F492135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1246 | 543 | 1018 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10000031|Ga0105251_1000003124 |
| Length | 230 |
| Sequence | VKVSFTVHVFCAVLSIAWQVENQNIPWTCIMLTADLLLAFILFAFVSSITPGPNNTMLLSSGVNFGFNRTIPHMLGISCGFALMVLAVGFGLGAVFKAYPVLYTILRYAGAAYLLYLAYKIATSGPAKDSDVSKGKPMSYLGAAAFQWVNPKAWVMAVGAISTYTPMNGYFTNVAVIALVFGVVNLPAVSMWAGFGSLLRNVLRDPLWLRVFNGVMAALLVLSLYPLLEH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 6 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 11 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 12 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 13 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 14 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 15 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 16 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 17 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 18 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 19 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 20 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 21 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 22 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 23 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 24 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 25 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 26 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 27 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 28 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 29 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 30 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 31 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 32 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 33 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 34 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 35 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 36 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 37 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 38 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 39 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 40 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 41 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 42 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 43 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 44 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 45 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 46 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 47 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 48 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 49 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 50 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 51 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 52 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 53 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 54 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 55 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 56 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 57 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 58 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 59 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 60 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 61 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 62 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 63 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 64 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 65 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 66 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 67 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 68 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 69 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 70 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 71 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 72 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 73 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 74 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 75 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 76 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 77 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 78 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 79 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 80 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 81 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 82 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 83 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 84 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 85 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 86 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 87 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 88 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 89 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 90 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 91 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 92 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 93 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 94 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 95 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 96 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 97 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 98 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 99 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 100 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 101 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 102 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 103 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 104 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 105 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 106 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 107 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 108 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 109 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 110 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 111 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 112 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 113 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 114 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 115 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 116 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 117 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 118 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 119 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 120 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 121 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 122 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 123 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 124 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 125 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 126 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 127 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 128 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 129 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 130 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 131 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 132 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 133 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 134 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 135 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 136 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 137 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 138 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 139 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 140 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 141 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 142 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 143 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 144 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 145 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 146 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 147 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 148 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 149 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 150 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 151 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 152 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 153 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 154 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 155 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 156 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 157 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 158 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 159 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 160 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 161 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 162 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 163 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 164 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 165 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 166 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 167 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 168 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 169 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 170 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 171 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 172 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 173 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 174 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 175 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 176 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 177 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 178 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 179 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 180 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 181 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 182 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 183 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 184 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 185 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 186 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 187 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 188 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 189 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 190 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 191 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 192 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 193 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 194 