | Bacteria | 1392 |
| 596 | Ga0157376_10059055 | 3300014969 | Bacteria | 3215 |
| 597 | Ga0157376_11074216 | 3300014969 | Bacteria | 830 |
| 598 | Ga0157376_11834896 | 3300014969 | Bacteria | 643 |
| 599 | Ga0182007_10094665 | 3300015262 | Bacteria | 985 |
| 600 | Ga0182007_10164005 | 3300015262 | Unclassified | 761 |
| 601 | Ga0163161_10001779 | 3300017792 | Bacteria | 15708 |
| 602 | Ga0163161_10333180 | 3300017792 | Unclassified | 1202 |
| 603 | Ga0163161_10390623 | 3300017792 | Bacteria | 1114 |
| 604 | Ga0163161_10496783 | 3300017792 | Unclassified | 993 |
| 605 | Ga0206356_10225113 | 3300020070 | Bacteria | 2157 |
| 606 | Ga0206356_11469576 | 3300020070 | Bacteria | 633 |
| 607 | Ga0206354_10201211 | 3300020081 | Bacteria | 2016 |
| 608 | Ga0206354_10259601 | 3300020081 | Bacteria | 978 |
| 609 | Ga0206354_11267766 | 3300020081 | Unclassified | 766 |
| 610 | Ga0206353_11473925 | 3300020082 | Unclassified | 2465 |
| 611 | Ga0213876_10066550 | 3300021384 | Bacteria | 1902 |
| 612 | Ga0213876_10219905 | 3300021384 | Bacteria | 1010 |
| 613 | Ga0207666_1018819 | 3300025271 | Bacteria | 1005 |
| 614 | Ga0207697_10000960 | 3300025315 | Bacteria | 16212 |
| 615 | Ga0207697_10026707 | 3300025315 | Bacteria | 2361 |
| 616 | Ga0207656_10025151 | 3300025321 | Unclassified | 2415 |
| 617 | Ga0207682_10097114 | 3300025893 | Bacteria | 1284 |
| 618 | Ga0207682_10363508 | 3300025893 | Bacteria | 682 |
| 619 | Ga0207692_10167460 | 3300025898 | Bacteria | 1271 |
| 620 | Ga0207692_10173524 | 3300025898 | Bacteria | 1251 |
| 621 | Ga0207642_10114679 | 3300025899 | Unclassified | 1379 |
| 622 | Ga0207642_10167480 | 3300025899 | Bacteria | 1186 |
| 623 | Ga0207688_10006788 | 3300025901 | Bacteria | 6229 |
| 624 | Ga0207688_10014228 | 3300025901 | Bacteria | 4329 |
| 625 | Ga0207680_10021164 | 3300025903 | Bacteria | 3515 |
| 626 | Ga0207647_10053077 | 3300025904 | Unclassified | 2500 |
| 627 | Ga0207699_10004646 | 3300025906 | Bacteria | 6570 |
| 628 | Ga0207699_10177893 | 3300025906 | Bacteria | 1428 |
| 629 | Ga0207699_10302619 | 3300025906 | Unclassified | 1117 |
| 630 | Ga0207699_10387936 | 3300025906 | Unclassified | 992 |
| 631 | Ga0207645_10003416 | 3300025907 | Bacteria | 12073 |
| 632 | Ga0207645_10019229 | 3300025907 | Bacteria | 4480 |
| 633 | Ga0207645_10026006 | 3300025907 | Bacteria | 3785 |
| 634 | Ga0207645_10032397 | 3300025907 | Unclassified | 3360 |
| 635 | Ga0207645_10051822 | 3300025907 | Unclassified | 2623 |
| 636 | Ga0207645_10074741 | 3300025907 | Bacteria | 2169 |
| 637 | Ga0207645_10431779 | 3300025907 | Bacteria | 888 |
| 638 | Ga0207645_10592450 | 3300025907 | Unclassified | 753 |
| 639 | Ga0207643_10001096 | 3300025908 | Bacteria | 16042 |
| 640 | Ga0207643_10009224 | 3300025908 | Bacteria | 5299 |
| 641 | Ga0207643_10237673 | 3300025908 | Unclassified | 1119 |
| 642 | Ga0207705_10002148 | 3300025909 | Bacteria | 15286 |
| 643 | Ga0207705_10009897 | 3300025909 | Bacteria | 6942 |
| 644 | Ga0207705_10029924 | 3300025909 | Bacteria | 3883 |
| 645 | Ga0207705_10265435 | 3300025909 | Bacteria | 1312 |
| 646 | Ga0207705_10315931 | 3300025909 | Bacteria | 1200 |
| 647 | Ga0207705_10351949 | 3300025909 | Bacteria | 1135 |
| 648 | Ga0207705_10366117 | 3300025909 | Bacteria | 1112 |
| 649 | Ga0207705_10367833 | 3300025909 | Bacteria | 1109 |
| 650 | Ga0207684_10185120 | 3300025910 | Bacteria | 1796 |
| 651 | Ga0207654_10755175 | 3300025911 | Unclassified | 701 |
| 652 | Ga0207707_10000804 | 3300025912 | Bacteria | 30691 |
| 653 | Ga0207707_10001018 | 3300025912 | Bacteria | 26906 |
| 654 | Ga0207707_10001727 | 3300025912 | Bacteria | 20071 |
| 655 | Ga0207707_10001809 | 3300025912 | Bacteria | 19630 |
| 656 | Ga0207707_10003329 | 3300025912 | Bacteria | 14278 |
| 657 | Ga0207707_10019943 | 3300025912 | Bacteria | 5851 |
| 658 | Ga0207707_10201619 | 3300025912 | Bacteria | 1735 |
| 659 | Ga0207707_10627295 | 3300025912 | Bacteria | 908 |
| 660 | Ga0207695_10001150 | 3300025913 | Bacteria | 45914 |
| 661 | Ga0207695_10010924 | 3300025913 | Bacteria | 11044 |
| 662 | Ga0207695_10014141 | 3300025913 | Bacteria | 9471 |
| 663 | Ga0207695_10117165 | 3300025913 | Bacteria | 2637 |
| 664 | Ga0207695_10214625 | 3300025913 | Bacteria | 1834 |
| 665 | Ga0207695_10247314 | 3300025913 | Unclassified | 1683 |
| 666 | Ga0207693_10004327 | 3300025915 | Bacteria | 12019 |
| 667 | Ga0207693_10040968 | 3300025915 | Bacteria | 3648 |
| 668 | Ga0207693_10195321 | 3300025915 | Bacteria | 1592 |
| 669 | Ga0207663_10074302 | 3300025916 | Unclassified | 2202 |
| 670 | Ga0207663_10347186 | 3300025916 | Bacteria | 1122 |
| 671 | Ga0207660_10001831 | 3300025917 | Bacteria | 14164 |
| 672 | Ga0207660_10003174 | 3300025917 | Bacteria | 10752 |
| 673 | Ga0207660_10007756 | 3300025917 | Bacteria | 6950 |
| 674 | Ga0207660_10040429 | 3300025917 | Bacteria | 3265 |
| 675 | Ga0207660_10055820 | 3300025917 | Unclassified | 2824 |
| 676 | Ga0207660_10101692 | 3300025917 | Bacteria | 2148 |
| 677 | Ga0207660_10166051 | 3300025917 | Bacteria | 1706 |
| 678 | Ga0207660_10303304 | 3300025917 | Bacteria | 1272 |
| 679 | Ga0207660_10479286 | 3300025917 | Unclassified | 1008 |
| 680 | Ga0207660_11015666 | 3300025917 | Unclassified | 676 |
| 681 | Ga0207662_10002215 | 3300025918 | Bacteria | 9692 |
| 682 | Ga0207662_10005035 | 3300025918 | Bacteria | 6998 |
| 683 | Ga0207662_10024010 | 3300025918 | Unclassified | 3508 |
| 684 | Ga0207662_10048738 | 3300025918 | Bacteria | 2511 |
| 685 | Ga0207662_10340344 | 3300025918 | Bacteria | 1005 |
| 686 | Ga0207662_10360577 | 3300025918 | Bacteria | 978 |
| 687 | Ga0207657_10002073 | 3300025919 | Bacteria | 21677 |
| 688 | Ga0207657_10017431 | 3300025919 | Bacteria | 6885 |
| 689 | Ga0207657_10019698 | 3300025919 | Bacteria | 6398 |
| 690 | Ga0207657_10074758 | 3300025919 | Bacteria | 2860 |
| 691 | Ga0207657_10134475 | 3300025919 | Unclassified | 2024 |
| 692 | Ga0207657_10156851 | 3300025919 | Bacteria | 1851 |
| 693 | Ga0207657_10160891 | 3300025919 | Unclassified | 1823 |
| 694 | Ga0207657_10268117 | 3300025919 | Bacteria | 1358 |
| 695 | Ga0207657_10348336 | 3300025919 | Bacteria | 1168 |
| 696 | Ga0207657_10823933 | 3300025919 | Unclassified | 717 |
| 697 | Ga0207657_10989033 | 3300025919 | Bacteria | 646 |
| 698 | Ga0207649_10009187 | 3300025920 | Bacteria | 5406 |
| 699 | Ga0207649_10012402 | 3300025920 | Bacteria | 4727 |
| 700 | Ga0207649_10031704 | 3300025920 | Bacteria | 3144 |
| 701 | Ga0207649_10040369 | 3300025920 | Bacteria | 2836 |
| 702 | Ga0207649_10070525 | 3300025920 | Unclassified | 2229 |
| 703 | Ga0207649_10095261 | 3300025920 | Bacteria | 1958 |
| 704 | Ga0207649_10126400 | 3300025920 | Bacteria | 1731 |
| 705 | Ga0207649_10157179 | 3300025920 | Unclassified | 1572 |
| 706 | Ga0207649_10241400 | 3300025920 | Bacteria | 1297 |
| 707 | Ga0207649_10294423 | 3300025920 | Bacteria | 1185 |
| 708 | Ga0207649_10426101 | 3300025920 | Bacteria | 997 |
| 709 | Ga0207649_10616964 | 3300025920 | Unclassified | 835 |
| 710 | Ga0207652_10000840 | 3300025921 | Bacteria | 29292 |
| 711 | Ga0207652_10001448 | 3300025921 | Bacteria | 21002 |
| 712 | Ga0207652_10024071 | 3300025921 | Bacteria | 5050 |
| 713 | Ga0207652_10033054 | 3300025921 | Bacteria | 4354 |
| 714 | Ga0207652_10040080 | 3300025921 | Bacteria | 3977 |
| 715 | Ga0207652_10076395 | 3300025921 | Bacteria | 2921 |
| 716 | Ga0207652_10093018 | 3300025921 | Bacteria | 2653 |
| 717 | Ga0207652_10093418 | 3300025921 | Bacteria | 2647 |
| 718 | Ga0207652_10160224 | 3300025921 | Bacteria | 2017 |
| 719 | Ga0207652_10164573 | 3300025921 | Bacteria | 1989 |
| 720 | Ga0207652_10171657 | 3300025921 | Unclassified | 1946 |
| 721 | Ga0207652_10197367 | 3300025921 | Bacteria | 1811 |
| 722 | Ga0207652_10216288 | 3300025921 | Bacteria | 1726 |
| 723 | Ga0207652_10235978 | 3300025921 | Unclassified | 1648 |
| 724 | Ga0207652_10241613 | 3300025921 | Unclassified | 1628 |
| 725 | Ga0207652_10507101 | 3300025921 | Bacteria | 1086 |
| 726 | Ga0207652_10576170 | 3300025921 | Bacteria | 1010 |
| 727 | Ga0207652_10637833 | 3300025921 | Bacteria | 953 |
| 728 | Ga0207652_10818367 | 3300025921 | Bacteria | 826 |
| 729 | Ga0207681_10000999 | 3300025923 | Bacteria | 18459 |
| 730 | Ga0207681_10003311 | 3300025923 | Bacteria | 10085 |
| 731 | Ga0207681_10009429 | 3300025923 | Bacteria | 5965 |
| 732 | Ga0207681_10183840 | 3300025923 | Bacteria | 1594 |
| 733 | Ga0207681_10833796 | 3300025923 | Bacteria | 771 |
| 734 | Ga0207681_10872341 | 3300025923 | Unclassified | 753 |
| 735 | Ga0207694_10004230 | 3300025924 | Bacteria | 11236 |
| 736 | Ga0207694_10880263 | 3300025924 | Bacteria | 757 |
| 737 | Ga0207694_10948439 | 3300025924 | Bacteria | 728 |
| 738 | Ga0207650_10001883 | 3300025925 | Bacteria | 14813 |
| 739 | Ga0207650_10014805 | 3300025925 | Bacteria | 5424 |
| 740 | Ga0207650_10027643 | 3300025925 | Unclassified | 4062 |
| 741 | Ga0207650_10041940 | 3300025925 | Unclassified | 3356 |
| 742 | Ga0207650_10049478 | 3300025925 | Bacteria | 3104 |
| 743 | Ga0207650_10182277 | 3300025925 | Unclassified | 1674 |
| 744 | Ga0207650_10239953 | 3300025925 | Unclassified | 1464 |
| 745 | Ga0207650_10322773 | 3300025925 | Unclassified | 1265 |
| 746 | Ga0207650_10401839 | 3300025925 | Unclassified | 1134 |
| 747 | Ga0207650_10463124 | 3300025925 | Unclassified | 1056 |
| 748 | Ga0207650_10718261 | 3300025925 | Bacteria | 845 |
| 749 | Ga0207659_10005681 | 3300025926 | Bacteria | 7590 |
| 750 | Ga0207659_10009766 | 3300025926 | Bacteria | 6003 |
| 751 | Ga0207659_10018153 | 3300025926 | Bacteria | 4607 |
| 752 | Ga0207659_10043734 | 3300025926 | Unclassified | 3147 |
| 753 | Ga0207659_10106391 | 3300025926 | Unclassified | 2124 |
| 754 | Ga0207659_10125441 | 3300025926 | Unclassified | 1973 |
| 755 | Ga0207659_10150407 | 3300025926 | Bacteria | 1817 |
| 756 | Ga0207659_10217927 | 3300025926 | Bacteria | 1533 |
| 757 | Ga0207659_10430910 | 3300025926 | Unclassified | 1107 |
| 758 | Ga0207687_10002031 | 3300025927 | Bacteria | 13882 |
| 759 | Ga0207687_10275848 | 3300025927 | Unclassified | 1346 |
| 760 | Ga0207687_10528822 | 3300025927 | Bacteria | 987 |
| 761 | Ga0207687_10979470 | 3300025927 | Unclassified | 725 |
| 762 | Ga0207700_10000413 | 3300025928 | Bacteria | 25020 |
| 763 | Ga0207700_10149397 | 3300025928 | Unclassified | 1929 |
| 764 | Ga0207700_10196232 | 3300025928 | Bacteria | 1699 |
| 765 | Ga0207700_10712067 | 3300025928 | Unclassified | 896 |
| 766 | Ga0207664_10000401 | 3300025929 | Bacteria | 30996 |
| 767 | Ga0207664_10003750 | 3300025929 | Bacteria | 10207 |
| 768 | Ga0207664_10044586 | 3300025929 | Bacteria | 3474 |
| 769 | Ga0207664_10100050 | 3300025929 | Bacteria | 2393 |
| 770 | Ga0207664_10164960 | 3300025929 | Unclassified | 1892 |
| 771 | Ga0207644_10068932 | 3300025931 | Unclassified | 2582 |
| 772 | Ga0207644_10160614 | 3300025931 | Bacteria | 1746 |
