F492439

General Info

Members Datasets Scaffolds Average Seq Length
1273 369 2542 89

Family's Representative Sequence

Representative Sequence 3300035114|Ga0373939_0274533|Ga0373939_0274533_338_646
Length 102
Sequence MAIHVNSGLEETMSEEQGCTHITAVTAIKHAKRHECDECVKIGSHWVHLRTCQNCNATLCCDNSPNRHATKHARASGHPVIASAEPGERWLYCYPDDAFAEY

Samples

Sample ID Description Type Environment
1 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
128 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
261 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
262 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
263 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
264 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
345 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 3.38
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 21.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373939_0274533 3300035114 Unclassified 664
2 SwRhRL2b_contig_1325478 2162886007 Bacteria 1227
3 CNBas_1011915 3300000531 Bacteria 539
4 JGI24749J21850_1062432 3300002076 Unclassified 568
5 JGI25405J52794_10000675 3300003911 Bacteria 5168
6 Ga0065714_10135982 3300005288 Bacteria 1209
7 Ga0065704_10000972 3300005289 Bacteria 12040
8 Ga0065704_10550004 3300005289 Unclassified 624
9 Ga0065712_10134113 3300005290 Unclassified 1516
10 Ga0065712_10208240 3300005290 Bacteria 1082
11 Ga0065712_10273787 3300005290 Bacteria 910
12 Ga0065712_10273893 3300005290 Bacteria 910
13 Ga0065712_10324160 3300005290 Bacteria 821
14 Ga0065712_10694230 3300005290 Bacteria 549
15 Ga0065712_10762263 3300005290 Bacteria 525
16 Ga0065715_10021739 3300005293 Bacteria 2218
17 Ga0065715_10161413 3300005293 Bacteria 1626
18 Ga0065715_10226471 3300005293 Unclassified 1250
19 Ga0065715_10376988 3300005293 Bacteria 913
20 Ga0065715_10405729 3300005293 Bacteria 876
21 Ga0065715_10466125 3300005293 Bacteria 811
22 Ga0065715_10767231 3300005293 Bacteria 623
23 Ga0065715_10784242 3300005293 Unclassified 616
24 Ga0065707_10036803 3300005295 Bacteria 1177
25 Ga0065707_10058476 3300005295 Bacteria 722
26 Ga0065707_10573396 3300005295 Unclassified 706
27 Ga0065707_10630914 3300005295 Bacteria 673
28 Ga0070658_10972178 3300005327 Bacteria 738
29 Ga0070676_10043821 3300005328 Bacteria 2601
30 Ga0070676_10276829 3300005328 Unclassified 1129
31 Ga0070676_10458558 3300005328 Unclassified 898
32 Ga0070676_10476347 3300005328 Bacteria 882
33 Ga0070676_10566825 3300005328 Bacteria 815
34 Ga0070676_10622108 3300005328 Bacteria 781
35 Ga0070683_100014959 3300005329 Bacteria 6805
36 Ga0070683_100231225 3300005329 Bacteria 1758
37 Ga0070690_100073226 3300005330 Bacteria 2229
38 Ga0070690_100281008 3300005330 Bacteria 1187
39 Ga0070690_100612220 3300005330 Unclassified 828
40 Ga0070690_101626077 3300005330 Unclassified 524
41 Ga0070670_100002777 3300005331 Bacteria 14468
42 Ga0070670_100021903 3300005331 Bacteria 5498
43 Ga0070670_100618355 3300005331 Unclassified 970
44 Ga0070670_100858453 3300005331 Bacteria 821
45 Ga0070670_100916094 3300005331 Unclassified 795
46 Ga0070670_100963074 3300005331 Bacteria 775
47 Ga0070670_100963262 3300005331 Bacteria 775
48 Ga0070670_101392119 3300005331 Bacteria 643
49 Ga0070677_10003834 3300005333 Bacteria 4871
50 Ga0070677_10210968 3300005333 Unclassified 943
51 Ga0068869_100422262 3300005334 Bacteria 1100
52 Ga0068869_102146078 3300005334 Unclassified 502
53 Ga0070666_10004055 3300005335 Bacteria 8891
54 Ga0070666_10029261 3300005335 Bacteria 3620
55 Ga0070666_10333829 3300005335 Bacteria 1083
56 Ga0070666_10671639 3300005335 Unclassified 759
57 Ga0070680_100238725 3300005336 Bacteria 1536
58 Ga0070682_100348184 3300005337 Unclassified 1104
59 Ga0068868_100012517 3300005338 Bacteria 6204
60 Ga0068868_100685926 3300005338 Bacteria 915
61 Ga0068868_101038862 3300005338 Bacteria 751
62 Ga0068868_101179454 3300005338 Bacteria 707
63 Ga0068868_101456554 3300005338 Bacteria 640
64 Ga0070660_101001206 3300005339 Unclassified 706
65 Ga0070689_100036807 3300005340 Bacteria 3742
66 Ga0070689_100071852 3300005340 Bacteria 2704
67 Ga0070689_100264772 3300005340 Unclassified 1422
68 Ga0070689_100373121 3300005340 Unclassified 1201
69 Ga0070689_100716846 3300005340 Bacteria 874
70 Ga0070691_10166979 3300005341 Bacteria 1138
71 Ga0070691_10197554 3300005341 Bacteria 1055
72 Ga0070691_10335974 3300005341 Bacteria 835
73 Ga0070687_100004985 3300005343 Bacteria 5344
74 Ga0070687_100461147 3300005343 Bacteria 847
75 Ga0070687_100564912 3300005343 Bacteria 776
76 Ga0070661_100827105 3300005344 Bacteria 761
77 Ga0070661_101093080 3300005344 Bacteria 664
78 Ga0070692_10003691 3300005345 Bacteria 6271
79 Ga0070668_100032074 3300005347 Bacteria 3998
80 Ga0070668_100184452 3300005347 Bacteria 1706
81 Ga0070668_100199599 3300005347 Bacteria 1642
82 Ga0070668_100414385 3300005347 Bacteria 1152
83 Ga0070668_100535253 3300005347 Bacteria 1018
84 Ga0070668_100880305 3300005347 Unclassified 799
85 Ga0070668_101568540 3300005347 Unclassified 603
86 Ga0070669_100000073 3300005353 Bacteria 99085
87 Ga0070669_100012143 3300005353 Bacteria 6114
88 Ga0070669_100057648 3300005353 Unclassified 2850
89 Ga0070669_100093374 3300005353 Bacteria 2259
90 Ga0070669_100197216 3300005353 Bacteria 1582
91 Ga0070669_100202377 3300005353 Bacteria 1563
92 Ga0070669_100829133 3300005353 Unclassified 787
93 Ga0070669_101016939 3300005353 Unclassified 711
94 Ga0070669_101598192 3300005353 Bacteria 567
95 Ga0070669_101814899 3300005353 Unclassified 532
96 Ga0070675_100002536 3300005354 Bacteria 13656
97 Ga0070675_100032122 3300005354 Bacteria 4246
98 Ga0070675_100036567 3300005354 Bacteria 3996
99 Ga0070675_100052248 3300005354 Bacteria 3359
100 Ga0070675_100061543 3300005354 Bacteria 3099
101 Ga0070675_100104551 3300005354 Bacteria 2389
102 Ga0070675_100140989 3300005354 Bacteria 2060
103 Ga0070675_100598522 3300005354 Bacteria 1000
104 Ga0070675_100776932 3300005354 Bacteria 875
105 Ga0070675_100989895 3300005354 Bacteria 772
106 Ga0070675_101585397 3300005354 Bacteria 604
107 Ga0070675_101813530 3300005354 Bacteria 563
108 Ga0070671_100115860 3300005355 Bacteria 2253
109 Ga0070671_100191742 3300005355 Bacteria 1732
110 Ga0070671_100208357 3300005355 Bacteria 1658
111 Ga0070671_100483600 3300005355 Bacteria 1064
112 Ga0070671_101020190 3300005355 Bacteria 725
113 Ga0070674_100000065 3300005356 Bacteria 47649
114 Ga0070674_100101828 3300005356 Bacteria 2094
115 Ga0070674_100175566 3300005356 Bacteria 1637
116 Ga0070674_100193792 3300005356 Bacteria 1565
117 Ga0070674_100204726 3300005356 Bacteria 1526
118 Ga0070674_100555396 3300005356 Bacteria 964
119 Ga0070674_100726616 3300005356 Bacteria 851
120 Ga0070674_101240070 3300005356 Unclassified 663
121 Ga0070674_101341459 3300005356 Bacteria 639
122 Ga0070674_101989181 3300005356 Unclassified 529
123 Ga0070673_100011356 3300005364 Bacteria 6077
124 Ga0070673_100114329 3300005364 Bacteria 2242
125 Ga0070673_100147768 3300005364 Bacteria 1988
126 Ga0070673_100465160 3300005364 Bacteria 1139
127 Ga0070673_100477795 3300005364 Bacteria 1124
128 Ga0070673_100601574 3300005364 Unclassified 1003
129 Ga0070673_100996509 3300005364 Unclassified 780
130 Ga0070673_101449720 3300005364 Bacteria 647
131 Ga0070688_100003519 3300005365 Bacteria 8070
132 Ga0070688_100011229 3300005365 Unclassified 4973
133 Ga0070688_100080273 3300005365 Bacteria 2110
134 Ga0070688_100155141 3300005365 Bacteria 1568
135 Ga0070688_100745840 3300005365 Bacteria 762
136 Ga0070688_100769161 3300005365 Bacteria 751
137 Ga0070659_100784942 3300005366 Bacteria 828
138 Ga0070659_100839706 3300005366 Unclassified 800
139 Ga0070659_101397707 3300005366 Bacteria 622
140 Ga0070667_100189187 3300005367 Bacteria 1823
141 Ga0070667_100305584 3300005367 Bacteria 1433
142 Ga0070667_100366381 3300005367 Bacteria 1307
143 Ga0070667_100442406 3300005367 Bacteria 1187
144 Ga0070703_10006146 3300005406 Bacteria 3360
145 Ga0070703_10078829 3300005406 Bacteria 1117
146 Ga0070709_10000039 3300005434 Bacteria 108771
147 Ga0070709_11764671 3300005434 Bacteria 506
148 Ga0070714_100282555 3300005435 Bacteria 1542
149 Ga0070713_100107328 3300005436 Bacteria 2429
150 Ga0070713_100134864 3300005436 Bacteria 2181
151 Ga0070713_100403430 3300005436 Bacteria 1277
152 Ga0070713_101479261 3300005436 Unclassified 659
153 Ga0070710_10238947 3300005437 Bacteria 1163
154 Ga0070701_10062097 3300005438 Bacteria 1972
155 Ga0070701_10080778 3300005438 Unclassified 1759
156 Ga0070701_10347456 3300005438 Unclassified 926
157 Ga0070701_10658145 3300005438 Bacteria 700
158 Ga0070701_11243686 3300005438 Unclassified 530
159 Ga0070711_100000175 3300005439 Bacteria 34287
160 Ga0070711_100688830 3300005439 Archaea 860
161 Ga0070711_100994459 3300005439 Bacteria 719
162 Ga0070711_101060289 3300005439 Bacteria 697
163 Ga0070711_101145923 3300005439 Unclassified 671
164 Ga0070705_100003759 3300005440 Bacteria 7430
165 Ga0070705_100013476 3300005440 Bacteria 4183
166 Ga0070705_100041961 3300005440 Bacteria 2612
167 Ga0070705_101254845 3300005440 Bacteria 612
168 Ga0070705_101440197 3300005440 Unclassified 575
169 Ga0070700_100043909 3300005441 Bacteria 2751
170 Ga0070700_100082136 3300005441 Bacteria 2083
171 Ga0070700_100462379 3300005441 Bacteria 968
172 Ga0070700_100549414 3300005441 Bacteria 897
173 Ga0070700_100723462 3300005441 Unclassified 794
174 Ga0070694_100005274 3300005444 Bacteria 7814
175 Ga0070694_100027057 3300005444 Bacteria 3722
176 Ga0070694_100040687 3300005444 Bacteria 3098
177 Ga0070694_100051015 3300005444 Bacteria 2791
178 Ga0070694_100056768 3300005444 Bacteria 2660
179 Ga0070694_100173174 3300005444 Bacteria 1591
180 Ga0070708_100011689 3300005445 Bacteria 7146
181 Ga0070708_100047851 3300005445 Bacteria 3778
182 Ga0070708_100050957 3300005445 Bacteria 3667
183 Ga0070708_100122591 3300005445 Archaea 2399
184 Ga0070708_100273015 3300005445 Unclassified 1590
185 Ga0070708_100296901 3300005445 Bacteria 1521
186 Ga0070708_100412850 3300005445 Bacteria 1273
187 Ga0070708_100661673 3300005445 Bacteria 984
188 Ga0070708_100761277 3300005445 Bacteria 911
189 Ga0070708_101657300 3300005445 Unclassified 595
190 Ga0070708_101763369 3300005445 Bacteria 575
191 Ga0070708_102039187 3300005445 Bacteria 531
192 Ga0070663_100136201 3300005455 Bacteria 1870
193 Ga0070663_101531695 3300005455 Unclassified 593
194 Ga0070663_101609306 3300005455 Unclassified 579
195 Ga0070678_100002433 3300005456 Bacteria 10199
196 Ga0070678_100030091 3300005456 Bacteria 3727
197 Ga0070678_100269284 3300005456 Bacteria 1436
198 Ga0070678_100283554 3300005456 Bacteria 1402
199 Ga0070678_100283852 3300005456 Bacteria 1401
200 Ga0070678_100374122 3300005456 Bacteria 1231
201 Ga0070678_100394034 3300005456 Bacteria 1201
202 Ga0070678_100518589 3300005456 Bacteria 1054
203 Ga0070678_100982814 3300005456 Unclassified 775
204 Ga0070678_101492257 3300005456 Bacteria 633
205 Ga0070678_101966483 3300005456 Bacteria 553
206 Ga0070662_100072558 3300005457 Bacteria 2542
207 Ga0070662_100074720 3300005457 Bacteria 2508
208 Ga0070662_100127454 3300005457 Bacteria 1958
209 Ga0070662_100189861 3300005457 Bacteria 1624
210 Ga0070662_100215701 3300005457 Bacteria 1529
211 Ga0070662_101587430 3300005457 Bacteria 565
212 Ga0070681_12022479 3300005458 Unclassified 504
213 Ga0068867_100321954 3300005459 Bacteria 1281
214 Ga0068867_100360422 3300005459 Bacteria 1216
215 Ga0068867_101980292 3300005459 Unclassified 550
216 Ga0068867_102224489 3300005459 Bacteria 520
217 Ga0070685_10140832 3300005466 Unclassified 1518
218 Ga0070685_10373071 3300005466 Bacteria 981
219 Ga0070685_10636640 3300005466 Bacteria 771
220 Ga0070685_10680885 3300005466 Unclassified 748
221 Ga0070685_10731551 3300005466 Bacteria 724
222 Ga0070706_100000015 3300005467 Bacteria 188425
223 Ga0070706_100002614 3300005467 Bacteria 18042
224 Ga0070706_100114283 3300005467 Archaea 2513
225 Ga0070706_100247101 3300005467 Bacteria 1666
226 Ga0070706_100349336 3300005467 Unclassified 1378
227 Ga0070706_100658559 3300005467 Bacteria 972