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 195 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 196 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 197 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 198 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 199 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 200 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 201 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 202 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 203 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 204 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 205 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 206 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 207 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 208 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 209 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 210 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 211 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 212 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 213 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 214 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 215 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 216 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 217 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 218 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 219 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 220 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 221 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 222 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 223 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 224 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 225 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 226 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 237 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 238 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 239 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 240 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 241 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 242 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 243 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 244 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 245 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 255 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 263 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 264 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 265 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 266 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 268 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 279 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 282 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 285 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 286 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 288 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 314 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 315 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 317 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 318 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 320 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 321 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 322 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 323 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 324 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 325 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 326 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 327 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 328 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 329 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 330 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 331 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 332 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 333 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 334 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 335 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 336 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 337 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 338 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 339 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 340 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 341 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 342 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 343 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 344 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 345 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 346 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 347 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 348 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 349 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 350 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 351 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 352 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 353 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 354 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 355 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 356 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 357 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 358 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 359 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 360 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 361 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 362 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 363 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 364 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 365 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 366 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 367 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 368 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 369 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 370 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 371 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 372 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 373 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 374 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 375 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 376 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 377 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 456 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 457 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 458 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 459 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 460 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 461 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 462 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 463 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 464 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 465 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 466 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 467 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 468 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 469 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 470 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 471 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 472 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 473 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 474 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 475 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 476 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 491 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 494 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 495 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 498 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 499 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 502 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 503 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 504 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 506 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 507 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 508 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 509 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 510 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 511 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 513 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 514 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 515 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 516 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 517 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 518 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 519 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 520 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 521 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 522 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 523 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 524 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 525 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 526 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 527 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 528 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 529 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 530 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 531 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 532 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 533 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 534 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 535 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 536 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 537 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 538 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 539 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 540 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 541 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 542 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 543 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.7 |
| Metatranscriptomes | 0 |
| Isolates | 18.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.99 |
| Nodule | 2.09 |
| Rhizoplane | 6.66 |
| Rhizosphere | 69.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_45 | 2124908027 | Bacteria | 78063 |
| 2 | SwRhRL2b_contig_1587916 | 2162886007 | Bacteria | 1173 |
| 3 | SwRhRL2b_contig_2309387 | 2162886007 | Bacteria | 1123 |
| 4 | SwRhRL2b_contig_456895 | 2162886007 | Bacteria | 8526 |
| 5 | JGI24739J22299_10001779 | 3300001989 | Bacteria | 8204 |
| 6 | JGI24739J22299_10013520 | 3300001989 | Bacteria | 2979 |
| 7 | JGI25162J39368_1000166 | 3300002737 | Bacteria | 72515 |