| 773 | Ga0207644_10192458 | 3300025931 | Bacteria | 1604 |
| 774 | Ga0207644_10207704 | 3300025931 | Unclassified | 1547 |
| 775 | Ga0207644_10295459 | 3300025931 | Unclassified | 1304 |
| 776 | Ga0207644_10498452 | 3300025931 | Unclassified | 1004 |
| 777 | Ga0207644_10939064 | 3300025931 | Bacteria | 725 |
| 778 | Ga0207690_10001401 | 3300025932 | Bacteria | 15153 |
| 779 | Ga0207690_10012392 | 3300025932 | Bacteria | 5099 |
| 780 | Ga0207690_10019476 | 3300025932 | Bacteria | 4181 |
| 781 | Ga0207690_10022331 | 3300025932 | Bacteria | 3935 |
| 782 | Ga0207690_10033092 | 3300025932 | Bacteria | 3322 |
| 783 | Ga0207690_10040802 | 3300025932 | Unclassified | 3037 |
| 784 | Ga0207690_10060884 | 3300025932 | Bacteria | 2564 |
| 785 | Ga0207690_10881198 | 3300025932 | Bacteria | 742 |
| 786 | Ga0207690_10900708 | 3300025932 | Unclassified | 734 |
| 787 | Ga0207706_10000083 | 3300025933 | Bacteria | 98149 |
| 788 | Ga0207706_10004128 | 3300025933 | Bacteria | 13706 |
| 789 | Ga0207706_10020458 | 3300025933 | Bacteria | 5950 |
| 790 | Ga0207706_10021768 | 3300025933 | Bacteria | 5754 |
| 791 | Ga0207706_10122276 | 3300025933 | Bacteria | 2289 |
| 792 | Ga0207706_10146602 | 3300025933 | Unclassified | 2076 |
| 793 | Ga0207706_10397304 | 3300025933 | Bacteria | 1195 |
| 794 | Ga0207706_10484613 | 3300025933 | Unclassified | 1068 |
| 795 | Ga0207686_10010499 | 3300025934 | Bacteria | 5046 |
| 796 | Ga0207686_10023464 | 3300025934 | Bacteria | 3564 |
| 797 | Ga0207686_10073847 | 3300025934 | Unclassified | 2201 |
| 798 | Ga0207686_10375241 | 3300025934 | Unclassified | 1077 |
| 799 | Ga0207670_10038252 | 3300025936 | Bacteria | 3133 |
| 800 | Ga0207670_10156020 | 3300025936 | Unclassified | 1699 |
| 801 | Ga0207670_10160845 | 3300025936 | Unclassified | 1676 |
| 802 | Ga0207670_11079698 | 3300025936 | Bacteria | 677 |
| 803 | Ga0207669_10017425 | 3300025937 | Unclassified | 3684 |
| 804 | Ga0207669_10083839 | 3300025937 | Unclassified | 2051 |
| 805 | Ga0207669_10161269 | 3300025937 | Unclassified | 1584 |
| 806 | Ga0207704_10004383 | 3300025938 | Bacteria | 6456 |
| 807 | Ga0207665_10395166 | 3300025939 | Bacteria | 1052 |
| 808 | Ga0207691_10001010 | 3300025940 | Bacteria | 27914 |
| 809 | Ga0207691_10001083 | 3300025940 | Bacteria | 27125 |
| 810 | Ga0207691_10034469 | 3300025940 | Bacteria | 4707 |
| 811 | Ga0207691_10050323 | 3300025940 | Bacteria | 3815 |
| 812 | Ga0207691_10060742 | 3300025940 | Bacteria | 3434 |
| 813 | Ga0207691_10066594 | 3300025940 | Bacteria | 3258 |
| 814 | Ga0207691_10324977 | 3300025940 | Bacteria | 1318 |
| 815 | Ga0207691_10821257 | 3300025940 | Bacteria | 780 |
| 816 | Ga0207711_10036021 | 3300025941 | Bacteria | 4197 |
| 817 | Ga0207711_10068039 | 3300025941 | Bacteria | 3084 |
| 818 | Ga0207711_10069322 | 3300025941 | Unclassified | 3056 |
| 819 | Ga0207711_10072711 | 3300025941 | Bacteria | 2987 |
| 820 | Ga0207711_10159915 | 3300025941 | Bacteria | 2038 |
| 821 | Ga0207711_10186240 | 3300025941 | Bacteria | 1890 |
| 822 | Ga0207711_10194651 | 3300025941 | Unclassified | 1849 |
| 823 | Ga0207711_10662117 | 3300025941 | Bacteria | 974 |
| 824 | Ga0207711_10974019 | 3300025941 | Unclassified | 787 |
| 825 | Ga0207689_10003195 | 3300025942 | Bacteria | 15013 |
| 826 | Ga0207689_10146452 | 3300025942 | Unclassified | 1946 |
| 827 | Ga0207661_10000284 | 3300025944 | Bacteria | 32352 |
| 828 | Ga0207661_10003651 | 3300025944 | Bacteria | 10720 |
| 829 | Ga0207661_10007571 | 3300025944 | Bacteria | 7724 |
| 830 | Ga0207661_10011108 | 3300025944 | Bacteria | 6510 |
| 831 | Ga0207661_10012328 | 3300025944 | Bacteria | 6210 |
| 832 | Ga0207661_10016297 | 3300025944 | Bacteria | 5483 |
| 833 | Ga0207661_10022799 | 3300025944 | Bacteria | 4721 |
| 834 | Ga0207661_10023015 | 3300025944 | Unclassified | 4703 |
| 835 | Ga0207661_10041205 | 3300025944 | Bacteria | 3634 |
| 836 | Ga0207661_10045707 | 3300025944 | Bacteria | 3467 |
| 837 | Ga0207661_10141524 | 3300025944 | Bacteria | 2071 |
| 838 | Ga0207661_10196770 | 3300025944 | Bacteria | 1770 |
| 839 | Ga0207661_10246295 | 3300025944 | Bacteria | 1587 |
| 840 | Ga0207661_10281927 | 3300025944 | Bacteria | 1485 |
| 841 | Ga0207661_10321082 | 3300025944 | Bacteria | 1392 |
| 842 | Ga0207661_10880165 | 3300025944 | Bacteria | 825 |
| 843 | Ga0207661_10968823 | 3300025944 | Unclassified | 783 |
| 844 | Ga0207679_10000495 | 3300025945 | Bacteria | 27188 |
| 845 | Ga0207679_10000933 | 3300025945 | Bacteria | 18674 |
| 846 | Ga0207679_10004713 | 3300025945 | Bacteria | 8490 |
| 847 | Ga0207679_10006151 | 3300025945 | Bacteria | 7581 |
| 848 | Ga0207679_10008786 | 3300025945 | Bacteria | 6444 |
| 849 | Ga0207679_10013514 | 3300025945 | Bacteria | 5352 |
| 850 | Ga0207679_10020637 | 3300025945 | Unclassified | 4449 |
| 851 | Ga0207679_10025821 | 3300025945 | Bacteria | 4045 |
| 852 | Ga0207679_10047458 | 3300025945 | Bacteria | 3120 |
| 853 | Ga0207679_10075455 | 3300025945 | Bacteria | 2558 |
| 854 | Ga0207679_10090659 | 3300025945 | Bacteria | 2364 |
| 855 | Ga0207679_10118922 | 3300025945 | Bacteria | 2100 |
| 856 | Ga0207679_10351856 | 3300025945 | Unclassified | 1284 |
| 857 | Ga0207679_10595702 | 3300025945 | Unclassified | 995 |
| 858 | Ga0207679_10665713 | 3300025945 | Unclassified | 943 |
| 859 | Ga0207667_10013718 | 3300025949 | Bacteria | 9262 |
| 860 | Ga0207667_10025121 | 3300025949 | Bacteria | 6528 |
| 861 | Ga0207667_10079152 | 3300025949 | Unclassified | 3407 |
| 862 | Ga0207667_10148571 | 3300025949 | Bacteria | 2412 |
| 863 | Ga0207667_10422377 | 3300025949 | Bacteria | 1356 |
| 864 | Ga0207667_10497074 | 3300025949 | Unclassified | 1237 |
| 865 | Ga0207667_11016419 | 3300025949 | Unclassified | 816 |
| 866 | Ga0207651_10010698 | 3300025960 | Bacteria | 5097 |
| 867 | Ga0207651_10014237 | 3300025960 | Bacteria | 4585 |
| 868 | Ga0207651_10059865 | 3300025960 | Bacteria | 2641 |
| 869 | Ga0207651_10288547 | 3300025960 | Unclassified | 1359 |
| 870 | Ga0207651_10419632 | 3300025960 | Bacteria | 1142 |
| 871 | Ga0207651_10569247 | 3300025960 | Bacteria | 987 |
| 872 | Ga0207712_10000077 | 3300025961 | Bacteria | 119803 |
| 873 | Ga0207712_10001289 | 3300025961 | Bacteria | 17213 |
| 874 | Ga0207712_10015530 | 3300025961 | Bacteria | 4916 |
| 875 | Ga0207668_10000854 | 3300025972 | Bacteria | 18375 |
| 876 | Ga0207668_10010653 | 3300025972 | Bacteria | 5563 |
| 877 | Ga0207668_10013896 | 3300025972 | Bacteria | 4971 |
| 878 | Ga0207668_10017002 | 3300025972 | Bacteria | 4551 |
| 879 | Ga0207668_10176875 | 3300025972 | Bacteria | 1679 |
| 880 | Ga0207668_10456120 | 3300025972 | Unclassified | 1092 |
| 881 | Ga0207640_10003157 | 3300025981 | Bacteria | 8871 |
| 882 | Ga0207640_10011619 | 3300025981 | Bacteria | 4990 |
| 883 | Ga0207640_10046676 | 3300025981 | Bacteria | 2789 |
| 884 | Ga0207640_10060188 | 3300025981 | Bacteria | 2509 |
| 885 | Ga0207640_10613000 | 3300025981 | Bacteria | 923 |
| 886 | Ga0207640_10620310 | 3300025981 | Bacteria | 918 |
| 887 | Ga0207640_10732514 | 3300025981 | Bacteria | 851 |
| 888 | Ga0207640_11284802 | 3300025981 | Unclassified | 653 |
| 889 | Ga0207658_10074901 | 3300025986 | Bacteria | 2573 |
| 890 | Ga0207658_10114140 | 3300025986 | Unclassified | 2141 |
| 891 | Ga0207658_10420483 | 3300025986 | Unclassified | 1178 |
| 892 | Ga0207658_10530702 | 3300025986 | Bacteria | 1051 |
| 893 | Ga0207658_10889672 | 3300025986 | Unclassified | 810 |
| 894 | Ga0207658_11348643 | 3300025986 | Bacteria | 652 |
| 895 | Ga0207677_10029032 | 3300026023 | Unclassified | 3509 |
| 896 | Ga0207677_10058195 | 3300026023 | Bacteria | 2659 |
| 897 | Ga0207677_10574266 | 3300026023 | Bacteria | 986 |
| 898 | Ga0207677_10855391 | 3300026023 | Unclassified | 817 |
| 899 | Ga0207703_10044662 | 3300026035 | Bacteria | 3562 |
| 900 | Ga0207703_10089201 | 3300026035 | Unclassified | 2589 |
| 901 | Ga0207703_11029095 | 3300026035 | Bacteria | 790 |
| 902 | Ga0207703_11257938 | 3300026035 | Unclassified | 712 |
| 903 | Ga0207703_11322869 | 3300026035 | Unclassified | 693 |
| 904 | Ga0207639_10044293 | 3300026041 | Unclassified | 3346 |
| 905 | Ga0207639_10090987 | 3300026041 | Bacteria | 2442 |
| 906 | Ga0207639_10649134 | 3300026041 | Unclassified | 976 |
| 907 | Ga0207639_10766421 | 3300026041 | Bacteria | 898 |
| 908 | Ga0207639_10772603 | 3300026041 | Bacteria | 894 |
| 909 | Ga0207639_11046137 | 3300026041 | Unclassified | 765 |
| 910 | Ga0207639_11122195 | 3300026041 | Unclassified | 738 |
| 911 | Ga0207639_11351809 | 3300026041 | Unclassified | 669 |
| 912 | Ga0207678_10034261 | 3300026067 | Bacteria | 4423 |
| 913 | Ga0207678_10094700 | 3300026067 | Bacteria | 2552 |
| 914 | Ga0207678_10171108 | 3300026067 | Unclassified | 1854 |
| 915 | Ga0207678_10206797 | 3300026067 | Bacteria | 1679 |
| 916 | Ga0207678_10515075 | 3300026067 | Bacteria | 1044 |
| 917 | Ga0207678_10964470 | 3300026067 | Unclassified | 754 |
| 918 | Ga0207708_10171441 | 3300026075 | Bacteria | 1719 |
| 919 | Ga0207708_10199955 | 3300026075 | Bacteria | 1594 |
| 920 | Ga0207708_10475156 | 3300026075 | Bacteria | 1044 |
| 921 | Ga0207702_10004820 | 3300026078 | Bacteria | 11891 |
| 922 | Ga0207702_10100136 | 3300026078 | Bacteria | 2556 |
| 923 | Ga0207702_10241965 | 3300026078 | Bacteria | 1691 |
| 924 | Ga0207702_10341592 | 3300026078 | Bacteria | 1430 |
| 925 | Ga0207702_10502654 | 3300026078 | Unclassified | 1182 |
| 926 | Ga0207702_10724318 | 3300026078 | Bacteria | 981 |
| 927 | Ga0207702_11597414 | 3300026078 | Unclassified | 645 |
| 928 | Ga0207641_10028323 | 3300026088 | Bacteria | 4628 |
| 929 | Ga0207641_10057619 | 3300026088 | Unclassified | 3304 |
| 930 | Ga0207641_10466140 | 3300026088 | Unclassified | 1223 |
| 931 | Ga0207648_10001896 | 3300026089 | Bacteria | 22853 |
| 932 | Ga0207648_10032607 | 3300026089 | Bacteria | 4598 |
| 933 | Ga0207648_10112401 | 3300026089 | Bacteria | 2392 |
| 934 | Ga0207648_10127779 | 3300026089 | Unclassified | 2236 |
| 935 | Ga0207648_10373675 | 3300026089 | Bacteria | 1288 |
| 936 | Ga0207676_10022236 | 3300026095 | Bacteria | 4662 |
| 937 | Ga0207676_10028619 | 3300026095 | Unclassified | 4164 |
| 938 | Ga0207676_10157175 | 3300026095 | Bacteria | 1966 |
| 939 | Ga0207676_10190084 | 3300026095 | Bacteria | 1806 |
| 940 | Ga0207676_10216414 | 3300026095 | Bacteria | 1703 |
| 941 | Ga0207676_10354752 | 3300026095 | Unclassified | 1357 |
| 942 | Ga0207674_10000033 | 3300026116 | Bacteria | 142149 |
| 943 | Ga0207674_10000930 | 3300026116 | Bacteria | 38072 |
| 944 | Ga0207674_10006057 | 3300026116 | Bacteria | 14305 |
| 945 | Ga0207674_10010997 | 3300026116 | Bacteria | 10181 |
| 946 | Ga0207674_10021676 | 3300026116 | Bacteria | 6917 |
| 947 | Ga0207674_10042082 | 3300026116 | Unclassified | 4721 |
| 948 | Ga0207674_10104445 | 3300026116 | Bacteria | 2811 |
| 949 | Ga0207674_10617000 | 3300026116 | Unclassified | 1047 |