228 Ga0070706_100709477 3300005467 Unclassified 933
229 Ga0070706_100829080 3300005467 Bacteria 856
230 Ga0070707_100002849 3300005468 Bacteria 16457
231 Ga0070707_100011801 3300005468 Bacteria 8158
232 Ga0070707_100013501 3300005468 Bacteria 7642
233 Ga0070707_100026839 3300005468 Bacteria 5472
234 Ga0070707_100032997 3300005468 Bacteria 4935
235 Ga0070707_100058551 3300005468 Bacteria 3695
236 Ga0070707_100130535 3300005468 Bacteria 2443
237 Ga0070707_100167085 3300005468 Bacteria 2144
238 Ga0070707_100293252 3300005468 Bacteria 1580
239 Ga0070707_100517436 3300005468 Bacteria 1155
240 Ga0070707_100879606 3300005468 Bacteria 860
241 Ga0070707_100940404 3300005468 Bacteria 829
242 Ga0070707_101510391 3300005468 Archaea 638
243 Ga0070698_100010122 3300005471 Bacteria 10070
244 Ga0070698_100021189 3300005471 Bacteria 6811
245 Ga0070698_100117383 3300005471 Bacteria 2623
246 Ga0070698_100263669 3300005471 Bacteria 1655
247 Ga0070698_100461995 3300005471 Archaea 1205
248 Ga0070698_100491862 3300005471 Unclassified 1164
249 Ga0070698_101100228 3300005471 Bacteria 743
250 Ga0070698_101235076 3300005471 Bacteria 697
251 Ga0070698_101800780 3300005471 Unclassified 565
252 Ga0070699_100000608 3300005518 Bacteria 33785
253 Ga0070699_100032222 3300005518 Bacteria 4525
254 Ga0070699_100100672 3300005518 Bacteria 2532
255 Ga0070699_100759929 3300005518 Unclassified 887
256 Ga0070699_100837203 3300005518 Bacteria 842
257 Ga0070699_101926410 3300005518 Bacteria 540
258 Ga0070699_102044924 3300005518 Unclassified 523
259 Ga0070679_100382061 3300005530 Unclassified 1355
260 Ga0070679_100912409 3300005530 Bacteria 822
261 Ga0070684_100025070 3300005535 Bacteria 5008
262 Ga0070684_100080309 3300005535 Unclassified 2885
263 Ga0070684_100091653 3300005535 Bacteria 2704
264 Ga0070684_100499245 3300005535 Bacteria 1127
265 Ga0070684_101614010 3300005535 Unclassified 612
266 Ga0070697_100000055 3300005536 Bacteria 86691
267 Ga0070697_100000211 3300005536 Bacteria 47665
268 Ga0070697_100004761 3300005536 Bacteria 10402
269 Ga0070697_100005118 3300005536 Bacteria 10070
270 Ga0070697_100040555 3300005536 Unclassified 3768
271 Ga0070697_100152218 3300005536 Unclassified 1950
272 Ga0070697_100198417 3300005536 Bacteria 1705
273 Ga0070697_100308299 3300005536 Archaea 1362
274 Ga0070697_100565319 3300005536 Unclassified 998
275 Ga0070697_100717769 3300005536 Unclassified 882
276 Ga0070697_101412971 3300005536 Bacteria 621
277 Ga0070697_101686633 3300005536 Unclassified 567
278 Ga0070697_101926720 3300005536 Unclassified 529
279 Ga0070697_102119551 3300005536 Bacteria 503
280 Ga0070672_100008521 3300005543 Bacteria 7022
281 Ga0070672_100061083 3300005543 Bacteria 2970
282 Ga0070672_100088168 3300005543 Bacteria 2498
283 Ga0070672_100113256 3300005543 Bacteria 2214
284 Ga0070672_100201034 3300005543 Unclassified 1666
285 Ga0070672_100347856 3300005543 Unclassified 1263
286 Ga0070672_100468207 3300005543 Bacteria 1087
287 Ga0070672_100505679 3300005543 Unclassified 1046
288 Ga0070672_100594715 3300005543 Bacteria 963
289 Ga0070672_100715346 3300005543 Unclassified 877
290 Ga0070672_100761488 3300005543 Unclassified 850
291 Ga0070686_100094902 3300005544 Bacteria 2003
292 Ga0070686_100406713 3300005544 Bacteria 1036
293 Ga0070686_101466818 3300005544 Bacteria 574
294 Ga0070695_100009503 3300005545 Bacteria 5792
295 Ga0070695_100059283 3300005545 Bacteria 2477
296 Ga0070695_100082445 3300005545 Bacteria 2129
297 Ga0070695_101177907 3300005545 Bacteria 630
298 Ga0070696_100018324 3300005546 Bacteria 4731
299 Ga0070696_100057483 3300005546 Bacteria 2715
300 Ga0070696_100163355 3300005546 Bacteria 1642
301 Ga0070696_100272468 3300005546 Unclassified 1287
302 Ga0070696_100373022 3300005546 Bacteria 1110
303 Ga0070696_100752481 3300005546 Unclassified 798
304 Ga0070696_101018841 3300005546 Unclassified 692
305 Ga0070693_100036650 3300005547 Bacteria 2729
306 Ga0070693_100082976 3300005547 Bacteria 1915
307 Ga0070693_100291316 3300005547 Bacteria 1097
308 Ga0070693_100880664 3300005547 Unclassified 670
309 Ga0070665_100003269 3300005548 Bacteria 17385
310 Ga0070665_100201149 3300005548 Bacteria 1992
311 Ga0070665_100339620 3300005548 Bacteria 1506
312 Ga0070665_101261834 3300005548 Unclassified 749
313 Ga0070665_101304850 3300005548 Unclassified 736
314 Ga0070665_102497134 3300005548 Unclassified 518
315 Ga0070704_100006221 3300005549 Bacteria 7020
316 Ga0070704_100097781 3300005549 Bacteria 2204
317 Ga0070704_100235312 3300005549 Bacteria 1496
318 Ga0070704_100652902 3300005549 Bacteria 929
319 Ga0070704_100960614 3300005549 Unclassified 771
320 Ga0070704_101329080 3300005549 Unclassified 658
321 Ga0068855_100427414 3300005563 Bacteria 1448
322 Ga0070664_100020404 3300005564 Bacteria 5457
323 Ga0070664_100098132 3300005564 Bacteria 2545
324 Ga0070664_100330400 3300005564 Bacteria 1383
325 Ga0070664_100447357 3300005564 Unclassified 1186
326 Ga0070664_100753775 3300005564 Bacteria 909
327 Ga0070664_100940286 3300005564 Bacteria 811
328 Ga0070664_101245847 3300005564 Bacteria 702
329 Ga0070664_101355953 3300005564 Unclassified 672
330 Ga0068857_100419106 3300005577 Unclassified 1248
331 Ga0068857_101985607 3300005577 Unclassified 570
332 Ga0068854_100047363 3300005578 Bacteria 3063
333 Ga0068854_100480338 3300005578 Bacteria 1043
334 Ga0068854_100749367 3300005578 Unclassified 847
335 Ga0068854_100877793 3300005578 Bacteria 787
336 Ga0068856_101791829 3300005614 Bacteria 626
337 Ga0068856_102166555 3300005614 Bacteria 565
338 Ga0070702_100116715 3300005615 Bacteria 1664
339 Ga0070702_100280316 3300005615 Bacteria 1144
340 Ga0070702_100579709 3300005615 Bacteria 837
341 Ga0070702_100706071 3300005615 Bacteria 769
342 Ga0070702_101473182 3300005615 Bacteria 559
343 Ga0068852_100349675 3300005616 Unclassified 1443
344 Ga0068852_101514198 3300005616 Bacteria 693
345 Ga0068859_100008697 3300005617 Bacteria 10266
346 Ga0068859_100077677 3300005617 Bacteria 3361
347 Ga0068859_100135271 3300005617 Bacteria 2537
348 Ga0068859_100250959 3300005617 Bacteria 1860
349 Ga0068859_100470343 3300005617 Unclassified 1353
350 Ga0068859_100866287 3300005617 Bacteria 989
351 Ga0068859_101357913 3300005617 Bacteria 784
352 Ga0068859_101440450 3300005617 Unclassified 760
353 Ga0068859_102974710 3300005617 Bacteria 518
354 Ga0068864_100001129 3300005618 Bacteria 22318
355 Ga0068864_100017094 3300005618 Bacteria 6047
356 Ga0068864_100127804 3300005618 Unclassified 2279
357 Ga0068864_100178435 3300005618 Bacteria 1940
358 Ga0068864_102226046 3300005618 Unclassified 555
359 Ga0068866_10051453 3300005718 Bacteria 2097
360 Ga0068866_10246658 3300005718 Bacteria 1090
361 Ga0068866_10508886 3300005718 Unclassified 798
362 Ga0068866_10592789 3300005718 Unclassified 747
363 Ga0068866_10923880 3300005718 Unclassified 615
364 Ga0068866_11285429 3300005718 Unclassified 531
365 Ga0068861_100078384 3300005719 Bacteria 2580
366 Ga0068861_100221541 3300005719 Bacteria 1599
367 Ga0068861_100580080 3300005719 Bacteria 1026
368 Ga0068861_100722386 3300005719 Unclassified 928
369 Ga0068851_10066339 3300005834 Bacteria 1859
370 Ga0068851_10425208 3300005834 Bacteria 785
371 Ga0068870_10145491 3300005840 Bacteria 1391
372 Ga0068870_10546788 3300005840 Unclassified 779
373 Ga0068870_10570078 3300005840 Bacteria 765
374 Ga0068870_10792267 3300005840 Unclassified 661
375 Ga0068870_11407240 3300005840 Unclassified 511
376 Ga0068863_100064523 3300005841 Bacteria 3463
377 Ga0068863_100186000 3300005841 Bacteria 1995
378 Ga0068863_100459658 3300005841 Unclassified 1250
379 Ga0068863_100607609 3300005841 Bacteria 1083
380 Ga0068863_100673423 3300005841 Bacteria 1027
381 Ga0068863_100787338 3300005841 Bacteria 948
382 Ga0068863_100904803 3300005841 Unclassified 883
383 Ga0068863_101236951 3300005841 Bacteria 753
384 Ga0068858_100013639 3300005842 Bacteria 7670
385 Ga0068858_100014123 3300005842 Bacteria 7532
386 Ga0068858_100045365 3300005842 Bacteria 4073
387 Ga0068858_100057051 3300005842 Bacteria 3609
388 Ga0068858_100100053 3300005842 Bacteria 2704
389 Ga0068858_100604251 3300005842 Bacteria 1064
390 Ga0068858_101054399 3300005842 Bacteria 797
391 Ga0068858_101084557 3300005842 Unclassified 786
392 Ga0068858_101562209 3300005842 Bacteria 651
393 Ga0068860_100038999 3300005843 Bacteria 4544
394 Ga0068860_100173360 3300005843 Bacteria 2084
395 Ga0068860_100721606 3300005843 Bacteria 1007
396 Ga0068860_101066562 3300005843 Unclassified 827
397 Ga0068860_101389707 3300005843 Unclassified 723
398 Ga0068862_100032713 3300005844 Bacteria 4393
399 Ga0068862_100108737 3300005844 Bacteria 2432
400 Ga0068862_100252855 3300005844 Bacteria 1607
401 Ga0068862_100335902 3300005844 Bacteria 1398
402 Ga0068862_100506845 3300005844 Bacteria 1146
403 Ga0068862_100628591 3300005844 Unclassified 1034
404 Ga0068862_100743176 3300005844 Unclassified 954
405 Ga0068862_101180729 3300005844 Bacteria 763
406 Ga0068862_101461756 3300005844 Unclassified 688
407 Ga0068862_102414069 3300005844 Unclassified 537
408 Ga0081455_10000821 3300005937 Bacteria 39932
409 Ga0081455_10043103 3300005937 Bacteria 3952
410 Ga0081455_10391635 3300005937 Bacteria 967
411 Ga0081539_10050465 3300005985 Bacteria 2354
412 Ga0081539_10055532 3300005985 Bacteria 2202
413 Ga0070717_10016916 3300006028 Bacteria 5663
414 Ga0075365_10009341 3300006038 Bacteria 5628
415 Ga0075365_10738402 3300006038 Bacteria 695
416 Ga0075368_10072111 3300006042 Bacteria 1396
417 Ga0075364_10010576 3300006051 Bacteria 5580
418 Ga0075364_10164151 3300006051 Bacteria 1500
419 Ga0075364_10444393 3300006051 Bacteria 886
420 Ga0075364_10979603 3300006051 Unclassified 575
421 Ga0075432_10148563 3300006058 Bacteria 899
422 Ga0075432_10155754 3300006058 Unclassified 880
423 Ga0070715_10466106 3300006163 Unclassified 716
424 Ga0070716_101092369 3300006173 Bacteria 636
425 Ga0070712_100541878 3300006175 Bacteria 980
426 Ga0075362_10053768 3300006177 Bacteria 1808
427 Ga0075367_10003423 3300006178 Bacteria 7562
428 Ga0075367_10187440 3300006178 Bacteria 1290
429 Ga0075367_10243004 3300006178 Bacteria 1128
430 Ga0075366_10001519 3300006195 Bacteria 11589
431 Ga0075366_10327073 3300006195 Bacteria 939
432 Ga0097621_100073911 3300006237 Bacteria 2823
433 Ga0097621_100205754 3300006237 Bacteria 1710
434 Ga0097621_100378390 3300006237 Bacteria 1264
435 Ga0097621_100822943 3300006237 Bacteria 861
436 Ga0097621_100945964 3300006237 Unclassified 804
437 Ga0097621_101257333 3300006237 Bacteria 698
438 Ga0075370_10158959 3300006353 Bacteria 1326
439 Ga0075370_10838930 3300006353 Bacteria 561
440 Ga0068871_100187765 3300006358 Bacteria 1779
441 Ga0068871_100340699 3300006358 Bacteria 1324
442 Ga0068871_100376844 3300006358 Bacteria 1260
443 Ga0068871_100495748 3300006358 Bacteria 1100
444 Ga0068871_100594232 3300006358 Bacteria 1006
445 Ga0068871_100911344 3300006358 Bacteria 815
446 Ga0075428_100033706 3300006844 Bacteria 5651
447 Ga0075428_100058028 3300006844 Bacteria 4238
448 Ga0075428_100119552 3300006844 Bacteria 2869
449 Ga0075428_100188842 3300006844 Bacteria 2229
450 Ga0075428_100425357 3300006844 Unclassified 1423
451 Ga0075428_100446449 3300006844 Bacteria 1385
452 Ga0075428_100691232 3300006844 Bacteria 1087
453 Ga0075430_100087873 3300006846 Bacteria 2601
454 Ga0075430_100988017 3300006846 Bacteria 693
455 Ga0075430_101505380 3300006846 Unclassified 553
456 Ga0075431_100007116 3300006847 Bacteria 11116
457 Ga0075431_100010770 3300006847 Bacteria 9195
458 Ga0075431_100033300 3300006847 Bacteria 5311
459 Ga0075431_100113822 3300006847 Bacteria 2792
460 Ga0075431_100235327 3300006847 Bacteria 1865
461 Ga0075431_100406724 3300006847 Unclassified 1362
462 Ga0075431_100806267 3300006847 Bacteria 912
463 Ga0075431_100848933 3300006847 Unclassified 884
464 Ga0075431_100938592 3300006847 Unclassified 834
465 Ga0075431_100967510 3300006847 Bacteria 819
466 Ga0075433_10000040 3300006852 Bacteria 52844
467 Ga0075433_10033057 3300006852 Bacteria 4433
468 Ga0075433_10172229 3300006852 Bacteria 1926