| 8 | JGI25154J39366_1001189 | 3300002738 | Bacteria | 9928 |
| 9 | JGI25163J39215_1000186 | 3300002771 | Bacteria | 24033 |
| 10 | JGI25163J39215_1000638 | 3300002771 | Bacteria | 9499 |
| 11 | JGI25164J39214_1000129 | 3300002772 | Bacteria | 72515 |
| 12 | JGI25164J39214_1000415 | 3300002772 | Bacteria | 24254 |
| 13 | JGI25165J46597_1000251 | 3300003214 | Bacteria | 72515 |
| 14 | JGI25165J46597_1000756 | 3300003214 | Bacteria | 24824 |
| 15 | rootH2_10030798 | 3300003320 | Bacteria | 12993 |
| 16 | rootH2_10232438 | 3300003320 | Bacteria | 4415 |
| 17 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 18 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 19 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 20 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 21 | Ga0055532_1000262 | 3300003758 | Bacteria | 35319 |
| 22 | Ga0055532_1000320 | 3300003758 | Bacteria | 27644 |
| 23 | Ga0055532_1002026 | 3300003758 | Bacteria | 4651 |
| 24 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 25 | Ga0055527_1000280 | 3300003760 | Bacteria | 30042 |
| 26 | Ga0055527_1006864 | 3300003760 | Bacteria | 1411 |
| 27 | Ga0055535_1000591 | 3300003761 | Bacteria | 30042 |
| 28 | Ga0055535_1002021 | 3300003761 | Bacteria | 8279 |
| 29 | Ga0055535_1008009 | 3300003761 | Bacteria | 1951 |
| 30 | Ga0055542_1001740 | 3300003762 | Bacteria | 9278 |
| 31 | Ga0055542_1002922 | 3300003762 | Bacteria | 5036 |
| 32 | Ga0055529_1000978 | 3300003763 | Bacteria | 14276 |
| 33 | Ga0055536_1000165 | 3300003781 | Bacteria | 56046 |
| 34 | Ga0055536_1000268 | 3300003781 | Bacteria | 40054 |
| 35 | Ga0055536_1009023 | 3300003781 | Bacteria | 4195 |
| 36 | Ga0055536_1032350 | 3300003781 | Bacteria | 1353 |
| 37 | Ga0055536_1068912 | 3300003781 | Bacteria | 705 |
| 38 | Ga0055528_1003527 | 3300003790 | Bacteria | 7809 |
| 39 | Ga0055530_10000259 | 3300003791 | Bacteria | 47742 |
| 40 | Ga0055530_10000357 | 3300003791 | Bacteria | 41227 |
| 41 | Ga0055530_10000450 | 3300003791 | Bacteria | 36555 |
| 42 | Ga0055530_10008590 | 3300003791 | Bacteria | 4060 |
| 43 | Ga0055540_1000105 | 3300003792 | Bacteria | 93593 |
| 44 | Ga0055540_1000386 | 3300003792 | Bacteria | 36555 |
| 45 | Ga0055540_1001210 | 3300003792 | Bacteria | 15871 |
| 46 | Ga0055531_10000081 | 3300003794 | Bacteria | 103600 |
| 47 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 48 | Ga0055541_1014359 | 3300003841 | Bacteria | 1079 |
| 49 | Ga0058692_1004472 | 3300003856 | Bacteria | 4138 |
| 50 | Ga0058692_1021800 | 3300003856 | Bacteria | 1326 |
| 51 | Ga0065714_10002494 | 3300005288 | Bacteria | 17407 |
| 52 | Ga0065714_10002507 | 3300005288 | Bacteria | 15532 |
| 53 | Ga0065714_10006419 | 3300005288 | Bacteria | 7218 |
| 54 | Ga0065714_10023978 | 3300005288 | Bacteria | 1783 |
| 55 | Ga0065714_10064719 | 3300005288 | Bacteria | 21761 |
| 56 | Ga0065704_10072002 | 3300005289 | Bacteria | 9406 |
| 57 | Ga0065704_10124139 | 3300005289 | Bacteria | 1722 |
| 58 | Ga0065704_10263780 | 3300005289 | Bacteria | 959 |
| 59 | Ga0065712_10001825 | 3300005290 | Bacteria | 5223 |
| 60 | Ga0070658_10182062 | 3300005327 | Bacteria | 1768 |
| 61 | Ga0070670_100000137 | 3300005331 | Bacteria | 68542 |
| 62 | Ga0070666_10012704 | 3300005335 | Bacteria | 5321 |
| 63 | Ga0070660_100000159 | 3300005339 | Bacteria | 43943 |
| 64 | Ga0070661_100000749 | 3300005344 | Bacteria | 23450 |
| 65 | Ga0070669_100013166 | 3300005353 | Bacteria | 5879 |
| 66 | Ga0070659_100000223 | 3300005366 | Bacteria | 44089 |
| 67 | Ga0070714_100725549 | 3300005435 | Bacteria | 960 |
| 68 | Ga0070663_100001049 | 3300005455 | Bacteria | 15125 |
| 69 | Ga0070664_100000861 | 3300005564 | Bacteria | 23450 |
| 70 | Ga0068857_100412432 | 3300005577 | Bacteria | 1258 |
| 71 | Ga0068852_100138430 | 3300005616 | Bacteria | 2250 |
| 72 | Ga0068858_100062991 | 3300005842 | Bacteria | 3430 |
| 73 | Ga0075364_10044785 | 3300006051 | Bacteria | 2879 |
| 74 | Ga0075364_10460751 | 3300006051 | Bacteria | 869 |
| 75 | Ga0075432_10001522 | 3300006058 | Bacteria | 7590 |
| 76 | Ga0075432_10001643 | 3300006058 | Bacteria | 7361 |
| 77 | Ga0075432_10008650 | 3300006058 | Bacteria | 3474 |
| 78 | Ga0075432_10014180 | 3300006058 | Bacteria | 2714 |
| 79 | Ga0075432_10047007 | 3300006058 | Bacteria | 1516 |
| 80 | Ga0075432_10124702 | 3300006058 | Bacteria | 970 |
| 81 | Ga0075432_10164104 | 3300006058 | Bacteria | 860 |
| 82 | Ga0075432_10246428 | 3300006058 | Bacteria | 723 |
| 83 | Ga0075369_10058202 | 3300006186 | Bacteria | 1683 |
| 84 | Ga0099823_1000029 | 3300006944 | Bacteria | 69209 |
| 85 | Ga0079104_1000094 | 3300006946 | Bacteria | 130202 |
| 86 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 87 | Ga0079104_1060811 | 3300006946 | Bacteria | 814 |
| 88 | Ga0099826_10003718 | 3300006948 | Bacteria | 10473 |
| 89 | Ga0105251_10000031 | 3300009011 | Bacteria | 124114 |
| 90 | Ga0105251_10010585 | 3300009011 | Bacteria | 5337 |
| 91 | Ga0105251_10032399 | 3300009011 | Bacteria | 2605 |
| 92 | Ga0105251_10066882 | 3300009011 | Bacteria | 1679 |
| 93 | Ga0105251_10122725 | 3300009011 | Bacteria | 1179 |
| 94 | Ga0105244_10000738 | 3300009036 | Bacteria | 27985 |
| 95 | Ga0105244_10000796 | 3300009036 | Bacteria | 26866 |
| 96 | Ga0105244_10015652 | 3300009036 | Bacteria | 4344 |
| 97 | Ga0105244_10015736 | 3300009036 | Bacteria | 4331 |
| 98 | Ga0105244_10018334 | 3300009036 | Bacteria | 3928 |
| 99 | Ga0105244_10031584 | 3300009036 | Bacteria | 2809 |
| 100 | Ga0105244_10036257 | 3300009036 | Bacteria | 2584 |
| 101 | Ga0105244_10039504 | 3300009036 | Bacteria | 2456 |
| 102 | Ga0105244_10042678 | 3300009036 | Bacteria | 2343 |
| 103 | Ga0105244_10043152 | 3300009036 | Bacteria | 2328 |
| 104 | Ga0105244_10082108 | 3300009036 | Bacteria | 1594 |
| 105 | Ga0105244_10102611 | 3300009036 | Bacteria | 1398 |
| 106 | Ga0105250_10000560 | 3300009092 | Bacteria | 25085 |
| 107 | Ga0105250_10000898 | 3300009092 | Bacteria | 17524 |
| 108 | Ga0105250_10010202 | 3300009092 | Bacteria | 3920 |
| 109 | Ga0105250_10013636 | 3300009092 | Bacteria | 3348 |
| 110 | Ga0105250_10188130 | 3300009092 | Bacteria | 868 |
| 111 | Ga0105250_10306551 | 3300009092 | Bacteria | 688 |
| 112 | Ga0105240_10001196 | 3300009093 | Bacteria | 45244 |
| 113 | Ga0105240_10003837 | 3300009093 | Bacteria | 23242 |
| 114 | Ga0105240_10042007 | 3300009093 | Bacteria | 5829 |
| 115 | Ga0105243_10000103 | 3300009148 | Bacteria | 97091 |
| 116 | Ga0105243_10000125 | 3300009148 | Bacteria | 86522 |
| 117 | Ga0105243_10020104 | 3300009148 | Bacteria | 5062 |
| 118 | Ga0105243_10212345 | 3300009148 | Bacteria | 1705 |
| 119 | Ga0105243_10214397 | 3300009148 | Bacteria | 1697 |
| 120 | Ga0105242_10016730 | 3300009176 | Bacteria | 5705 |
| 121 | Ga0105237_10004461 | 3300009545 | Bacteria | 16177 |
| 122 | Ga0105237_10065380 | 3300009545 | Bacteria | 3633 |
| 123 | Ga0105238_10117875 | 3300009551 | Bacteria | 2635 |
| 124 | Ga0105238_10154380 | 3300009551 | Bacteria | 2270 |
| 125 | Ga0105246_10000357 | 3300011119 | Bacteria | 24630 |
| 126 | Ga0105246_10023370 | 3300011119 | Bacteria | 3999 |
| 127 | Ga0157345_1000009 | 3300012498 | Bacteria | 55332 |
| 128 | Ga0157345_1000928 | 3300012498 | Bacteria | 2175 |
| 129 | Ga0157373_10000151 | 3300013100 | Bacteria | 55916 |
| 130 | Ga0157373_10000225 | 3300013100 | Bacteria | 46142 |
| 131 | Ga0157373_10006005 | 3300013100 | Bacteria | 9083 |
| 132 | Ga0157373_10017933 | 3300013100 | Bacteria | 5154 |
| 133 | Ga0157373_10020435 | 3300013100 | Bacteria | 4812 |
| 134 | Ga0157373_10046441 | 3300013100 | Bacteria | 3099 |
| 135 | Ga0157373_10072424 | 3300013100 | Bacteria | 2432 |
| 136 | Ga0157373_10269277 | 3300013100 | Bacteria | 1206 |
| 137 | Ga0157373_10365300 | 3300013100 | Bacteria | 1031 |
| 138 | Ga0157373_10549411 | 3300013100 | Bacteria | 837 |
| 139 | Ga0157371_10000463 | 3300013102 | Bacteria | 49682 |
| 140 | Ga0157371_10004579 | 3300013102 | Bacteria | 12017 |
| 141 | Ga0157371_10428980 | 3300013102 | Bacteria | 970 |
| 142 | Ga0157370_10005821 | 3300013104 | Bacteria | 13777 |
| 143 | Ga0157370_10082525 | 3300013104 | Bacteria | 3023 |
| 144 | Ga0157370_10159805 | 3300013104 | Bacteria | 2097 |
| 145 | Ga0157370_10198950 | 3300013104 | Bacteria | 1859 |
| 146 | Ga0157370_10273552 | 3300013104 | Bacteria | 1560 |
| 147 | Ga0157370_10554702 | 3300013104 | Bacteria | 1053 |
| 148 | Ga0157370_10930684 | 3300013104 | Bacteria | 788 |
| 149 | Ga0157369_10001402 | 3300013105 | Bacteria | 29596 |
| 150 | Ga0157369_10005269 | 3300013105 | Bacteria | 15076 |
| 151 | Ga0157369_10014332 | 3300013105 | Bacteria | 8953 |
| 152 | Ga0157369_10014764 | 3300013105 | Bacteria | 8812 |
| 153 | Ga0157369_10078365 | 3300013105 | Bacteria | 3540 |
| 154 | Ga0157369_11454637 | 3300013105 | Bacteria | 697 |
| 155 | Ga0163162_10000072 | 3300013306 | Bacteria | 92818 |
| 156 | Ga0163162_10008712 | 3300013306 | Bacteria | 9871 |
| 157 | Ga0163162_10077091 | 3300013306 | Bacteria | 3396 |
| 158 | Ga0163162_10586450 | 3300013306 | Bacteria | 1241 |
| 159 | Ga0157372_10019720 | 3300013307 | Bacteria | 7269 |
| 160 | Ga0157375_10000139 | 3300013308 | Bacteria | 72260 |
| 161 | Ga0157375_10002380 | 3300013308 | Bacteria | 16274 |
| 162 | Ga0157375_10084113 | 3300013308 | Bacteria | 3229 |
| 163 | Ga0157375_10354463 | 3300013308 | Bacteria | 1633 |
| 164 | Ga0157375_10898380 | 3300013308 | Bacteria | 1030 |
| 165 | Ga0182008_10001317 | 3300014497 | Bacteria | 16936 |
| 166 | Ga0182008_10002359 | 3300014497 | Bacteria | 11888 |
| 167 | Ga0182008_10006016 | 3300014497 | Bacteria | 6832 |
| 168 | Ga0182008_10028516 | 3300014497 | Bacteria | 2823 |
| 169 | Ga0182008_10230097 | 3300014497 | Bacteria | 951 |
| 170 | Ga0182006_1002945 | 3300015261 | Bacteria | 9006 |
| 171 | Ga0182006_1003352 | 3300015261 | Bacteria | 8246 |
| 172 | Ga0182006_1015711 | 3300015261 | Bacteria | 3241 |
| 173 | Ga0182007_10001953 | 3300015262 | Bacteria | 10662 |
| 174 | Ga0182005_1000842 | 3300015265 | Bacteria | 13719 |
| 175 | Ga0182005_1015984 | 3300015265 | Bacteria | 2089 |
| 176 | Ga0182005_1026147 | 3300015265 | Bacteria | 1592 |
| 177 | Ga0163161_10000156 | 3300017792 | Bacteria | 63154 |
| 178 | Ga0163161_10003953 | 3300017792 | Bacteria | 10398 |
| 179 | Ga0163161_10045752 | 3300017792 | Bacteria | 3157 |
| 180 | Ga0163161_10050229 | 3300017792 | Bacteria | 3018 |
| 181 | Ga0163161_10064565 | 3300017792 | Bacteria | 2670 |
| 182 | Ga0163161_10088392 | 3300017792 | Bacteria | 2290 |
| 183 | Ga0163161_10672240 | 3300017792 | Bacteria | 860 |
| 184 | Ga0213875_10001893 | 3300021388 | Bacteria | 12940 |
| 185 | Ga0209760_100227 | 3300025207 | Bacteria | 24289 |
| 186 | Ga0209760_100434 | 3300025207 | Bacteria | 9846 |
| 187 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 188 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 189 | Ga0209566_100443 | 3300025225 | Bacteria | 30572 |
| 190 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 191 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 192 | Ga0209672_100063 | 3300025228 | Bacteria | 204903 |