| 950 | Ga0207675_100000132 | 3300026118 | Bacteria | 62776 |
| 951 | Ga0207675_100008276 | 3300026118 | Bacteria | 9797 |
| 952 | Ga0207675_100210822 | 3300026118 | Bacteria | 1868 |
| 953 | Ga0207675_101111574 | 3300026118 | Unclassified | 810 |
| 954 | Ga0207683_10262036 | 3300026121 | Bacteria | 1578 |
| 955 | Ga0207683_10382147 | 3300026121 | Bacteria | 1294 |
| 956 | Ga0207683_10578073 | 3300026121 | Bacteria | 1039 |
| 957 | Ga0207698_10001204 | 3300026142 | Bacteria | 15091 |
| 958 | Ga0207698_10001894 | 3300026142 | Bacteria | 12258 |
| 959 | Ga0207698_10024783 | 3300026142 | Unclassified | 4217 |
| 960 | Ga0207698_10083559 | 3300026142 | Unclassified | 2585 |
| 961 | Ga0207698_10146774 | 3300026142 | Bacteria | 2041 |
| 962 | Ga0207698_10167006 | 3300026142 | Bacteria | 1933 |
| 963 | Ga0207698_10219096 | 3300026142 | Unclassified | 1718 |
| 964 | Ga0207698_10404781 | 3300026142 | Unclassified | 1305 |
| 965 | Ga0207698_10754892 | 3300026142 | Unclassified | 972 |
| 966 | Ga0207698_10798463 | 3300026142 | Bacteria | 946 |
| 967 | Ga0207428_10161850 | 3300027907 | Archaea | 1699 |
| 968 | Ga0207428_10227859 | 3300027907 | Unclassified | 1395 |
| 969 | Ga0207428_10355391 | 3300027907 | Bacteria | 1077 |
| 970 | Ga0268266_10038170 | 3300028379 | Bacteria | 4090 |
| 971 | Ga0268266_10591064 | 3300028379 | Bacteria | 1066 |
| 972 | Ga0268266_10862515 | 3300028379 | Bacteria | 875 |
| 973 | Ga0268265_10000974 | 3300028380 | Bacteria | 26160 |
| 974 | Ga0268265_10029181 | 3300028380 | Unclassified | 3957 |
| 975 | Ga0268265_10108036 | 3300028380 | Bacteria | 2264 |
| 976 | Ga0268265_10279159 | 3300028380 | Unclassified | 1494 |
| 977 | Ga0268264_10039701 | 3300028381 | Unclassified | 3889 |
| 978 | Ga0268264_10154809 | 3300028381 | Bacteria | 2059 |
| 979 | Ga0268264_10243393 | 3300028381 | Bacteria | 1667 |
| 980 | Ga0268264_10513257 | 3300028381 | Unclassified | 1170 |
| 981 | Ga0268264_10548680 | 3300028381 | Bacteria | 1133 |
| 982 | Ga0268264_10720233 | 3300028381 | Bacteria | 992 |
| 983 | Ga0265332_10001283 | 3300031238 | Bacteria | 14368 |
| 984 | Ga0265327_10009209 | 3300031251 | Bacteria | 7162 |
| 985 | Ga0307408_100000585 | 3300031548 | Bacteria | 31310 |
| 986 | Ga0307408_100008968 | 3300031548 | Bacteria | 6608 |
| 987 | Ga0307408_100016391 | 3300031548 | Unclassified | 4945 |
| 988 | Ga0307408_100075110 | 3300031548 | Unclassified | 2510 |
| 989 | Ga0307408_100632469 | 3300031548 | Bacteria | 955 |
| 990 | Ga0265314_10004770 | 3300031711 | Bacteria | 12424 |
| 991 | Ga0307405_10005707 | 3300031731 | Bacteria | 6038 |
| 992 | Ga0307405_10010597 | 3300031731 | Bacteria | 4789 |
| 993 | Ga0307405_10024571 | 3300031731 | Bacteria | 3444 |
| 994 | Ga0307405_10028360 | 3300031731 | Unclassified | 3259 |
| 995 | Ga0307405_10113621 | 3300031731 | Bacteria | 1839 |
| 996 | Ga0307405_10411685 | 3300031731 | Unclassified | 1061 |
| 997 | Ga0307405_10551063 | 3300031731 | Unclassified | 933 |
| 998 | Ga0307413_10000973 | 3300031824 | Bacteria | 10295 |
| 999 | Ga0307413_10003576 | 3300031824 | Bacteria | 6576 |
| 1000 | Ga0307413_10004590 | 3300031824 | Bacteria | 6030 |
| 1001 | Ga0307413_10015188 | 3300031824 | Bacteria | 3939 |
| 1002 | Ga0307413_10022620 | 3300031824 | Bacteria | 3391 |
| 1003 | Ga0307413_10048993 | 3300031824 | Unclassified | 2529 |
| 1004 | Ga0307413_10454046 | 3300031824 | Bacteria | 1018 |
| 1005 | Ga0307410_10000932 | 3300031852 | Bacteria | 12529 |
| 1006 | Ga0307410_10002010 | 3300031852 | Bacteria | 9591 |
| 1007 | Ga0307410_10002256 | 3300031852 | Bacteria | 9220 |
| 1008 | Ga0307410_10040580 | 3300031852 | Bacteria | 3064 |
| 1009 | Ga0307410_10282243 | 3300031852 | Unclassified | 1303 |
| 1010 | Ga0307410_11031805 | 3300031852 | Unclassified | 710 |
| 1011 | Ga0307406_10000378 | 3300031901 | Bacteria | 25641 |
| 1012 | Ga0307406_10002903 | 3300031901 | Bacteria | 9336 |
| 1013 | Ga0307406_10021111 | 3300031901 | Bacteria | 3847 |
| 1014 | Ga0307406_10035469 | 3300031901 | Unclassified | 3068 |
| 1015 | Ga0307406_10042016 | 3300031901 | Bacteria | 2852 |
| 1016 | Ga0307406_10044747 | 3300031901 | Bacteria | 2775 |
| 1017 | Ga0307406_10150185 | 3300031901 | Unclassified | 1661 |
| 1018 | Ga0307406_10182781 | 3300031901 | Bacteria | 1528 |
| 1019 | Ga0307406_10257209 | 3300031901 | Bacteria | 1319 |
| 1020 | Ga0307406_10317313 | 3300031901 | Bacteria | 1204 |
| 1021 | Ga0307406_10371941 | 3300031901 | Bacteria | 1124 |
| 1022 | Ga0307406_10596606 | 3300031901 | Unclassified | 910 |
| 1023 | Ga0307407_10001021 | 3300031903 | Bacteria | 9645 |
| 1024 | Ga0307407_10016941 | 3300031903 | Bacteria | 3642 |
| 1025 | Ga0307407_10030830 | 3300031903 | Bacteria | 2897 |
| 1026 | Ga0307407_10060752 | 3300031903 | Bacteria | 2206 |
| 1027 | Ga0307407_10098482 | 3300031903 | Bacteria | 1809 |
| 1028 | Ga0307407_10140189 | 3300031903 | Bacteria | 1559 |
| 1029 | Ga0307407_10326944 | 3300031903 | Bacteria | 1078 |
| 1030 | Ga0307407_10413451 | 3300031903 | Bacteria | 970 |
| 1031 | Ga0307407_10493353 | 3300031903 | Bacteria | 896 |
| 1032 | Ga0307407_10537388 | 3300031903 | Unclassified | 862 |
| 1033 | Ga0307412_10003542 | 3300031911 | Bacteria | 8668 |
| 1034 | Ga0307412_10071987 | 3300031911 | Bacteria | 2361 |
| 1035 | Ga0307412_10309503 | 3300031911 | Unclassified | 1252 |
| 1036 | Ga0307412_10333562 | 3300031911 | Bacteria | 1211 |
| 1037 | Ga0307409_100008233 | 3300031995 | Bacteria | 6311 |
| 1038 | Ga0307409_100014039 | 3300031995 | Bacteria | 5188 |
| 1039 | Ga0307409_100034581 | 3300031995 | Bacteria | 3692 |
| 1040 | Ga0307409_100080622 | 3300031995 | Bacteria | 2627 |
| 1041 | Ga0307409_100104195 | 3300031995 | Bacteria | 2362 |
| 1042 | Ga0307409_100179860 | 3300031995 | Unclassified | 1871 |
| 1043 | Ga0307409_100383716 | 3300031995 | Bacteria | 1336 |
| 1044 | Ga0307409_100750950 | 3300031995 | Unclassified | 979 |
| 1045 | Ga0307409_100771113 | 3300031995 | Unclassified | 967 |
| 1046 | Ga0307416_100000517 | 3300032002 | Bacteria | 19743 |
| 1047 | Ga0307416_100002050 | 3300032002 | Bacteria | 11348 |
| 1048 | Ga0307416_100025168 | 3300032002 | Unclassified | 4359 |
| 1049 | Ga0307416_100071783 | 3300032002 | Bacteria | 2878 |
| 1050 | Ga0307416_100107271 | 3300032002 | Bacteria | 2451 |
| 1051 | Ga0307416_100113394 | 3300032002 | Bacteria | 2395 |
| 1052 | Ga0307416_100166234 | 3300032002 | Bacteria | 2047 |
| 1053 | Ga0307416_100196118 | 3300032002 | Unclassified | 1910 |
| 1054 | Ga0307416_100283996 | 3300032002 | Unclassified | 1634 |
| 1055 | Ga0307416_100306759 | 3300032002 | Unclassified | 1581 |
| 1056 | Ga0307416_100538475 | 3300032002 | Bacteria | 1239 |
| 1057 | Ga0307416_101280972 | 3300032002 | Bacteria | 839 |
| 1058 | Ga0307416_101312090 | 3300032002 | Bacteria | 830 |
| 1059 | Ga0307416_101718322 | 3300032002 | Unclassified | 732 |
| 1060 | Ga0307414_10003177 | 3300032004 | Bacteria | 8732 |
| 1061 | Ga0307414_10018140 | 3300032004 | Unclassified | 4323 |
| 1062 | Ga0307414_10019823 | 3300032004 | Bacteria | 4177 |
| 1063 | Ga0307414_10193654 | 3300032004 | Bacteria | 1647 |
| 1064 | Ga0307411_10000766 | 3300032005 | Bacteria | 11895 |
| 1065 | Ga0307411_10011921 | 3300032005 | Bacteria | 4717 |
| 1066 | Ga0307411_10012145 | 3300032005 | Bacteria | 4683 |
| 1067 | Ga0307411_10036298 | 3300032005 | Unclassified | 3087 |
| 1068 | Ga0307411_10041258 | 3300032005 | Bacteria | 2934 |
| 1069 | Ga0307411_10069683 | 3300032005 | Unclassified | 2376 |
| 1070 | Ga0307411_10684707 | 3300032005 | Unclassified | 891 |
| 1071 | Ga0307411_11059660 | 3300032005 | Bacteria | 729 |
| 1072 | Ga0307415_100006818 | 3300032126 | Bacteria | 6196 |
| 1073 | Ga0307415_100012511 | 3300032126 | Bacteria | 4908 |
| 1074 | Ga0307415_100012924 | 3300032126 | Bacteria | 4851 |
| 1075 | Ga0307415_100025095 | 3300032126 | Bacteria | 3734 |
| 1076 | Ga0307415_100089736 | 3300032126 | Bacteria | 2221 |
| 1077 | Ga0307415_100420201 | 3300032126 | Unclassified | 1147 |
| 1078 | Ga0307415_100529906 | 3300032126 | Unclassified | 1035 |
| 1079 | Ga0307415_101181019 | 3300032126 | Bacteria | 720 |
| 1080 | Ga0373939_0216230 | 3300035114 | Bacteria | 732 |
| 1081 | Ga0373960_0056383 | 3300035121 | Bacteria | 1180 |
| 1082 | Ga0373962_0059918 | 3300035242 | Bacteria | 1116 |
| 1083 | Ga0373931_0004142 | 3300035691 | Bacteria | 6583 |
| 1084 | Ga0373927_0452735 | 3300035695 | Unclassified | 848 |
| 1085 | Ga0373933_0176136 | 3300035724 | Bacteria | 1362 |
| 1086 | Ga0373947_0957921 | 3300035725 | Bacteria | 584 |
| 1087 | Ga0373937_0037818 | 3300036401 | Bacteria | 4399 |
| 1088 | Ga0373937_0059406 | 3300036401 | Bacteria | 3514 |
| 1089 | Ga0373937_0136314 | 3300036401 | Unclassified | 2295 |
| 1090 | Ga0373937_0343959 | 3300036401 | Bacteria | 1412 |
| 1091 | Ga0373937_0870481 | 3300036401 | Bacteria | 850 |
| 1092 | Ga0373925_0684797 | 3300037068 | Bacteria | 845 |
| 1093 | Ga0395899_0010801 | 3300037312 | Bacteria | 7001 |
| 1094 | Ga0395900_0051538 | 3300037418 | Bacteria | 4239 |
| 1095 | Ga0395898_0289746 | 3300037466 | Bacteria | 1562 |
| 1096 | Ga0395905_0010794 | 3300037471 | Bacteria | 8850 |
| 1097 | Ga0395905_0317285 | 3300037471 | Bacteria | 1448 |
| 1098 | Ga0395901_0005925 | 3300038443 | Bacteria | 12377 |
| 1099 | Ga0395901_0621789 | 3300038443 | Bacteria | 1087 |
| 1100 | Ga0436365_0326765 | 3300039437 | Bacteria | 5369 |
| 1101 | Ga0450894_041460 | 3300042131 | Unclassified | 662 |
| 1102 | Ga0450896_053153 | 3300042133 | Bacteria | 649 |
| 1103 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 1104 | Ga0451577_0000228 | 3300042876 | Bacteria | 114707 |
| 1105 | Ga0451577_0096522 | 3300042876 | Bacteria | 2639 |
| 1106 | Ga0451577_0334906 | 3300042876 | Bacteria | 1372 |
| 1107 | Ga0451577_0359077 | 3300042876 | Bacteria | 1321 |
| 1108 | Ga0451577_0402492 | 3300042876 | Bacteria | 1242 |
| 1109 | Ga0466961_0239714 | 3300044693 | Bacteria | 1115 |
| 1110 | Ga0453684_0000351 | 3300044712 | Bacteria | 191794 |
| 1111 | Ga0453684_0061429 | 3300044712 | Bacteria | 4823 |
| 1112 | Ga0453684_0207900 | 3300044712 | Unclassified | 2277 |
| 1113 | Ga0453684_0209602 | 3300044712 | Bacteria | 2266 |
| 1114 | Ga0453684_1283340 | 3300044712 | Bacteria | 765 |
| 1115 | Ga0466957_0114757 | 3300044842 | Bacteria | 1712 |
| 1116 | Ga0466957_0232141 | 3300044842 | Bacteria | 1222 |
| 1117 | Ga0451576_0092850 | 3300045051 | Unclassified | 3139 |
| 1118 | Ga0451576_0171993 | 3300045051 | Unclassified | 2261 |
| 1119 | Ga0451576_0184224 | 3300045051 | Bacteria | 2180 |
| 1120 | Ga0451576_1261339 | 3300045051 | Bacteria | 771 |
| 1121 | Ga0466958_0033283 | 3300045836 | Bacteria | 3070 |
| 1122 | Ga0466958_0424255 | 3300045836 | Unclassified | 860 |
| 1123 | Ga0466967_0053158 | 3300045976 | Bacteria | 3559 |
| 1124 | Ga0466967_0566431 | 3300045976 | Bacteria | 1119 |
| 1125 | Ga0495592_0099139 | 3300046454 | Bacteria | 2078 |