469 Ga0075433_10332036 3300006852 Bacteria 1344
470 Ga0075433_10421547 3300006852 Bacteria 1177
471 Ga0075433_10556099 3300006852 Bacteria 1008
472 Ga0075433_11092984 3300006852 Unclassified 693
473 Ga0075433_11410121 3300006852 Unclassified 602
474 Ga0075433_11556342 3300006852 Bacteria 571
475 Ga0075434_100001061 3300006871 Bacteria 22440
476 Ga0075434_100063595 3300006871 Bacteria 3673
477 Ga0075434_100067711 3300006871 Bacteria 3556
478 Ga0075434_100161665 3300006871 Bacteria 2259
479 Ga0075434_100198951 3300006871 Bacteria 2023
480 Ga0075434_100432111 3300006871 Bacteria 1338
481 Ga0075434_100607750 3300006871 Bacteria 1112
482 Ga0075434_100842659 3300006871 Bacteria 932
483 Ga0075434_100884925 3300006871 Bacteria 908
484 Ga0075434_101480480 3300006871 Bacteria 688
485 Ga0075429_100041964 3300006880 Bacteria 3982
486 Ga0075429_100300408 3300006880 Unclassified 1406
487 Ga0075429_100353883 3300006880 Bacteria 1286
488 Ga0075429_101057904 3300006880 Bacteria 709
489 Ga0075429_101918104 3300006880 Unclassified 513
490 Ga0068865_100094661 3300006881 Bacteria 2174
491 Ga0068865_101538467 3300006881 Unclassified 597
492 Ga0068865_101704517 3300006881 Unclassified 568
493 Ga0075436_100029502 3300006914 Bacteria 3772
494 Ga0075436_100033217 3300006914 Bacteria 3556
495 Ga0075436_100073217 3300006914 Bacteria 2371
496 Ga0075436_100141822 3300006914 Bacteria 1689
497 Ga0075436_100216617 3300006914 Bacteria 1358
498 Ga0075436_100754515 3300006914 Archaea 723
499 Ga0075436_100898041 3300006914 Bacteria 662
500 Ga0075436_101439356 3300006914 Bacteria 523
501 Ga0075436_101454186 3300006914 Bacteria 520
502 Ga0097620_100008697 3300006931 Bacteria 10266
503 Ga0097620_100077676 3300006931 Bacteria 3361
504 Ga0097620_100135276 3300006931 Bacteria 2537
505 Ga0097620_100250951 3300006931 Bacteria 1860
506 Ga0097620_100470346 3300006931 Unclassified 1353
507 Ga0097620_100866292 3300006931 Bacteria 989
508 Ga0097620_101358029 3300006931 Bacteria 784
509 Ga0097620_101440780 3300006931 Unclassified 760
510 Ga0097620_102975345 3300006931 Bacteria 518
511 Ga0075435_100010221 3300007076 Bacteria 6855
512 Ga0075435_100045628 3300007076 Bacteria 3514
513 Ga0075435_100786148 3300007076 Bacteria 828
514 Ga0075435_101061155 3300007076 Bacteria 708
515 Ga0075435_101560147 3300007076 Unclassified 579
516 Ga0099794_10037262 3300007265 Bacteria 2301
517 Ga0099794_10251432 3300007265 Bacteria 911
518 Ga0099794_10317411 3300007265 Bacteria 808
519 Ga0099795_10000017 3300007788 Bacteria 63153
520 Ga0105240_10141019 3300009093 Bacteria 2882
521 Ga0111539_10000484 3300009094 Bacteria 50406
522 Ga0111539_10001724 3300009094 Bacteria 29113
523 Ga0111539_10353603 3300009094 Bacteria 1710
524 Ga0111539_11006958 3300009094 Bacteria 969
525 Ga0111539_11334000 3300009094 Archaea 832
526 Ga0105245_10014790 3300009098 Bacteria 6796
527 Ga0105245_10066632 3300009098 Bacteria 3259
528 Ga0105245_10111253 3300009098 Bacteria 2547
529 Ga0105245_10157804 3300009098 Bacteria 2150
530 Ga0105245_10465223 3300009098 Bacteria 1275
531 Ga0105245_10575832 3300009098 Bacteria 1150
532 Ga0105245_10825253 3300009098 Bacteria 966
533 Ga0105247_10006298 3300009101 Bacteria 7355
534 Ga0114129_10008151 3300009147 Bacteria 14932
535 Ga0114129_10021654 3300009147 Bacteria 9123
536 Ga0114129_10039516 3300009147 Bacteria 6652
537 Ga0114129_10074040 3300009147 Bacteria 4744
538 Ga0114129_10076941 3300009147 Bacteria 4643
539 Ga0114129_10108581 3300009147 Bacteria 3831
540 Ga0114129_10136479 3300009147 Bacteria 3366
541 Ga0114129_10156174 3300009147 Bacteria 3119
542 Ga0114129_10196276 3300009147 Unclassified 2737
543 Ga0114129_10212967 3300009147 Bacteria 2611
544 Ga0114129_10648647 3300009147 Unclassified 1363
545 Ga0114129_10778976 3300009147 Bacteria 1222
546 Ga0114129_11062784 3300009147 Bacteria 1016
547 Ga0114129_11101577 3300009147 Bacteria 994
548 Ga0114129_11700064 3300009147 Bacteria 770
549 Ga0114129_11785882 3300009147 Unclassified 748
550 Ga0105243_10139896 3300009148 Bacteria 2064
551 Ga0105243_11333013 3300009148 Unclassified 736
552 Ga0105243_12048611 3300009148 Bacteria 607
553 Ga0105243_12447834 3300009148 Bacteria 561
554 Ga0105243_12877666 3300009148 Unclassified 522
555 Ga0105243_13007238 3300009148 Unclassified 511
556 Ga0105241_10768575 3300009174 Bacteria 885
557 Ga0105241_11598258 3300009174 Unclassified 630
558 Ga0105242_10007687 3300009176 Bacteria 8296
559 Ga0105242_10040320 3300009176 Bacteria 3763
560 Ga0105242_11290537 3300009176 Bacteria 753
561 Ga0105242_11400374 3300009176 Unclassified 727
562 Ga0105242_12350316 3300009176 Bacteria 580
563 Ga0105248_10004031 3300009177 Bacteria 16230
564 Ga0105248_10139420 3300009177 Bacteria 2735
565 Ga0105248_10225960 3300009177 Bacteria 2107
566 Ga0105248_10262578 3300009177 Bacteria 1944
567 Ga0105248_10291129 3300009177 Bacteria 1839
568 Ga0105248_10361536 3300009177 Bacteria 1634
569 Ga0105248_10679795 3300009177 Bacteria 1161
570 Ga0105248_10938903 3300009177 Unclassified 977
571 Ga0105248_11006815 3300009177 Bacteria 941
572 Ga0105248_11054246 3300009177 Bacteria 919
573 Ga0105248_11710616 3300009177 Bacteria 713
574 Ga0105248_12013164 3300009177 Bacteria 656
575 Ga0105238_10889583 3300009551 Bacteria 909
576 Ga0105238_12832804 3300009551 Bacteria 521
577 Ga0105249_10130399 3300009553 Bacteria 2399
578 Ga0105249_10186786 3300009553 Bacteria 2020
579 Ga0105249_10332899 3300009553 Bacteria 1533
580 Ga0105249_10336422 3300009553 Unclassified 1525
581 Ga0105249_10413061 3300009553 Bacteria 1382
582 Ga0105249_10454929 3300009553 Bacteria 1319
583 Ga0105249_10636438 3300009553 Bacteria 1123
584 Ga0105249_10705927 3300009553 Bacteria 1069
585 Ga0105249_10955709 3300009553 Bacteria 925
586 Ga0105249_11329688 3300009553 Bacteria 790
587 Ga0105249_11677255 3300009553 Bacteria 708
588 Ga0105249_11704474 3300009553 Bacteria 703
589 Ga0105249_12475715 3300009553 Bacteria 591
590 Ga0099796_10000009 3300010159 Bacteria 63267
591 Ga0099796_10000089 3300010159 Bacteria 15213
592 Ga0099796_10209017 3300010159 Unclassified 795
593 Ga0099796_10511704 3300010159 Bacteria 538
594 Ga0099796_10528038 3300010159 Bacteria 530
595 Ga0105239_13281881 3300010375 Bacteria 527
596 Ga0105246_10310720 3300011119 Bacteria 1277
597 Ga0105246_10674793 3300011119 Bacteria 902
598 Ga0157339_1006993 3300012505 Unclassified 936
599 Ga0157324_1063183 3300012506 Unclassified 511
600 Ga0157373_10188462 3300013100 Bacteria 1453
601 Ga0157370_10169989 3300013104 Bacteria 2026
602 Ga0157370_10206353 3300013104 Bacteria 1822
603 Ga0157374_10008650 3300013296 Bacteria 8712
604 Ga0157374_10130436 3300013296 Unclassified 2432
605 Ga0157374_10186694 3300013296 Bacteria 2027
606 Ga0157374_12134916 3300013296 Bacteria 587
607 Ga0157374_12780118 3300013296 Unclassified 517
608 Ga0157378_10004278 3300013297 Bacteria 12575
609 Ga0157378_10053454 3300013297 Bacteria 3596
610 Ga0157378_10227427 3300013297 Bacteria 1776
611 Ga0157378_10411562 3300013297 Bacteria 1335
612 Ga0157378_10414620 3300013297 Bacteria 1330
613 Ga0157378_10637580 3300013297 Bacteria 1080
614 Ga0157378_10668804 3300013297 Bacteria 1055
615 Ga0157378_10825308 3300013297 Unclassified 954
616 Ga0157378_11133144 3300013297 Unclassified 820
617 Ga0157378_11478498 3300013297 Unclassified 724
618 Ga0157378_11696692 3300013297 Unclassified 679
619 Ga0157378_13200816 3300013297 Unclassified 508
620 Ga0163162_10215990 3300013306 Bacteria 2048
621 Ga0163162_10307337 3300013306 Bacteria 1718
622 Ga0163162_11901448 3300013306 Bacteria 681
623 Ga0163162_12746234 3300013306 Bacteria 567
624 Ga0157375_10549984 3300013308 Unclassified 1316
625 Ga0157375_10802143 3300013308 Unclassified 1090
626 Ga0157375_11173830 3300013308 Unclassified 900
627 Ga0157375_11493188 3300013308 Bacteria 797
628 Ga0157375_12457083 3300013308 Unclassified 622
629 Ga0163163_10006254 3300014325 Bacteria 10392
630 Ga0163163_10006835 3300014325 Bacteria 10010
631 Ga0163163_10490769 3300014325 Bacteria 1290
632 Ga0163163_10775825 3300014325 Bacteria 1022
633 Ga0163163_12139447 3300014325 Unclassified 619
634 Ga0157380_10014976 3300014326 Bacteria 5688
635 Ga0157380_10032156 3300014326 Bacteria 4034
636 Ga0157380_10585169 3300014326 Unclassified 1101
637 Ga0157380_11170793 3300014326 Unclassified 811
638 Ga0157380_11601852 3300014326 Unclassified 707
639 Ga0157380_12798752 3300014326 Unclassified 554
640 Ga0157377_10199814 3300014745 Bacteria 1268
641 Ga0157377_10768708 3300014745 Bacteria 707
642 Ga0157377_11007106 3300014745 Bacteria 631
643 Ga0157377_11573241 3300014745 Bacteria 525
644 Ga0157379_10001408 3300014968 Bacteria 19710
645 Ga0157379_10032125 3300014968 Bacteria 4678
646 Ga0157379_10052585 3300014968 Bacteria 3638
647 Ga0157379_10169206 3300014968 Unclassified 1973
648 Ga0157379_10895316 3300014968 Bacteria 842
649 Ga0157376_10455547 3300014969 Bacteria 1249
650 Ga0157376_10989419 3300014969 Unclassified 863
651 Ga0182007_10013977 3300015262 Bacteria 3042
652 Ga0163161_11695867 3300017792 Bacteria 560
653 Ga0163161_12038792 3300017792 Bacteria 510
654 Ga0206354_11301016 3300020081 Bacteria 760
655 Ga0206353_11684825 3300020082 Bacteria 1789
656 Ga0213876_10275008 3300021384 Bacteria 895
657 Ga0207697_10045146 3300025315 Bacteria 1814
658 Ga0207656_10151047 3300025321 Bacteria 1100
659 Ga0207656_10277661 3300025321 Bacteria 826
660 Ga0207656_10625645 3300025321 Bacteria 550
661 Ga0207653_10005831 3300025885 Bacteria 3844
662 Ga0207653_10094590 3300025885 Bacteria 1050
663 Ga0207682_10004858 3300025893 Bacteria 5552
664 Ga0207682_10152299 3300025893 Bacteria 1043
665 Ga0207642_10018049 3300025899 Bacteria 2699
666 Ga0207642_10448752 3300025899 Unclassified 781
667 Ga0207642_10581048 3300025899 Unclassified 695
668 Ga0207642_10905439 3300025899 Unclassified 565
669 Ga0207642_11038044 3300025899 Bacteria 529
670 Ga0207710_10006780 3300025900 Bacteria 4878
671 Ga0207710_10136273 3300025900 Bacteria 1182
672 Ga0207688_10309398 3300025901 Bacteria 967
673 Ga0207688_10358701 3300025901 Bacteria 899
674 Ga0207688_10723628 3300025901 Bacteria 630
675 Ga0207688_10757317 3300025901 Bacteria 615
676 Ga0207680_10292280 3300025903 Bacteria 1134
677 Ga0207680_10616690 3300025903 Bacteria 776
678 Ga0207680_10743722 3300025903 Bacteria 703
679 Ga0207680_11238161 3300025903 Bacteria 532
680 Ga0207699_10000023 3300025906 Bacteria 172262
681 Ga0207645_10023379 3300025907 Bacteria 4018
682 Ga0207645_10217964 3300025907 Unclassified 1257
683 Ga0207645_10298410 3300025907 Unclassified 1072
684 Ga0207645_10318033 3300025907 Bacteria 1038
685 Ga0207645_10330059 3300025907 Unclassified 1019
686 Ga0207645_10415190 3300025907 Bacteria 906
687 Ga0207645_10535740 3300025907 Unclassified 794
688 Ga0207643_10001060 3300025908 Bacteria 16259
689 Ga0207643_10326391 3300025908 Bacteria 959
690 Ga0207643_10561734 3300025908 Unclassified 733
691 Ga0207643_10829900 3300025908 Unclassified 599
692 Ga0207684_10006738 3300025910 Bacteria 10425
693 Ga0207684_10009566 3300025910 Bacteria 8550
694 Ga0207684_10021789 3300025910 Bacteria 5470
695 Ga0207684_10126190 3300025910 Bacteria 2196
696 Ga0207684_10326624 3300025910 Bacteria 1322
697 Ga0207684_10470015 3300025910 Archaea 1079
698 Ga0207684_10733465 3300025910 Bacteria 838
699 Ga0207707_10078280 3300025912 Bacteria 2887
700 Ga0207707_10313211 3300025912 Bacteria 1356
701 Ga0207695_10174028 3300025913 Bacteria 2076
702 Ga0207695_10331905 3300025913 Bacteria 1409
703 Ga0207671_10528750 3300025914 Bacteria 940
704 Ga0207693_10333318 3300025915 Bacteria 1188
705 Ga0207663_10000031 3300025916 Bacteria 96659
706 Ga0207663_10922673 3300025916 Unclassified 699
707 Ga0207663_11263878 3300025916 Archaea 595
708 Ga0207662_10001711 3300025918 Bacteria 10747
709 Ga0207657_11215797 3300025919 Unclassified 572
710 Ga0207649_10262245 3300025920 Unclassified 1249
711 Ga0207649_10275383 3300025920 Bacteria 1221
712 Ga0207646_10001692 3300025922 Bacteria 26802
713 Ga0207646_10003600 3300025922 Bacteria 17368