| 193 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 194 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 195 | Ga0209147_100077 | 3300025229 | Bacteria | 205964 |
| 196 | Ga0209147_100119 | 3300025229 | Bacteria | 142860 |
| 197 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 198 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 199 | Ga0207427_100074 | 3300025231 | Bacteria | 153455 |
| 200 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 201 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 202 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 203 | Ga0209258_100105 | 3300025242 | Bacteria | 207862 |
| 204 | Ga0209258_100520 | 3300025242 | Bacteria | 37049 |
| 205 | Ga0209646_1000110 | 3300025246 | Bacteria | 156257 |
| 206 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 207 | Ga0209148_1000107 | 3300025254 | Bacteria | 207862 |
| 208 | Ga0209148_1000337 | 3300025254 | Bacteria | 63295 |
| 209 | Ga0209759_1001226 | 3300025256 | Bacteria | 15698 |
| 210 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 211 | Ga0209233_1000484 | 3300025261 | Bacteria | 24306 |
| 212 | Ga0209455_1000100 | 3300025272 | Bacteria | 207862 |
| 213 | Ga0209455_1000138 | 3300025272 | Bacteria | 141021 |
| 214 | Ga0209673_1000101 | 3300025273 | Bacteria | 190230 |
| 215 | Ga0209675_1006516 | 3300025291 | Bacteria | 4662 |
| 216 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 217 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 218 | Ga0209676_1000646 | 3300025292 | Bacteria | 50033 |
| 219 | Ga0209676_1000752 | 3300025292 | Bacteria | 43942 |
| 220 | Ga0209676_1007290 | 3300025292 | Bacteria | 5235 |
| 221 | Ga0209676_1010061 | 3300025292 | Bacteria | 3991 |
| 222 | Ga0209564_1007842 | 3300025295 | Bacteria | 5413 |
| 223 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 224 | Ga0209050_1000227 | 3300025298 | Bacteria | 123743 |
| 225 | Ga0209050_1000363 | 3300025298 | Bacteria | 86923 |
| 226 | Ga0209050_1000595 | 3300025298 | Bacteria | 57712 |
| 227 | Ga0209051_1000164 | 3300025303 | Bacteria | 124186 |
| 228 | Ga0209051_1000185 | 3300025303 | Bacteria | 110195 |
| 229 | Ga0209051_1000407 | 3300025303 | Bacteria | 59487 |
| 230 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 231 | Ga0209257_1008247 | 3300025304 | Bacteria | 5996 |
| 232 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 233 | Ga0207696_1001567 | 3300025711 | Bacteria | 12168 |
| 234 | Ga0207696_1002536 | 3300025711 | Bacteria | 8901 |
| 235 | Ga0207696_1012173 | 3300025711 | Bacteria | 3052 |
| 236 | Ga0207696_1013067 | 3300025711 | Bacteria | 2911 |
| 237 | Ga0207696_1017693 | 3300025711 | Bacteria | 2356 |
| 238 | Ga0207696_1018219 | 3300025711 | Bacteria | 2310 |
| 239 | Ga0207696_1018265 | 3300025711 | Bacteria | 2306 |
| 240 | Ga0207655_1000074 | 3300025728 | Bacteria | 232056 |
| 241 | Ga0207655_1000551 | 3300025728 | Bacteria | 46983 |
| 242 | Ga0207655_1000940 | 3300025728 | Bacteria | 30221 |
| 243 | Ga0207655_1001227 | 3300025728 | Bacteria | 24729 |
| 244 | Ga0207655_1001930 | 3300025728 | Bacteria | 17745 |
| 245 | Ga0207655_1002591 | 3300025728 | Bacteria | 14398 |
| 246 | Ga0207655_1004649 | 3300025728 | Bacteria | 9632 |
| 247 | Ga0207655_1010235 | 3300025728 | Bacteria | 5709 |
| 248 | Ga0207655_1011899 | 3300025728 | Bacteria | 5133 |
| 249 | Ga0207655_1018219 | 3300025728 | Bacteria | 3740 |
| 250 | Ga0207655_1020537 | 3300025728 | Bacteria | 3389 |
| 251 | Ga0207655_1023881 | 3300025728 | Bacteria | 3015 |
| 252 | Ga0207655_1024503 | 3300025728 | Bacteria | 2955 |
| 253 | Ga0207655_1041659 | 3300025728 | Bacteria | 1965 |
| 254 | Ga0207655_1060197 | 3300025728 | Bacteria | 1473 |
| 255 | Ga0207655_1087869 | 3300025728 | Bacteria | 1102 |
| 256 | Ga0207713_1000042 | 3300025735 | Bacteria | 242199 |
| 257 | Ga0207713_1001221 | 3300025735 | Bacteria | 21470 |
| 258 | Ga0207713_1001918 | 3300025735 | Bacteria | 15757 |
| 259 | Ga0207713_1003241 | 3300025735 | Bacteria | 11226 |
| 260 | Ga0207713_1006429 | 3300025735 | Bacteria | 7155 |
| 261 | Ga0207713_1012331 | 3300025735 | Bacteria | 4578 |
| 262 | Ga0207713_1013609 | 3300025735 | Bacteria | 4277 |
| 263 | Ga0207713_1028640 | 3300025735 | Bacteria | 2508 |
| 264 | Ga0207713_1101848 | 3300025735 | Bacteria | 990 |
| 265 | Ga0207713_1102312 | 3300025735 | Bacteria | 987 |
| 266 | Ga0207680_10412147 | 3300025903 | Bacteria | 956 |
| 267 | Ga0207647_10005055 | 3300025904 | Bacteria | 9726 |
| 268 | Ga0207705_10098965 | 3300025909 | Bacteria | 2143 |
| 269 | Ga0207695_10000368 | 3300025913 | Bacteria | 103176 |
| 270 | Ga0207695_10006884 | 3300025913 | Bacteria | 14629 |
| 271 | Ga0207695_10043331 | 3300025913 | Bacteria | 4797 |
| 272 | Ga0207671_10065834 | 3300025914 | Bacteria | 2696 |
| 273 | Ga0207657_10000442 | 3300025919 | Bacteria | 43937 |
| 274 | Ga0207649_10000954 | 3300025920 | Bacteria | 17951 |
| 275 | Ga0207649_10107248 | 3300025920 | Bacteria | 1860 |
| 276 | Ga0207681_10024058 | 3300025923 | Bacteria | 3904 |
| 277 | Ga0207694_10163663 | 3300025924 | Bacteria | 1798 |
| 278 | Ga0207650_10001314 | 3300025925 | Bacteria | 17994 |
| 279 | Ga0207690_10000037 | 3300025932 | Bacteria | 142658 |
| 280 | Ga0207706_10042785 | 3300025933 | Bacteria | 4014 |
| 281 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 282 | Ga0207709_10002421 | 3300025935 | Bacteria | 11739 |
| 283 | Ga0207709_10012519 | 3300025935 | Bacteria | 4671 |
| 284 | Ga0207661_10350006 | 3300025944 | Bacteria | 1333 |
| 285 | Ga0207679_10000097 | 3300025945 | Bacteria | 75900 |
| 286 | Ga0207667_10136649 | 3300025949 | Bacteria | 2524 |
| 287 | Ga0207703_10072389 | 3300026035 | Bacteria | 2849 |
| 288 | Ga0207678_10000317 | 3300026067 | Bacteria | 43506 |
| 289 | Ga0207674_10058378 | 3300026116 | Bacteria | 3909 |
| 290 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 291 | Ga0209281_1000212 | 3300027111 | Bacteria | 130216 |
| 292 | Ga0209281_1006513 | 3300027111 | Bacteria | 3039 |
| 293 | Ga0209281_1011142 | 3300027111 | Bacteria | 2024 |
| 294 | Ga0209389_1000091 | 3300027296 | Bacteria | 83421 |
| 295 | Ga0209371_1000080 | 3300027312 | Bacteria | 185771 |
| 296 | Ga0209371_1001552 | 3300027312 | Bacteria | 15166 |
| 297 | Ga0209282_1012669 | 3300027666 | Bacteria | 5360 |
| 298 | Ga0207428_10005837 | 3300027907 | Bacteria | 11419 |
| 299 | Ga0207428_10054766 | 3300027907 | Bacteria | 3176 |
| 300 | Ga0207428_10080023 | 3300027907 | Bacteria | 2554 |
| 301 | Ga0207428_10482419 | 3300027907 | Bacteria | 902 |
| 302 | Ga0268266_10099467 | 3300028379 | Bacteria | 2560 |
| 303 | Ga0268256_1000160 | 3300030500 | Bacteria | 86682 |
| 304 | Ga0268256_1002253 | 3300030500 | Bacteria | 10081 |
| 305 | Ga0307511_10028132 | 3300030521 | Bacteria | 5113 |
| 306 | Ga0316179_1039086 | 3300030734 | Bacteria | 2024 |
| 307 | Ga0316178_1138063 | 3300030735 | Bacteria | 8679 |
| 308 | Ga0316183_1077777 | 3300030742 | Bacteria | 1926 |
| 309 | Ga0316183_1106054 | 3300030742 | Bacteria | 1594 |
| 310 | Ga0307408_100002671 | 3300031548 | Bacteria | 12368 |
| 311 | Ga0307408_100002956 | 3300031548 | Bacteria | 11780 |
| 312 | Ga0307408_100436648 | 3300031548 | Bacteria | 1132 |
| 313 | Ga0307408_100467367 | 3300031548 | Bacteria | 1097 |
| 314 | Ga0307405_10000024 | 3300031731 | Bacteria | 127508 |
| 315 | Ga0307405_10000624 | 3300031731 | Bacteria | 13604 |
| 316 | Ga0307405_10002473 | 3300031731 | Bacteria | 8156 |
| 317 | Ga0307405_10320653 | 3300031731 | Bacteria | 1183 |
| 318 | Ga0307413_10013068 | 3300031824 | Bacteria | 4156 |
| 319 | Ga0307413_10032714 | 3300031824 | Bacteria | 2951 |
| 320 | Ga0307406_10053238 | 3300031901 | Bacteria | 2577 |
| 321 | Ga0307407_10135080 | 3300031903 | Bacteria | 1583 |
| 322 | Ga0307412_10000878 | 3300031911 | Bacteria | 17292 |
| 323 | Ga0307412_10000944 | 3300031911 | Bacteria | 16618 |
| 324 | Ga0307412_10001619 | 3300031911 | Bacteria | 12408 |
| 325 | Ga0307412_11144039 | 3300031911 | Bacteria | 694 |
| 326 | Ga0307414_10055195 | 3300032004 | Bacteria | 2780 |
| 327 | Ga0307414_10137367 | 3300032004 | Bacteria | 1908 |
| 328 | Ga0307414_10486470 | 3300032004 | Bacteria | 1089 |
| 329 | Ga0307414_10967960 | 3300032004 | Bacteria | 782 |
| 330 | Ga0307411_10008616 | 3300032005 | Bacteria | 5298 |
| 331 | Ga0307411_10015363 | 3300032005 | Bacteria | 4297 |
| 332 | Ga0307411_10020708 | 3300032005 | Bacteria | 3832 |
| 333 | Ga0307510_10012774 | 3300033180 | Bacteria | 9967 |
| 334 | Ga0373944_0024203 | 3300035089 | Bacteria | 1777 |
| 335 | Ga0373946_0014580 | 3300035171 | Bacteria | 2965 |
| 336 | Ga0373927_0000731 | 3300035695 | Bacteria | 25089 |
| 337 | Ga0373947_0317631 | 3300035725 | Bacteria | 1041 |
| 338 | Ga0373925_0000049 | 3300037068 | Bacteria | 128065 |
| 339 | Ga0395900_0079296 | 3300037418 | Bacteria | 3374 |
| 340 | Ga0395898_0139849 | 3300037466 | Bacteria | 2318 |
| 341 | Ga0436364_0011200 | 3300037853 | Bacteria | 14393 |
| 342 | Ga0237819_00585 | 3300038705 | Bacteria | 12172 |
| 343 | Ga0400489_31717 | 3300039093 | Bacteria | 1122 |
| 344 | Ga0436365_0907137 | 3300039437 | Bacteria | 2597 |
| 345 | Ga0439438_001949 | 3300041405 | Bacteria | 9009 |
| 346 | Ga0439438_002256 | 3300041405 | Bacteria | 8268 |
| 347 | Ga0439438_002400 | 3300041405 | Bacteria | 7987 |
| 348 | Ga0439438_002403 | 3300041405 | Bacteria | 7985 |
| 349 | Ga0439438_002513 | 3300041405 | Bacteria | 7783 |
| 350 | Ga0439438_002539 | 3300041405 | Bacteria | 7740 |
| 351 | Ga0439438_003729 | 3300041405 | Bacteria | 6049 |
| 352 | Ga0439438_015614 | 3300041405 | Bacteria | 2229 |
| 353 | Ga0439447_000280 | 3300041407 | Bacteria | 18107 |
| 354 | Ga0439447_000355 | 3300041407 | Bacteria | 16602 |
| 355 | Ga0439447_000621 | 3300041407 | Bacteria | 13205 |
| 356 | Ga0439447_000698 | 3300041407 | Bacteria | 12415 |
| 357 | Ga0439447_003542 | 3300041407 | Bacteria | 5534 |
| 358 | Ga0439447_003943 | 3300041407 | Bacteria | 5199 |
| 359 | Ga0439447_006856 | 3300041407 | Bacteria | 3658 |
| 360 | Ga0439447_016415 | 3300041407 | Bacteria | 2032 |
| 361 | Ga0439447_026239 | 3300041407 | Bacteria | 1495 |
| 362 | Ga0439466_0000181 | 3300041411 | Bacteria | 25115 |
| 363 | Ga0439466_0000422 | 3300041411 | Bacteria | 16049 |
| 364 | Ga0439466_0002836 | 3300041411 | Bacteria | 6784 |
| 365 | Ga0439466_0009673 | 3300041411 | Bacteria | 3598 |
| 366 | Ga0439466_0011006 | 3300041411 | Bacteria | 3353 |
| 367 | Ga0439466_0013955 | 3300041411 | Bacteria | 2933 |
| 368 | Ga0439466_0020081 | 3300041411 | Bacteria | 2386 |
| 369 | Ga0439466_0043550 | 3300041411 | Bacteria | 1490 |
| 370 | Ga0451797_0248178 | 3300041453 | Bacteria | 638 |
| 371 | Ga0451841_0467719 | 3300041498 | Bacteria | 1004 |
| 372 | Ga0439431_0013624 | 3300041997 | Bacteria | 1877 |
| 373 | Ga0439445_0004818 | 3300042004 | Bacteria | 3063 |
| 374 | Ga0439432_001312 | 3300042006 | Bacteria | 9416 |
| 375 | Ga0439432_003675 | 3300042006 | Bacteria | 5675 |
| 376 | Ga0439432_006504 | 3300042006 | Bacteria | 4171 |
| 377 | Ga0439432_010421 | 3300042006 | Bacteria | 3216 |
| 378 | Ga0439432_017024 | 3300042006 | Bacteria | 2441 |
| 379 | Ga0439451_004155 | 3300042009 | Bacteria | 2936 |