| 1126 | Ga0495603_0014068 | 3300046455 | Bacteria | 4839 |
| 1127 | Ga0495603_0157744 | 3300046455 | Unclassified | 1317 |
| 1128 | Ga0495629_0092351 | 3300046459 | Bacteria | 2113 |
| 1129 | Ga0495651_0064553 | 3300046462 | Bacteria | 2798 |
| 1130 | Ga0495653_0147123 | 3300046463 | Unclassified | 1649 |
| 1131 | Ga0495582_0025392 | 3300046473 | Bacteria | 3245 |
| 1132 | Ga0495639_0028444 | 3300046475 | Bacteria | 2477 |
| 1133 | Ga0495662_0050440 | 3300046476 | Bacteria | 2009 |
| 1134 | Ga0495664_0067932 | 3300046477 | Bacteria | 2127 |
| 1135 | Ga0495584_0189584 | 3300046491 | Bacteria | 1045 |
| 1136 | Ga0495594_0030057 | 3300046499 | Bacteria | 2938 |
| 1137 | Ga0495594_0064521 | 3300046499 | Bacteria | 2030 |
| 1138 | Ga0495594_0337247 | 3300046499 | Bacteria | 859 |
| 1139 | Ga0495608_0033359 | 3300046511 | Bacteria | 3480 |
| 1140 | Ga0495608_0446087 | 3300046511 | Bacteria | 788 |
| 1141 | Ga0495628_0007851 | 3300046516 | Bacteria | 9199 |
| 1142 | Ga0495628_0060773 | 3300046516 | Bacteria | 2965 |
| 1143 | Ga0495628_0250545 | 3300046516 | Bacteria | 1322 |
| 1144 | Ga0495630_0003698 | 3300046517 | Bacteria | 10664 |
| 1145 | Ga0495630_0010563 | 3300046517 | Bacteria | 6671 |
| 1146 | Ga0495663_0030215 | 3300046525 | Unclassified | 1604 |
| 1147 | Ga0495652_0012716 | 3300046529 | Bacteria | 7583 |
| 1148 | Ga0495665_0010905 | 3300046531 | Bacteria | 4917 |
| 1149 | Ga0495665_0047343 | 3300046531 | Unclassified | 2281 |
| 1150 | Ga0495640_0242729 | 3300046533 | Unclassified | 1130 |
| 1151 | Ga0495586_0009209 | 3300046535 | Bacteria | 5250 |
| 1152 | Ga0495587_0043965 | 3300046536 | Unclassified | 2658 |
| 1153 | Ga0495587_0087288 | 3300046536 | Bacteria | 1805 |
| 1154 | Ga0495587_0116928 | 3300046536 | Bacteria | 1529 |
| 1155 | Ga0495587_0152256 | 3300046536 | Bacteria | 1318 |
| 1156 | Ga0495587_0274525 | 3300046536 | Bacteria | 945 |
| 1157 | Ga0495598_0219793 | 3300046537 | Bacteria | 693 |
| 1158 | Ga0495645_0018552 | 3300046543 | Bacteria | 4998 |
| 1159 | Ga0495645_0263399 | 3300046543 | Bacteria | 1140 |
| 1160 | Ga0495667_0025865 | 3300046559 | Bacteria | 3953 |
| 1161 | Ga0495667_0083958 | 3300046559 | Bacteria | 2068 |
| 1162 | Ga0495667_0191905 | 3300046559 | Bacteria | 1309 |
| 1163 | Ga0495667_0467793 | 3300046559 | Unclassified | 791 |
| 1164 | Ga0495634_0009995 | 3300046642 | Bacteria | 6970 |
| 1165 | Ga0495634_0319647 | 3300046642 | Bacteria | 935 |
| 1166 | Ga0495634_0433954 | 3300046642 | Unclassified | 777 |
| 1167 | Ga0495635_0039454 | 3300046663 | Bacteria | 3266 |
| 1168 | Ga0495635_0232770 | 3300046663 | Bacteria | 1244 |
| 1169 | Ga0495599_0005132 | 3300046678 | Bacteria | 7801 |
| 1170 | Ga0495623_0049749 | 3300046679 | Bacteria | 2656 |
| 1171 | Ga0495623_0226351 | 3300046679 | Bacteria | 1063 |
| 1172 | Ga0495623_0233126 | 3300046679 | Bacteria | 1043 |
| 1173 | Ga0495646_0010163 | 3300046680 | Bacteria | 5983 |
| 1174 | Ga0495646_0011244 | 3300046680 | Bacteria | 5684 |
| 1175 | Ga0495658_0193918 | 3300046683 | Unclassified | 1264 |
| 1176 | Ga0495669_0076258 | 3300046684 | Unclassified | 1534 |
| 1177 | Ga0495613_0015526 | 3300046689 | Bacteria | 5663 |
| 1178 | Ga0495613_0024715 | 3300046689 | Bacteria | 4475 |
| 1179 | Ga0495613_0122559 | 3300046689 | Bacteria | 1866 |
| 1180 | Ga0495624_0280584 | 3300046690 | Bacteria | 1006 |
| 1181 | Ga0495600_0129763 | 3300046809 | Bacteria | 1639 |
| 1182 | Ga0495600_0430784 | 3300046809 | Bacteria | 818 |
| 1183 | Ga0495581_0019625 | 3300047315 | Bacteria | 3923 |
| 1184 | Ga0495581_0057567 | 3300047315 | Bacteria | 2243 |
| 1185 | Ga0495581_0088936 | 3300047315 | Bacteria | 1791 |
| 1186 | Ga0495581_0636010 | 3300047315 | Bacteria | 617 |
| 1187 | Ga0495604_0039479 | 3300047317 | Bacteria | 3710 |
| 1188 | Ga0495604_0403240 | 3300047317 | Bacteria | 900 |
| 1189 | Ga0495636_0066095 | 3300047318 | Unclassified | 1537 |
| 1190 | Ga0495674_0008111 | 3300047319 | Bacteria | 10023 |
| 1191 | Ga0495674_0081523 | 3300047319 | Bacteria | 2775 |
| 1192 | Ga0495674_0930627 | 3300047319 | Unclassified | 669 |
| 1193 | Ga0495672_0001689 | 3300047320 | Bacteria | 21377 |
| 1194 | Ga0495676_0361551 | 3300047321 | Bacteria | 969 |
| 1195 | Ga0495680_0004863 | 3300047322 | Bacteria | 12728 |
| 1196 | Ga0495680_0114036 | 3300047322 | Bacteria | 2000 |
| 1197 | Ga0495675_0008395 | 3300047444 | Bacteria | 6396 |
| 1198 | Ga0495675_0058917 | 3300047444 | Bacteria | 2435 |
| 1199 | Ga0495675_0064036 | 3300047444 | Bacteria | 2326 |
| 1200 | Ga0495675_0266143 | 3300047444 | Unclassified | 1025 |
| 1201 | Ga0495684_0000527 | 3300047471 | Bacteria | 30992 |
| 1202 | Ga0495684_0014003 | 3300047471 | Bacteria | 6169 |
| 1203 | Ga0495602_0020001 | 3300048088 | Bacteria | 6627 |
| 1204 | Ga0495602_0086880 | 3300048088 | Bacteria | 2609 |
| 1205 | Ga0495602_0144112 | 3300048088 | Bacteria | 1882 |
| 1206 | Ga0496104_0036877 | 3300048907 | Unclassified | 4571 |
| 1207 | Ga0496107_0291627 | 3300048910 | Unclassified | 1214 |
| 1208 | Ga0496108_0008584 | 3300048911 | Bacteria | 8286 |
| 1209 | Ga0496108_0138744 | 3300048911 | Bacteria | 2094 |
| 1210 | Ga0496108_0229412 | 3300048911 | Bacteria | 1614 |
| 1211 | Ga0496109_0045219 | 3300048912 | Bacteria | 3994 |
| 1212 | Ga0496109_0705680 | 3300048912 | Bacteria | 946 |
| 1213 | Ga0496110_0339244 | 3300048913 | Unclassified | 1369 |
| 1214 | Ga0496112_0000397 | 3300048915 | Bacteria | 28390 |
| 1215 | Ga0496112_0000936 | 3300048915 | Bacteria | 21161 |
| 1216 | Ga0496112_0043352 | 3300048915 | Bacteria | 4405 |
| 1217 | Ga0496113_0011765 | 3300048916 | Bacteria | 5858 |
| 1218 | Ga0496115_0032734 | 3300048918 | Bacteria | 4103 |
| 1219 | Ga0501299_121071 | 3300049522 | Bacteria | 631 |
| 1220 | Ga0501033_0111675 | 3300049570 | Bacteria | 1989 |
| 1221 | Ga0501033_0605845 | 3300049570 | Unclassified | 751 |
| 1222 | Ga0501034_0106129 | 3300049571 | Bacteria | 2802 |
| 1223 | Ga0501036_0165673 | 3300049572 | Unclassified | 1863 |
| 1224 | Ga0501040_0060458 | 3300049576 | Bacteria | 2604 |
| 1225 | Ga0501042_0569592 | 3300049578 | Bacteria | 823 |
| 1226 | Ga0501043_0124865 | 3300049579 | Bacteria | 2018 |
| 1227 | Ga0501046_0100530 | 3300049580 | Unclassified | 2219 |
| 1228 | Ga0501046_0158754 | 3300049580 | Bacteria | 1702 |
| 1229 | Ga0501046_0277210 | 3300049580 | Bacteria | 1229 |
| 1230 | Ga0501047_0035252 | 3300049581 | Bacteria | 4834 |
| 1231 | Ga0501070_0013394 | 3300049586 | Bacteria | 6915 |
| 1232 | Ga0501071_0182627 | 3300049587 | Bacteria | 1572 |
| 1233 | Ga0501072_0119347 | 3300049588 | Bacteria | 2101 |
| 1234 | Ga0501075_0042382 | 3300049591 | Unclassified | 3412 |
| 1235 | Ga0501076_0593046 | 3300049592 | Bacteria | 914 |
| 1236 | Ga0501227_032560 | 3300049665 | Bacteria | 1258 |
| 1237 | Ga0501257_189572 | 3300049686 | Unclassified | 586 |
| 1238 | Ga0501079_0015369 | 3300049741 | Bacteria | 5841 |
| 1239 | Ga0501079_0540010 | 3300049741 | Bacteria | 917 |
| 1240 | Ga0501080_0051019 | 3300049742 | Bacteria | 3849 |
| 1241 | Ga0501080_0111289 | 3300049742 | Bacteria | 2538 |
| 1242 | Ga0501080_0598712 | 3300049742 | Bacteria | 979 |
| 1243 | Ga0501081_0225642 | 3300049743 | Bacteria | 1363 |
| 1244 | Ga0501035_0047376 | 3300049822 | Bacteria | 3859 |
| 1245 | Ga0501035_0963376 | 3300049822 | Bacteria | 673 |
| 1246 | Ga0501044_0424225 | 3300049823 | Bacteria | 1240 |
| 1247 | Ga0501044_0780204 | 3300049823 | Bacteria | 836 |
| 1248 | Ga0501044_1152884 | 3300049823 | Unclassified | 643 |
| 1249 | Ga0501045_0163242 | 3300049824 | Unclassified | 1658 |
| 1250 | Ga0501045_0569136 | 3300049824 | Unclassified | 840 |
| 1251 | nmdc:mga05p37_66004_c1 | 3300050507 | Unclassified | 4452 |
| 1252 | nmdc:mga05p37_898529_c1 | 3300050507 | Bacteria | 955 |
| 1253 | nmdc:mga09592_182827_c1 | 3300050508 | Bacteria | 1814 |
| 1254 | nmdc:mga09592_240985_c1 | 3300050508 | Bacteria | 1567 |
| 1255 | nmdc:mga09592_392702_c1 | 3300050508 | Unclassified | 1199 |
| 1256 | nmdc:mga09592_85301_c1 | 3300050508 | Unclassified | 2694 |
| 1257 | nmdc:mga0qj67_74501_c1 | 3300050509 | Bacteria | 2713 |
| 1258 | nmdc:mga06r32_153556_c1 | 3300050510 | Archaea | 2282 |
| 1259 | nmdc:mga06r32_16610_c1 | 3300050510 | Bacteria | 6710 |
| 1260 | nmdc:mga06r32_443296_c1 | 3300050510 | Bacteria | 1278 |
| 1261 | nmdc:mga08y16_38267_c1 | 3300050511 | Bacteria | 5037 |
| 1262 | nmdc:mga0n895_32332_c1 | 3300050512 | Bacteria | 5021 |
| 1263 | nmdc:mga0n895_78265_c1 | 3300050512 | Unclassified | 3291 |
| 1264 | nmdc:mga0a205_999_c1 | 3300050515 | Bacteria | 23420 |
| 1265 | Ga0495595_0139406 | 3300053084 | Bacteria | 1189 |
| 1266 | Ga0495619_0519440 | 3300053085 | Bacteria | 818 |
| 1267 | Ga0500596_006466 | 3300053735 | Bacteria | 1980 |
| 1268 | Ga0501084_0522324 | 3300054114 | Bacteria | 1003 |
| 1269 | Ga0501084_1019482 | 3300054114 | Bacteria | 695 |
| 1270 | Ga0590071_010887 | 3300059421 | Bacteria | 2127 |
| 1271 | Ga0590075_064035 | 3300059424 | Bacteria | 948 |
| 1272 | Ga0501082_0070426 | 3300060353 | Unclassified | 3011 |
| 1273 | Ga0501082_0200113 | 3300060353 | Bacteria | 1738 |
| 1274 | Ga0530510_0236510 | 3300061734 | Bacteria | 1359 |
| 1275 | Ga0157380_11096736 | |||
| 1276 | JGI24737J22298_10085535 | |||
| 1277 | JGI24750J21931_1004366 | |||
| 1278 | JGI25406J46586_10029214 | |||
| 1279 | JGI26131J50246_101093 | |||
| 1280 | Ga0058861_11685109 | |||
| 1281 | Ga0065712_10003350 | |||
| 1282 | Ga0065707_10093585 | |||
| 1283 | Ga0070658_10005818 | |||
| 1284 | Ga0070658_10029742 | |||
| 1285 | Ga0070658_10031731 | |||
| 1286 | Ga0070658_10143682 | |||
| 1287 | Ga0070676_10000168 | |||
| 1288 | Ga0070676_10009237 | |||
| 1289 | Ga0070676_10013900 | |||
| 1290 | Ga0070676_10278890 | |||
| 1291 | Ga0070676_10279142 | |||
| 1292 | Ga0070683_100004732 | |||
| 1293 | Ga0070683_100007250 | |||
| 1294 | Ga0070683_100007752 | |||
| 1295 | Ga0070683_100018870 | |||
| 1296 | Ga0070683_100097593 | |||
| 1297 | Ga0070683_100153771 | |||
| 1298 | Ga0070683_100206937 | |||
| 1299 | Ga0070683_100239151 | |||
| 1300 | Ga0070683_100259336 | |||
| 1301 | Ga0070683_100263494 | |||
| 1302 | Ga0070683_100277344 | |||
| 1303 | Ga0070683_100309519 | |||
| 1304 | Ga0070683_100770203 | |||
| 1305 | Ga0070683_100849876 | |||
| 1306 | Ga0070683_101147633 | |||
| 1307 | Ga0070690_100002712 | |||
| 1308 | Ga0070690_100024555 | |||
| 1309 | Ga0070690_100123578 | |||
| 1310 | Ga0070690_100135457 | |||
| 1311 | Ga0070690_100240467 | |||
| 1312 | Ga0070690_100955210 | |||
| 1313 | Ga0070670_100000138 | |||
| 1314 | Ga0070670_100001486 | |||
| 1315 | Ga0070670_100051467 | |||
| 1316 | Ga0070670_100198696 | |||
| 1317 | Ga0070670_100344293 | |||
| 1318 | Ga0070670_100417374 | |||
| 1319 | Ga0070670_100429364 | |||
| 1320 | Ga0070670_100451992 | |||
| 1321 | Ga0070670_100588373 | |||
| 1322 | Ga0070670_100654713 | |||
| 1323 | Ga0070670_101099126 | |||
| 1324 | Ga0070677_10301572 | |||