714 Ga0207646_10003938 3300025922 Bacteria 16476
715 Ga0207646_10004852 3300025922 Bacteria 14410
716 Ga0207646_10005464 3300025922 Bacteria 13356
717 Ga0207646_10047286 3300025922 Bacteria 3858
718 Ga0207646_10059650 3300025922 Bacteria 3407
719 Ga0207646_10080091 3300025922 Archaea 2920
720 Ga0207646_10095513 3300025922 Bacteria 2663
721 Ga0207646_10434549 3300025922 Bacteria 1184
722 Ga0207646_10455518 3300025922 Unclassified 1154
723 Ga0207646_11100322 3300025922 Unclassified 699
724 Ga0207646_11525674 3300025922 Unclassified 578
725 Ga0207681_10000064 3300025923 Bacteria 99054
726 Ga0207681_10017882 3300025923 Bacteria 4457
727 Ga0207681_10085715 3300025923 Bacteria 2236
728 Ga0207681_10140924 3300025923 Bacteria 1795
729 Ga0207681_10192732 3300025923 Bacteria 1560
730 Ga0207681_10422882 3300025923 Bacteria 1080
731 Ga0207681_10897410 3300025923 Bacteria 742
732 Ga0207650_10028536 3300025925 Bacteria 4003
733 Ga0207650_10058162 3300025925 Bacteria 2878
734 Ga0207650_10138866 3300025925 Bacteria 1909
735 Ga0207650_10524128 3300025925 Unclassified 992
736 Ga0207650_10678959 3300025925 Bacteria 869
737 Ga0207650_10741173 3300025925 Bacteria 831
738 Ga0207659_10015264 3300025926 Bacteria 4972
739 Ga0207659_10044689 3300025926 Bacteria 3118
740 Ga0207659_10080516 3300025926 Bacteria 2406
741 Ga0207659_10087690 3300025926 Bacteria 2317
742 Ga0207659_10524266 3300025926 Bacteria 1005
743 Ga0207659_11121636 3300025926 Bacteria 677
744 Ga0207687_10154461 3300025927 Bacteria 1754
745 Ga0207687_10204581 3300025927 Unclassified 1545
746 Ga0207687_10221861 3300025927 Bacteria 1489
747 Ga0207687_11325478 3300025927 Bacteria 619
748 Ga0207700_10206065 3300025928 Bacteria 1660
749 Ga0207700_11136601 3300025928 Unclassified 698
750 Ga0207644_10085596 3300025931 Bacteria 2339
751 Ga0207644_10657619 3300025931 Bacteria 872
752 Ga0207690_10310534 3300025932 Bacteria 1237
753 Ga0207690_10968524 3300025932 Bacteria 707
754 Ga0207706_10097660 3300025933 Bacteria 2583
755 Ga0207706_10169041 3300025933 Bacteria 1921
756 Ga0207706_10242797 3300025933 Bacteria 1574
757 Ga0207706_10255467 3300025933 Bacteria 1530
758 Ga0207706_10955991 3300025933 Unclassified 721
759 Ga0207686_10005569 3300025934 Bacteria 6750
760 Ga0207686_10584242 3300025934 Bacteria 877
761 Ga0207686_10693284 3300025934 Bacteria 809
762 Ga0207709_10388498 3300025935 Bacteria 1064
763 Ga0207709_10735220 3300025935 Unclassified 792
764 Ga0207709_11322916 3300025935 Bacteria 596
765 Ga0207670_10107049 3300025936 Bacteria 2007
766 Ga0207670_10419618 3300025936 Bacteria 1073
767 Ga0207670_10460957 3300025936 Bacteria 1026
768 Ga0207670_10474271 3300025936 Bacteria 1012
769 Ga0207670_11016129 3300025936 Bacteria 698
770 Ga0207669_10154591 3300025937 Bacteria 1612
771 Ga0207669_10260742 3300025937 Bacteria 1296
772 Ga0207669_10464312 3300025937 Bacteria 1006
773 Ga0207669_10676009 3300025937 Bacteria 846
774 Ga0207669_10933999 3300025937 Bacteria 726
775 Ga0207669_11018242 3300025937 Unclassified 696
776 Ga0207669_11267168 3300025937 Bacteria 626
777 Ga0207704_10056577 3300025938 Bacteria 2404
778 Ga0207704_10157512 3300025938 Bacteria 1611
779 Ga0207704_10429917 3300025938 Bacteria 1049
780 Ga0207704_11554687 3300025938 Unclassified 568
781 Ga0207704_11565564 3300025938 Unclassified 566
782 Ga0207665_10233653 3300025939 Bacteria 1352
783 Ga0207665_10261972 3300025939 Bacteria 1281
784 Ga0207665_10650410 3300025939 Bacteria 826
785 Ga0207691_10007528 3300025940 Bacteria 10481
786 Ga0207691_10015658 3300025940 Bacteria 7207
787 Ga0207691_10019449 3300025940 Bacteria 6424
788 Ga0207691_10122999 3300025940 Bacteria 2297
789 Ga0207691_10129489 3300025940 Bacteria 2230
790 Ga0207691_10395324 3300025940 Bacteria 1179
791 Ga0207691_10526321 3300025940 Unclassified 1003
792 Ga0207691_10639497 3300025940 Unclassified 899
793 Ga0207691_10658500 3300025940 Bacteria 884
794 Ga0207691_11573019 3300025940 Unclassified 535
795 Ga0207691_11648515 3300025940 Bacteria 520
796 Ga0207711_10012622 3300025941 Bacteria 7017
797 Ga0207711_10069821 3300025941 Bacteria 3046
798 Ga0207711_10180021 3300025941 Bacteria 1922
799 Ga0207711_10247926 3300025941 Bacteria 1634
800 Ga0207711_10449756 3300025941 Unclassified 1199
801 Ga0207711_10658882 3300025941 Bacteria 977
802 Ga0207711_10769294 3300025941 Bacteria 897
803 Ga0207711_11117851 3300025941 Bacteria 729
804 Ga0207711_11259584 3300025941 Bacteria 681
805 Ga0207711_11277719 3300025941 Bacteria 676
806 Ga0207689_10408010 3300025942 Unclassified 1133
807 Ga0207689_11703167 3300025942 Unclassified 522
808 Ga0207661_10022960 3300025944 Bacteria 4708
809 Ga0207661_10374966 3300025944 Bacteria 1287
810 Ga0207661_11418374 3300025944 Unclassified 637
811 Ga0207679_10012937 3300025945 Bacteria 5460
812 Ga0207679_10027297 3300025945 Bacteria 3947
813 Ga0207679_10029451 3300025945 Bacteria 3823
814 Ga0207679_10068246 3300025945 Bacteria 2671
815 Ga0207679_10603766 3300025945 Bacteria 989
816 Ga0207679_10789091 3300025945 Bacteria 865
817 Ga0207679_12148998 3300025945 Bacteria 507
818 Ga0207679_12169341 3300025945 Unclassified 504
819 Ga0207667_10351254 3300025949 Bacteria 1504
820 Ga0207667_10981776 3300025949 Bacteria 833
821 Ga0207667_11766120 3300025949 Bacteria 583
822 Ga0207651_10023503 3300025960 Bacteria 3793
823 Ga0207651_10048304 3300025960 Bacteria 2876
824 Ga0207651_10103409 3300025960 Bacteria 2120
825 Ga0207651_10137105 3300025960 Bacteria 1884
826 Ga0207651_10143980 3300025960 Bacteria 1845
827 Ga0207651_10482476 3300025960 Unclassified 1069
828 Ga0207651_10689503 3300025960 Unclassified 899
829 Ga0207651_10772229 3300025960 Bacteria 850
830 Ga0207651_11222946 3300025960 Bacteria 675
831 Ga0207712_10118849 3300025961 Bacteria 1996
832 Ga0207712_10151618 3300025961 Bacteria 1791
833 Ga0207712_10425597 3300025961 Bacteria 1121
834 Ga0207712_10459783 3300025961 Bacteria 1081
835 Ga0207712_10530280 3300025961 Bacteria 1010
836 Ga0207668_10071130 3300025972 Bacteria 2484
837 Ga0207668_10118998 3300025972 Bacteria 1997
838 Ga0207668_10266965 3300025972 Bacteria 1397
839 Ga0207668_10348285 3300025972 Bacteria 1238
840 Ga0207668_10831594 3300025972 Bacteria 819
841 Ga0207668_11029867 3300025972 Bacteria 736
842 Ga0207668_11612876 3300025972 Bacteria 586
843 Ga0207640_10061451 3300025981 Bacteria 2488
844 Ga0207640_10458382 3300025981 Bacteria 1052
845 Ga0207640_10822297 3300025981 Bacteria 806
846 Ga0207658_10125849 3300025986 Bacteria 2051
847 Ga0207658_10149515 3300025986 Bacteria 1901
848 Ga0207658_10158074 3300025986 Bacteria 1855
849 Ga0207658_10228029 3300025986 Bacteria 1571
850 Ga0207658_11026219 3300025986 Bacteria 753
851 Ga0207658_11077416 3300025986 Unclassified 734
852 Ga0207658_11647786 3300025986 Unclassified 586
853 Ga0207677_10008333 3300026023 Bacteria 5783
854 Ga0207677_10312396 3300026023 Bacteria 1303
855 Ga0207677_10364757 3300026023 Bacteria 1215
856 Ga0207677_10561181 3300026023 Bacteria 997
857 Ga0207677_11415540 3300026023 Unclassified 641
858 Ga0207703_10021760 3300026035 Bacteria 5021
859 Ga0207703_10079223 3300026035 Bacteria 2733
860 Ga0207703_10079435 3300026035 Bacteria 2730
861 Ga0207703_10152681 3300026035 Bacteria 2015
862 Ga0207703_10433297 3300026035 Bacteria 1225
863 Ga0207639_10510078 3300026041 Bacteria 1100
864 Ga0207678_10266086 3300026067 Bacteria 1470
865 Ga0207678_11872328 3300026067 Unclassified 524
866 Ga0207708_10003426 3300026075 Bacteria 11686
867 Ga0207708_10027011 3300026075 Bacteria 4346
868 Ga0207708_10156898 3300026075 Unclassified 1795
869 Ga0207708_10178037 3300026075 Bacteria 1687
870 Ga0207708_10574709 3300026075 Bacteria 952
871 Ga0207708_11286266 3300026075 Unclassified 640
872 Ga0207641_10039685 3300026088 Bacteria 3938
873 Ga0207641_10050023 3300026088 Bacteria 3535
874 Ga0207641_10296150 3300026088 Unclassified 1527
875 Ga0207641_10352849 3300026088 Bacteria 1402
876 Ga0207641_10368364 3300026088 Bacteria 1373
877 Ga0207641_10373720 3300026088 Bacteria 1363
878 Ga0207641_10485337 3300026088 Bacteria 1198
879 Ga0207641_10493469 3300026088 Bacteria 1188
880 Ga0207641_11142077 3300026088 Bacteria 778
881 Ga0207641_11823410 3300026088 Bacteria 610
882 Ga0207641_12226020 3300026088 Bacteria 548
883 Ga0207648_10005264 3300026089 Bacteria 13060
884 Ga0207648_10134922 3300026089 Bacteria 2174
885 Ga0207648_10185062 3300026089 Bacteria 1845
886 Ga0207648_10259120 3300026089 Bacteria 1551
887 Ga0207648_10279365 3300026089 Bacteria 1493
888 Ga0207648_10607092 3300026089 Unclassified 1009
889 Ga0207648_10846798 3300026089 Bacteria 853
890 Ga0207648_11596198 3300026089 Bacteria 613
891 Ga0207648_11932240 3300026089 Bacteria 552
892 Ga0207676_10010293 3300026095 Bacteria 6658
893 Ga0207676_10024045 3300026095 Unclassified 4504
894 Ga0207676_10045265 3300026095 Bacteria 3399
895 Ga0207676_10265493 3300026095 Unclassified 1552
896 Ga0207676_11210805 3300026095 Bacteria 749
897 Ga0207676_11433915 3300026095 Unclassified 687
898 Ga0207676_12485514 3300026095 Unclassified 515
899 Ga0207676_12518906 3300026095 Bacteria 511
900 Ga0207674_10185403 3300026116 Bacteria 2031
901 Ga0207674_11948405 3300026116 Unclassified 553
902 Ga0207674_12206841 3300026116 Bacteria 513
903 Ga0207675_100020890 3300026118 Bacteria 6105
904 Ga0207675_100037639 3300026118 Bacteria 4512
905 Ga0207675_100060822 3300026118 Bacteria 3526
906 Ga0207675_100071495 3300026118 Bacteria 3244
907 Ga0207675_100268115 3300026118 Unclassified 1656
908 Ga0207683_10004055 3300026121 Bacteria 12658
909 Ga0207683_10024258 3300026121 Bacteria 5222
910 Ga0207683_10031272 3300026121 Bacteria 4619
911 Ga0207683_10223248 3300026121 Bacteria 1717
912 Ga0207683_10226369 3300026121 Bacteria 1705
913 Ga0207683_10314786 3300026121 Bacteria 1433
914 Ga0207683_11004712 3300026121 Unclassified 774
915 Ga0207698_10243694 3300026142 Bacteria 1640
916 Ga0209179_1000001 3300027512 Bacteria 128813
917 Ga0209179_1000015 3300027512 Bacteria 50401
918 Ga0209982_1009016 3300027552 Unclassified 1470
919 Ga0209998_10028911 3300027717 Bacteria 1220
920 Ga0209813_10021610 3300027866 Bacteria 1811
921 Ga0209974_10000567 3300027876 Bacteria 12352
922 Ga0207428_10359166 3300027907 Bacteria 1071
923 Ga0207428_10670763 3300027907 Bacteria 743
924 Ga0268266_10002152 3300028379 Bacteria 21639
925 Ga0268266_10195667 3300028379 Bacteria 1848
926 Ga0268265_10189077 3300028380 Bacteria 1776
927 Ga0268265_10350983 3300028380 Bacteria 1347
928 Ga0268265_10444939 3300028380 Unclassified 1209
929 Ga0268265_10475405 3300028380 Bacteria 1172
930 Ga0268265_10910755 3300028380 Bacteria 864
931 Ga0268265_11360280 3300028380 Unclassified 711
932 Ga0268265_11455157 3300028380 Unclassified 688
933 Ga0268265_11883566 3300028380 Unclassified 605
934 Ga0268264_10028925 3300028381 Bacteria 4537
935 Ga0268264_10388342 3300028381 Bacteria 1338
936 Ga0268264_10476492 3300028381 Bacteria 1213
937 Ga0268264_10569934 3300028381 Unclassified 1113
938 Ga0268264_10630112 3300028381 Bacteria 1059
939 Ga0268264_11245555 3300028381 Unclassified 754
940 Ga0268264_11825636 3300028381 Bacteria 618
941 Ga0265318_10041069 3300028577 Bacteria 1760
942 Ga0265336_10165074 3300028666 Unclassified 659
943 Ga0265328_10031126 3300031239 Bacteria 1984
944 Ga0265325_10171330 3300031241 Unclassified 1016
945 Ga0265340_10098704 3300031247 Unclassified 1359
946 Ga0265339_10415038 3300031249 Unclassified 628
947 Ga0265316_10212075 3300031344 Bacteria 1432
948 Ga0307509_10515349 3300031507 Bacteria 878
949 Ga0307408_101835844 3300031548 Bacteria 580
950 Ga0307408_102156194 3300031548 Bacteria 538
951 Ga0265314_10165024 3300031711 Bacteria 1343
952 Ga0265342_10104078 3300031712 Bacteria 1614
953 Ga0307405_11187183 3300031731 Bacteria 659
954 Ga0307413_10046998 3300031824 Bacteria 2571
955 Ga0307413_10520306 3300031824 Bacteria 959
956 Ga0307410_10030657 3300031852 Bacteria 3440
957 Ga0307410_10160891 3300031852 Bacteria 1682
958 Ga0307410_10613929 3300031852 Bacteria 908
959 Ga0307410_10754606 3300031852 Unclassified 824