| 380 | Ga0439451_020469 | 3300042009 | Bacteria | 1334 |
| 381 | Ga0439452_000091 | 3300042010 | Bacteria | 78007 |
| 382 | Ga0439452_000172 | 3300042010 | Bacteria | 48128 |
| 383 | Ga0439452_000309 | 3300042010 | Bacteria | 31187 |
| 384 | Ga0439452_004717 | 3300042010 | Bacteria | 4513 |
| 385 | Ga0439452_005180 | 3300042010 | Bacteria | 4240 |
| 386 | Ga0439452_006684 | 3300042010 | Bacteria | 3593 |
| 387 | Ga0439452_025368 | 3300042010 | Bacteria | 1505 |
| 388 | Ga0439452_033726 | 3300042010 | Bacteria | 1241 |
| 389 | Ga0439456_000810 | 3300042013 | Bacteria | 6331 |
| 390 | Ga0439456_007282 | 3300042013 | Bacteria | 2267 |
| 391 | Ga0439456_009090 | 3300042013 | Bacteria | 2052 |
| 392 | Ga0439456_024071 | 3300042013 | Bacteria | 1291 |
| 393 | Ga0439456_028274 | 3300042013 | Bacteria | 1196 |
| 394 | Ga0439456_045321 | 3300042013 | Bacteria | 957 |
| 395 | Ga0439463_000135 | 3300042016 | Bacteria | 18610 |
| 396 | Ga0439463_002404 | 3300042016 | Bacteria | 4769 |
| 397 | Ga0439463_050307 | 3300042016 | Bacteria | 1063 |
| 398 | Ga0439463_126636 | 3300042016 | Bacteria | 660 |
| 399 | Ga0450911_000025 | 3300042115 | Bacteria | 83941 |
| 400 | Ga0450919_003138 | 3300042121 | Bacteria | 2100 |
| 401 | Ga0450920_003350 | 3300042122 | Bacteria | 2769 |
| 402 | Ga0450922_000181 | 3300042124 | Bacteria | 6527 |
| 403 | Ga0450923_001551 | 3300042125 | Bacteria | 3088 |
| 404 | Ga0450900_005759 | 3300042136 | Bacteria | 1476 |
| 405 | Ga0450902_000571 | 3300042137 | Bacteria | 4674 |
| 406 | Ga0450903_002442 | 3300042138 | Bacteria | 3311 |
| 407 | Ga0450903_004051 | 3300042138 | Bacteria | 2513 |
| 408 | Ga0450903_004391 | 3300042138 | Bacteria | 2411 |
| 409 | Ga0450903_012557 | 3300042138 | Bacteria | 1352 |
| 410 | Ga0450905_005175 | 3300042142 | Bacteria | 1748 |
| 411 | Ga0450906_000612 | 3300042145 | Bacteria | 7613 |
| 412 | Ga0450906_001636 | 3300042145 | Bacteria | 4918 |
| 413 | Ga0450907_000038 | 3300042146 | Bacteria | 57421 |
| 414 | Ga0450907_000855 | 3300042146 | Bacteria | 7381 |
| 415 | Ga0450907_039969 | 3300042146 | Bacteria | 803 |
| 416 | Ga0439446_0064553 | 3300042156 | Bacteria | 1111 |
| 417 | Ga0450909_000065 | 3300042185 | Bacteria | 9292 |
| 418 | Ga0439434_0000253 | 3300042435 | Bacteria | 15062 |
| 419 | Ga0439460_0000460 | 3300042461 | Bacteria | 8801 |
| 420 | Ga0439460_0001474 | 3300042461 | Bacteria | 5541 |
| 421 | Ga0439440_0001144 | 3300042993 | Bacteria | 4745 |
| 422 | Ga0439440_0003618 | 3300042993 | Bacteria | 2996 |
| 423 | Ga0466969_0005486 | 3300044656 | Bacteria | 6747 |
| 424 | Ga0466972_0050894 | 3300044658 | Bacteria | 1999 |
| 425 | Ga0466965_0012175 | 3300044683 | Bacteria | 4043 |
| 426 | Ga0466965_0021841 | 3300044683 | Bacteria | 3084 |
| 427 | Ga0466965_0137102 | 3300044683 | Bacteria | 1272 |
| 428 | Ga0451576_0230380 | 3300045051 | Bacteria | 1935 |
| 429 | Ga0451576_0358142 | 3300045051 | Bacteria | 1528 |
| 430 | Ga0466967_0157347 | 3300045976 | Bacteria | 2130 |
| 431 | Ga0495617_004146 | 3300046452 | Bacteria | 5312 |
| 432 | Ga0495617_004255 | 3300046452 | Bacteria | 5227 |
| 433 | Ga0495617_008453 | 3300046452 | Bacteria | 3548 |
| 434 | Ga0495617_009307 | 3300046452 | Bacteria | 3371 |
| 435 | Ga0495617_026063 | 3300046452 | Bacteria | 1968 |
| 436 | Ga0495617_028225 | 3300046452 | Bacteria | 1886 |
| 437 | Ga0495617_042370 | 3300046452 | Bacteria | 1521 |
| 438 | Ga0495627_000013 | 3300046453 | Bacteria | 332765 |
| 439 | Ga0495627_000239 | 3300046453 | Bacteria | 57647 |
| 440 | Ga0495627_000864 | 3300046453 | Bacteria | 21508 |
| 441 | Ga0495627_002308 | 3300046453 | Bacteria | 9399 |
| 442 | Ga0495627_004519 | 3300046453 | Bacteria | 5803 |
| 443 | Ga0495627_005591 | 3300046453 | Bacteria | 5035 |
| 444 | Ga0495592_0128017 | 3300046454 | Bacteria | 1779 |
| 445 | Ga0495603_0018361 | 3300046455 | Bacteria | 4231 |
| 446 | Ga0495603_0019564 | 3300046455 | Bacteria | 4098 |
| 447 | Ga0495590_0013094 | 3300046457 | Bacteria | 3058 |
| 448 | Ga0495590_0032480 | 3300046457 | Bacteria | 1825 |
| 449 | Ga0495590_0041811 | 3300046457 | Bacteria | 1598 |
| 450 | Ga0495590_0070549 | 3300046457 | Bacteria | 1225 |
| 451 | Ga0495591_000041 | 3300046458 | Bacteria | 155639 |
| 452 | Ga0495591_000064 | 3300046458 | Bacteria | 123820 |
| 453 | Ga0495591_000107 | 3300046458 | Bacteria | 95742 |
| 454 | Ga0495591_000287 | 3300046458 | Bacteria | 46879 |
| 455 | Ga0495591_000481 | 3300046458 | Bacteria | 31694 |
| 456 | Ga0495591_000774 | 3300046458 | Bacteria | 23026 |
| 457 | Ga0495591_002390 | 3300046458 | Bacteria | 10506 |
| 458 | Ga0495591_003090 | 3300046458 | Bacteria | 8818 |
| 459 | Ga0495591_005561 | 3300046458 | Bacteria | 5796 |
| 460 | Ga0495591_008395 | 3300046458 | Bacteria | 4233 |
| 461 | Ga0495591_009734 | 3300046458 | Bacteria | 3788 |
| 462 | Ga0495591_014040 | 3300046458 | Bacteria | 2898 |
| 463 | Ga0495591_016768 | 3300046458 | Bacteria | 2537 |
| 464 | Ga0495591_049195 | 3300046458 | Bacteria | 1159 |
| 465 | Ga0495629_0351154 | 3300046459 | Bacteria | 1006 |
| 466 | Ga0495638_0002189 | 3300046460 | Bacteria | 16352 |
| 467 | Ga0495638_0003517 | 3300046460 | Bacteria | 12299 |
| 468 | Ga0495638_0003771 | 3300046460 | Bacteria | 11778 |
| 469 | Ga0495638_0015395 | 3300046460 | Bacteria | 5136 |
| 470 | Ga0495638_0020618 | 3300046460 | Bacteria | 4353 |
| 471 | Ga0495638_0026277 | 3300046460 | Bacteria | 3774 |
| 472 | Ga0495638_0044924 | 3300046460 | Bacteria | 2781 |
| 473 | Ga0495638_0073514 | 3300046460 | Bacteria | 2086 |
| 474 | Ga0495638_0085793 | 3300046460 | Bacteria | 1903 |
| 475 | Ga0495638_0094289 | 3300046460 | Bacteria | 1799 |
| 476 | Ga0495638_0151464 | 3300046460 | Bacteria | 1345 |
| 477 | Ga0495653_0000525 | 3300046463 | Bacteria | 29386 |
| 478 | Ga0495653_0023268 | 3300046463 | Bacteria | 5009 |
| 479 | Ga0495653_0037094 | 3300046463 | Bacteria | 3833 |
| 480 | Ga0495650_0001462 | 3300046471 | Bacteria | 22659 |
| 481 | Ga0495650_0003372 | 3300046471 | Bacteria | 11705 |
| 482 | Ga0495650_0006289 | 3300046471 | Bacteria | 7430 |
| 483 | Ga0495650_0006670 | 3300046471 | Bacteria | 7155 |
| 484 | Ga0495650_0017460 | 3300046471 | Bacteria | 3597 |
| 485 | Ga0495650_0029119 | 3300046471 | Bacteria | 2522 |
| 486 | Ga0495650_0057982 | 3300046471 | Bacteria | 1565 |
| 487 | Ga0495582_0002084 | 3300046473 | Bacteria | 11187 |
| 488 | Ga0495605_0000191 | 3300046474 | Bacteria | 76513 |
| 489 | Ga0495605_0000212 | 3300046474 | Bacteria | 71789 |
| 490 | Ga0495605_0000309 | 3300046474 | Bacteria | 51425 |
| 491 | Ga0495605_0001761 | 3300046474 | Bacteria | 13880 |
| 492 | Ga0495605_0003411 | 3300046474 | Bacteria | 9468 |
| 493 | Ga0495605_0027322 | 3300046474 | Bacteria | 2958 |
| 494 | Ga0495605_0029904 | 3300046474 | Bacteria | 2797 |
| 495 | Ga0495605_0044150 | 3300046474 | Bacteria | 2205 |
| 496 | Ga0495605_0044664 | 3300046474 | Bacteria | 2189 |
| 497 | Ga0495605_0045491 | 3300046474 | Bacteria | 2163 |
| 498 | Ga0495605_0202154 | 3300046474 | Bacteria | 865 |
| 499 | Ga0495639_0011149 | 3300046475 | Bacteria | 3871 |
| 500 | Ga0495639_0022419 | 3300046475 | Bacteria | 2770 |
| 501 | Ga0495584_0000505 | 3300046491 | Bacteria | 26765 |
| 502 | Ga0495584_0002635 | 3300046491 | Bacteria | 10114 |
| 503 | Ga0495584_0003226 | 3300046491 | Bacteria | 9051 |
| 504 | Ga0495584_0009835 | 3300046491 | Bacteria | 4918 |
| 505 | Ga0495584_0039182 | 3300046491 | Bacteria | 2394 |
| 506 | Ga0495584_0053247 | 3300046491 | Bacteria | 2036 |
| 507 | Ga0495584_0063235 | 3300046491 | Bacteria | 1860 |
| 508 | Ga0495584_0127431 | 3300046491 | Bacteria | 1290 |
| 509 | Ga0495584_0208913 | 3300046491 | Bacteria | 992 |
| 510 | Ga0495585_0000228 | 3300046492 | Bacteria | 57922 |
| 511 | Ga0495585_0004597 | 3300046492 | Bacteria | 8921 |
| 512 | Ga0495585_0011533 | 3300046492 | Bacteria | 5229 |
| 513 | Ga0495585_0066195 | 3300046492 | Bacteria | 1979 |
| 514 | Ga0495585_0075193 | 3300046492 | Bacteria | 1837 |
| 515 | Ga0495594_0000125 | 3300046499 | Bacteria | 35944 |
| 516 | Ga0495594_0007936 | 3300046499 | Bacteria | 5458 |
| 517 | Ga0495594_0008555 | 3300046499 | Bacteria | 5275 |
| 518 | Ga0495594_0009339 | 3300046499 | Bacteria | 5066 |
| 519 | Ga0495596_0000028 | 3300046500 | Bacteria | 103710 |
| 520 | Ga0495596_0030659 | 3300046500 | Bacteria | 2151 |
| 521 | Ga0495596_0037155 | 3300046500 | Bacteria | 1926 |
| 522 | Ga0495607_0000058 | 3300046501 | Bacteria | 109864 |
| 523 | Ga0495607_0000936 | 3300046501 | Bacteria | 27159 |
| 524 | Ga0495607_0001376 | 3300046501 | Bacteria | 21622 |
| 525 | Ga0495607_0001798 | 3300046501 | Bacteria | 18317 |
| 526 | Ga0495607_0002668 | 3300046501 | Bacteria | 14272 |
| 527 | Ga0495607_0003115 | 3300046501 | Bacteria | 12872 |
| 528 | Ga0495607_0008043 | 3300046501 | Bacteria | 7241 |
| 529 | Ga0495607_0012233 | 3300046501 | Bacteria | 5672 |
| 530 | Ga0495607_0027603 | 3300046501 | Bacteria | 3507 |
| 531 | Ga0495607_0035349 | 3300046501 | Bacteria | 3023 |
| 532 | Ga0495607_0137465 | 3300046501 | Bacteria | 1264 |
| 533 | Ga0495607_0169315 | 3300046501 | Bacteria | 1104 |
| 534 | Ga0495607_0271837 | 3300046501 | Bacteria | 807 |
| 535 | Ga0495583_0000036 | 3300046506 | Bacteria | 246077 |
| 536 | Ga0495583_0000465 | 3300046506 | Bacteria | 59902 |
| 537 | Ga0495583_0001061 | 3300046506 | Bacteria | 30742 |
| 538 | Ga0495583_0004020 | 3300046506 | Bacteria | 10833 |
| 539 | Ga0495583_0006457 | 3300046506 | Bacteria | 7665 |
| 540 | Ga0495583_0015625 | 3300046506 | Bacteria | 4118 |
| 541 | Ga0495606_0000691 | 3300046507 | Bacteria | 52384 |
| 542 | Ga0495606_0000724 | 3300046507 | Bacteria | 51037 |
| 543 | Ga0495606_0000782 | 3300046507 | Bacteria | 48702 |
| 544 | Ga0495606_0000988 | 3300046507 | Bacteria | 41466 |
| 545 | Ga0495606_0004452 | 3300046507 | Bacteria | 13991 |
| 546 | Ga0495606_0004727 | 3300046507 | Bacteria | 13409 |
| 547 | Ga0495606_0008677 | 3300046507 | Bacteria | 8759 |
| 548 | Ga0495606_0009687 | 3300046507 | Bacteria | 8107 |
| 549 | Ga0495606_0010638 | 3300046507 | Bacteria | 7609 |
| 550 | Ga0495606_0013017 | 3300046507 | Bacteria | 6613 |
| 551 | Ga0495606_0026021 | 3300046507 | Bacteria | 4175 |
| 552 | Ga0495606_0026693 | 3300046507 | Bacteria | 4111 |
| 553 | Ga0495606_0048957 | 3300046507 | Bacteria | 2775 |
| 554 | Ga0495610_0003177 | 3300046512 | Bacteria | 13024 |
| 555 | Ga0495610_0003532 | 3300046512 | Bacteria | 12113 |
| 556 | Ga0495610_0006409 | 3300046512 | Bacteria | 8103 |
| 557 | Ga0495610_0009530 | 3300046512 | Bacteria | 6127 |
| 558 | Ga0495610_0010263 | 3300046512 | Bacteria | 5836 |
| 559 | Ga0495610_0010542 | 3300046512 | Bacteria | 5731 |
| 560 | Ga0495610_0013697 | 3300046512 | Bacteria | 4803 |
| 561 | Ga0495610_0014956 | 3300046512 | Bacteria | 4532 |
| 562 | Ga0495610_0018000 | 3300046512 | Bacteria | 4005 |
| 563 | Ga0495610_0022822 | 3300046512 | Bacteria | 3414 |
| 564 | Ga0495610_0050357 | 3300046512 | Bacteria | 2034 |
| 565 | Ga0495610_0051532 | 3300046512 | Bacteria | 2002 |
| 566 | Ga0495610_0068125 | 3300046512 | Bacteria | 1669 |
| 567 | Ga0495616_0000168 | 3300046513 | Bacteria | 56324 |