| 1325 | Ga0068869_100004073 | |||
| 1326 | Ga0068869_100402581 | |||
| 1327 | Ga0068869_100722209 | |||
| 1328 | Ga0070666_10211825 | |||
| 1329 | Ga0070680_100000013 | |||
| 1330 | Ga0070680_100036695 | |||
| 1331 | Ga0070680_100046546 | |||
| 1332 | Ga0070680_100055200 | |||
| 1333 | Ga0070680_100110394 | |||
| 1334 | Ga0070680_100258391 | |||
| 1335 | Ga0070680_100528799 | |||
| 1336 | Ga0070682_100002084 | |||
| 1337 | Ga0070682_100194942 | |||
| 1338 | Ga0070682_100367923 | |||
| 1339 | Ga0070682_100617379 | |||
| 1340 | Ga0068868_100011253 | |||
| 1341 | Ga0068868_100145280 | |||
| 1342 | Ga0068868_100541855 | |||
| 1343 | Ga0068868_100782096 | |||
| 1344 | Ga0070660_100006418 | |||
| 1345 | Ga0070660_100008715 | |||
| 1346 | Ga0070660_100010055 | |||
| 1347 | Ga0070660_100030691 | |||
| 1348 | Ga0070660_100158382 | |||
| 1349 | Ga0070660_100516539 | |||
| 1350 | Ga0070660_100596882 | |||
| 1351 | Ga0070660_100720566 | |||
| 1352 | Ga0070689_100001539 | |||
| 1353 | Ga0070689_100042354 | |||
| 1354 | Ga0070689_100063153 | |||
| 1355 | Ga0070689_100657579 | |||
| 1356 | Ga0070691_10037922 | |||
| 1357 | Ga0070691_10046986 | |||
| 1358 | Ga0070687_100001896 | |||
| 1359 | Ga0070687_100009368 | |||
| 1360 | Ga0070687_100034893 | |||
| 1361 | Ga0070687_100311396 | |||
| 1362 | Ga0070661_100000734 | |||
| 1363 | Ga0070661_100001898 | |||
| 1364 | Ga0070661_100004203 | |||
| 1365 | Ga0070661_100015798 | |||
| 1366 | Ga0070661_100045747 | |||
| 1367 | Ga0070661_100084277 | |||
| 1368 | Ga0070661_100106794 | |||
| 1369 | Ga0070661_100143473 | |||
| 1370 | Ga0070661_100297970 | |||
| 1371 | Ga0070661_100326007 | |||
| 1372 | Ga0070661_100338402 | |||
| 1373 | Ga0070661_100420035 | |||
| 1374 | Ga0070692_10005540 | |||
| 1375 | Ga0070692_10039580 | |||
| 1376 | Ga0070692_10436222 | |||
| 1377 | Ga0070668_100000678 | |||
| 1378 | Ga0070668_100000880 | |||
| 1379 | Ga0070668_100005111 | |||
| 1380 | Ga0070668_100011973 | |||
| 1381 | Ga0070668_100083128 | |||
| 1382 | Ga0070668_100192247 | |||
| 1383 | Ga0070668_100671785 | |||
| 1384 | Ga0070669_100000540 | |||
| 1385 | Ga0070669_100001286 | |||
| 1386 | Ga0070669_100004218 | |||
| 1387 | Ga0070669_100085773 | |||
| 1388 | Ga0070669_100266331 | |||
| 1389 | Ga0070669_100616814 | |||
| 1390 | Ga0070675_100003493 | |||
| 1391 | Ga0070675_100004393 | |||
| 1392 | Ga0070675_100013137 | |||
| 1393 | Ga0070675_100018476 | |||
| 1394 | Ga0070675_100037481 | |||
| 1395 | Ga0070675_100140455 | |||
| 1396 | Ga0070671_100016516 | |||
| 1397 | Ga0070671_100028426 | |||
| 1398 | Ga0070671_100221814 | |||
| 1399 | Ga0070671_100246747 | |||
| 1400 | Ga0070671_100548826 | |||
| 1401 | Ga0070671_100698796 | |||
| 1402 | Ga0070671_101028813 | |||
| 1403 | Ga0070671_101353297 | |||
| 1404 | Ga0070674_100006253 | |||
| 1405 | Ga0070674_100041356 | |||
| 1406 | Ga0070674_100060234 | |||
| 1407 | Ga0070674_100081882 | |||
| 1408 | Ga0070674_100591296 | |||
| 1409 | Ga0070673_100027074 | |||
| 1410 | Ga0070673_100035765 | |||
| 1411 | Ga0070673_100065175 | |||
| 1412 | Ga0070673_100168737 | |||
| 1413 | Ga0070673_100482519 | |||
| 1414 | Ga0070673_100551438 | |||
| 1415 | Ga0070673_100599470 | |||
| 1416 | Ga0070688_100015310 | |||
| 1417 | Ga0070688_100019586 | |||
| 1418 | Ga0070688_100042802 | |||
| 1419 | Ga0070688_100050142 | |||
| 1420 | Ga0070688_100217234 | |||
| 1421 | Ga0070688_100632519 | |||
| 1422 | Ga0070659_100000291 | |||
| 1423 | Ga0070659_100022506 | |||
| 1424 | Ga0070659_100023399 | |||
| 1425 | Ga0070659_100025696 | |||
| 1426 | Ga0070659_100030949 | |||
| 1427 | Ga0070659_100050493 | |||
| 1428 | Ga0070659_100100147 | |||
| 1429 | Ga0070659_100159350 | |||
| 1430 | Ga0070659_100587685 | |||
| 1431 | Ga0070659_100666020 | |||
| 1432 | Ga0070659_100685672 | |||
| 1433 | Ga0070659_101068498 | |||
| 1434 | Ga0070659_101246451 | |||
| 1435 | Ga0070659_101394057 | |||
| 1436 | Ga0070667_100009570 | |||
| 1437 | Ga0070667_100039501 | |||
| 1438 | Ga0070667_100192006 | |||
| 1439 | Ga0070667_100350136 | |||
| 1440 | Ga0070667_100448702 | |||
| 1441 | Ga0070667_100662772 | |||
| 1442 | Ga0070709_10042515 | |||
| 1443 | Ga0070709_10100118 | |||
| 1444 | Ga0070709_10358099 | |||
| 1445 | Ga0070714_100003238 | |||
| 1446 | Ga0070714_100003435 | |||
| 1447 | Ga0070714_100004487 | |||
| 1448 | Ga0070714_100117251 | |||
| 1449 | Ga0070714_100169757 | |||
| 1450 | Ga0070713_100000095 | |||
| 1451 | Ga0070713_100147922 | |||
| 1452 | Ga0070713_100746381 | |||
| 1453 | Ga0070713_101045853 | |||
| 1454 | Ga0070713_101286063 | |||
| 1455 | Ga0070710_10050893 | |||
| 1456 | Ga0070710_10127599 | |||
| 1457 | Ga0070710_10163231 | |||
| 1458 | Ga0070701_10008887 | |||
| 1459 | Ga0070701_10038757 | |||
| 1460 | Ga0070701_10070552 | |||
| 1461 | Ga0070701_10132471 | |||
| 1462 | Ga0070701_10430996 | |||
| 1463 | Ga0070711_100064802 | |||
| 1464 | Ga0070711_100210604 | |||
| 1465 | Ga0070711_100441226 | |||
| 1466 | Ga0070705_100084933 | |||
| 1467 | Ga0070705_100573587 | |||
| 1468 | Ga0070700_100033729 | |||
| 1469 | Ga0070700_100034857 | |||
| 1470 | Ga0070700_100126567 | |||
| 1471 | Ga0070700_100364241 | |||
| 1472 | Ga0070700_100551161 | |||
| 1473 | Ga0070700_100840393 | |||
| 1474 | Ga0070694_100093933 | |||
| 1475 | Ga0070694_100358805 | |||
| 1476 | Ga0070694_100593170 | |||
| 1477 | Ga0070708_100326692 | |||
| 1478 | Ga0070663_100043127 | |||
| 1479 | Ga0070663_100109520 | |||
| 1480 | Ga0070663_100142654 | |||
| 1481 | Ga0070663_100266949 | |||
| 1482 | Ga0070663_100343695 | |||
| 1483 | Ga0070663_100441460 | |||
| 1484 | Ga0070663_100494603 | |||
| 1485 | Ga0070678_100260634 | |||
| 1486 | Ga0070678_100650150 | |||
| 1487 | Ga0070678_100913111 | |||
| 1488 | Ga0070662_100004834 | |||
| 1489 | Ga0070662_100010581 | |||
| 1490 | Ga0070662_100016639 | |||
| 1491 | Ga0070662_100017321 | |||
| 1492 | Ga0070662_100017619 | |||
| 1493 | Ga0070662_100075905 | |||
| 1494 | Ga0070662_100270419 | |||
| 1495 | Ga0070662_100850108 | |||
| 1496 | Ga0070681_10000279 | |||
| 1497 | Ga0070681_10001401 | |||
| 1498 | Ga0070681_10004777 | |||
| 1499 | Ga0070681_10005847 | |||
| 1500 | Ga0070681_10006833 | |||
| 1501 | Ga0070681_10022331 | |||
| 1502 | Ga0070681_10105390 | |||
| 1503 | Ga0070681_10228503 | |||
| 1504 | Ga0070681_10268833 | |||
| 1505 | Ga0070681_10501665 | |||
| 1506 | Ga0070681_10701899 | |||
| 1507 | Ga0068867_100002642 | |||
| 1508 | Ga0068867_100008150 | |||
| 1509 | Ga0068867_100919148 | |||
| 1510 | Ga0070685_10007422 | |||
| 1511 | Ga0070685_10037107 | |||
| 1512 | Ga0070685_10038452 | |||
| 1513 | Ga0070706_100287132 | |||
| 1514 | Ga0070707_100678577 | |||
| 1515 | Ga0070707_100925940 | |||
| 1516 | Ga0070698_100000313 | |||
| 1517 | Ga0070698_100023878 | |||
| 1518 | Ga0070698_100068253 | |||
| 1519 | Ga0070698_100192394 | |||
| 1520 | Ga0070699_100002608 | |||
| 1521 | Ga0070699_100095470 | |||
| 1522 | Ga0070699_100524160 | |||
| 1523 | Ga0070699_100788300 | |||
| 1524 | Ga0070679_100000874 | |||
| 1525 | Ga0070679_100000939 | |||
| 1526 | Ga0070679_100001684 | |||
| 1527 | Ga0070679_100009396 | |||
| 1528 | Ga0070679_100016713 | |||
| 1529 | Ga0070679_100019441 | |||
| 1530 | Ga0070679_100021072 | |||
| 1531 | Ga0070679_100041763 | |||
| 1532 | Ga0070679_100046402 | |||
| 1533 | Ga0070679_100062370 | |||
| 1534 | Ga0070679_100080334 | |||
| 1535 | Ga0070679_100081189 | |||
| 1536 | Ga0070679_100090382 | |||
| 1537 | Ga0070679_100141995 | |||
| 1538 | Ga0070679_100167787 | |||
| 1539 | Ga0070679_100365976 | |||
| 1540 | Ga0070679_100410004 | |||
| 1541 | Ga0070679_101486581 | |||
| 1542 | Ga0070684_100006545 | |||
| 1543 | Ga0070684_100009374 | |||
| 1544 | Ga0070684_100015982 | |||
| 1545 | Ga0070684_100017108 | |||
| 1546 | Ga0070684_100017490 | |||
| 1547 | Ga0070684_100028570 | |||
| 1548 | Ga0070684_100035828 | |||
| 1549 | Ga0070684_100115789 | |||
| 1550 | Ga0070684_100141729 | |||
| 1551 | Ga0070684_100156339 | |||
| 1552 | Ga0070684_100157973 | |||
| 1553 | Ga0070684_100294621 | |||
| 1554 | Ga0070684_100297055 | |||
| 1555 | Ga0070684_100558413 | |||
| 1556 | Ga0070684_100814249 | |||
| 1557 | Ga0070684_101253301 | |||
| 1558 | Ga0070697_100077357 | |||
| 1559 | Ga0070697_100629957 | |||
| 1560 | Ga0070697_100801653 | |||
| 1561 | Ga0068853_100003657 | |||
| 1562 | Ga0068853_100009729 | |||
| 1563 | Ga0068853_100062682 | |||
| 1564 | Ga0068853_100103828 | |||
| 1565 | Ga0068853_100120338 | |||
| 1566 | Ga0068853_100184630 | |||
| 1567 | Ga0068853_101350388 | |||
| 1568 | Ga0070672_100009462 | |||
| 1569 | Ga0070672_100014207 | |||
| 1570 | Ga0070672_100017142 | |||
| 1571 | Ga0070672_100028463 | |||
| 1572 | Ga0070672_100149714 | |||
| 1573 | Ga0070672_100169590 | |||
| 1574 | Ga0070672_100452636 | |||
| 1575 | Ga0070672_100542576 | |||
| 1576 | Ga0070672_100613758 | |||
| 1577 | Ga0070672_100784309 | |||
| 1578 | Ga0070686_100364648 | |||
| 1579 | Ga0070695_100434602 | |||
| 1580 | Ga0070696_100000190 | |||
| 1581 | Ga0070696_100251274 | |||
| 1582 | Ga0070693_100002253 | |||
| 1583 | Ga0070693_100003289 | |||
| 1584 | Ga0070693_100003791 | |||
| 1585 | Ga0070693_100225147 | |||
| 1586 | Ga0070665_100312188 | |||
| 1587 | Ga0070665_100315992 | |||
| 1588 | Ga0070665_101228823 | |||
| 1589 | Ga0070704_100097734 | |||
| 1590 | Ga0070704_100130152 | |||
| 1591 | Ga0068855_100010233 | |||
| 1592 | Ga0068855_100020223 | |||
| 1593 | Ga0068855_100031164 | |||
| 1594 | Ga0068855_100055811 | |||
| 1595 | Ga0068855_100081061 | |||
| 1596 | Ga0068855_100086592 | |||
| 1597 | Ga0068855_101517613 | |||
| 1598 | Ga0070664_100005169 | |||
| 1599 | Ga0070664_100005766 | |||
| 1600 | Ga0070664_100011681 | |||
| 1601 | Ga0070664_100016028 | |||
| 1602 | Ga0070664_100022022 | |||
| 1603 | Ga0070664_100032406 | |||
| 1604 | Ga0070664_100038168 | |||
| 1605 | Ga0070664_100072912 | |||
| 1606 | Ga0070664_100076502 | |||
| 1607 | Ga0070664_100081659 | |||
| 1608 | Ga0070664_100132548 | |||
| 1609 | Ga0070664_100165577 | |||
| 1610 | Ga0070664_100693691 | |||
| 1611 | Ga0070664_101292195 | |||
| 1612 | Ga0068857_100000435 | |||
| 1613 | Ga0068857_100000456 | |||
| 1614 | Ga0068857_100011507 | |||
| 1615 | Ga0068857_100024423 | |||
| 1616 | Ga0068857_100061990 | |||
| 1617 | Ga0068857_100152751 | |||
| 1618 | Ga0068854_100005455 | |||
| 1619 | Ga0068854_100046441 | |||
| 1620 | Ga0068854_100053750 | |||
| 1621 | Ga0068854_100500477 | |||
| 1622 | Ga0068854_100668091 | |||
| 1623 | Ga0068856_100041180 | |||
| 1624 | Ga0068856_100350449 | |||
| 1625 | Ga0070702_100000053 | |||
| 1626 | Ga0070702_100048828 | |||
| 1627 | Ga0068852_100003960 | |||
| 1628 | Ga0068852_100006328 | |||
| 1629 | Ga0068852_100010182 | |||
| 1630 | Ga0068852_100020736 | |||
| 1631 | Ga0068852_100213334 | |||
| 1632 | Ga0068852_100274856 | |||
| 1633 | Ga0068852_100277016 | |||
| 1634 | Ga0068852_100407162 | |||
| 1635 | Ga0068852_100445217 | |||