960 Ga0307406_10913972 3300031901 Bacteria 748
961 Ga0307407_10063689 3300031903 Unclassified 2164
962 Ga0307407_10216323 3300031903 Unclassified 1293
963 Ga0307412_10277747 3300031911 Bacteria 1314
964 Ga0307409_100152771 3300031995 Bacteria 2007
965 Ga0307409_100196639 3300031995 Bacteria 1800
966 Ga0307409_100456639 3300031995 Bacteria 1234
967 Ga0307409_101485049 3300031995 Bacteria 705
968 Ga0307409_102697677 3300031995 Bacteria 525
969 Ga0307416_100088348 3300032002 Bacteria 2650
970 Ga0307416_100322175 3300032002 Bacteria 1548
971 Ga0307416_101483069 3300032002 Bacteria 784
972 Ga0307416_102551865 3300032002 Bacteria 609
973 Ga0307411_10756925 3300032005 Bacteria 851
974 Ga0307415_100586432 3300032126 Bacteria 990
975 Ga0307415_102178796 3300032126 Bacteria 542
976 Ga0316583_10001467 3300032133 Bacteria 7878
977 Ga0373926_0095681 3300035083 Bacteria 1107
978 Ga0373926_0196350 3300035083 Bacteria 776
979 Ga0373926_0418256 3300035083 Unclassified 530
980 Ga0373929_0170438 3300035085 Unclassified 595
981 Ga0373944_0017388 3300035089 Bacteria 2041
982 Ga0373949_0038135 3300035090 Bacteria 1172
983 Ga0373923_0045083 3300035111 Bacteria 1831
984 Ga0373932_0076252 3300035112 Bacteria 1050
985 Ga0373936_0607293 3300035113 Unclassified 514
986 Ga0373939_0090351 3300035114 Unclassified 1034
987 Ga0373941_0194251 3300035115 Bacteria 768
988 Ga0373945_0069266 3300035116 Bacteria 1332
989 Ga0373945_0240489 3300035116 Unclassified 762
990 Ga0373945_0261789 3300035116 Bacteria 733
991 Ga0373953_0310144 3300035117 Unclassified 689
992 Ga0373943_0013767 3300035170 Bacteria 3657
993 Ga0373943_0579837 3300035170 Unclassified 659
994 Ga0373943_0879364 3300035170 Bacteria 535
995 Ga0373943_0993497 3300035170 Unclassified 503
996 Ga0373946_0022927 3300035171 Bacteria 2435
997 Ga0373946_0304193 3300035171 Unclassified 789
998 Ga0373955_0118534 3300035172 Unclassified 1537
999 Ga0373942_0197350 3300035207 Bacteria 666
1000 Ga0373962_0007056 3300035242 Bacteria 2744
1001 Ga0316574_0904136 3300035398 Bacteria 534
1002 Ga0373931_0048208 3300035691 Bacteria 2258
1003 Ga0373931_0286151 3300035691 Bacteria 1014
1004 Ga0373931_0956388 3300035691 Bacteria 578
1005 Ga0373931_0974749 3300035691 Bacteria 573
1006 Ga0373935_0019946 3300035692 Bacteria 4091
1007 Ga0373935_0034596 3300035692 Bacteria 3150
1008 Ga0373935_0579578 3300035692 Bacteria 819
1009 Ga0373935_0644155 3300035692 Bacteria 777
1010 Ga0373935_1104464 3300035692 Bacteria 590
1011 Ga0373927_0167770 3300035695 Bacteria 1439
1012 Ga0373933_0806101 3300035724 Bacteria 618
1013 Ga0373933_1181000 3300035724 Bacteria 504
1014 Ga0373947_0034785 3300035725 Bacteria 2980
1015 Ga0373947_1036951 3300035725 Bacteria 559
1016 Ga0373937_0173687 3300036401 Bacteria 2022
1017 Ga0373937_0471506 3300036401 Unclassified 1192
1018 Ga0373937_0874770 3300036401 Unclassified 847
1019 Ga0373937_1035198 3300036401 Unclassified 770
1020 Ga0373937_1675434 3300036401 Bacteria 583
1021 Ga0316584_0058550 3300036712 Bacteria 2885
1022 Ga0373925_0015617 3300037068 Bacteria 5493
1023 Ga0373925_0044305 3300037068 Bacteria 3303
1024 Ga0373925_0225157 3300037068 Bacteria 1498
1025 Ga0373925_1055567 3300037068 Unclassified 669
1026 Ga0395900_0517987 3300037418 Bacteria 1141
1027 Ga0436365_0041363 3300039437 Bacteria 1982
1028 Ga0451789_0328186 3300041443 Bacteria 571
1029 Ga0451797_0789507 3300041453 Bacteria 1143
1030 Ga0451795_1365508 3300041456 Unclassified 507
1031 Ga0451839_1144603 3300041496 Bacteria 707
1032 Ga0451843_1069817 3300041509 Bacteria 527
1033 Ga0451853_2180419 3300041512 Unclassified 535
1034 Ga0450891_010962 3300042129 Unclassified 837
1035 Ga0439435_0323966 3300042436 Bacteria 531
1036 Ga0450916_051189 3300042530 Unclassified 651
1037 Ga0451577_0263402 3300042876 Bacteria 1561
1038 Ga0451577_0495844 3300042876 Bacteria 1109
1039 Ga0451577_0649304 3300042876 Unclassified 957
1040 Ga0453683_0590287 3300044673 Bacteria 724
1041 Ga0451576_0100573 3300045051 Bacteria 3006
1042 Ga0451576_0103412 3300045051 Bacteria 2963
1043 Ga0451576_0423453 3300045051 Bacteria 1397
1044 Ga0451576_0459410 3300045051 Bacteria 1337
1045 Ga0451576_1372917 3300045051 Unclassified 736
1046 Ga0495592_0357237 3300046454 Unclassified 935
1047 Ga0495603_0085623 3300046455 Bacteria 1845
1048 Ga0495603_0094591 3300046455 Bacteria 1746
1049 Ga0495629_0237566 3300046459 Bacteria 1255
1050 Ga0495629_0274881 3300046459 Bacteria 1157
1051 Ga0495629_0302169 3300046459 Bacteria 1096
1052 Ga0495641_0400569 3300046461 Unclassified 623
1053 Ga0495651_0269580 3300046462 Bacteria 1155
1054 Ga0495580_0119518 3300046472 Bacteria 1830
1055 Ga0495580_0494751 3300046472 Unclassified 817
1056 Ga0495580_0631108 3300046472 Bacteria 706
1057 Ga0495580_1082995 3300046472 Unclassified 508
1058 Ga0495605_0361326 3300046474 Bacteria 608
1059 Ga0495662_0632628 3300046476 Bacteria 523
1060 Ga0495584_0075300 3300046491 Bacteria 1697
1061 Ga0495584_0617715 3300046491 Unclassified 553
1062 Ga0495585_0119943 3300046492 Bacteria 1392
1063 Ga0495585_0306465 3300046492 Bacteria 780
1064 Ga0495594_0010462 3300046499 Bacteria 4813
1065 Ga0495594_0027389 3300046499 Bacteria 3071
1066 Ga0495594_0162949 3300046499 Bacteria 1268
1067 Ga0495594_0169262 3300046499 Unclassified 1243
1068 Ga0495607_0088895 3300046501 Bacteria 1678
1069 Ga0495628_0108801 3300046516 Bacteria 2134
1070 Ga0495630_1125655 3300046517 Bacteria 595
1071 Ga0495644_0236979 3300046523 Bacteria 707
1072 Ga0495666_0474726 3300046526 Bacteria 559
1073 Ga0495665_0652103 3300046531 Unclassified 524
1074 Ga0495586_0217909 3300046535 Bacteria 1084
1075 Ga0495598_0073956 3300046537 Unclassified 1079
1076 Ga0495598_0170116 3300046537 Unclassified 772
1077 Ga0495609_0201003 3300046538 Unclassified 833
1078 Ga0495621_0016693 3300046539 Unclassified 2360
1079 Ga0495621_0144666 3300046539 Bacteria 932
1080 Ga0495621_0177006 3300046539 Bacteria 850
1081 Ga0495621_0260271 3300046539 Bacteria 710
1082 Ga0495621_0459467 3300046539 Bacteria 546
1083 Ga0495633_0360076 3300046558 Unclassified 659
1084 Ga0495667_0477851 3300046559 Bacteria 782
1085 Ga0495611_0074577 3300046648 Bacteria 1554
1086 Ga0495659_0109953 3300046664 Bacteria 1076
1087 Ga0495659_0115172 3300046664 Bacteria 1053
1088 Ga0495659_0410428 3300046664 Unclassified 585
1089 Ga0495659_0468018 3300046664 Unclassified 550
1090 Ga0495588_0016996 3300046674 Unclassified 3525
1091 Ga0495588_0025036 3300046674 Bacteria 2970
1092 Ga0495588_0035015 3300046674 Bacteria 2543
1093 Ga0495657_0733532 3300046675 Bacteria 567
1094 Ga0495599_0281288 3300046678 Bacteria 1008
1095 Ga0495647_0005694 3300046681 Unclassified 4095
1096 Ga0495647_0010820 3300046681 Bacteria 3116
1097 Ga0495658_0021488 3300046683 Unclassified 3402
1098 Ga0495658_0441398 3300046683 Bacteria 831
1099 Ga0495658_0729534 3300046683 Bacteria 635
1100 Ga0495669_0015569 3300046684 Bacteria 3257
1101 Ga0495669_0149347 3300046684 Bacteria 1106
1102 Ga0495669_0264515 3300046684 Bacteria 826
1103 Ga0495670_0211288 3300046691 Bacteria 1029
1104 Ga0495581_0074031 3300047315 Bacteria 1971
1105 Ga0495581_0224272 3300047315 Bacteria 1099
1106 Ga0495676_0009175 3300047321 Bacteria 9015
1107 Ga0495680_0573246 3300047322 Unclassified 758
1108 Ga0495677_0414956 3300047445 Unclassified 533
1109 Ga0495684_0095992 3300047471 Bacteria 2244
1110 Ga0495684_0187689 3300047471 Bacteria 1530
1111 Ga0496100_0729941 3300048903 Unclassified 774
1112 Ga0496100_1060488 3300048903 Bacteria 638
1113 Ga0496101_1457210 3300048904 Bacteria 533
1114 Ga0496102_0817100 3300048905 Bacteria 854
1115 Ga0496102_1969153 3300048905 Bacteria 501
1116 Ga0496104_0107103 3300048907 Bacteria 2679
1117 Ga0496104_0114096 3300048907 Bacteria 2591
1118 Ga0496104_0167226 3300048907 Bacteria 2109
1119 Ga0496104_0207554 3300048907 Bacteria 1871
1120 Ga0496104_0358902 3300048907 Bacteria 1370
1121 Ga0496105_0073529 3300048908 Bacteria 2824
1122 Ga0496105_0216491 3300048908 Bacteria 1560
1123 Ga0496105_0536542 3300048908 Bacteria 915
1124 Ga0496105_1135771 3300048908 Bacteria 578
1125 Ga0496106_0067050 3300048909 Bacteria 2735
1126 Ga0496106_0164244 3300048909 Bacteria 1757
1127 Ga0496106_0383119 3300048909 Unclassified 1130
1128 Ga0496106_0400816 3300048909 Bacteria 1103
1129 Ga0496106_0566961 3300048909 Unclassified 911
1130 Ga0496106_0719857 3300048909 Bacteria 795
1131 Ga0496107_0234907 3300048910 Bacteria 1364
1132 Ga0496107_0329617 3300048910 Bacteria 1136
1133 Ga0496107_0531353 3300048910 Bacteria 872
1134 Ga0496108_0022458 3300048911 Bacteria 5186
1135 Ga0496109_1449459 3300048912 Unclassified 622
1136 Ga0496111_0124297 3300048914 Bacteria 1907
1137 Ga0496111_0605583 3300048914 Unclassified 802
1138 Ga0496112_0001807 3300048915 Bacteria 16841
1139 Ga0496112_0029406 3300048915 Bacteria 5314
1140 Ga0496112_0775549 3300048915 Bacteria 884
1141 Ga0496112_0821437 3300048915 Unclassified 854
1142 Ga0496112_1151945 3300048915 Bacteria 693
1143 Ga0496113_0026090 3300048916 Bacteria 4174
1144 Ga0496113_0415341 3300048916 Bacteria 1081
1145 Ga0496113_0722901 3300048916 Unclassified 794
1146 Ga0496114_0149607 3300048917 Bacteria 2025
1147 Ga0496114_0218368 3300048917 Bacteria 1673
1148 Ga0496114_0725551 3300048917 Bacteria 870
1149 Ga0496114_1345228 3300048917 Unclassified 601
1150 Ga0496115_0004775 3300048918 Bacteria 9837
1151 Ga0501031_0539405 3300049568 Unclassified 752
1152 Ga0501034_0069707 3300049571 Bacteria 3527
1153 Ga0501034_0179889 3300049571 Bacteria 2080
1154 Ga0501034_0837956 3300049571 Bacteria 810
1155 Ga0501034_1067271 3300049571 Bacteria 690
1156 Ga0501038_0447156 3300049574 Bacteria 994
1157 Ga0501040_0100914 3300049576 Bacteria 2013
1158 Ga0501042_0469779 3300049578 Archaea 912
1159 Ga0501042_0859687 3300049578 Bacteria 660
1160 Ga0501043_0624202 3300049579 Bacteria 794
1161 Ga0501046_0538202 3300049580 Bacteria 834
1162 Ga0501047_0099425 3300049581 Bacteria 2788
1163 Ga0501047_1207281 3300049581 Unclassified 570
1164 Ga0501048_0024803 3300049582 Bacteria 4374
1165 Ga0501048_0726085 3300049582 Bacteria 713
1166 Ga0501048_1104348 3300049582 Unclassified 570
1167 Ga0501067_0086909 3300049583 Bacteria 1735
1168 Ga0501071_0160931 3300049587 Bacteria 1678
1169 Ga0501072_0268244 3300049588 Bacteria 1358
1170 Ga0501072_0668532 3300049588 Bacteria 817
1171 Ga0501073_0027611 3300049589 Bacteria 4058
1172 Ga0501074_0199351 3300049590 Bacteria 1427
1173 Ga0501074_1245829 3300049590 Bacteria 521
1174 Ga0501075_0128714 3300049591 Bacteria 1928
1175 Ga0501075_0943904 3300049591 Unclassified 656
1176 Ga0501076_0172087 3300049592 Bacteria 1765
1177 Ga0501076_0614934 3300049592 Archaea 896
1178 Ga0501209_276435 3300049656 Bacteria 527
1179 Ga0501079_0364108 3300049741 Bacteria 1133
1180 Ga0501080_0197445 3300049742 Bacteria 1848
1181 Ga0501080_0352406 3300049742 Bacteria 1329
1182 Ga0501080_1387493 3300049742 Bacteria 600
1183 Ga0501081_0070509 3300049743 Bacteria 2436
1184 Ga0501081_0816495 3300049743 Bacteria 702
1185 Ga0501083_0681606 3300049744 Bacteria 668
1186 Ga0501083_0687551 3300049744 Bacteria 665
1187 Ga0501083_0734432 3300049744 Bacteria 642
1188 Ga0501241_153142 3300049758 Bacteria 533
1189 Ga0501283_125442 3300049779 Archaea 517
1190 Ga0501045_0311354 3300049824 Bacteria 1172
1191 Ga0501045_0443247 3300049824 Bacteria 965
1192 nmdc:mga03683_83695_c1 3300050489 Bacteria 1382
1193 nmdc:mga00v17_18735_c1 3300050491 Bacteria 3938
1194 nmdc:mga00v17_21186_c1 3300050491 Bacteria 3735
1195 nmdc:mga00v17_703608_c1 3300050491 Unclassified 647
1196 nmdc:mga00v17_928877_c1 3300050491 Bacteria 550
1197 nmdc:mga0yw44_230243_c1 3300050492 Bacteria 1230
1198 nmdc:mga0k408_19429_c1 3300050493 Bacteria 3798
1199 nmdc:mga0k408_411859_c1 3300050493 Bacteria 804
1200 nmdc:mga0k408_641765_c1 3300050493 Bacteria 625
1201 nmdc:mga06z11_13291_c1 3300050494 Bacteria 3610
1202 nmdc:mga06z11_210315_c1 3300050494 Bacteria 1133
1203 nmdc:mga04h51_10238_c1 3300050495 Bacteria 2570
1204 nmdc:mga07m45_170269_c2 3300050496 Bacteria 580
1205 nmdc:mga05p37_107297_c1 3300050507 Bacteria 3436