| 568 | Ga0495616_0001849 | 3300046513 | Bacteria | 14321 |
| 569 | Ga0495616_0005394 | 3300046513 | Bacteria | 7877 |
| 570 | Ga0495616_0008103 | 3300046513 | Bacteria | 6255 |
| 571 | Ga0495616_0014318 | 3300046513 | Bacteria | 4443 |
| 572 | Ga0495616_0035367 | 3300046513 | Bacteria | 2585 |
| 573 | Ga0495616_0038241 | 3300046513 | Bacteria | 2464 |
| 574 | Ga0495616_0053366 | 3300046513 | Bacteria | 2009 |
| 575 | Ga0495616_0125305 | 3300046513 | Bacteria | 1182 |
| 576 | Ga0495616_0143504 | 3300046513 | Bacteria | 1085 |
| 577 | Ga0495620_0000006 | 3300046515 | Bacteria | 273098 |
| 578 | Ga0495620_0000022 | 3300046515 | Bacteria | 136531 |
| 579 | Ga0495620_0000184 | 3300046515 | Bacteria | 48200 |
| 580 | Ga0495620_0001469 | 3300046515 | Bacteria | 14091 |
| 581 | Ga0495620_0002359 | 3300046515 | Bacteria | 10941 |
| 582 | Ga0495620_0004194 | 3300046515 | Bacteria | 8154 |
| 583 | Ga0495620_0006752 | 3300046515 | Bacteria | 6276 |
| 584 | Ga0495620_0014936 | 3300046515 | Bacteria | 3932 |
| 585 | Ga0495620_0018385 | 3300046515 | Bacteria | 3462 |
| 586 | Ga0495620_0030251 | 3300046515 | Bacteria | 2495 |
| 587 | Ga0495620_0075761 | 3300046515 | Bacteria | 1368 |
| 588 | Ga0495620_0221031 | 3300046515 | Bacteria | 725 |
| 589 | Ga0495628_0065374 | 3300046516 | Bacteria | 2845 |
| 590 | Ga0495630_0012152 | 3300046517 | Bacteria | 6244 |
| 591 | Ga0495630_0024402 | 3300046517 | Bacteria | 4471 |
| 592 | Ga0495630_0030578 | 3300046517 | Bacteria | 4007 |
| 593 | Ga0495631_0000020 | 3300046518 | Bacteria | 92958 |
| 594 | Ga0495631_0000221 | 3300046518 | Bacteria | 39142 |
| 595 | Ga0495631_0003793 | 3300046518 | Bacteria | 8219 |
| 596 | Ga0495631_0049788 | 3300046518 | Bacteria | 1833 |
| 597 | Ga0495631_0058201 | 3300046518 | Bacteria | 1681 |
| 598 | Ga0495631_0208088 | 3300046518 | Bacteria | 836 |
| 599 | Ga0495632_0000074 | 3300046519 | Bacteria | 103136 |
| 600 | Ga0495632_0000162 | 3300046519 | Bacteria | 69536 |
| 601 | Ga0495632_0000222 | 3300046519 | Bacteria | 57787 |
| 602 | Ga0495632_0002292 | 3300046519 | Bacteria | 14740 |
| 603 | Ga0495632_0004343 | 3300046519 | Bacteria | 9656 |
| 604 | Ga0495632_0004406 | 3300046519 | Bacteria | 9568 |
| 605 | Ga0495632_0008780 | 3300046519 | Bacteria | 6157 |
| 606 | Ga0495632_0015507 | 3300046519 | Bacteria | 4268 |
| 607 | Ga0495632_0054147 | 3300046519 | Bacteria | 1967 |
| 608 | Ga0495632_0133447 | 3300046519 | Bacteria | 1154 |
| 609 | Ga0495637_0000089 | 3300046520 | Bacteria | 71239 |
| 610 | Ga0495637_0000947 | 3300046520 | Bacteria | 18544 |
| 611 | Ga0495637_0001443 | 3300046520 | Bacteria | 13998 |
| 612 | Ga0495637_0002811 | 3300046520 | Bacteria | 9437 |
| 613 | Ga0495637_0010044 | 3300046520 | Bacteria | 4596 |
| 614 | Ga0495637_0016489 | 3300046520 | Bacteria | 3452 |
| 615 | Ga0495637_0020019 | 3300046520 | Bacteria | 3082 |
| 616 | Ga0495637_0033185 | 3300046520 | Bacteria | 2269 |
| 617 | Ga0495637_0036173 | 3300046520 | Bacteria | 2152 |
| 618 | Ga0495637_0185531 | 3300046520 | Bacteria | 769 |
| 619 | Ga0495643_0000185 | 3300046522 | Bacteria | 99895 |
| 620 | Ga0495643_0002208 | 3300046522 | Bacteria | 15866 |
| 621 | Ga0495643_0003299 | 3300046522 | Bacteria | 11925 |
| 622 | Ga0495643_0008354 | 3300046522 | Bacteria | 6562 |
| 623 | Ga0495643_0011217 | 3300046522 | Bacteria | 5474 |
| 624 | Ga0495643_0026753 | 3300046522 | Bacteria | 3249 |
| 625 | Ga0495643_0061631 | 3300046522 | Bacteria | 1988 |
| 626 | Ga0495643_0070710 | 3300046522 | Bacteria | 1832 |
| 627 | Ga0495644_0001883 | 3300046523 | Bacteria | 8449 |
| 628 | Ga0495644_0081195 | 3300046523 | Bacteria | 1222 |
| 629 | Ga0495648_0000243 | 3300046524 | Bacteria | 61488 |
| 630 | Ga0495648_0001614 | 3300046524 | Bacteria | 21924 |
| 631 | Ga0495648_0002022 | 3300046524 | Bacteria | 19228 |
| 632 | Ga0495648_0002271 | 3300046524 | Bacteria | 17946 |
| 633 | Ga0495648_0003640 | 3300046524 | Bacteria | 13471 |
| 634 | Ga0495648_0006325 | 3300046524 | Bacteria | 9687 |
| 635 | Ga0495648_0006428 | 3300046524 | Bacteria | 9594 |
| 636 | Ga0495648_0007373 | 3300046524 | Bacteria | 8810 |
| 637 | Ga0495648_0007672 | 3300046524 | Bacteria | 8603 |
| 638 | Ga0495648_0025015 | 3300046524 | Bacteria | 4051 |
| 639 | Ga0495648_0033010 | 3300046524 | Bacteria | 3387 |
| 640 | Ga0495648_0052554 | 3300046524 | Bacteria | 2474 |
| 641 | Ga0495648_0086131 | 3300046524 | Bacteria | 1772 |
| 642 | Ga0495648_0114050 | 3300046524 | Bacteria | 1464 |
| 643 | Ga0495648_0257739 | 3300046524 | Bacteria | 838 |
| 644 | Ga0495666_0001984 | 3300046526 | Bacteria | 10108 |
| 645 | Ga0495666_0022868 | 3300046526 | Bacteria | 3093 |
| 646 | Ga0495666_0039073 | 3300046526 | Bacteria | 2305 |
| 647 | Ga0495642_0000033 | 3300046528 | Bacteria | 85849 |
| 648 | Ga0495642_0000086 | 3300046528 | Bacteria | 53956 |
| 649 | Ga0495654_0000111 | 3300046530 | Bacteria | 92977 |
| 650 | Ga0495654_0002862 | 3300046530 | Bacteria | 10841 |
| 651 | Ga0495654_0002994 | 3300046530 | Bacteria | 10567 |
| 652 | Ga0495654_0003325 | 3300046530 | Bacteria | 9904 |
| 653 | Ga0495654_0004462 | 3300046530 | Bacteria | 8300 |
| 654 | Ga0495654_0007333 | 3300046530 | Bacteria | 6176 |
| 655 | Ga0495654_0007655 | 3300046530 | Bacteria | 6013 |
| 656 | Ga0495654_0010924 | 3300046530 | Bacteria | 4933 |
| 657 | Ga0495654_0011790 | 3300046530 | Bacteria | 4719 |
| 658 | Ga0495654_0018913 | 3300046530 | Bacteria | 3605 |
| 659 | Ga0495654_0031970 | 3300046530 | Bacteria | 2669 |
| 660 | Ga0495654_0103381 | 3300046530 | Bacteria | 1308 |
| 661 | Ga0495654_0129448 | 3300046530 | Bacteria | 1134 |
| 662 | Ga0495654_0157986 | 3300046530 | Bacteria | 997 |
| 663 | Ga0495586_0002403 | 3300046535 | Bacteria | 10163 |
| 664 | Ga0495587_0001739 | 3300046536 | Bacteria | 14536 |
| 665 | Ga0495587_0003739 | 3300046536 | Bacteria | 10095 |
| 666 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 667 | Ga0495609_0000329 | 3300046538 | Bacteria | 41907 |
| 668 | Ga0495609_0000631 | 3300046538 | Bacteria | 27394 |
| 669 | Ga0495609_0001719 | 3300046538 | Bacteria | 14187 |
| 670 | Ga0495609_0015134 | 3300046538 | Bacteria | 3614 |
| 671 | Ga0495609_0019639 | 3300046538 | Bacteria | 3124 |
| 672 | Ga0495609_0040845 | 3300046538 | Bacteria | 2086 |
| 673 | Ga0495597_0000004 | 3300046542 | Bacteria | 307496 |
| 674 | Ga0495597_0001453 | 3300046542 | Bacteria | 16962 |
| 675 | Ga0495597_0003855 | 3300046542 | Bacteria | 8499 |
| 676 | Ga0495597_0011117 | 3300046542 | Bacteria | 4370 |
| 677 | Ga0495597_0012258 | 3300046542 | Bacteria | 4138 |
| 678 | Ga0495597_0013089 | 3300046542 | Bacteria | 3982 |
| 679 | Ga0495597_0019648 | 3300046542 | Bacteria | 3157 |
| 680 | Ga0495597_0039126 | 3300046542 | Bacteria | 2124 |
| 681 | Ga0495597_0088211 | 3300046542 | Bacteria | 1319 |
| 682 | Ga0495645_0260393 | 3300046543 | Bacteria | 1149 |
| 683 | Ga0495622_0000538 | 3300046557 | Bacteria | 22760 |
| 684 | Ga0495622_0000911 | 3300046557 | Bacteria | 16047 |
| 685 | Ga0495622_0027675 | 3300046557 | Bacteria | 2646 |
| 686 | Ga0495622_0042954 | 3300046557 | Bacteria | 2101 |
| 687 | Ga0495622_0068214 | 3300046557 | Bacteria | 1643 |
| 688 | Ga0495633_0000140 | 3300046558 | Bacteria | 96787 |
| 689 | Ga0495633_0001679 | 3300046558 | Bacteria | 16654 |
| 690 | Ga0495633_0006318 | 3300046558 | Bacteria | 7056 |
| 691 | Ga0495633_0016429 | 3300046558 | Bacteria | 3815 |
| 692 | Ga0495633_0053985 | 3300046558 | Bacteria | 1891 |
| 693 | Ga0495633_0134234 | 3300046558 | Bacteria | 1145 |
| 694 | Ga0495668_0000814 | 3300046616 | Bacteria | 35749 |
| 695 | Ga0495668_0001572 | 3300046616 | Bacteria | 21592 |
| 696 | Ga0495668_0012939 | 3300046616 | Bacteria | 4939 |
| 697 | Ga0495668_0135602 | 3300046616 | Bacteria | 1347 |
| 698 | Ga0495668_0230155 | 3300046616 | Bacteria | 1015 |
| 699 | Ga0495634_0062265 | 3300046642 | Bacteria | 2478 |
| 700 | Ga0495611_0000107 | 3300046648 | Bacteria | 58046 |
| 701 | Ga0495611_0001100 | 3300046648 | Bacteria | 14250 |
| 702 | Ga0495611_0014337 | 3300046648 | Bacteria | 3385 |
| 703 | Ga0495625_0001089 | 3300046660 | Bacteria | 35275 |
| 704 | Ga0495625_0001350 | 3300046660 | Bacteria | 30319 |
| 705 | Ga0495625_0003934 | 3300046660 | Bacteria | 14282 |
| 706 | Ga0495625_0003974 | 3300046660 | Bacteria | 14180 |
| 707 | Ga0495625_0010214 | 3300046660 | Bacteria | 7789 |
| 708 | Ga0495625_0014514 | 3300046660 | Bacteria | 6279 |
| 709 | Ga0495625_0296255 | 3300046660 | Bacteria | 1036 |
| 710 | Ga0495625_0533201 | 3300046660 | Bacteria | 713 |
| 711 | Ga0495625_0551019 | 3300046660 | Bacteria | 698 |
| 712 | Ga0495635_0008476 | 3300046663 | Bacteria | 7180 |
| 713 | Ga0495635_0021942 | 3300046663 | Bacteria | 4449 |
| 714 | Ga0495659_0009818 | 3300046664 | Bacteria | 3062 |
| 715 | Ga0495661_0000018 | 3300046665 | Bacteria | 200787 |
| 716 | Ga0495661_0000313 | 3300046665 | Bacteria | 54614 |
| 717 | Ga0495661_0004385 | 3300046665 | Bacteria | 10204 |
| 718 | Ga0495661_0013508 | 3300046665 | Bacteria | 5483 |
| 719 | Ga0495661_0014483 | 3300046665 | Bacteria | 5281 |
| 720 | Ga0495661_0046274 | 3300046665 | Bacteria | 2657 |
| 721 | Ga0495661_0051854 | 3300046665 | Bacteria | 2475 |
| 722 | Ga0495661_0070924 | 3300046665 | Bacteria | 2037 |
| 723 | Ga0495661_0123709 | 3300046665 | Bacteria | 1425 |
| 724 | Ga0495588_0003508 | 3300046674 | Bacteria | 6841 |
| 725 | Ga0495588_0008803 | 3300046674 | Bacteria | 4639 |
| 726 | Ga0495588_0277440 | 3300046674 | Bacteria | 883 |
| 727 | Ga0495623_0001644 | 3300046679 | Bacteria | 15015 |
| 728 | Ga0495646_0003217 | 3300046680 | Bacteria | 10152 |
| 729 | Ga0495669_0002058 | 3300046684 | Bacteria | 8248 |
| 730 | Ga0495613_0006146 | 3300046689 | Bacteria | 8985 |
| 731 | Ga0495613_0040121 | 3300046689 | Bacteria | 3469 |
| 732 | Ga0495624_0000637 | 3300046690 | Bacteria | 27477 |
| 733 | Ga0495624_0057096 | 3300046690 | Bacteria | 2455 |
| 734 | Ga0495670_0000105 | 3300046691 | Bacteria | 37273 |
| 735 | Ga0495670_0001677 | 3300046691 | Bacteria | 10876 |
| 736 | Ga0495670_0001702 | 3300046691 | Bacteria | 10812 |
| 737 | Ga0495670_0002656 | 3300046691 | Bacteria | 8825 |
| 738 | Ga0495670_0003253 | 3300046691 | Bacteria | 8004 |
| 739 | Ga0495670_0046903 | 3300046691 | Bacteria | 2159 |
| 740 | Ga0495671_0001925 | 3300046692 | Bacteria | 13325 |
| 741 | Ga0495671_0003981 | 3300046692 | Bacteria | 8933 |
| 742 | Ga0495671_0004211 | 3300046692 | Bacteria | 8659 |
| 743 | Ga0495671_0012446 | 3300046692 | Bacteria | 4646 |
| 744 | Ga0495671_0016959 | 3300046692 | Bacteria | 3880 |
| 745 | Ga0495671_0035561 | 3300046692 | Bacteria | 2528 |
| 746 | Ga0495671_0047522 | 3300046692 | Bacteria | 2144 |
| 747 | Ga0495671_0057448 | 3300046692 | Bacteria | 1925 |
| 748 | Ga0495671_0147240 | 3300046692 | Bacteria | 1146 |
| 749 | Ga0495671_0263208 | 3300046692 | Bacteria | 831 |
| 750 | Ga0495649_0003035 | 3300046694 | Bacteria | 11518 |
| 751 | Ga0495649_0003965 | 3300046694 | Bacteria | 9768 |
| 752 | Ga0495649_0003972 | 3300046694 | Bacteria | 9762 |
| 753 | Ga0495649_0005030 | 3300046694 | Bacteria | 8500 |
| 754 | Ga0495649_0009234 | 3300046694 | Bacteria | 5875 |