| 1636 | Ga0068852_100874609 | |||
| 1637 | Ga0068852_101001748 | |||
| 1638 | Ga0068852_101024439 | |||
| 1639 | Ga0068852_101376636 | |||
| 1640 | Ga0068859_100014164 | |||
| 1641 | Ga0068859_100078645 | |||
| 1642 | Ga0068859_100123299 | |||
| 1643 | Ga0068859_100124815 | |||
| 1644 | Ga0068859_100194473 | |||
| 1645 | Ga0068859_100235850 | |||
| 1646 | Ga0068859_100431363 | |||
| 1647 | Ga0068859_102160041 | |||
| 1648 | Ga0068864_100004639 | |||
| 1649 | Ga0068864_100081017 | |||
| 1650 | Ga0068864_100110516 | |||
| 1651 | Ga0068864_100120970 | |||
| 1652 | Ga0068864_100235627 | |||
| 1653 | Ga0068864_100527880 | |||
| 1654 | Ga0068864_100652782 | |||
| 1655 | Ga0068864_101089748 | |||
| 1656 | Ga0068861_100008798 | |||
| 1657 | Ga0068861_100010924 | |||
| 1658 | Ga0068861_101143242 | |||
| 1659 | Ga0068851_10062968 | |||
| 1660 | Ga0068870_10000965 | |||
| 1661 | Ga0068870_10005182 | |||
| 1662 | Ga0068870_10059254 | |||
| 1663 | Ga0068870_10164160 | |||
| 1664 | Ga0068863_100001285 | |||
| 1665 | Ga0068863_100006717 | |||
| 1666 | Ga0068863_100210448 | |||
| 1667 | Ga0068863_100269397 | |||
| 1668 | Ga0068863_100269802 | |||
| 1669 | Ga0068863_100303181 | |||
| 1670 | Ga0068858_100088084 | |||
| 1671 | Ga0068858_100140249 | |||
| 1672 | Ga0068858_100513713 | |||
| 1673 | Ga0068860_100003929 | |||
| 1674 | Ga0068860_100023638 | |||
| 1675 | Ga0068860_100167691 | |||
| 1676 | Ga0068860_100379244 | |||
| 1677 | Ga0068862_100000846 | |||
| 1678 | Ga0068862_100009616 | |||
| 1679 | Ga0068862_100062863 | |||
| 1680 | Ga0068862_100123546 | |||
| 1681 | Ga0081539_10000131 | |||
| 1682 | Ga0081539_10007371 | |||
| 1683 | Ga0081539_10163606 | |||
| 1684 | Ga0070717_10002392 | |||
| 1685 | Ga0070717_10140320 | |||
| 1686 | Ga0070717_10244011 | |||
| 1687 | Ga0070715_10428448 | |||
| 1688 | Ga0070712_100003513 | |||
| 1689 | Ga0070712_100231385 | |||
| 1690 | Ga0070712_101213635 | |||
| 1691 | Ga0097621_100017887 | |||
| 1692 | Ga0097621_100331384 | |||
| 1693 | Ga0068871_100015696 | |||
| 1694 | Ga0068871_100025116 | |||
| 1695 | Ga0075428_100597542 | |||
| 1696 | Ga0075428_100673380 | |||
| 1697 | Ga0075430_100009123 | |||
| 1698 | Ga0075430_100016363 | |||
| 1699 | Ga0075430_100020044 | |||
| 1700 | Ga0075430_100032090 | |||
| 1701 | Ga0075430_100058524 | |||
| 1702 | Ga0075430_100061491 | |||
| 1703 | Ga0075431_100012678 | |||
| 1704 | Ga0075431_100015816 | |||
| 1705 | Ga0075431_100132922 | |||
| 1706 | Ga0075431_100238022 | |||
| 1707 | Ga0075431_100353559 | |||
| 1708 | Ga0075431_100356831 | |||
| 1709 | Ga0075431_100485812 | |||
| 1710 | Ga0075431_100507627 | |||
| 1711 | Ga0075431_100920337 | |||
| 1712 | Ga0075433_10012329 | |||
| 1713 | Ga0075433_10021411 | |||
| 1714 | Ga0075434_100023582 | |||
| 1715 | Ga0075434_100229404 | |||
| 1716 | Ga0075434_100297142 | |||
| 1717 | Ga0075434_100299681 | |||
| 1718 | Ga0075434_100478628 | |||
| 1719 | Ga0075429_100055347 | |||
| 1720 | Ga0075429_100057297 | |||
| 1721 | Ga0075429_100186631 | |||
| 1722 | Ga0075429_100218947 | |||
| 1723 | Ga0075429_101094463 | |||
| 1724 | Ga0068865_100013918 | |||
| 1725 | Ga0068865_100091177 | |||
| 1726 | Ga0068865_100120636 | |||
| 1727 | Ga0068865_100158155 | |||
| 1728 | Ga0068865_100164652 | |||
| 1729 | Ga0075436_100097699 | |||
| 1730 | Ga0097620_100014165 | |||
| 1731 | Ga0097620_100078642 | |||
| 1732 | Ga0097620_100123299 | |||
| 1733 | Ga0097620_100124814 | |||
| 1734 | Ga0097620_100194478 | |||
| 1735 | Ga0097620_100235866 | |||
| 1736 | Ga0097620_100431368 | |||
| 1737 | Ga0097620_100538649 | |||
| 1738 | Ga0097620_102160021 | |||
| 1739 | Ga0075435_100017876 | |||
| 1740 | Ga0075435_100170667 | |||
| 1741 | Ga0105240_10012482 | |||
| 1742 | Ga0105240_10064366 | |||
| 1743 | Ga0105240_10576768 | |||
| 1744 | Ga0111539_10007826 | |||
| 1745 | Ga0111539_10058021 | |||
| 1746 | Ga0111539_10070557 | |||
| 1747 | Ga0111539_10400356 | |||
| 1748 | Ga0111539_10569533 | |||
| 1749 | Ga0105245_10062208 | |||
| 1750 | Ga0105245_10183517 | |||
| 1751 | Ga0105245_10229360 | |||
| 1752 | Ga0105245_10511613 | |||
| 1753 | Ga0105245_10567189 | |||
| 1754 | Ga0105245_11822974 | |||
| 1755 | Ga0105247_10489318 | |||
| 1756 | Ga0114129_10044841 | |||
| 1757 | Ga0114129_10165608 | |||
| 1758 | Ga0114129_11330570 | |||
| 1759 | Ga0105243_10033730 | |||
| 1760 | Ga0105243_10108483 | |||
| 1761 | Ga0105243_11120700 | |||
| 1762 | Ga0105241_10003074 | |||
| 1763 | Ga0105241_10016968 | |||
| 1764 | Ga0105241_10683380 | |||
| 1765 | Ga0105242_10008146 | |||
| 1766 | Ga0105242_10009063 | |||
| 1767 | Ga0105242_10180733 | |||
| 1768 | Ga0105242_10335962 | |||
| 1769 | Ga0105242_10438421 | |||
| 1770 | Ga0105248_10013744 | |||
| 1771 | Ga0105248_10029207 | |||
| 1772 | Ga0105248_10039086 | |||
| 1773 | Ga0105248_10039980 | |||
| 1774 | Ga0105248_10093987 | |||
| 1775 | Ga0105248_10223406 | |||
| 1776 | Ga0105248_10401324 | |||
| 1777 | Ga0105237_10002586 | |||
| 1778 | Ga0105238_10114356 | |||
| 1779 | Ga0105238_10174132 | |||
| 1780 | Ga0105249_10000009 | |||
| 1781 | Ga0105249_10000188 | |||
| 1782 | Ga0105249_10001451 | |||
| 1783 | Ga0105249_10114589 | |||
| 1784 | Ga0105249_10482655 | |||
| 1785 | Ga0105239_10003476 | |||
| 1786 | Ga0105239_10027015 | |||
| 1787 | Ga0105246_10000122 | |||
| 1788 | Ga0105246_10154875 | |||
| 1789 | Ga0105246_10181175 | |||
| 1790 | Ga0105246_10358808 | |||
| 1791 | Ga0157373_10010453 | |||
| 1792 | Ga0157373_10028086 | |||
| 1793 | Ga0157373_10182404 | |||
| 1794 | Ga0157373_10465921 | |||
| 1795 | Ga0157371_10015191 | |||
| 1796 | Ga0157371_10133327 | |||
| 1797 | Ga0157371_10403280 | |||
| 1798 | Ga0157371_10457612 | |||
| 1799 | Ga0157371_10661941 | |||
| 1800 | Ga0157371_10789946 | |||
| 1801 | Ga0157370_10008914 | |||
| 1802 | Ga0157370_10019218 | |||
| 1803 | Ga0157370_10246607 | |||
| 1804 | Ga0157370_10247528 | |||
| 1805 | Ga0157370_11298930 | |||
| 1806 | Ga0157369_10000582 | |||
| 1807 | Ga0157369_10037773 | |||
| 1808 | Ga0157369_10105420 | |||
| 1809 | Ga0157369_10113710 | |||
| 1810 | Ga0157369_10114898 | |||
| 1811 | Ga0157369_10135130 | |||
| 1812 | Ga0157369_10219900 | |||
| 1813 | Ga0157369_10235381 | |||
| 1814 | Ga0157369_10334468 | |||
| 1815 | Ga0157369_10397740 | |||
| 1816 | Ga0157369_10624052 | |||
| 1817 | Ga0157369_10900436 | |||
| 1818 | Ga0157374_10006957 | |||
| 1819 | Ga0157374_10107822 | |||
| 1820 | Ga0157374_10473466 | |||
| 1821 | Ga0157374_10775152 | |||
| 1822 | Ga0157378_10017585 | |||
| 1823 | Ga0157378_10677819 | |||
| 1824 | Ga0157378_10970890 | |||
| 1825 | Ga0163162_10000292 | |||
| 1826 | Ga0163162_10050706 | |||
| 1827 | Ga0163162_10138340 | |||
| 1828 | Ga0163162_10278037 | |||
| 1829 | Ga0163162_10341959 | |||
| 1830 | Ga0157372_10002643 | |||
| 1831 | Ga0157372_10003254 | |||
| 1832 | Ga0157372_10014357 | |||
| 1833 | Ga0157372_10024230 | |||
| 1834 | Ga0157372_10038957 | |||
| 1835 | Ga0157372_10041939 | |||
| 1836 | Ga0157372_10053358 | |||
| 1837 | Ga0157372_10057646 | |||
| 1838 | Ga0157372_10263541 | |||
| 1839 | Ga0157372_10318552 | |||
| 1840 | Ga0157372_10340182 | |||
| 1841 | Ga0157372_10346861 | |||
| 1842 | Ga0157372_10366684 | |||
| 1843 | Ga0157372_10455572 | |||
| 1844 | Ga0157372_10804216 | |||
| 1845 | Ga0157372_10844834 | |||
| 1846 | Ga0157372_11195461 | |||
| 1847 | Ga0157372_11761233 | |||
| 1848 | Ga0157375_10010955 | |||
| 1849 | Ga0157375_10026791 | |||
| 1850 | Ga0157375_10032439 | |||
| 1851 | Ga0157375_10035316 | |||
| 1852 | Ga0157375_10063033 | |||
| 1853 | Ga0157375_10099576 | |||
| 1854 | Ga0157375_10107598 | |||
| 1855 | Ga0157375_10118637 | |||
| 1856 | Ga0157375_10815040 | |||
| 1857 | Ga0163163_10203468 | |||
| 1858 | Ga0163163_10298618 | |||
| 1859 | Ga0163163_12136399 | |||
| 1860 | Ga0157380_10003058 | |||
| 1861 | Ga0157380_10199527 | |||
| 1862 | Ga0182008_10004406 | |||
| 1863 | Ga0157377_10001140 | |||
| 1864 | Ga0157377_10028239 | |||
| 1865 | Ga0157377_10185395 | |||
| 1866 | Ga0157377_10230167 | |||
| 1867 | Ga0157377_10514332 | |||
| 1868 | Ga0157379_10000694 | |||
| 1869 | Ga0157379_10330815 | |||
| 1870 | Ga0157376_10059055 | |||
| 1871 | Ga0157376_11074216 | |||
| 1872 | Ga0157376_11834896 | |||
| 1873 | Ga0182007_10094665 | |||
| 1874 | Ga0182007_10164005 | |||
| 1875 | Ga0163161_10001779 | |||
| 1876 | Ga0163161_10333180 | |||
| 1877 | Ga0163161_10390623 | |||
| 1878 | Ga0163161_10496783 | |||
| 1879 | Ga0206356_10225113 | |||
| 1880 | Ga0206356_11469576 | |||
| 1881 | Ga0206354_10201211 | |||
| 1882 | Ga0206354_10259601 | |||
| 1883 | Ga0206354_11267766 | |||
| 1884 | Ga0206353_11473925 | |||
| 1885 | Ga0213876_10066550 | |||
| 1886 | Ga0213876_10219905 | |||
| 1887 | Ga0207666_1018819 | |||
| 1888 | Ga0207697_10000960 | |||
| 1889 | Ga0207697_10026707 | |||
| 1890 | Ga0207656_10025151 | |||
| 1891 | Ga0207682_10097114 | |||
| 1892 | Ga0207682_10363508 | |||
| 1893 | Ga0207692_10167460 | |||
| 1894 | Ga0207692_10173524 | |||
| 1895 | Ga0207642_10114679 | |||
| 1896 | Ga0207642_10167480 | |||
| 1897 | Ga0207688_10006788 | |||
| 1898 | Ga0207688_10014228 | |||
| 1899 | Ga0207680_10021164 | |||
| 1900 | Ga0207647_10053077 | |||
| 1901 | Ga0207699_10004646 | |||
| 1902 | Ga0207699_10177893 | |||
| 1903 | Ga0207699_10302619 | |||
| 1904 | Ga0207699_10387936 | |||
| 1905 | Ga0207645_10003416 | |||
| 1906 | Ga0207645_10019229 | |||
| 1907 | Ga0207645_10026006 | |||
| 1908 | Ga0207645_10032397 | |||
| 1909 | Ga0207645_10051822 | |||
| 1910 | Ga0207645_10074741 | |||
| 1911 | Ga0207645_10431779 | |||
| 1912 | Ga0207645_10592450 | |||
| 1913 | Ga0207643_10001096 | |||
| 1914 | Ga0207643_10009224 | |||
| 1915 | Ga0207643_10237673 | |||
| 1916 | Ga0207705_10002148 | |||
| 1917 | Ga0207705_10009897 | |||
| 1918 | Ga0207705_10029924 | |||
| 1919 | Ga0207705_10265435 | |||
| 1920 | Ga0207705_10315931 | |||
| 1921 | Ga0207705_10351949 | |||
| 1922 | Ga0207705_10366117 | |||
| 1923 | Ga0207705_10367833 | |||
| 1924 | Ga0207684_10185120 | |||
| 1925 | Ga0207654_10755175 | |||
| 1926 | Ga0207707_10000804 | |||
| 1927 | Ga0207707_10001018 | |||
| 1928 | Ga0207707_10001727 | |||
| 1929 | Ga0207707_10001809 | |||
| 1930 | Ga0207707_10003329 | |||
| 1931 | Ga0207707_10019943 | |||
| 1932 | Ga0207707_10201619 | |||
| 1933 | Ga0207707_10627295 | |||
| 1934 | Ga0207695_10001150 | |||
| 1935 | Ga0207695_10010924 | |||
| 1936 | Ga0207695_10014141 | |||
| 1937 | Ga0207695_10117165 | |||
| 1938 | Ga0207695_10214625 | |||
| 1939 | Ga0207695_10247314 | |||
| 1940 | Ga0207693_10004327 | |||
| 1941 | Ga0207693_10040968 | |||
| 1942 | Ga0207693_10195321 | |||
| 1943 | Ga0207663_10074302 | |||
| 1944 | Ga0207663_10347186 | |||
| 1945 | Ga0207660_10001831 | |||
| 1946 | Ga0207660_10003174 | |||
| 1947 | Ga0207660_10007756 | |||
| 1948 | Ga0207660_10040429 | |||
| 1949 | Ga0207660_10055820 | |||
| 1950 | Ga0207660_10101692 | |||
| 1951 | Ga0207660_10166051 | |||