1206 nmdc:mga05p37_111941_c1 3300050507 Bacteria 1779
1207 nmdc:mga05p37_13811_c1 3300050507 Bacteria 9675
1208 nmdc:mga05p37_251735_c1 3300050507 Bacteria 2118
1209 nmdc:mga05p37_2970_c1 3300050507 Bacteria 19691
1210 nmdc:mga05p37_298122_c1 3300050507 Unclassified 1916
1211 nmdc:mga05p37_97992_c1 3300050507 Bacteria 3612
1212 nmdc:mga05p37_985218_c1 3300050507 Unclassified 898
1213 nmdc:mga09592_1005353_c1 3300050508 Unclassified 697
1214 nmdc:mga09592_288458_c1 3300050508 Unclassified 1423
1215 nmdc:mga09592_56614_c1 3300050508 Bacteria 3313
1216 nmdc:mga0qj67_1292374_c1 3300050509 Unclassified 565
1217 nmdc:mga0qj67_863543_c1 3300050509 Bacteria 714
1218 nmdc:mga06r32_1173929_c1 3300050510 Bacteria 715
1219 nmdc:mga06r32_1471812_c1 3300050510 Bacteria 622
1220 nmdc:mga06r32_270678_c1 3300050510 Bacteria 1686
1221 nmdc:mga06r32_395908_c1 3300050510 Bacteria 1363
1222 nmdc:mga06r32_449667_c1 3300050510 Bacteria 1268
1223 nmdc:mga06r32_46286_c1 3300050510 Bacteria 4151
1224 nmdc:mga06r32_485745_c1 3300050510 Bacteria 1213
1225 nmdc:mga06r32_56468_c1 3300050510 Bacteria 3769
1226 nmdc:mga06r32_622944_c1 3300050510 Bacteria 1049
1227 nmdc:mga08y16_271887_c1 3300050511 Bacteria 1749
1228 nmdc:mga08y16_28291_c1 3300050511 Bacteria 5908
1229 nmdc:mga08y16_467_c1 3300050511 Bacteria 37584
1230 nmdc:mga08y16_665243_c1 3300050511 Bacteria 1044
1231 nmdc:mga0n895_116835_c1 3300050512 Bacteria 2687
1232 nmdc:mga0n895_1299623_c1 3300050512 Bacteria 698
1233 nmdc:mga0n895_249125_c1 3300050512 Bacteria 1803
1234 nmdc:mga0n895_36244_c1 3300050512 Bacteria 4763
1235 nmdc:mga0n895_4120_c1 3300050512 Bacteria 11850
1236 nmdc:mga0n895_442672_c1 3300050512 Bacteria 1313
1237 nmdc:mga0n895_525477_c1 3300050512 Unclassified 1191
1238 nmdc:mga0n895_5821_c1 3300050512 Bacteria 10358
1239 nmdc:mga0n895_68857_c1 3300050512 Bacteria 3506
1240 nmdc:mga0n895_702431_c1 3300050512 Bacteria 1007
1241 nmdc:mga0n895_8031_c1 3300050512 Bacteria 9103
1242 nmdc:mga0n895_835974_c1 3300050512 Bacteria 909
1243 nmdc:mga0rr50_17265_c1 3300050513 Bacteria 4815
1244 nmdc:mga0rr50_1737318_c1 3300050513 Unclassified 526
1245 nmdc:mga0rr50_540950_c1 3300050513 Bacteria 992
1246 nmdc:mga0rr50_61925_c1 3300050513 Bacteria 2821
1247 nmdc:mga0rr50_947507_c1 3300050513 Bacteria 734
1248 nmdc:mga08x19_1370987_c1 3300050514 Bacteria 501
1249 nmdc:mga08x19_153507_c1 3300050514 Archaea 1561
1250 nmdc:mga08x19_3157_c1 3300050514 Bacteria 9890
1251 nmdc:mga08x19_4367_c1 3300050514 Bacteria 8384
1252 nmdc:mga08x19_455183_c1 3300050514 Bacteria 901
1253 nmdc:mga08x19_539665_c1 3300050514 Bacteria 825
1254 nmdc:mga08x19_70106_c1 3300050514 Bacteria 2283
1255 nmdc:mga0a205_1037342_c1 3300050515 Unclassified 667
1256 nmdc:mga0a205_29183_c1 3300050515 Bacteria 5280
1257 nmdc:mga0a205_47745_c1 3300050515 Bacteria 4132
1258 nmdc:mga0a205_573497_c1 3300050515 Bacteria 983
1259 nmdc:mga0a205_723_c1 3300050515 Bacteria 26575
1260 nmdc:mga0a205_84159_c1 3300050515 Bacteria 3072
1261 Ga0495619_0613455 3300053085 Bacteria 744
1262 Ga0495619_1043928 3300053085 Unclassified 545
1263 Ga0500623_211582 3300053127 Bacteria 700
1264 Ga0500616_0000016 3300053153 Bacteria 627087
1265 Ga0500637_0132812 3300053178 Bacteria 1443
1266 Ga0501084_0884801 3300054114 Bacteria 751
1267 Ga0501082_0070904 3300060353 Bacteria 3000
1268 Ga0501082_0083596 3300060353 Bacteria 2754
1269 Ga0501082_0300541 3300060353 Bacteria 1398
1270 Ga0530510_0495457 3300061734 Unclassified 926
1271 Ga0530510_1406456 3300061734 Unclassified 535
1272 Ga0373939_0274533
1273 SwRhRL2b_contig_1325478
1274 CNBas_1011915
1275 JGI24749J21850_1062432
1276 JGI25405J52794_10000675
1277 Ga0065714_10135982
1278 Ga0065704_10000972
1279 Ga0065704_10550004
1280 Ga0065712_10134113
1281 Ga0065712_10208240
1282 Ga0065712_10273787
1283 Ga0065712_10273893
1284 Ga0065712_10324160
1285 Ga0065712_10694230
1286 Ga0065712_10762263
1287 Ga0065715_10021739
1288 Ga0065715_10161413
1289 Ga0065715_10226471
1290 Ga0065715_10376988
1291 Ga0065715_10405729
1292 Ga0065715_10466125
1293 Ga0065715_10767231
1294 Ga0065715_10784242
1295 Ga0065707_10036803
1296 Ga0065707_10058476
1297 Ga0065707_10573396
1298 Ga0065707_10630914
1299 Ga0070658_10972178
1300 Ga0070676_10043821
1301 Ga0070676_10276829
1302 Ga0070676_10458558
1303 Ga0070676_10476347
1304 Ga0070676_10566825
1305 Ga0070676_10622108
1306 Ga0070683_100014959
1307 Ga0070683_100231225
1308 Ga0070690_100073226
1309 Ga0070690_100281008
1310 Ga0070690_100612220
1311 Ga0070690_101626077
1312 Ga0070670_100002777
1313 Ga0070670_100021903
1314 Ga0070670_100618355
1315 Ga0070670_100858453
1316 Ga0070670_100916094
1317 Ga0070670_100963074
1318 Ga0070670_100963262
1319 Ga0070670_101392119
1320 Ga0070677_10003834
1321 Ga0070677_10210968
1322 Ga0068869_100422262
1323 Ga0068869_102146078
1324 Ga0070666_10004055
1325 Ga0070666_10029261
1326 Ga0070666_10333829
1327 Ga0070666_10671639
1328 Ga0070680_100238725
1329 Ga0070682_100348184
1330 Ga0068868_100012517
1331 Ga0068868_100685926
1332 Ga0068868_101038862
1333 Ga0068868_101179454
1334 Ga0068868_101456554
1335 Ga0070660_101001206
1336 Ga0070689_100036807
1337 Ga0070689_100071852
1338 Ga0070689_100264772
1339 Ga0070689_100373121
1340 Ga0070689_100716846
1341 Ga0070691_10166979
1342 Ga0070691_10197554
1343 Ga0070691_10335974
1344 Ga0070687_100004985
1345 Ga0070687_100461147
1346 Ga0070687_100564912
1347 Ga0070661_100827105
1348 Ga0070661_101093080
1349 Ga0070692_10003691
1350 Ga0070668_100032074
1351 Ga0070668_100184452
1352 Ga0070668_100199599
1353 Ga0070668_100414385
1354 Ga0070668_100535253
1355 Ga0070668_100880305
1356 Ga0070668_101568540
1357 Ga0070669_100000073
1358 Ga0070669_100012143
1359 Ga0070669_100057648
1360 Ga0070669_100093374
1361 Ga0070669_100197216
1362 Ga0070669_100202377
1363 Ga0070669_100829133
1364 Ga0070669_101016939
1365 Ga0070669_101598192
1366 Ga0070669_101814899
1367 Ga0070675_100002536
1368 Ga0070675_100032122
1369 Ga0070675_100036567
1370 Ga0070675_100052248
1371 Ga0070675_100061543
1372 Ga0070675_100104551
1373 Ga0070675_100140989
1374 Ga0070675_100598522
1375 Ga0070675_100776932
1376 Ga0070675_100989895
1377 Ga0070675_101585397
1378 Ga0070675_101813530
1379 Ga0070671_100115860
1380 Ga0070671_100191742
1381 Ga0070671_100208357
1382 Ga0070671_100483600
1383 Ga0070671_101020190
1384 Ga0070674_100000065
1385 Ga0070674_100101828
1386 Ga0070674_100175566
1387 Ga0070674_100193792
1388 Ga0070674_100204726
1389 Ga0070674_100555396
1390 Ga0070674_100726616
1391 Ga0070674_101240070
1392 Ga0070674_101341459
1393 Ga0070674_101989181
1394 Ga0070673_100011356
1395 Ga0070673_100114329
1396 Ga0070673_100147768
1397 Ga0070673_100465160
1398 Ga0070673_100477795
1399 Ga0070673_100601574
1400 Ga0070673_100996509
1401 Ga0070673_101449720
1402 Ga0070688_100003519
1403 Ga0070688_100011229
1404 Ga0070688_100080273
1405 Ga0070688_100155141
1406 Ga0070688_100745840
1407 Ga0070688_100769161
1408 Ga0070659_100784942
1409 Ga0070659_100839706
1410 Ga0070659_101397707
1411 Ga0070667_100189187
1412 Ga0070667_100305584
1413 Ga0070667_100366381
1414 Ga0070667_100442406
1415 Ga0070703_10006146
1416 Ga0070703_10078829
1417 Ga0070709_10000039
1418 Ga0070709_11764671
1419 Ga0070714_100282555
1420 Ga0070713_100107328
1421 Ga0070713_100134864
1422 Ga0070713_100403430
1423 Ga0070713_101479261
1424 Ga0070710_10238947
1425 Ga0070701_10062097
1426 Ga0070701_10080778
1427 Ga0070701_10347456
1428 Ga0070701_10658145
1429 Ga0070701_11243686
1430 Ga0070711_100000175
1431 Ga0070711_100688830
1432 Ga0070711_100994459
1433 Ga0070711_101060289
1434 Ga0070711_101145923
1435 Ga0070705_100003759
1436 Ga0070705_100013476
1437 Ga0070705_100041961
1438 Ga0070705_101254845
1439 Ga0070705_101440197
1440 Ga0070700_100043909
1441 Ga0070700_100082136
1442 Ga0070700_100462379
1443 Ga0070700_100549414
1444 Ga0070700_100723462
1445 Ga0070694_100005274
1446 Ga0070694_100027057
1447 Ga0070694_100040687
1448 Ga0070694_100051015
1449 Ga0070694_100056768
1450 Ga0070694_100173174
1451 Ga0070708_100011689
1452 Ga0070708_100047851
1453 Ga0070708_100050957
1454 Ga0070708_100122591
1455 Ga0070708_100273015
1456 Ga0070708_100296901
1457 Ga0070708_100412850
1458 Ga0070708_100661673
1459 Ga0070708_100761277
1460 Ga0070708_101657300
1461 Ga0070708_101763369
1462 Ga0070708_102039187
1463 Ga0070663_100136201
1464 Ga0070663_101531695
1465 Ga0070663_101609306
1466 Ga0070678_100002433
1467 Ga0070678_100030091
1468 Ga0070678_100269284
1469 Ga0070678_100283554
1470 Ga0070678_100283852
1471 Ga0070678_100374122
1472 Ga0070678_100394034
1473 Ga0070678_100518589
1474 Ga0070678_100982814
1475 Ga0070678_101492257
1476 Ga0070678_101966483
1477 Ga0070662_100072558
1478 Ga0070662_100074720
1479 Ga0070662_100127454
1480 Ga0070662_100189861
1481 Ga0070662_100215701
1482 Ga0070662_101587430
1483 Ga0070681_12022479
1484 Ga0068867_100321954
1485 Ga0068867_100360422
1486 Ga0068867_101980292
1487 Ga0068867_102224489
1488 Ga0070685_10140832
1489 Ga0070685_10373071
1490 Ga0070685_10636640
1491 Ga0070685_10680885
1492 Ga0070685_10731551
1493 Ga0070706_100000015
1494 Ga0070706_100002614
1495 Ga0070706_100114283
1496 Ga0070706_100247101
1497 Ga0070706_100349336
1498 Ga0070706_100658559
1499 Ga0070706_100709477
1500 Ga0070706_100829080
1501 Ga0070707_100002849
1502 Ga0070707_100011801
1503 Ga0070707_100013501
1504 Ga0070707_100026839
1505 Ga0070707_100032997
1506 Ga0070707_100058551
1507 Ga0070707_100130535
1508 Ga0070707_100167085
1509 Ga0070707_100293252
1510 Ga0070707_100517436
1511 Ga0070707_100879606
1512 Ga0070707_100940404
1513 Ga0070707_101510391
1514 Ga0070698_100010122
1515 Ga0070698_100021189
1516 Ga0070698_100117383
1517 Ga0070698_100263669
1518 Ga0070698_100461995
1519 Ga0070698_100491862
1520 Ga0070698_101100228
1521 Ga0070698_101235076
1522 Ga0070698_101800780
1523 Ga0070699_100000608
1524 Ga0070699_100032222
1525 Ga0070699_100100672
1526 Ga0070699_100759929
1527 Ga0070699_100837203
1528 Ga0070699_101926410
1529 Ga0070699_102044924
1530 Ga0070679_100382061
1531 Ga0070679_100912409
1532 Ga0070684_100025070
1533 Ga0070684_100080309
1534 Ga0070684_100091653
1535 Ga0070684_100499245
1536 Ga0070684_101614010
1537 Ga0070697_100000055
1538 Ga0070697_100000211
1539 Ga0070697_100004761
1540 Ga0070697_100005118
1541 Ga0070697_100040555
1542 Ga0070697_100152218
1543 Ga0070697_100198417
1544 Ga0070697_100308299
1545 Ga0070697_100565319
1546 Ga0070697_100717769
1547 Ga0070697_101412971
1548 Ga0070697_101686633
1549 Ga0070697_101926720
1550 Ga0070697_102119551
1551 Ga0070672_100008521
1552 Ga0070672_100061083
1553 Ga0070672_100088168
1554 Ga0070672_100113256
1555 Ga0070672_100201034
1556 Ga0070672_100347856
1557 Ga0070672_100468207
1558 Ga0070672_100505679
1559 Ga0070672_100594715
1560 Ga0070672_100715346
1561 Ga0070672_100761488
1562 Ga0070686_100094902
1563 Ga0070686_100406713
1564 Ga0070686_101466818
1565 Ga0070695_100009503
1566 Ga0070695_100059283
1567 Ga0070695_100082445
1568 Ga0070695_101177907
1569 Ga0070696_100018324
1570 Ga0070696_100057483
1571 Ga0070696_100163355
1572 Ga0070696_100272468
1573 Ga0070696_100373022
1574 Ga0070696_100752481
1575 Ga0070696_101018841
1576 Ga0070693_100036650
1577 Ga0070693_100082976
1578 Ga0070693_100291316
1579 Ga0070693_100880664
1580 Ga0070665_100003269
1581 Ga0070665_100201149
1582 Ga0070665_100339620
1583 Ga0070665_101261834
1584 Ga0070665_101304850
1585 Ga0070665_102497134
1586 Ga0070704_100006221
1587 Ga0070704_100097781
1588 Ga0070704_100235312
1589 Ga0070704_100652902
1590 Ga0070704_100960614
1591 Ga0070704_101329080
1592 Ga0068855_100427414
1593 Ga0070664_100020404
1594 Ga0070664_100098132
1595 Ga0070664_100330400
1596 Ga0070664_100447357
1597 Ga0070664_100753775
1598 Ga0070664_100940286
1599 Ga0070664_101245847
1600 Ga0070664_101355953
1601 Ga0068857_100419106
1602 Ga0068857_101985607
1603 Ga0068854_100047363
1604 Ga0068854_100480338
1605 Ga0068854_100749367
1606 Ga0068854_100877793
1607 Ga0068856_101791829
1608 Ga0068856_102166555
1609 Ga0070702_100116715
1610 Ga0070702_100280316