| 755 | Ga0495649_0013087 | 3300046694 | Bacteria | 4795 |
| 756 | Ga0495649_0037104 | 3300046694 | Bacteria | 2675 |
| 757 | Ga0495649_0086955 | 3300046694 | Bacteria | 1668 |
| 758 | Ga0495649_0119919 | 3300046694 | Bacteria | 1391 |
| 759 | Ga0495649_0154255 | 3300046694 | Bacteria | 1205 |
| 760 | Ga0495649_0176877 | 3300046694 | Bacteria | 1114 |
| 761 | Ga0495649_0197132 | 3300046694 | Bacteria | 1047 |
| 762 | Ga0495649_0283316 | 3300046694 | Bacteria | 846 |
| 763 | Ga0495589_0000278 | 3300046794 | Bacteria | 41647 |
| 764 | Ga0495589_0002566 | 3300046794 | Bacteria | 10102 |
| 765 | Ga0495589_0017355 | 3300046794 | Bacteria | 3694 |
| 766 | Ga0495589_0036664 | 3300046794 | Bacteria | 2457 |
| 767 | Ga0495600_0022484 | 3300046809 | Bacteria | 4048 |
| 768 | Ga0495660_0000998 | 3300046810 | Bacteria | 20590 |
| 769 | Ga0495660_0001470 | 3300046810 | Bacteria | 16027 |
| 770 | Ga0495660_0001702 | 3300046810 | Bacteria | 14721 |
| 771 | Ga0495660_0002330 | 3300046810 | Bacteria | 12173 |
| 772 | Ga0495660_0003030 | 3300046810 | Bacteria | 10482 |
| 773 | Ga0495660_0003946 | 3300046810 | Bacteria | 9066 |
| 774 | Ga0495660_0005400 | 3300046810 | Bacteria | 7651 |
| 775 | Ga0495660_0008214 | 3300046810 | Bacteria | 6117 |
| 776 | Ga0495660_0012232 | 3300046810 | Bacteria | 4980 |
| 777 | Ga0495660_0013937 | 3300046810 | Bacteria | 4659 |
| 778 | Ga0495660_0025510 | 3300046810 | Bacteria | 3357 |
| 779 | Ga0495660_0026415 | 3300046810 | Bacteria | 3292 |
| 780 | Ga0495660_0065117 | 3300046810 | Bacteria | 1946 |
| 781 | Ga0495660_0079872 | 3300046810 | Bacteria | 1717 |
| 782 | Ga0495581_0013609 | 3300047315 | Bacteria | 4719 |
| 783 | Ga0495604_0002977 | 3300047317 | Bacteria | 13559 |
| 784 | Ga0495604_0019743 | 3300047317 | Bacteria | 5392 |
| 785 | Ga0495604_0031966 | 3300047317 | Bacteria | 4172 |
| 786 | Ga0495672_0000672 | 3300047320 | Bacteria | 37986 |
| 787 | Ga0495672_0001345 | 3300047320 | Bacteria | 24376 |
| 788 | Ga0495672_0003274 | 3300047320 | Bacteria | 14020 |
| 789 | Ga0495672_0009799 | 3300047320 | Bacteria | 6895 |
| 790 | Ga0495672_0017776 | 3300047320 | Bacteria | 4745 |
| 791 | Ga0495672_0046378 | 3300047320 | Bacteria | 2592 |
| 792 | Ga0495672_0065471 | 3300047320 | Bacteria | 2077 |
| 793 | Ga0495672_0069864 | 3300047320 | Bacteria | 1992 |
| 794 | Ga0495672_0140929 | 3300047320 | Bacteria | 1259 |
| 795 | Ga0495672_0225265 | 3300047320 | Bacteria | 923 |
| 796 | Ga0495676_0000286 | 3300047321 | Bacteria | 40855 |
| 797 | Ga0495676_0096988 | 3300047321 | Bacteria | 2190 |
| 798 | Ga0495680_0003972 | 3300047322 | Bacteria | 14287 |
| 799 | Ga0495680_0007080 | 3300047322 | Bacteria | 10333 |
| 800 | Ga0495680_0010401 | 3300047322 | Bacteria | 8302 |
| 801 | Ga0495680_0408872 | 3300047322 | Bacteria | 935 |
| 802 | Ga0495683_0000085 | 3300047323 | Bacteria | 93009 |
| 803 | Ga0495683_0000270 | 3300047323 | Bacteria | 45608 |
| 804 | Ga0495683_0009634 | 3300047323 | Bacteria | 5142 |
| 805 | Ga0495683_0011491 | 3300047323 | Bacteria | 4655 |
| 806 | Ga0495687_000375 | 3300047443 | Bacteria | 55715 |
| 807 | Ga0495687_001177 | 3300047443 | Bacteria | 25211 |
| 808 | Ga0495687_009480 | 3300047443 | Bacteria | 5435 |
| 809 | Ga0495675_0023229 | 3300047444 | Bacteria | 3951 |
| 810 | Ga0495675_0102852 | 3300047444 | Bacteria | 1786 |
| 811 | Ga0495679_000190 | 3300047446 | Bacteria | 54219 |
| 812 | Ga0495679_000211 | 3300047446 | Bacteria | 50030 |
| 813 | Ga0495679_000233 | 3300047446 | Bacteria | 46629 |
| 814 | Ga0495679_000689 | 3300047446 | Bacteria | 21996 |
| 815 | Ga0495679_006729 | 3300047446 | Bacteria | 4902 |
| 816 | Ga0495679_009097 | 3300047446 | Bacteria | 4000 |
| 817 | Ga0495679_010665 | 3300047446 | Bacteria | 3595 |
| 818 | Ga0495673_0000183 | 3300047469 | Bacteria | 101083 |
| 819 | Ga0495673_0000297 | 3300047469 | Bacteria | 66473 |
| 820 | Ga0495673_0000537 | 3300047469 | Bacteria | 39215 |
| 821 | Ga0495673_0000628 | 3300047469 | Bacteria | 34725 |
| 822 | Ga0495673_0002220 | 3300047469 | Bacteria | 13970 |
| 823 | Ga0495673_0002230 | 3300047469 | Bacteria | 13918 |
| 824 | Ga0495673_0009831 | 3300047469 | Bacteria | 5255 |
| 825 | Ga0495673_0015998 | 3300047469 | Bacteria | 3847 |
| 826 | Ga0495673_0051299 | 3300047469 | Bacteria | 1807 |
| 827 | Ga0495673_0059258 | 3300047469 | Bacteria | 1646 |
| 828 | Ga0495673_0073449 | 3300047469 | Bacteria | 1433 |
| 829 | Ga0495673_0095150 | 3300047469 | Bacteria | 1211 |
| 830 | Ga0495673_0139864 | 3300047469 | Bacteria | 944 |
| 831 | Ga0495673_0145522 | 3300047469 | Bacteria | 920 |
| 832 | Ga0495681_0000448 | 3300047470 | Bacteria | 31537 |
| 833 | Ga0495681_0000856 | 3300047470 | Bacteria | 23410 |
| 834 | Ga0495681_0002022 | 3300047470 | Bacteria | 14803 |
| 835 | Ga0495681_0002233 | 3300047470 | Bacteria | 13928 |
| 836 | Ga0495681_0002398 | 3300047470 | Bacteria | 13412 |
| 837 | Ga0495681_0002965 | 3300047470 | Bacteria | 11958 |
| 838 | Ga0495681_0003914 | 3300047470 | Bacteria | 10266 |
| 839 | Ga0495681_0004992 | 3300047470 | Bacteria | 8949 |
| 840 | Ga0495681_0012491 | 3300047470 | Bacteria | 4986 |
| 841 | Ga0495681_0015669 | 3300047470 | Bacteria | 4281 |
| 842 | Ga0495681_0016972 | 3300047470 | Bacteria | 4060 |
| 843 | Ga0495681_0020296 | 3300047470 | Bacteria | 3608 |
| 844 | Ga0495681_0032455 | 3300047470 | Bacteria | 2628 |
| 845 | Ga0495681_0077050 | 3300047470 | Bacteria | 1497 |
| 846 | Ga0495684_0231387 | 3300047471 | Bacteria | 1351 |
| 847 | Ga0495686_0000029 | 3300047472 | Bacteria | 369110 |
| 848 | Ga0495686_0005722 | 3300047472 | Bacteria | 9713 |
| 849 | Ga0495686_0017829 | 3300047472 | Bacteria | 4778 |
| 850 | Ga0495686_0059930 | 3300047472 | Bacteria | 2367 |
| 851 | Ga0495686_0104466 | 3300047472 | Bacteria | 1705 |
| 852 | Ga0495686_0108175 | 3300047472 | Bacteria | 1670 |
| 853 | Ga0495593_0008535 | 3300047673 | Bacteria | 5956 |
| 854 | Ga0495593_0014594 | 3300047673 | Bacteria | 4464 |
| 855 | Ga0495593_0025676 | 3300047673 | Bacteria | 3260 |
| 856 | Ga0495602_0030341 | 3300048088 | Bacteria | 5129 |
| 857 | Ga0495626_0000144 | 3300048091 | Bacteria | 89793 |
| 858 | Ga0495626_0000324 | 3300048091 | Bacteria | 50382 |
| 859 | Ga0495626_0000420 | 3300048091 | Bacteria | 43492 |
| 860 | Ga0495626_0000679 | 3300048091 | Bacteria | 32576 |
| 861 | Ga0495626_0002781 | 3300048091 | Bacteria | 11730 |
| 862 | Ga0495626_0021703 | 3300048091 | Bacteria | 3181 |
| 863 | Ga0495626_0040258 | 3300048091 | Bacteria | 2208 |
| 864 | Ga0495626_0094540 | 3300048091 | Bacteria | 1310 |
| 865 | Ga0496100_0793705 | 3300048903 | Bacteria | 742 |
| 866 | Ga0496101_0258484 | 3300048904 | Bacteria | 1358 |
| 867 | Ga0496102_0118909 | 3300048905 | Bacteria | 2467 |
| 868 | Ga0496103_0394662 | 3300048906 | Bacteria | 889 |
| 869 | Ga0496104_0229097 | 3300048907 | Bacteria | 1770 |
| 870 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 871 | Ga0496106_0285170 | 3300048909 | Bacteria | 1323 |
| 872 | Ga0496108_0204626 | 3300048911 | Bacteria | 1713 |
| 873 | Ga0496110_0153118 | 3300048913 | Bacteria | 2088 |
| 874 | Ga0496110_0231549 | 3300048913 | Bacteria | 1680 |
| 875 | Ga0496110_0275727 | 3300048913 | Bacteria | 1531 |
| 876 | Ga0496110_0355037 | 3300048913 | Bacteria | 1336 |
| 877 | Ga0496111_0003743 | 3300048914 | Bacteria | 9472 |
| 878 | Ga0496111_0282541 | 3300048914 | Bacteria | 1231 |
| 879 | Ga0496112_0020353 | 3300048915 | Bacteria | 6289 |
| 880 | Ga0496112_0109911 | 3300048915 | Bacteria | 2727 |
| 881 | Ga0496114_0057296 | 3300048917 | Bacteria | 3253 |
| 882 | Ga0496114_0077268 | 3300048917 | Bacteria | 2807 |
| 883 | Ga0496115_0522910 | 3300048918 | Bacteria | 951 |
| 884 | Ga0496116_0000168 | 3300048919 | Bacteria | 132462 |
| 885 | Ga0496116_0000869 | 3300048919 | Bacteria | 37701 |
| 886 | Ga0496116_0007948 | 3300048919 | Bacteria | 9295 |
| 887 | Ga0496116_0008311 | 3300048919 | Bacteria | 9020 |
| 888 | Ga0496116_0126930 | 3300048919 | Bacteria | 1463 |
| 889 | Ga0496117_0000272 | 3300048920 | Bacteria | 96736 |
| 890 | Ga0496117_0002072 | 3300048920 | Bacteria | 26520 |
| 891 | Ga0496117_0004053 | 3300048920 | Bacteria | 16464 |
| 892 | Ga0496117_0005260 | 3300048920 | Bacteria | 13734 |
| 893 | Ga0496117_0007492 | 3300048920 | Bacteria | 10641 |
| 894 | Ga0496117_0033297 | 3300048920 | Bacteria | 3899 |
| 895 | Ga0496117_0083261 | 3300048920 | Bacteria | 2092 |
| 896 | Ga0496117_0143808 | 3300048920 | Bacteria | 1423 |
| 897 | Ga0496117_0251105 | 3300048920 | Bacteria | 965 |
| 898 | Ga0496118_0001876 | 3300048921 | Bacteria | 30011 |
| 899 | Ga0496118_0008366 | 3300048921 | Bacteria | 10704 |
| 900 | Ga0496118_0017735 | 3300048921 | Bacteria | 6462 |
| 901 | Ga0496118_0022749 | 3300048921 | Bacteria | 5465 |
| 902 | Ga0496118_0040580 | 3300048921 | Bacteria | 3698 |
| 903 | Ga0496118_0051411 | 3300048921 | Bacteria | 3152 |
| 904 | Ga0496118_0076401 | 3300048921 | Bacteria | 2382 |
| 905 | Ga0496118_0131082 | 3300048921 | Bacteria | 1610 |
| 906 | Ga0496118_0134133 | 3300048921 | Bacteria | 1583 |
| 907 | Ga0496119_0000016 | 3300048922 | Bacteria | 309806 |
| 908 | Ga0496119_0025249 | 3300048922 | Bacteria | 4154 |
| 909 | Ga0496119_0169367 | 3300048922 | Bacteria | 1155 |
| 910 | Ga0496120_0000310 | 3300048923 | Bacteria | 81092 |
| 911 | Ga0496120_0014298 | 3300048923 | Bacteria | 5298 |
| 912 | Ga0496121_0000199 | 3300048924 | Bacteria | 132751 |
| 913 | Ga0496121_0002620 | 3300048924 | Bacteria | 27128 |
| 914 | Ga0496121_0004114 | 3300048924 | Bacteria | 19942 |
| 915 | Ga0496121_0013203 | 3300048924 | Bacteria | 8900 |
| 916 | Ga0496121_0018115 | 3300048924 | Bacteria | 7125 |
| 917 | Ga0496121_0031729 | 3300048924 | Bacteria | 4819 |
| 918 | Ga0496121_0166251 | 3300048924 | Bacteria | 1607 |
| 919 | Ga0496122_0000285 | 3300048925 | Bacteria | 113073 |
| 920 | Ga0496122_0001556 | 3300048925 | Bacteria | 36329 |
| 921 | Ga0496122_0002556 | 3300048925 | Bacteria | 25569 |
| 922 | Ga0496122_0003462 | 3300048925 | Bacteria | 20754 |
| 923 | Ga0496122_0032233 | 3300048925 | Bacteria | 4338 |
| 924 | Ga0496122_0033675 | 3300048925 | Bacteria | 4208 |
| 925 | Ga0496122_0042353 | 3300048925 | Bacteria | 3584 |
| 926 | Ga0496122_0057594 | 3300048925 | Bacteria | 2884 |
| 927 | Ga0496122_0084045 | 3300048925 | Bacteria | 2204 |
| 928 | Ga0496123_0000028 | 3300048926 | Bacteria | 306006 |
| 929 | Ga0496123_0000232 | 3300048926 | Bacteria | 113073 |
| 930 | Ga0496123_0006867 | 3300048926 | Bacteria | 10900 |
| 931 | Ga0496123_0009172 | 3300048926 | Bacteria | 8945 |
| 932 | Ga0496123_0009973 | 3300048926 | Bacteria | 8465 |
| 933 | Ga0496123_0011036 | 3300048926 | Bacteria | 7887 |
| 934 | Ga0496123_0023832 | 3300048926 | Bacteria | 4673 |
| 935 | Ga0496123_0047498 | 3300048926 | Bacteria | 2899 |
| 936 | Ga0496123_0205838 | 3300048926 | Bacteria | 1004 |
| 937 | Ga0496124_0000845 | 3300048927 | Bacteria | 49946 |
| 938 | Ga0496124_0003855 | 3300048927 | Bacteria | 17946 |
| 939 | Ga0496124_0006097 | 3300048927 | Bacteria | 13258 |
| 940 | Ga0496124_0012251 | 3300048927 | Bacteria | 8477 |
| 941 | Ga0496124_0016579 | 3300048927 | Bacteria | 6993 |