| 1952 | Ga0207660_10303304 | |||
| 1953 | Ga0207660_10479286 | |||
| 1954 | Ga0207660_11015666 | |||
| 1955 | Ga0207662_10002215 | |||
| 1956 | Ga0207662_10005035 | |||
| 1957 | Ga0207662_10024010 | |||
| 1958 | Ga0207662_10048738 | |||
| 1959 | Ga0207662_10340344 | |||
| 1960 | Ga0207662_10360577 | |||
| 1961 | Ga0207657_10002073 | |||
| 1962 | Ga0207657_10017431 | |||
| 1963 | Ga0207657_10019698 | |||
| 1964 | Ga0207657_10074758 | |||
| 1965 | Ga0207657_10134475 | |||
| 1966 | Ga0207657_10156851 | |||
| 1967 | Ga0207657_10160891 | |||
| 1968 | Ga0207657_10268117 | |||
| 1969 | Ga0207657_10348336 | |||
| 1970 | Ga0207657_10823933 | |||
| 1971 | Ga0207657_10989033 | |||
| 1972 | Ga0207649_10009187 | |||
| 1973 | Ga0207649_10012402 | |||
| 1974 | Ga0207649_10031704 | |||
| 1975 | Ga0207649_10040369 | |||
| 1976 | Ga0207649_10070525 | |||
| 1977 | Ga0207649_10095261 | |||
| 1978 | Ga0207649_10126400 | |||
| 1979 | Ga0207649_10157179 | |||
| 1980 | Ga0207649_10241400 | |||
| 1981 | Ga0207649_10294423 | |||
| 1982 | Ga0207649_10426101 | |||
| 1983 | Ga0207649_10616964 | |||
| 1984 | Ga0207652_10000840 | |||
| 1985 | Ga0207652_10001448 | |||
| 1986 | Ga0207652_10024071 | |||
| 1987 | Ga0207652_10033054 | |||
| 1988 | Ga0207652_10040080 | |||
| 1989 | Ga0207652_10076395 | |||
| 1990 | Ga0207652_10093018 | |||
| 1991 | Ga0207652_10093418 | |||
| 1992 | Ga0207652_10160224 | |||
| 1993 | Ga0207652_10164573 | |||
| 1994 | Ga0207652_10171657 | |||
| 1995 | Ga0207652_10197367 | |||
| 1996 | Ga0207652_10216288 | |||
| 1997 | Ga0207652_10235978 | |||
| 1998 | Ga0207652_10241613 | |||
| 1999 | Ga0207652_10507101 | |||
| 2000 | Ga0207652_10576170 | |||
| 2001 | Ga0207652_10637833 | |||
| 2002 | Ga0207652_10818367 | |||
| 2003 | Ga0207681_10000999 | |||
| 2004 | Ga0207681_10003311 | |||
| 2005 | Ga0207681_10009429 | |||
| 2006 | Ga0207681_10183840 | |||
| 2007 | Ga0207681_10833796 | |||
| 2008 | Ga0207681_10872341 | |||
| 2009 | Ga0207694_10004230 | |||
| 2010 | Ga0207694_10880263 | |||
| 2011 | Ga0207694_10948439 | |||
| 2012 | Ga0207650_10001883 | |||
| 2013 | Ga0207650_10014805 | |||
| 2014 | Ga0207650_10027643 | |||
| 2015 | Ga0207650_10041940 | |||
| 2016 | Ga0207650_10049478 | |||
| 2017 | Ga0207650_10182277 | |||
| 2018 | Ga0207650_10239953 | |||
| 2019 | Ga0207650_10322773 | |||
| 2020 | Ga0207650_10401839 | |||
| 2021 | Ga0207650_10463124 | |||
| 2022 | Ga0207650_10718261 | |||
| 2023 | Ga0207659_10005681 | |||
| 2024 | Ga0207659_10009766 | |||
| 2025 | Ga0207659_10018153 | |||
| 2026 | Ga0207659_10043734 | |||
| 2027 | Ga0207659_10106391 | |||
| 2028 | Ga0207659_10125441 | |||
| 2029 | Ga0207659_10150407 | |||
| 2030 | Ga0207659_10217927 | |||
| 2031 | Ga0207659_10430910 | |||
| 2032 | Ga0207687_10002031 | |||
| 2033 | Ga0207687_10275848 | |||
| 2034 | Ga0207687_10528822 | |||
| 2035 | Ga0207687_10979470 | |||
| 2036 | Ga0207700_10000413 | |||
| 2037 | Ga0207700_10149397 | |||
| 2038 | Ga0207700_10196232 | |||
| 2039 | Ga0207700_10712067 | |||
| 2040 | Ga0207664_10000401 | |||
| 2041 | Ga0207664_10003750 | |||
| 2042 | Ga0207664_10044586 | |||
| 2043 | Ga0207664_10100050 | |||
| 2044 | Ga0207664_10164960 | |||
| 2045 | Ga0207644_10068932 | |||
| 2046 | Ga0207644_10160614 | |||
| 2047 | Ga0207644_10192458 | |||
| 2048 | Ga0207644_10207704 | |||
| 2049 | Ga0207644_10295459 | |||
| 2050 | Ga0207644_10498452 | |||
| 2051 | Ga0207644_10939064 | |||
| 2052 | Ga0207690_10001401 | |||
| 2053 | Ga0207690_10012392 | |||
| 2054 | Ga0207690_10019476 | |||
| 2055 | Ga0207690_10022331 | |||
| 2056 | Ga0207690_10033092 | |||
| 2057 | Ga0207690_10040802 | |||
| 2058 | Ga0207690_10060884 | |||
| 2059 | Ga0207690_10881198 | |||
| 2060 | Ga0207690_10900708 | |||
| 2061 | Ga0207706_10000083 | |||
| 2062 | Ga0207706_10004128 | |||
| 2063 | Ga0207706_10020458 | |||
| 2064 | Ga0207706_10021768 | |||
| 2065 | Ga0207706_10122276 | |||
| 2066 | Ga0207706_10146602 | |||
| 2067 | Ga0207706_10397304 | |||
| 2068 | Ga0207706_10484613 | |||
| 2069 | Ga0207686_10010499 | |||
| 2070 | Ga0207686_10023464 | |||
| 2071 | Ga0207686_10073847 | |||
| 2072 | Ga0207686_10375241 | |||
| 2073 | Ga0207670_10038252 | |||
| 2074 | Ga0207670_10156020 | |||
| 2075 | Ga0207670_10160845 | |||
| 2076 | Ga0207670_11079698 | |||
| 2077 | Ga0207669_10017425 | |||
| 2078 | Ga0207669_10083839 | |||
| 2079 | Ga0207669_10161269 | |||
| 2080 | Ga0207704_10004383 | |||
| 2081 | Ga0207665_10395166 | |||
| 2082 | Ga0207691_10001010 | |||
| 2083 | Ga0207691_10001083 | |||
| 2084 | Ga0207691_10034469 | |||
| 2085 | Ga0207691_10050323 | |||
| 2086 | Ga0207691_10060742 | |||
| 2087 | Ga0207691_10066594 | |||
| 2088 | Ga0207691_10324977 | |||
| 2089 | Ga0207691_10821257 | |||
| 2090 | Ga0207711_10036021 | |||
| 2091 | Ga0207711_10068039 | |||
| 2092 | Ga0207711_10069322 | |||
| 2093 | Ga0207711_10072711 | |||
| 2094 | Ga0207711_10159915 | |||
| 2095 | Ga0207711_10186240 | |||
| 2096 | Ga0207711_10194651 | |||
| 2097 | Ga0207711_10662117 | |||
| 2098 | Ga0207711_10974019 | |||
| 2099 | Ga0207689_10003195 | |||
| 2100 | Ga0207689_10146452 | |||
| 2101 | Ga0207661_10000284 | |||
| 2102 | Ga0207661_10003651 | |||
| 2103 | Ga0207661_10007571 | |||
| 2104 | Ga0207661_10011108 | |||
| 2105 | Ga0207661_10012328 | |||
| 2106 | Ga0207661_10016297 | |||
| 2107 | Ga0207661_10022799 | |||
| 2108 | Ga0207661_10023015 | |||
| 2109 | Ga0207661_10041205 | |||
| 2110 | Ga0207661_10045707 | |||
| 2111 | Ga0207661_10141524 | |||
| 2112 | Ga0207661_10196770 | |||
| 2113 | Ga0207661_10246295 | |||
| 2114 | Ga0207661_10281927 | |||
| 2115 | Ga0207661_10321082 | |||
| 2116 | Ga0207661_10880165 | |||
| 2117 | Ga0207661_10968823 | |||
| 2118 | Ga0207679_10000495 | |||
| 2119 | Ga0207679_10000933 | |||
| 2120 | Ga0207679_10004713 | |||
| 2121 | Ga0207679_10006151 | |||
| 2122 | Ga0207679_10008786 | |||
| 2123 | Ga0207679_10013514 | |||
| 2124 | Ga0207679_10020637 | |||
| 2125 | Ga0207679_10025821 | |||
| 2126 | Ga0207679_10047458 | |||
| 2127 | Ga0207679_10075455 | |||
| 2128 | Ga0207679_10090659 | |||
| 2129 | Ga0207679_10118922 | |||
| 2130 | Ga0207679_10351856 | |||
| 2131 | Ga0207679_10595702 | |||
| 2132 | Ga0207679_10665713 | |||
| 2133 | Ga0207667_10013718 | |||
| 2134 | Ga0207667_10025121 | |||
| 2135 | Ga0207667_10079152 | |||
| 2136 | Ga0207667_10148571 | |||
| 2137 | Ga0207667_10422377 | |||
| 2138 | Ga0207667_10497074 | |||
| 2139 | Ga0207667_11016419 | |||
| 2140 | Ga0207651_10010698 | |||
| 2141 | Ga0207651_10014237 | |||
| 2142 | Ga0207651_10059865 | |||
| 2143 | Ga0207651_10288547 | |||
| 2144 | Ga0207651_10419632 | |||
| 2145 | Ga0207651_10569247 | |||
| 2146 | Ga0207712_10000077 | |||
| 2147 | Ga0207712_10001289 | |||
| 2148 | Ga0207712_10015530 | |||
| 2149 | Ga0207668_10000854 | |||
| 2150 | Ga0207668_10010653 | |||
| 2151 | Ga0207668_10013896 | |||
| 2152 | Ga0207668_10017002 | |||
| 2153 | Ga0207668_10176875 | |||
| 2154 | Ga0207668_10456120 | |||
| 2155 | Ga0207640_10003157 | |||
| 2156 | Ga0207640_10011619 | |||
| 2157 | Ga0207640_10046676 | |||
| 2158 | Ga0207640_10060188 | |||
| 2159 | Ga0207640_10613000 | |||
| 2160 | Ga0207640_10620310 | |||
| 2161 | Ga0207640_10732514 | |||
| 2162 | Ga0207640_11284802 | |||
| 2163 | Ga0207658_10074901 | |||
| 2164 | Ga0207658_10114140 | |||
| 2165 | Ga0207658_10420483 | |||
| 2166 | Ga0207658_10530702 | |||
| 2167 | Ga0207658_10889672 | |||
| 2168 | Ga0207658_11348643 | |||
| 2169 | Ga0207677_10029032 | |||
| 2170 | Ga0207677_10058195 | |||
| 2171 | Ga0207677_10574266 | |||
| 2172 | Ga0207677_10855391 | |||
| 2173 | Ga0207703_10044662 | |||
| 2174 | Ga0207703_10089201 | |||
| 2175 | Ga0207703_11029095 | |||
| 2176 | Ga0207703_11257938 | |||
| 2177 | Ga0207703_11322869 | |||
| 2178 | Ga0207639_10044293 | |||
| 2179 | Ga0207639_10090987 | |||
| 2180 | Ga0207639_10649134 | |||
| 2181 | Ga0207639_10766421 | |||
| 2182 | Ga0207639_10772603 | |||
| 2183 | Ga0207639_11046137 | |||
| 2184 | Ga0207639_11122195 | |||
| 2185 | Ga0207639_11351809 | |||
| 2186 | Ga0207678_10034261 | |||
| 2187 | Ga0207678_10094700 | |||
| 2188 | Ga0207678_10171108 | |||
| 2189 | Ga0207678_10206797 | |||
| 2190 | Ga0207678_10515075 | |||
| 2191 | Ga0207678_10964470 | |||
| 2192 | Ga0207708_10171441 | |||
| 2193 | Ga0207708_10199955 | |||
| 2194 | Ga0207708_10475156 | |||
| 2195 | Ga0207702_10004820 | |||
| 2196 | Ga0207702_10100136 | |||
| 2197 | Ga0207702_10241965 | |||
| 2198 | Ga0207702_10341592 | |||
| 2199 | Ga0207702_10502654 | |||
| 2200 | Ga0207702_10724318 | |||
| 2201 | Ga0207702_11597414 | |||
| 2202 | Ga0207641_10028323 | |||
| 2203 | Ga0207641_10057619 | |||
| 2204 | Ga0207641_10466140 | |||
| 2205 | Ga0207648_10001896 | |||
| 2206 | Ga0207648_10032607 | |||
| 2207 | Ga0207648_10112401 | |||
| 2208 | Ga0207648_10127779 | |||
| 2209 | Ga0207648_10373675 | |||
| 2210 | Ga0207676_10022236 | |||
| 2211 | Ga0207676_10028619 | |||
| 2212 | Ga0207676_10157175 | |||
| 2213 | Ga0207676_10190084 | |||
| 2214 | Ga0207676_10216414 | |||
| 2215 | Ga0207676_10354752 | |||
| 2216 | Ga0207674_10000033 | |||
| 2217 | Ga0207674_10000930 | |||
| 2218 | Ga0207674_10006057 | |||
| 2219 | Ga0207674_10010997 | |||
| 2220 | Ga0207674_10021676 | |||
| 2221 | Ga0207674_10042082 | |||
| 2222 | Ga0207674_10104445 | |||
| 2223 | Ga0207674_10617000 | |||
| 2224 | Ga0207675_100000132 | |||
| 2225 | Ga0207675_100008276 | |||
| 2226 | Ga0207675_100210822 | |||
| 2227 | Ga0207675_101111574 | |||
| 2228 | Ga0207683_10262036 | |||
| 2229 | Ga0207683_10382147 | |||
| 2230 | Ga0207683_10578073 | |||
| 2231 | Ga0207698_10001204 | |||
| 2232 | Ga0207698_10001894 | |||
| 2233 | Ga0207698_10024783 | |||
| 2234 | Ga0207698_10083559 | |||
| 2235 | Ga0207698_10146774 | |||
| 2236 | Ga0207698_10167006 | |||
| 2237 | Ga0207698_10219096 | |||
| 2238 | Ga0207698_10404781 | |||
| 2239 | Ga0207698_10754892 | |||
| 2240 | Ga0207698_10798463 | |||
| 2241 | Ga0207428_10161850 | |||
| 2242 | Ga0207428_10227859 | |||
| 2243 | Ga0207428_10355391 | |||
| 2244 | Ga0268266_10038170 | |||
| 2245 | Ga0268266_10591064 | |||
| 2246 | Ga0268266_10862515 | |||
| 2247 | Ga0268265_10000974 | |||
| 2248 | Ga0268265_10029181 | |||
| 2249 | Ga0268265_10108036 | |||
| 2250 | Ga0268265_10279159 | |||
| 2251 | Ga0268264_10039701 | |||
| 2252 | Ga0268264_10154809 | |||
| 2253 | Ga0268264_10243393 | |||
| 2254 | Ga0268264_10513257 | |||
| 2255 | Ga0268264_10548680 | |||
| 2256 | Ga0268264_10720233 | |||
| 2257 | Ga0265332_10001283 | |||
| 2258 | Ga0265327_10009209 | |||
| 2259 | Ga0307408_100000585 | |||
| 2260 | Ga0307408_100008968 | |||
| 2261 | Ga0307408_100016391 | |||
| 2262 | Ga0307408_100075110 | |||
| 2263 | Ga0307408_100632469 | |||
| 2264 | Ga0265314_10004770 | |||
| 2265 | Ga0307405_10005707 | |||
| 2266 | Ga0307405_10010597 | |||
| 2267 | Ga0307405_10024571 | |||
| 2268 | Ga0307405_10028360 | |||
| 2269 | Ga0307405_10113621 | |||
| 2270 | Ga0307405_10411685 | |||