1611 Ga0070702_100579709
1612 Ga0070702_100706071
1613 Ga0070702_101473182
1614 Ga0068852_100349675
1615 Ga0068852_101514198
1616 Ga0068859_100008697
1617 Ga0068859_100077677
1618 Ga0068859_100135271
1619 Ga0068859_100250959
1620 Ga0068859_100470343
1621 Ga0068859_100866287
1622 Ga0068859_101357913
1623 Ga0068859_101440450
1624 Ga0068859_102974710
1625 Ga0068864_100001129
1626 Ga0068864_100017094
1627 Ga0068864_100127804
1628 Ga0068864_100178435
1629 Ga0068864_102226046
1630 Ga0068866_10051453
1631 Ga0068866_10246658
1632 Ga0068866_10508886
1633 Ga0068866_10592789
1634 Ga0068866_10923880
1635 Ga0068866_11285429
1636 Ga0068861_100078384
1637 Ga0068861_100221541
1638 Ga0068861_100580080
1639 Ga0068861_100722386
1640 Ga0068851_10066339
1641 Ga0068851_10425208
1642 Ga0068870_10145491
1643 Ga0068870_10546788
1644 Ga0068870_10570078
1645 Ga0068870_10792267
1646 Ga0068870_11407240
1647 Ga0068863_100064523
1648 Ga0068863_100186000
1649 Ga0068863_100459658
1650 Ga0068863_100607609
1651 Ga0068863_100673423
1652 Ga0068863_100787338
1653 Ga0068863_100904803
1654 Ga0068863_101236951
1655 Ga0068858_100013639
1656 Ga0068858_100014123
1657 Ga0068858_100045365
1658 Ga0068858_100057051
1659 Ga0068858_100100053
1660 Ga0068858_100604251
1661 Ga0068858_101054399
1662 Ga0068858_101084557
1663 Ga0068858_101562209
1664 Ga0068860_100038999
1665 Ga0068860_100173360
1666 Ga0068860_100721606
1667 Ga0068860_101066562
1668 Ga0068860_101389707
1669 Ga0068862_100032713
1670 Ga0068862_100108737
1671 Ga0068862_100252855
1672 Ga0068862_100335902
1673 Ga0068862_100506845
1674 Ga0068862_100628591
1675 Ga0068862_100743176
1676 Ga0068862_101180729
1677 Ga0068862_101461756
1678 Ga0068862_102414069
1679 Ga0081455_10000821
1680 Ga0081455_10043103
1681 Ga0081455_10391635
1682 Ga0081539_10050465
1683 Ga0081539_10055532
1684 Ga0070717_10016916
1685 Ga0075365_10009341
1686 Ga0075365_10738402
1687 Ga0075368_10072111
1688 Ga0075364_10010576
1689 Ga0075364_10164151
1690 Ga0075364_10444393
1691 Ga0075364_10979603
1692 Ga0075432_10148563
1693 Ga0075432_10155754
1694 Ga0070715_10466106
1695 Ga0070716_101092369
1696 Ga0070712_100541878
1697 Ga0075362_10053768
1698 Ga0075367_10003423
1699 Ga0075367_10187440
1700 Ga0075367_10243004
1701 Ga0075366_10001519
1702 Ga0075366_10327073
1703 Ga0097621_100073911
1704 Ga0097621_100205754
1705 Ga0097621_100378390
1706 Ga0097621_100822943
1707 Ga0097621_100945964
1708 Ga0097621_101257333
1709 Ga0075370_10158959
1710 Ga0075370_10838930
1711 Ga0068871_100187765
1712 Ga0068871_100340699
1713 Ga0068871_100376844
1714 Ga0068871_100495748
1715 Ga0068871_100594232
1716 Ga0068871_100911344
1717 Ga0075428_100033706
1718 Ga0075428_100058028
1719 Ga0075428_100119552
1720 Ga0075428_100188842
1721 Ga0075428_100425357
1722 Ga0075428_100446449
1723 Ga0075428_100691232
1724 Ga0075430_100087873
1725 Ga0075430_100988017
1726 Ga0075430_101505380
1727 Ga0075431_100007116
1728 Ga0075431_100010770
1729 Ga0075431_100033300
1730 Ga0075431_100113822
1731 Ga0075431_100235327
1732 Ga0075431_100406724
1733 Ga0075431_100806267
1734 Ga0075431_100848933
1735 Ga0075431_100938592
1736 Ga0075431_100967510
1737 Ga0075433_10000040
1738 Ga0075433_10033057
1739 Ga0075433_10172229
1740 Ga0075433_10332036
1741 Ga0075433_10421547
1742 Ga0075433_10556099
1743 Ga0075433_11092984
1744 Ga0075433_11410121
1745 Ga0075433_11556342
1746 Ga0075434_100001061
1747 Ga0075434_100063595
1748 Ga0075434_100067711
1749 Ga0075434_100161665
1750 Ga0075434_100198951
1751 Ga0075434_100432111
1752 Ga0075434_100607750
1753 Ga0075434_100842659
1754 Ga0075434_100884925
1755 Ga0075434_101480480
1756 Ga0075429_100041964
1757 Ga0075429_100300408
1758 Ga0075429_100353883
1759 Ga0075429_101057904
1760 Ga0075429_101918104
1761 Ga0068865_100094661
1762 Ga0068865_101538467
1763 Ga0068865_101704517
1764 Ga0075436_100029502
1765 Ga0075436_100033217
1766 Ga0075436_100073217
1767 Ga0075436_100141822
1768 Ga0075436_100216617
1769 Ga0075436_100754515
1770 Ga0075436_100898041
1771 Ga0075436_101439356
1772 Ga0075436_101454186
1773 Ga0097620_100008697
1774 Ga0097620_100077676
1775 Ga0097620_100135276
1776 Ga0097620_100250951
1777 Ga0097620_100470346
1778 Ga0097620_100866292
1779 Ga0097620_101358029
1780 Ga0097620_101440780
1781 Ga0097620_102975345
1782 Ga0075435_100010221
1783 Ga0075435_100045628
1784 Ga0075435_100786148
1785 Ga0075435_101061155
1786 Ga0075435_101560147
1787 Ga0099794_10037262
1788 Ga0099794_10251432
1789 Ga0099794_10317411
1790 Ga0099795_10000017
1791 Ga0105240_10141019
1792 Ga0111539_10000484
1793 Ga0111539_10001724
1794 Ga0111539_10353603
1795 Ga0111539_11006958
1796 Ga0111539_11334000
1797 Ga0105245_10014790
1798 Ga0105245_10066632
1799 Ga0105245_10111253
1800 Ga0105245_10157804
1801 Ga0105245_10465223
1802 Ga0105245_10575832
1803 Ga0105245_10825253
1804 Ga0105247_10006298
1805 Ga0114129_10008151
1806 Ga0114129_10021654
1807 Ga0114129_10039516
1808 Ga0114129_10074040
1809 Ga0114129_10076941
1810 Ga0114129_10108581
1811 Ga0114129_10136479
1812 Ga0114129_10156174
1813 Ga0114129_10196276
1814 Ga0114129_10212967
1815 Ga0114129_10648647
1816 Ga0114129_10778976
1817 Ga0114129_11062784
1818 Ga0114129_11101577
1819 Ga0114129_11700064
1820 Ga0114129_11785882
1821 Ga0105243_10139896
1822 Ga0105243_11333013
1823 Ga0105243_12048611
1824 Ga0105243_12447834
1825 Ga0105243_12877666
1826 Ga0105243_13007238
1827 Ga0105241_10768575
1828 Ga0105241_11598258
1829 Ga0105242_10007687
1830 Ga0105242_10040320
1831 Ga0105242_11290537
1832 Ga0105242_11400374
1833 Ga0105242_12350316
1834 Ga0105248_10004031
1835 Ga0105248_10139420
1836 Ga0105248_10225960
1837 Ga0105248_10262578
1838 Ga0105248_10291129
1839 Ga0105248_10361536
1840 Ga0105248_10679795
1841 Ga0105248_10938903
1842 Ga0105248_11006815
1843 Ga0105248_11054246
1844 Ga0105248_11710616
1845 Ga0105248_12013164
1846 Ga0105238_10889583
1847 Ga0105238_12832804
1848 Ga0105249_10130399
1849 Ga0105249_10186786
1850 Ga0105249_10332899
1851 Ga0105249_10336422
1852 Ga0105249_10413061
1853 Ga0105249_10454929
1854 Ga0105249_10636438
1855 Ga0105249_10705927
1856 Ga0105249_10955709
1857 Ga0105249_11329688
1858 Ga0105249_11677255
1859 Ga0105249_11704474
1860 Ga0105249_12475715
1861 Ga0099796_10000009
1862 Ga0099796_10000089
1863 Ga0099796_10209017
1864 Ga0099796_10511704
1865 Ga0099796_10528038
1866 Ga0105239_13281881
1867 Ga0105246_10310720
1868 Ga0105246_10674793
1869 Ga0157339_1006993
1870 Ga0157324_1063183
1871 Ga0157373_10188462
1872 Ga0157370_10169989
1873 Ga0157370_10206353
1874 Ga0157374_10008650
1875 Ga0157374_10130436
1876 Ga0157374_10186694
1877 Ga0157374_12134916
1878 Ga0157374_12780118
1879 Ga0157378_10004278
1880 Ga0157378_10053454
1881 Ga0157378_10227427
1882 Ga0157378_10411562
1883 Ga0157378_10414620
1884 Ga0157378_10637580
1885 Ga0157378_10668804
1886 Ga0157378_10825308
1887 Ga0157378_11133144
1888 Ga0157378_11478498
1889 Ga0157378_11696692
1890 Ga0157378_13200816
1891 Ga0163162_10215990
1892 Ga0163162_10307337
1893 Ga0163162_11901448
1894 Ga0163162_12746234
1895 Ga0157375_10549984
1896 Ga0157375_10802143
1897 Ga0157375_11173830
1898 Ga0157375_11493188
1899 Ga0157375_12457083
1900 Ga0163163_10006254
1901 Ga0163163_10006835
1902 Ga0163163_10490769
1903 Ga0163163_10775825
1904 Ga0163163_12139447
1905 Ga0157380_10014976
1906 Ga0157380_10032156
1907 Ga0157380_10585169
1908 Ga0157380_11170793
1909 Ga0157380_11601852
1910 Ga0157380_12798752
1911 Ga0157377_10199814
1912 Ga0157377_10768708
1913 Ga0157377_11007106
1914 Ga0157377_11573241
1915 Ga0157379_10001408
1916 Ga0157379_10032125
1917 Ga0157379_10052585
1918 Ga0157379_10169206
1919 Ga0157379_10895316
1920 Ga0157376_10455547
1921 Ga0157376_10989419
1922 Ga0182007_10013977
1923 Ga0163161_11695867
1924 Ga0163161_12038792
1925 Ga0206354_11301016
1926 Ga0206353_11684825
1927 Ga0213876_10275008
1928 Ga0207697_10045146
1929 Ga0207656_10151047
1930 Ga0207656_10277661
1931 Ga0207656_10625645
1932 Ga0207653_10005831
1933 Ga0207653_10094590
1934 Ga0207682_10004858
1935 Ga0207682_10152299
1936 Ga0207642_10018049
1937 Ga0207642_10448752
1938 Ga0207642_10581048
1939 Ga0207642_10905439
1940 Ga0207642_11038044
1941 Ga0207710_10006780
1942 Ga0207710_10136273
1943 Ga0207688_10309398
1944 Ga0207688_10358701
1945 Ga0207688_10723628
1946 Ga0207688_10757317
1947 Ga0207680_10292280
1948 Ga0207680_10616690
1949 Ga0207680_10743722
1950 Ga0207680_11238161
1951 Ga0207699_10000023
1952 Ga0207645_10023379
1953 Ga0207645_10217964
1954 Ga0207645_10298410
1955 Ga0207645_10318033
1956 Ga0207645_10330059
1957 Ga0207645_10415190
1958 Ga0207645_10535740
1959 Ga0207643_10001060
1960 Ga0207643_10326391
1961 Ga0207643_10561734
1962 Ga0207643_10829900
1963 Ga0207684_10006738
1964 Ga0207684_10009566
1965 Ga0207684_10021789
1966 Ga0207684_10126190
1967 Ga0207684_10326624
1968 Ga0207684_10470015
1969 Ga0207684_10733465
1970 Ga0207707_10078280
1971 Ga0207707_10313211
1972 Ga0207695_10174028
1973 Ga0207695_10331905
1974 Ga0207671_10528750
1975 Ga0207693_10333318
1976 Ga0207663_10000031
1977 Ga0207663_10922673
1978 Ga0207663_11263878
1979 Ga0207662_10001711
1980 Ga0207657_11215797
1981 Ga0207649_10262245
1982 Ga0207649_10275383
1983 Ga0207646_10001692
1984 Ga0207646_10003600
1985 Ga0207646_10003938
1986 Ga0207646_10004852
1987 Ga0207646_10005464
1988 Ga0207646_10047286
1989 Ga0207646_10059650
1990 Ga0207646_10080091
1991 Ga0207646_10095513
1992 Ga0207646_10434549
1993 Ga0207646_10455518
1994 Ga0207646_11100322
1995 Ga0207646_11525674
1996 Ga0207681_10000064
1997 Ga0207681_10017882
1998 Ga0207681_10085715
1999 Ga0207681_10140924
2000 Ga0207681_10192732
2001 Ga0207681_10422882
2002 Ga0207681_10897410
2003 Ga0207650_10028536
2004 Ga0207650_10058162
2005 Ga0207650_10138866
2006 Ga0207650_10524128
2007 Ga0207650_10678959
2008 Ga0207650_10741173
2009 Ga0207659_10015264
2010 Ga0207659_10044689
2011 Ga0207659_10080516
2012 Ga0207659_10087690
2013 Ga0207659_10524266
2014 Ga0207659_11121636
2015 Ga0207687_10154461
2016 Ga0207687_10204581
2017 Ga0207687_10221861
2018 Ga0207687_11325478
2019 Ga0207700_10206065
2020 Ga0207700_11136601
2021 Ga0207644_10085596
2022 Ga0207644_10657619
2023 Ga0207690_10310534
2024 Ga0207690_10968524
2025 Ga0207706_10097660
2026 Ga0207706_10169041
2027 Ga0207706_10242797
2028 Ga0207706_10255467
2029 Ga0207706_10955991
2030 Ga0207686_10005569
2031 Ga0207686_10584242
2032 Ga0207686_10693284
2033 Ga0207709_10388498
2034 Ga0207709_10735220
2035 Ga0207709_11322916
2036 Ga0207670_10107049
2037 Ga0207670_10419618
2038 Ga0207670_10460957
2039 Ga0207670_10474271
2040 Ga0207670_11016129
2041 Ga0207669_10154591
2042 Ga0207669_10260742
2043 Ga0207669_10464312
2044 Ga0207669_10676009
2045 Ga0207669_10933999
2046 Ga0207669_11018242
2047 Ga0207669_11267168
2048 Ga0207704_10056577
2049 Ga0207704_10157512
2050 Ga0207704_10429917
2051 Ga0207704_11554687
2052 Ga0207704_11565564
2053 Ga0207665_10233653
2054 Ga0207665_10261972
2055 Ga0207665_10650410
2056 Ga0207691_10007528
2057 Ga0207691_10015658
2058 Ga0207691_10019449
2059 Ga0207691_10122999
2060 Ga0207691_10129489
2061 Ga0207691_10395324
2062 Ga0207691_10526321
2063 Ga0207691_10639497
2064 Ga0207691_10658500
2065 Ga0207691_11573019
2066 Ga0207691_11648515
2067 Ga0207711_10012622
2068 Ga0207711_10069821
2069 Ga0207711_10180021
2070 Ga0207711_10247926
2071 Ga0207711_10449756
2072 Ga0207711_10658882
2073 Ga0207711_10769294
2074 Ga0207711_11117851
2075 Ga0207711_11259584
2076 Ga0207711_11277719
2077 Ga0207689_10408010
2078 Ga0207689_11703167
2079 Ga0207661_10022960
2080 Ga0207661_10374966
2081 Ga0207661_11418374
2082 Ga0207679_10012937
2083 Ga0207679_10027297
2084 Ga0207679_10029451
2085 Ga0207679_10068246
2086 Ga0207679_10603766
2087 Ga0207679_10789091
2088 Ga0207679_12148998
2089 Ga0207679_12169341
2090 Ga0207667_10351254
2091 Ga0207667_10981776
2092 Ga0207667_11766120
2093 Ga0207651_10023503
2094 Ga0207651_10048304
2095 Ga0207651_10103409
2096 Ga0207651_10137105
2097 Ga0207651_10143980
2098 Ga0207651_10482476
2099 Ga0207651_10689503
2100 Ga0207651_10772229
2101 Ga0207651_11222946
2102 Ga0207712_10118849