| 2271 | Ga0307405_10551063 | |||
| 2272 | Ga0307413_10000973 | |||
| 2273 | Ga0307413_10003576 | |||
| 2274 | Ga0307413_10004590 | |||
| 2275 | Ga0307413_10015188 | |||
| 2276 | Ga0307413_10022620 | |||
| 2277 | Ga0307413_10048993 | |||
| 2278 | Ga0307413_10454046 | |||
| 2279 | Ga0307410_10000932 | |||
| 2280 | Ga0307410_10002010 | |||
| 2281 | Ga0307410_10002256 | |||
| 2282 | Ga0307410_10040580 | |||
| 2283 | Ga0307410_10282243 | |||
| 2284 | Ga0307410_11031805 | |||
| 2285 | Ga0307406_10000378 | |||
| 2286 | Ga0307406_10002903 | |||
| 2287 | Ga0307406_10021111 | |||
| 2288 | Ga0307406_10035469 | |||
| 2289 | Ga0307406_10042016 | |||
| 2290 | Ga0307406_10044747 | |||
| 2291 | Ga0307406_10150185 | |||
| 2292 | Ga0307406_10182781 | |||
| 2293 | Ga0307406_10257209 | |||
| 2294 | Ga0307406_10317313 | |||
| 2295 | Ga0307406_10371941 | |||
| 2296 | Ga0307406_10596606 | |||
| 2297 | Ga0307407_10001021 | |||
| 2298 | Ga0307407_10016941 | |||
| 2299 | Ga0307407_10030830 | |||
| 2300 | Ga0307407_10060752 | |||
| 2301 | Ga0307407_10098482 | |||
| 2302 | Ga0307407_10140189 | |||
| 2303 | Ga0307407_10326944 | |||
| 2304 | Ga0307407_10413451 | |||
| 2305 | Ga0307407_10493353 | |||
| 2306 | Ga0307407_10537388 | |||
| 2307 | Ga0307412_10003542 | |||
| 2308 | Ga0307412_10071987 | |||
| 2309 | Ga0307412_10309503 | |||
| 2310 | Ga0307412_10333562 | |||
| 2311 | Ga0307409_100008233 | |||
| 2312 | Ga0307409_100014039 | |||
| 2313 | Ga0307409_100034581 | |||
| 2314 | Ga0307409_100080622 | |||
| 2315 | Ga0307409_100104195 | |||
| 2316 | Ga0307409_100179860 | |||
| 2317 | Ga0307409_100383716 | |||
| 2318 | Ga0307409_100750950 | |||
| 2319 | Ga0307409_100771113 | |||
| 2320 | Ga0307416_100000517 | |||
| 2321 | Ga0307416_100002050 | |||
| 2322 | Ga0307416_100025168 | |||
| 2323 | Ga0307416_100071783 | |||
| 2324 | Ga0307416_100107271 | |||
| 2325 | Ga0307416_100113394 | |||
| 2326 | Ga0307416_100166234 | |||
| 2327 | Ga0307416_100196118 | |||
| 2328 | Ga0307416_100283996 | |||
| 2329 | Ga0307416_100306759 | |||
| 2330 | Ga0307416_100538475 | |||
| 2331 | Ga0307416_101280972 | |||
| 2332 | Ga0307416_101312090 | |||
| 2333 | Ga0307416_101718322 | |||
| 2334 | Ga0307414_10003177 | |||
| 2335 | Ga0307414_10018140 | |||
| 2336 | Ga0307414_10019823 | |||
| 2337 | Ga0307414_10193654 | |||
| 2338 | Ga0307411_10000766 | |||
| 2339 | Ga0307411_10011921 | |||
| 2340 | Ga0307411_10012145 | |||
| 2341 | Ga0307411_10036298 | |||
| 2342 | Ga0307411_10041258 | |||
| 2343 | Ga0307411_10069683 | |||
| 2344 | Ga0307411_10684707 | |||
| 2345 | Ga0307411_11059660 | |||
| 2346 | Ga0307415_100006818 | |||
| 2347 | Ga0307415_100012511 | |||
| 2348 | Ga0307415_100012924 | |||
| 2349 | Ga0307415_100025095 | |||
| 2350 | Ga0307415_100089736 | |||
| 2351 | Ga0307415_100420201 | |||
| 2352 | Ga0307415_100529906 | |||
| 2353 | Ga0307415_101181019 | |||
| 2354 | Ga0373939_0216230 | |||
| 2355 | Ga0373960_0056383 | |||
| 2356 | Ga0373962_0059918 | |||
| 2357 | Ga0373931_0004142 | |||
| 2358 | Ga0373927_0452735 | |||
| 2359 | Ga0373933_0176136 | |||
| 2360 | Ga0373947_0957921 | |||
| 2361 | Ga0373937_0037818 | |||
| 2362 | Ga0373937_0059406 | |||
| 2363 | Ga0373937_0136314 | |||
| 2364 | Ga0373937_0343959 | |||
| 2365 | Ga0373937_0870481 | |||
| 2366 | Ga0373925_0684797 | |||
| 2367 | Ga0395899_0010801 | |||
| 2368 | Ga0395900_0051538 | |||
| 2369 | Ga0395898_0289746 | |||
| 2370 | Ga0395905_0010794 | |||
| 2371 | Ga0395905_0317285 | |||
| 2372 | Ga0395901_0005925 | |||
| 2373 | Ga0395901_0621789 | |||
| 2374 | Ga0436365_0326765 | |||
| 2375 | Ga0450894_041460 | |||
| 2376 | Ga0450896_053153 | |||
| 2377 | Ga0451577_0000001 | |||
| 2378 | Ga0451577_0000228 | |||
| 2379 | Ga0451577_0096522 | |||
| 2380 | Ga0451577_0334906 | |||
| 2381 | Ga0451577_0359077 | |||
| 2382 | Ga0451577_0402492 | |||
| 2383 | Ga0466961_0239714 | |||
| 2384 | Ga0453684_0000351 | |||
| 2385 | Ga0453684_0061429 | |||
| 2386 | Ga0453684_0207900 | |||
| 2387 | Ga0453684_0209602 | |||
| 2388 | Ga0453684_1283340 | |||
| 2389 | Ga0466957_0114757 | |||
| 2390 | Ga0466957_0232141 | |||
| 2391 | Ga0451576_0092850 | |||
| 2392 | Ga0451576_0171993 | |||
| 2393 | Ga0451576_0184224 | |||
| 2394 | Ga0451576_1261339 | |||
| 2395 | Ga0466958_0033283 | |||
| 2396 | Ga0466958_0424255 | |||
| 2397 | Ga0466967_0053158 | |||
| 2398 | Ga0466967_0566431 | |||
| 2399 | Ga0495592_0099139 | |||
| 2400 | Ga0495603_0014068 | |||
| 2401 | Ga0495603_0157744 | |||
| 2402 | Ga0495629_0092351 | |||
| 2403 | Ga0495651_0064553 | |||
| 2404 | Ga0495653_0147123 | |||
| 2405 | Ga0495582_0025392 | |||
| 2406 | Ga0495639_0028444 | |||
| 2407 | Ga0495662_0050440 | |||
| 2408 | Ga0495664_0067932 | |||
| 2409 | Ga0495584_0189584 | |||
| 2410 | Ga0495594_0030057 | |||
| 2411 | Ga0495594_0064521 | |||
| 2412 | Ga0495594_0337247 | |||
| 2413 | Ga0495608_0033359 | |||
| 2414 | Ga0495608_0446087 | |||
| 2415 | Ga0495628_0007851 | |||
| 2416 | Ga0495628_0060773 | |||
| 2417 | Ga0495628_0250545 | |||
| 2418 | Ga0495630_0003698 | |||
| 2419 | Ga0495630_0010563 | |||
| 2420 | Ga0495663_0030215 | |||
| 2421 | Ga0495652_0012716 | |||
| 2422 | Ga0495665_0010905 | |||
| 2423 | Ga0495665_0047343 | |||
| 2424 | Ga0495640_0242729 | |||
| 2425 | Ga0495586_0009209 | |||
| 2426 | Ga0495587_0043965 | |||
| 2427 | Ga0495587_0087288 | |||
| 2428 | Ga0495587_0116928 | |||
| 2429 | Ga0495587_0152256 | |||
| 2430 | Ga0495587_0274525 | |||
| 2431 | Ga0495598_0219793 | |||
| 2432 | Ga0495645_0018552 | |||
| 2433 | Ga0495645_0263399 | |||
| 2434 | Ga0495667_0025865 | |||
| 2435 | Ga0495667_0083958 | |||
| 2436 | Ga0495667_0191905 | |||
| 2437 | Ga0495667_0467793 | |||
| 2438 | Ga0495634_0009995 | |||
| 2439 | Ga0495634_0319647 | |||
| 2440 | Ga0495634_0433954 | |||
| 2441 | Ga0495635_0039454 | |||
| 2442 | Ga0495635_0232770 | |||
| 2443 | Ga0495599_0005132 | |||
| 2444 | Ga0495623_0049749 | |||
| 2445 | Ga0495623_0226351 | |||
| 2446 | Ga0495623_0233126 | |||
| 2447 | Ga0495646_0010163 | |||
| 2448 | Ga0495646_0011244 | |||
| 2449 | Ga0495658_0193918 | |||
| 2450 | Ga0495669_0076258 | |||
| 2451 | Ga0495613_0015526 | |||
| 2452 | Ga0495613_0024715 | |||
| 2453 | Ga0495613_0122559 | |||
| 2454 | Ga0495624_0280584 | |||
| 2455 | Ga0495600_0129763 | |||
| 2456 | Ga0495600_0430784 | |||
| 2457 | Ga0495581_0019625 | |||
| 2458 | Ga0495581_0057567 | |||
| 2459 | Ga0495581_0088936 | |||
| 2460 | Ga0495581_0636010 | |||
| 2461 | Ga0495604_0039479 | |||
| 2462 | Ga0495604_0403240 | |||
| 2463 | Ga0495636_0066095 | |||
| 2464 | Ga0495674_0008111 | |||
| 2465 | Ga0495674_0081523 | |||
| 2466 | Ga0495674_0930627 | |||
| 2467 | Ga0495672_0001689 | |||
| 2468 | Ga0495676_0361551 | |||
| 2469 | Ga0495680_0004863 | |||
| 2470 | Ga0495680_0114036 | |||
| 2471 | Ga0495675_0008395 | |||
| 2472 | Ga0495675_0058917 | |||
| 2473 | Ga0495675_0064036 | |||
| 2474 | Ga0495675_0266143 | |||
| 2475 | Ga0495684_0000527 | |||
| 2476 | Ga0495684_0014003 | |||
| 2477 | Ga0495602_0020001 | |||
| 2478 | Ga0495602_0086880 | |||
| 2479 | Ga0495602_0144112 | |||
| 2480 | Ga0496104_0036877 | |||
| 2481 | Ga0496107_0291627 | |||
| 2482 | Ga0496108_0008584 | |||
| 2483 | Ga0496108_0138744 | |||
| 2484 | Ga0496108_0229412 | |||
| 2485 | Ga0496109_0045219 | |||
| 2486 | Ga0496109_0705680 | |||
| 2487 | Ga0496110_0339244 | |||
| 2488 | Ga0496112_0000397 | |||
| 2489 | Ga0496112_0000936 | |||
| 2490 | Ga0496112_0043352 | |||
| 2491 | Ga0496113_0011765 | |||
| 2492 | Ga0496115_0032734 | |||
| 2493 | Ga0501299_121071 | |||
| 2494 | Ga0501033_0111675 | |||
| 2495 | Ga0501033_0605845 | |||
| 2496 | Ga0501034_0106129 | |||
| 2497 | Ga0501036_0165673 | |||
| 2498 | Ga0501040_0060458 | |||
| 2499 | Ga0501042_0569592 | |||
| 2500 | Ga0501043_0124865 | |||
| 2501 | Ga0501046_0100530 | |||
| 2502 | Ga0501046_0158754 | |||
| 2503 | Ga0501046_0277210 | |||
| 2504 | Ga0501047_0035252 | |||
| 2505 | Ga0501070_0013394 | |||
| 2506 | Ga0501071_0182627 | |||
| 2507 | Ga0501072_0119347 | |||
| 2508 | Ga0501075_0042382 | |||
| 2509 | Ga0501076_0593046 | |||
| 2510 | Ga0501227_032560 | |||
| 2511 | Ga0501257_189572 | |||
| 2512 | Ga0501079_0015369 | |||
| 2513 | Ga0501079_0540010 | |||
| 2514 | Ga0501080_0051019 | |||
| 2515 | Ga0501080_0111289 | |||
| 2516 | Ga0501080_0598712 | |||
| 2517 | Ga0501081_0225642 | |||
| 2518 | Ga0501035_0047376 | |||
| 2519 | Ga0501035_0963376 | |||
| 2520 | Ga0501044_0424225 | |||
| 2521 | Ga0501044_0780204 | |||
| 2522 | Ga0501044_1152884 | |||
| 2523 | Ga0501045_0163242 | |||
| 2524 | Ga0501045_0569136 | |||
| 2525 | nmdc:mga05p37_66004_c1 | |||
| 2526 | nmdc:mga05p37_898529_c1 | |||
| 2527 | nmdc:mga09592_182827_c1 | |||
| 2528 | nmdc:mga09592_240985_c1 | |||
| 2529 | nmdc:mga09592_392702_c1 | |||
| 2530 | nmdc:mga09592_85301_c1 | |||
| 2531 | nmdc:mga0qj67_74501_c1 | |||
| 2532 | nmdc:mga06r32_153556_c1 | |||
| 2533 | nmdc:mga06r32_16610_c1 | |||
| 2534 | nmdc:mga06r32_443296_c1 | |||
| 2535 | nmdc:mga08y16_38267_c1 | |||
| 2536 | nmdc:mga0n895_32332_c1 | |||
| 2537 | nmdc:mga0n895_78265_c1 | |||
| 2538 | nmdc:mga0a205_999_c1 | |||
| 2539 | Ga0495595_0139406 | |||
| 2540 | Ga0495619_0519440 | |||
| 2541 | Ga0500596_006466 | |||
| 2542 | Ga0501084_0522324 | |||
| 2543 | Ga0501084_1019482 | |||
| 2544 | Ga0590071_010887 | |||
| 2545 | Ga0590075_064035 | |||
| 2546 | Ga0501082_0070426 | |||
| 2547 | Ga0501082_0200113 | |||
| 2548 | Ga0530510_0236510 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r4e-assembly1.cif.gz_A | structure of glnr-dna complex | 0.8614 | 46 | 101 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.7421 | 14 | 100 |
| 5i44-assembly4.cif.gz_G-2 | structure of raca-dna complex; p21 form | 0.6977 | 25 | 95 |
| 5i44-assembly4.cif.gz_F-2 | structure of raca-dna complex; p21 form | 0.6949 | 25 | 94 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.6749 | 14 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4r4eA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8614 | 46 | 101 | 1.10.1660.10 |
| af_P9WME7_10_96_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8375 | 46 | 103 | 1.10.1660.10 |
| 3d6zA01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.7889 | 46 | 100 | 1.10.1660.10 |
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.7214 | 25 | 98 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.7043 | 28 | 102 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7NVI1-F1-model_v4 | HTH merR-type domain-containing protein | 0.9384 | 1 | 118 |
GO:0003677
GO:0006355 |
| AF-A0A838NN64-F1-model_v4 | MerR family transcriptional regulator | 0.935 | 2 | 119 |
GO:0003677
GO:0006355 |
| AF-A0A5B1BPM0-F1-model_v4 | MerR family transcriptional regulator | 0.8873 | 14 | 100 |
GO:0003677
GO:0006355 |
| AF-A0A7K1IC29-F1-model_v4 | deleted | 0.8814 | 17 | 101 |
|
| AF-A0A419HF95-F1-model_v4 | MerR family transcriptional regulator | 0.8812 | 16 | 100 |
GO:0003677
GO:0003700 |