2103 Ga0207712_10151618
2104 Ga0207712_10425597
2105 Ga0207712_10459783
2106 Ga0207712_10530280
2107 Ga0207668_10071130
2108 Ga0207668_10118998
2109 Ga0207668_10266965
2110 Ga0207668_10348285
2111 Ga0207668_10831594
2112 Ga0207668_11029867
2113 Ga0207668_11612876
2114 Ga0207640_10061451
2115 Ga0207640_10458382
2116 Ga0207640_10822297
2117 Ga0207658_10125849
2118 Ga0207658_10149515
2119 Ga0207658_10158074
2120 Ga0207658_10228029
2121 Ga0207658_11026219
2122 Ga0207658_11077416
2123 Ga0207658_11647786
2124 Ga0207677_10008333
2125 Ga0207677_10312396
2126 Ga0207677_10364757
2127 Ga0207677_10561181
2128 Ga0207677_11415540
2129 Ga0207703_10021760
2130 Ga0207703_10079223
2131 Ga0207703_10079435
2132 Ga0207703_10152681
2133 Ga0207703_10433297
2134 Ga0207639_10510078
2135 Ga0207678_10266086
2136 Ga0207678_11872328
2137 Ga0207708_10003426
2138 Ga0207708_10027011
2139 Ga0207708_10156898
2140 Ga0207708_10178037
2141 Ga0207708_10574709
2142 Ga0207708_11286266
2143 Ga0207641_10039685
2144 Ga0207641_10050023
2145 Ga0207641_10296150
2146 Ga0207641_10352849
2147 Ga0207641_10368364
2148 Ga0207641_10373720
2149 Ga0207641_10485337
2150 Ga0207641_10493469
2151 Ga0207641_11142077
2152 Ga0207641_11823410
2153 Ga0207641_12226020
2154 Ga0207648_10005264
2155 Ga0207648_10134922
2156 Ga0207648_10185062
2157 Ga0207648_10259120
2158 Ga0207648_10279365
2159 Ga0207648_10607092
2160 Ga0207648_10846798
2161 Ga0207648_11596198
2162 Ga0207648_11932240
2163 Ga0207676_10010293
2164 Ga0207676_10024045
2165 Ga0207676_10045265
2166 Ga0207676_10265493
2167 Ga0207676_11210805
2168 Ga0207676_11433915
2169 Ga0207676_12485514
2170 Ga0207676_12518906
2171 Ga0207674_10185403
2172 Ga0207674_11948405
2173 Ga0207674_12206841
2174 Ga0207675_100020890
2175 Ga0207675_100037639
2176 Ga0207675_100060822
2177 Ga0207675_100071495
2178 Ga0207675_100268115
2179 Ga0207683_10004055
2180 Ga0207683_10024258
2181 Ga0207683_10031272
2182 Ga0207683_10223248
2183 Ga0207683_10226369
2184 Ga0207683_10314786
2185 Ga0207683_11004712
2186 Ga0207698_10243694
2187 Ga0209179_1000001
2188 Ga0209179_1000015
2189 Ga0209982_1009016
2190 Ga0209998_10028911
2191 Ga0209813_10021610
2192 Ga0209974_10000567
2193 Ga0207428_10359166
2194 Ga0207428_10670763
2195 Ga0268266_10002152
2196 Ga0268266_10195667
2197 Ga0268265_10189077
2198 Ga0268265_10350983
2199 Ga0268265_10444939
2200 Ga0268265_10475405
2201 Ga0268265_10910755
2202 Ga0268265_11360280
2203 Ga0268265_11455157
2204 Ga0268265_11883566
2205 Ga0268264_10028925
2206 Ga0268264_10388342
2207 Ga0268264_10476492
2208 Ga0268264_10569934
2209 Ga0268264_10630112
2210 Ga0268264_11245555
2211 Ga0268264_11825636
2212 Ga0265318_10041069
2213 Ga0265336_10165074
2214 Ga0265328_10031126
2215 Ga0265325_10171330
2216 Ga0265340_10098704
2217 Ga0265339_10415038
2218 Ga0265316_10212075
2219 Ga0307509_10515349
2220 Ga0307408_101835844
2221 Ga0307408_102156194
2222 Ga0265314_10165024
2223 Ga0265342_10104078
2224 Ga0307405_11187183
2225 Ga0307413_10046998
2226 Ga0307413_10520306
2227 Ga0307410_10030657
2228 Ga0307410_10160891
2229 Ga0307410_10613929
2230 Ga0307410_10754606
2231 Ga0307406_10913972
2232 Ga0307407_10063689
2233 Ga0307407_10216323
2234 Ga0307412_10277747
2235 Ga0307409_100152771
2236 Ga0307409_100196639
2237 Ga0307409_100456639
2238 Ga0307409_101485049
2239 Ga0307409_102697677
2240 Ga0307416_100088348
2241 Ga0307416_100322175
2242 Ga0307416_101483069
2243 Ga0307416_102551865
2244 Ga0307411_10756925
2245 Ga0307415_100586432
2246 Ga0307415_102178796
2247 Ga0316583_10001467
2248 Ga0373926_0095681
2249 Ga0373926_0196350
2250 Ga0373926_0418256
2251 Ga0373929_0170438
2252 Ga0373944_0017388
2253 Ga0373949_0038135
2254 Ga0373923_0045083
2255 Ga0373932_0076252
2256 Ga0373936_0607293
2257 Ga0373939_0090351
2258 Ga0373941_0194251
2259 Ga0373945_0069266
2260 Ga0373945_0240489
2261 Ga0373945_0261789
2262 Ga0373953_0310144
2263 Ga0373943_0013767
2264 Ga0373943_0579837
2265 Ga0373943_0879364
2266 Ga0373943_0993497
2267 Ga0373946_0022927
2268 Ga0373946_0304193
2269 Ga0373955_0118534
2270 Ga0373942_0197350
2271 Ga0373962_0007056
2272 Ga0316574_0904136
2273 Ga0373931_0048208
2274 Ga0373931_0286151
2275 Ga0373931_0956388
2276 Ga0373931_0974749
2277 Ga0373935_0019946
2278 Ga0373935_0034596
2279 Ga0373935_0579578
2280 Ga0373935_0644155
2281 Ga0373935_1104464
2282 Ga0373927_0167770
2283 Ga0373933_0806101
2284 Ga0373933_1181000
2285 Ga0373947_0034785
2286 Ga0373947_1036951
2287 Ga0373937_0173687
2288 Ga0373937_0471506
2289 Ga0373937_0874770
2290 Ga0373937_1035198
2291 Ga0373937_1675434
2292 Ga0316584_0058550
2293 Ga0373925_0015617
2294 Ga0373925_0044305
2295 Ga0373925_0225157
2296 Ga0373925_1055567
2297 Ga0395900_0517987
2298 Ga0436365_0041363
2299 Ga0451789_0328186
2300 Ga0451797_0789507
2301 Ga0451795_1365508
2302 Ga0451839_1144603
2303 Ga0451843_1069817
2304 Ga0451853_2180419
2305 Ga0450891_010962
2306 Ga0439435_0323966
2307 Ga0450916_051189
2308 Ga0451577_0263402
2309 Ga0451577_0495844
2310 Ga0451577_0649304
2311 Ga0453683_0590287
2312 Ga0451576_0100573
2313 Ga0451576_0103412
2314 Ga0451576_0423453
2315 Ga0451576_0459410
2316 Ga0451576_1372917
2317 Ga0495592_0357237
2318 Ga0495603_0085623
2319 Ga0495603_0094591
2320 Ga0495629_0237566
2321 Ga0495629_0274881
2322 Ga0495629_0302169
2323 Ga0495641_0400569
2324 Ga0495651_0269580
2325 Ga0495580_0119518
2326 Ga0495580_0494751
2327 Ga0495580_0631108
2328 Ga0495580_1082995
2329 Ga0495605_0361326
2330 Ga0495662_0632628
2331 Ga0495584_0075300
2332 Ga0495584_0617715
2333 Ga0495585_0119943
2334 Ga0495585_0306465
2335 Ga0495594_0010462
2336 Ga0495594_0027389
2337 Ga0495594_0162949
2338 Ga0495594_0169262
2339 Ga0495607_0088895
2340 Ga0495628_0108801
2341 Ga0495630_1125655
2342 Ga0495644_0236979
2343 Ga0495666_0474726
2344 Ga0495665_0652103
2345 Ga0495586_0217909
2346 Ga0495598_0073956
2347 Ga0495598_0170116
2348 Ga0495609_0201003
2349 Ga0495621_0016693
2350 Ga0495621_0144666
2351 Ga0495621_0177006
2352 Ga0495621_0260271
2353 Ga0495621_0459467
2354 Ga0495633_0360076
2355 Ga0495667_0477851
2356 Ga0495611_0074577
2357 Ga0495659_0109953
2358 Ga0495659_0115172
2359 Ga0495659_0410428
2360 Ga0495659_0468018
2361 Ga0495588_0016996
2362 Ga0495588_0025036
2363 Ga0495588_0035015
2364 Ga0495657_0733532
2365 Ga0495599_0281288
2366 Ga0495647_0005694
2367 Ga0495647_0010820
2368 Ga0495658_0021488
2369 Ga0495658_0441398
2370 Ga0495658_0729534
2371 Ga0495669_0015569
2372 Ga0495669_0149347
2373 Ga0495669_0264515
2374 Ga0495670_0211288
2375 Ga0495581_0074031
2376 Ga0495581_0224272
2377 Ga0495676_0009175
2378 Ga0495680_0573246
2379 Ga0495677_0414956
2380 Ga0495684_0095992
2381 Ga0495684_0187689
2382 Ga0496100_0729941
2383 Ga0496100_1060488
2384 Ga0496101_1457210
2385 Ga0496102_0817100
2386 Ga0496102_1969153
2387 Ga0496104_0107103
2388 Ga0496104_0114096
2389 Ga0496104_0167226
2390 Ga0496104_0207554
2391 Ga0496104_0358902
2392 Ga0496105_0073529
2393 Ga0496105_0216491
2394 Ga0496105_0536542
2395 Ga0496105_1135771
2396 Ga0496106_0067050
2397 Ga0496106_0164244
2398 Ga0496106_0383119
2399 Ga0496106_0400816
2400 Ga0496106_0566961
2401 Ga0496106_0719857
2402 Ga0496107_0234907
2403 Ga0496107_0329617
2404 Ga0496107_0531353
2405 Ga0496108_0022458
2406 Ga0496109_1449459
2407 Ga0496111_0124297
2408 Ga0496111_0605583
2409 Ga0496112_0001807
2410 Ga0496112_0029406
2411 Ga0496112_0775549
2412 Ga0496112_0821437
2413 Ga0496112_1151945
2414 Ga0496113_0026090
2415 Ga0496113_0415341
2416 Ga0496113_0722901
2417 Ga0496114_0149607
2418 Ga0496114_0218368
2419 Ga0496114_0725551
2420 Ga0496114_1345228
2421 Ga0496115_0004775
2422 Ga0501031_0539405
2423 Ga0501034_0069707
2424 Ga0501034_0179889
2425 Ga0501034_0837956
2426 Ga0501034_1067271
2427 Ga0501038_0447156
2428 Ga0501040_0100914
2429 Ga0501042_0469779
2430 Ga0501042_0859687
2431 Ga0501043_0624202
2432 Ga0501046_0538202
2433 Ga0501047_0099425
2434 Ga0501047_1207281
2435 Ga0501048_0024803
2436 Ga0501048_0726085
2437 Ga0501048_1104348
2438 Ga0501067_0086909
2439 Ga0501071_0160931
2440 Ga0501072_0268244
2441 Ga0501072_0668532
2442 Ga0501073_0027611
2443 Ga0501074_0199351
2444 Ga0501074_1245829
2445 Ga0501075_0128714
2446 Ga0501075_0943904
2447 Ga0501076_0172087
2448 Ga0501076_0614934
2449 Ga0501209_276435
2450 Ga0501079_0364108
2451 Ga0501080_0197445
2452 Ga0501080_0352406
2453 Ga0501080_1387493
2454 Ga0501081_0070509
2455 Ga0501081_0816495
2456 Ga0501083_0681606
2457 Ga0501083_0687551
2458 Ga0501083_0734432
2459 Ga0501241_153142
2460 Ga0501283_125442
2461 Ga0501045_0311354
2462 Ga0501045_0443247
2463 nmdc:mga03683_83695_c1
2464 nmdc:mga00v17_18735_c1
2465 nmdc:mga00v17_21186_c1
2466 nmdc:mga00v17_703608_c1
2467 nmdc:mga00v17_928877_c1
2468 nmdc:mga0yw44_230243_c1
2469 nmdc:mga0k408_19429_c1
2470 nmdc:mga0k408_411859_c1
2471 nmdc:mga0k408_641765_c1
2472 nmdc:mga06z11_13291_c1
2473 nmdc:mga06z11_210315_c1
2474 nmdc:mga04h51_10238_c1
2475 nmdc:mga07m45_170269_c2
2476 nmdc:mga05p37_107297_c1
2477 nmdc:mga05p37_111941_c1
2478 nmdc:mga05p37_13811_c1
2479 nmdc:mga05p37_251735_c1
2480 nmdc:mga05p37_2970_c1
2481 nmdc:mga05p37_298122_c1
2482 nmdc:mga05p37_97992_c1
2483 nmdc:mga05p37_985218_c1
2484 nmdc:mga09592_1005353_c1
2485 nmdc:mga09592_288458_c1
2486 nmdc:mga09592_56614_c1
2487 nmdc:mga0qj67_1292374_c1
2488 nmdc:mga0qj67_863543_c1
2489 nmdc:mga06r32_1173929_c1
2490 nmdc:mga06r32_1471812_c1
2491 nmdc:mga06r32_270678_c1
2492 nmdc:mga06r32_395908_c1
2493 nmdc:mga06r32_449667_c1
2494 nmdc:mga06r32_46286_c1
2495 nmdc:mga06r32_485745_c1
2496 nmdc:mga06r32_56468_c1
2497 nmdc:mga06r32_622944_c1
2498 nmdc:mga08y16_271887_c1
2499 nmdc:mga08y16_28291_c1
2500 nmdc:mga08y16_467_c1
2501 nmdc:mga08y16_665243_c1
2502 nmdc:mga0n895_116835_c1
2503 nmdc:mga0n895_1299623_c1
2504 nmdc:mga0n895_249125_c1
2505 nmdc:mga0n895_36244_c1
2506 nmdc:mga0n895_4120_c1
2507 nmdc:mga0n895_442672_c1
2508 nmdc:mga0n895_525477_c1
2509 nmdc:mga0n895_5821_c1
2510 nmdc:mga0n895_68857_c1
2511 nmdc:mga0n895_702431_c1
2512 nmdc:mga0n895_8031_c1
2513 nmdc:mga0n895_835974_c1
2514 nmdc:mga0rr50_17265_c1
2515 nmdc:mga0rr50_1737318_c1
2516 nmdc:mga0rr50_540950_c1
2517 nmdc:mga0rr50_61925_c1
2518 nmdc:mga0rr50_947507_c1
2519 nmdc:mga08x19_1370987_c1
2520 nmdc:mga08x19_153507_c1
2521 nmdc:mga08x19_3157_c1
2522 nmdc:mga08x19_4367_c1
2523 nmdc:mga08x19_455183_c1
2524 nmdc:mga08x19_539665_c1
2525 nmdc:mga08x19_70106_c1
2526 nmdc:mga0a205_1037342_c1
2527 nmdc:mga0a205_29183_c1
2528 nmdc:mga0a205_47745_c1
2529 nmdc:mga0a205_573497_c1
2530 nmdc:mga0a205_723_c1
2531 nmdc:mga0a205_84159_c1
2532 Ga0495619_0613455
2533 Ga0495619_1043928
2534 Ga0500623_211582
2535 Ga0500616_0000016
2536 Ga0500637_0132812
2537 Ga0501084_0884801
2538 Ga0501082_0070904
2539 Ga0501082_0083596
2540 Ga0501082_0300541
2541 Ga0530510_0495457
2542 Ga0530510_1406456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

36

102

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8893 6 88
3m99-assembly1.cif.gz_A structure of the ubp8-sgf11-sgf73-sus1 saga dub module 0.8404 34 86
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8161 6 88
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.7868 23 89
7svo-assembly2.cif.gz_B dpp8 in complex with ligand iced-1 0.7868 65 88
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8893 6 88 3.30.40.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8664 36 89 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8651 20 86 3.30.40.10
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.864 18 89 3.30.40.10
af_Q54QE6_6_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8577 19 89 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A2V6MP59-F1-model_v4 UBP-type domain-containing protein 0.9982 6 89 GO:0008270
AF-A0A2V5ZUY0-F1-model_v4 UBP-type domain-containing protein 0.9969 5 89 GO:0008270
AF-A0A2V5UKL3-F1-model_v4 UBP-type domain-containing protein 0.9905 13 89 GO:0008270
AF-A0A1G9GPU1-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9893 2 89 GO:0008270
GO:0016787
AF-A0A2V8DZ59-F1-model_v4 UBP-type domain-containing protein 0.9875 7 89 GO:0008270

Map