| 942 | Ga0496124_0017941 | 3300048927 | Bacteria | 6651 |
| 943 | Ga0496124_0029892 | 3300048927 | Bacteria | 4846 |
| 944 | Ga0496124_0052275 | 3300048927 | Bacteria | 3471 |
| 945 | Ga0496124_0065967 | 3300048927 | Bacteria | 3016 |
| 946 | Ga0496124_0068180 | 3300048927 | Bacteria | 2958 |
| 947 | Ga0496124_0178626 | 3300048927 | Bacteria | 1636 |
| 948 | Ga0496124_0316514 | 3300048927 | Bacteria | 1119 |
| 949 | Ga0496124_0355513 | 3300048927 | Bacteria | 1034 |
| 950 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 951 | Ga0496125_0006102 | 3300048928 | Bacteria | 13154 |
| 952 | Ga0496125_0008266 | 3300048928 | Bacteria | 10927 |
| 953 | Ga0496125_0014915 | 3300048928 | Bacteria | 7547 |
| 954 | Ga0496125_0016068 | 3300048928 | Bacteria | 7204 |
| 955 | Ga0496125_0069656 | 3300048928 | Bacteria | 2758 |
| 956 | Ga0496126_0001078 | 3300048929 | Bacteria | 45930 |
| 957 | Ga0496126_0847537 | 3300048929 | Bacteria | 697 |
| 958 | Ga0495678_000037 | 3300049459 | Bacteria | 197851 |
| 959 | Ga0495678_000309 | 3300049459 | Bacteria | 52491 |
| 960 | Ga0495678_000573 | 3300049459 | Bacteria | 34988 |
| 961 | Ga0495678_004351 | 3300049459 | Bacteria | 8231 |
| 962 | Ga0495678_004855 | 3300049459 | Bacteria | 7615 |
| 963 | Ga0495678_014755 | 3300049459 | Bacteria | 3621 |
| 964 | Ga0495678_014771 | 3300049459 | Bacteria | 3619 |
| 965 | Ga0495678_015339 | 3300049459 | Bacteria | 3529 |
| 966 | Ga0495678_018439 | 3300049459 | Bacteria | 3137 |
| 967 | Ga0495678_033073 | 3300049459 | Bacteria | 2137 |
| 968 | Ga0495678_034781 | 3300049459 | Bacteria | 2070 |
| 969 | Ga0495678_078501 | 3300049459 | Bacteria | 1191 |
| 970 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 971 | Ga0495682_0002232 | 3300049460 | Bacteria | 9338 |
| 972 | Ga0501031_0039731 | 3300049568 | Bacteria | 3071 |
| 973 | Ga0501033_0147188 | 3300049570 | Bacteria | 1700 |
| 974 | Ga0501034_0000154 | 3300049571 | Bacteria | 129750 |
| 975 | Ga0501034_0002701 | 3300049571 | Bacteria | 20885 |
| 976 | Ga0501037_0000642 | 3300049573 | Bacteria | 27029 |
| 977 | Ga0501037_0010929 | 3300049573 | Bacteria | 6672 |
| 978 | Ga0501038_0008387 | 3300049574 | Bacteria | 9503 |
| 979 | Ga0501039_0000426 | 3300049575 | Bacteria | 30431 |
| 980 | Ga0501043_0160252 | 3300049579 | Bacteria | 1758 |
| 981 | Ga0501046_0004813 | 3300049580 | Bacteria | 12171 |
| 982 | Ga0501047_0004014 | 3300049581 | Bacteria | 13833 |
| 983 | Ga0501048_0000754 | 3300049582 | Bacteria | 23695 |
| 984 | Ga0501067_0010822 | 3300049583 | Bacteria | 5046 |
| 985 | Ga0501080_0000620 | 3300049742 | Bacteria | 28124 |
| 986 | Ga0501241_000265 | 3300049758 | Bacteria | 11675 |
| 987 | Ga0501241_016342 | 3300049758 | Bacteria | 1353 |
| 988 | Ga0501035_0000020 | 3300049822 | Bacteria | 221605 |
| 989 | Ga0501044_0000397 | 3300049823 | Bacteria | 54054 |
| 990 | Ga0501226_000854 | 3300049853 | Bacteria | 4082 |
| 991 | nmdc:mga03683_56220_c1 | 3300050489 | Bacteria | 1654 |
| 992 | nmdc:mga00v17_32906_c1 | 3300050491 | Bacteria | 3068 |
| 993 | nmdc:mga00v17_394140_c1 | 3300050491 | Bacteria | 900 |
| 994 | nmdc:mga08x19_199240_c1 | 3300050514 | Bacteria | 1372 |
| 995 | Ga0500643_000521 | 3300053087 | Bacteria | 27149 |
| 996 | Ga0500643_001627 | 3300053087 | Bacteria | 12551 |
| 997 | Ga0500641_0000496 | 3300053096 | Bacteria | 14224 |
| 998 | Ga0500650_0196879 | 3300053098 | Bacteria | 919 |
| 999 | Ga0500650_0234971 | 3300053098 | Bacteria | 826 |
| 1000 | Ga0500556_0019834 | 3300053104 | Bacteria | 2143 |
| 1001 | Ga0500562_003504 | 3300053108 | Bacteria | 3935 |
| 1002 | Ga0500562_009216 | 3300053108 | Bacteria | 2495 |
| 1003 | Ga0500572_000566 | 3300053111 | Bacteria | 12617 |
| 1004 | Ga0500595_106409 | 3300053119 | Bacteria | 800 |
| 1005 | Ga0500618_022445 | 3300053125 | Bacteria | 1534 |
| 1006 | Ga0500659_0001554 | 3300053135 | Bacteria | 14414 |
| 1007 | Ga0500573_0069783 | 3300053140 | Bacteria | 2005 |
| 1008 | Ga0500616_0005812 | 3300053153 | Bacteria | 8279 |
| 1009 | Ga0500616_0059483 | 3300053153 | Bacteria | 1984 |
| 1010 | Ga0500616_0120588 | 3300053153 | Bacteria | 1253 |
| 1011 | Ga0500616_0184955 | 3300053153 | Bacteria | 935 |
| 1012 | Ga0500622_0022117 | 3300053156 | Bacteria | 3372 |
| 1013 | Ga0500622_0162555 | 3300053156 | Bacteria | 1046 |
| 1014 | Ga0500634_0000091 | 3300053161 | Bacteria | 34955 |
| 1015 | Ga0500645_001154 | 3300053730 | Bacteria | 14234 |
| 1016 | Ga0500645_022142 | 3300053730 | Bacteria | 1957 |
| 1017 | Ga0501082_0004759 | 3300060353 | Bacteria | 11845 |
| 1018 | Ga0466962_0095127 | 3300061719 | Bacteria | 1428 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0847537 | Ga0496126_0847537_144_674 | 176 |
| 2 | 3300053119 | Ga0500595_106409 | Ga0500595_106409_260_790 | 176 |
| 3 | 3300044683 | Ga0466965_0012175 | Ga0466965_0012175_1194_1853 | 180 |
| 4 | 3300049582 | Ga0501048_0000754 | Ga0501048_0000754_7755_8360 | 184 |
| 5 | iso_pu_bacteria | 2929189879 | 2929192710 | 184 |
| 6 | 3300025711 | Ga0207696_1018265 | Ga0207696_10182652 | 185 |
| 7 | 3300041453 | Ga0451797_0248178 | Ga0451797_0248178_59_625 | 185 |
| 8 | 3300025944 | Ga0207661_10350006 | Ga0207661_103500061 | 187 |
| 9 | iso_pu_bacteria | 2899275550 | 2899275657 | 187 |
| 10 | 2162886007 | SwRhRL2b_contig_1587916 | SwRhRL2b_0328.00011640 | 189 |
| 11 | 3300005289 | Ga0065704_10124139 | Ga0065704_101241392 | 189 |
| 12 | 3300006944 | Ga0099823_1000029 | Ga0099823_100002948 | 189 |
| 13 | 3300009011 | Ga0105251_10010585 | Ga0105251_100105851 | 189 |
| 14 | 3300009036 | Ga0105244_10015652 | Ga0105244_100156525 | 189 |
| 15 | 3300009148 | Ga0105243_10020104 | Ga0105243_100201042 | 189 |
| 16 | 3300025728 | Ga0207655_1041659 | Ga0207655_10416592 | 189 |
| 17 | 3300025935 | Ga0207709_10012519 | Ga0207709_100125192 | 189 |
| 18 | 3300027296 | Ga0209389_1000091 | Ga0209389_100009111 | 189 |
| 19 | 3300042006 | Ga0439432_003675 | Ga0439432_003675_4604_5233 | 189 |
| 20 | 3300042142 | Ga0450905_005175 | Ga0450905_005175_1052_1681 | 189 |
| 21 | 3300046515 | Ga0495620_0000006 | Ga0495620_0000006_18164_18793 | 189 |
| 22 | 3300046519 | Ga0495632_0000074 | Ga0495632_0000074_91151_91780 | 189 |
| 23 | 3300046522 | Ga0495643_0000185 | Ga0495643_0000185_87521_88150 | 189 |
| 24 | 3300046524 | Ga0495648_0000243 | Ga0495648_0000243_48841_49470 | 189 |
| 25 | 3300048906 | Ga0496103_0394662 | Ga0496103_0394662_149_769 | 189 |
| 26 | 3300048919 | Ga0496116_0126930 | Ga0496116_0126930_85_714 | 189 |
| 27 | 3300048920 | Ga0496117_0000272 | Ga0496117_0000272_29157_29786 | 189 |
| 28 | 3300049571 | Ga0501034_0000154 | Ga0501034_0000154_17951_18580 | 189 |
| 29 | 3300053135 | Ga0500659_0001554 | Ga0500659_0001554_9654_10283 | 189 |
| 30 | 3300009092 | Ga0105250_10306551 | Ga0105250_103065511 | 190 |
| 31 | 3300046543 | Ga0495645_0260393 | Ga0495645_0260393_68_733 | 190 |
| 32 | 3300003781 | Ga0055536_1000165 | Ga0055536_100016510 | 191 |
| 33 | 3300003791 | Ga0055530_10000357 | Ga0055530_1000035710 | 191 |
| 34 | 3300003792 | Ga0055540_1001210 | Ga0055540_100121015 | 191 |
| 35 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021254 | 191 |
| 36 | 3300025298 | Ga0209050_1000595 | Ga0209050_100059510 | 191 |
| 37 | 3300025303 | Ga0209051_1000407 | Ga0209051_100040751 | 191 |
| 38 | 3300041411 | Ga0439466_0000181 | Ga0439466_0000181_18477_19082 | 191 |
| 39 | 3300042013 | Ga0439456_028274 | Ga0439456_028274_28_633 | 191 |
| 40 | 3300042016 | Ga0439463_000135 | Ga0439463_000135_3584_4189 | 191 |
| 41 | 3300042993 | Ga0439440_0001144 | Ga0439440_0001144_3557_4162 | 191 |
| 42 | 3300048928 | Ga0496125_0069656 | Ga0496125_0069656_15_590 | 191 |
| 43 | 3300049460 | Ga0495682_0000020 | Ga0495682_0000020_7452_8060 | 191 |
| 44 | 3300053153 | Ga0500616_0184955 | Ga0500616_0184955_168_773 | 191 |
| 45 | 3300045051 | Ga0451576_0230380 | Ga0451576_0230380_672_1250 | 192 |
| 46 | 3300009036 | Ga0105244_10039504 | Ga0105244_100395044 | 193 |
| 47 | iso_pu_bacteria | 2643221558 | 2643813925 | 193 |
| 48 | 2162886007 | SwRhRL2b_contig_2309387 | SwRhRL2b_0467.00004360 | 194 |
| 49 | 3300003781 | Ga0055536_1009023 | Ga0055536_10090233 | 194 |
| 50 | 3300009036 | Ga0105244_10000738 | Ga0105244_1000073810 | 194 |
| 51 | 3300009036 | Ga0105244_10015736 | Ga0105244_100157364 | 194 |
| 52 | 3300013104 | Ga0157370_10082525 | Ga0157370_100825252 | 194 |
| 53 | 3300013307 | Ga0157372_10019720 | Ga0157372_100197203 | 194 |
| 54 | 3300025292 | Ga0209676_1000752 | Ga0209676_100075222 | 194 |
| 55 | 3300025711 | Ga0207696_1000006 | Ga0207696_1000006261 | 194 |
| 56 | 3300025711 | Ga0207696_1017693 | Ga0207696_10176931 | 194 |
| 57 | 3300025728 | Ga0207655_1000940 | Ga0207655_100094023 | 194 |
| 58 | 3300025728 | Ga0207655_1001227 | Ga0207655_10012279 | 194 |
| 59 | 3300025728 | Ga0207655_1020537 | Ga0207655_10205372 | 194 |
| 60 | 3300025735 | Ga0207713_1012331 | Ga0207713_10123314 | 194 |
| 61 | 3300048911 | Ga0496108_0204626 | Ga0496108_0204626_84_710 | 194 |
| 62 | 3300048913 | Ga0496110_0153118 | Ga0496110_0153118_546_1175 | 194 |
| 63 | 3300048917 | Ga0496114_0057296 | Ga0496114_0057296_662_1291 | 194 |
| 64 | 3300048920 | Ga0496117_0004053 | Ga0496117_0004053_4147_4776 | 194 |
| 65 | 3300048921 | Ga0496118_0022749 | Ga0496118_0022749_656_1285 | 194 |
| 66 | 3300048922 | Ga0496119_0000016 | Ga0496119_0000016_215182_215805 | 194 |
| 67 | 3300048923 | Ga0496120_0000310 | Ga0496120_0000310_12900_13523 | 194 |
| 68 | 3300048924 | Ga0496121_0018115 | Ga0496121_0018115_1558_2187 | 194 |
| 69 | 3300048925 | Ga0496122_0001556 | Ga0496122_0001556_19063_19692 | 194 |
| 70 | 3300048925 | Ga0496122_0042353 | Ga0496122_0042353_640_1269 | 194 |
| 71 | 3300048926 | Ga0496123_0000028 | Ga0496123_0000028_17519_18148 | 194 |
| 72 | 3300048926 | Ga0496123_0205838 | Ga0496123_0205838_244_873 | 194 |
| 73 | 3300048927 | Ga0496124_0003855 | Ga0496124_0003855_8421_9050 | 194 |
| 74 | 3300048927 | Ga0496124_0006097 | Ga0496124_0006097_7479_8099 | 194 |
| 75 | 3300048927 | Ga0496124_0052275 | Ga0496124_0052275_781_1410 | 194 |
| 76 | 3300048927 | Ga0496124_0065967 | Ga0496124_0065967_371_1000 | 194 |
| 77 | 3300048927 | Ga0496124_0316514 | Ga0496124_0316514_95_724 | 194 |
| 78 | 3300048928 | Ga0496125_0000038 | Ga0496125_0000038_32149_32778 | 194 |
| 79 | 3300048928 | Ga0496125_0006102 | Ga0496125_0006102_2886_3515 | 194 |
| 80 | 3300048928 | Ga0496125_0016068 | Ga0496125_0016068_6476_7105 | 194 |
| 81 | iso_pu_bacteria | 2643221736 | 2644743280 | 194 |
| 82 | iso_pu_bacteria | 2728369097 | 2729148181 | 194 |
| 83 | iso_pu_bacteria | 640427133 | 640487744 | 194 |
| 84 | iso_pu_bacteria | 651053060 | 651175679 | 194 |
| 85 | 3300035089 | Ga0373944_0024203 | Ga0373944_0024203_622_1239 | 195 |
| 86 | 3300035171 | Ga0373946_0014580 | Ga0373946_0014580_311_928 | 195 |
| 87 | 3300035695 | Ga0373927_0000731 | Ga0373927_0000731_7075_7692 | 195 |
| 88 | 3300035725 | Ga0373947_0317631 | Ga0373947_0317631_97_714 | 195 |
| 89 | 3300037068 | Ga0373925_0000049 | Ga0373925_0000049_116762_117379 | 195 |
| 90 | 3300045051 | Ga0451576_0358142 | Ga0451576_0358142_351_944 | 196 |
| 91 | iso_pu_bacteria | 2599185307 | 2599973711 | 196 |
| 92 | iso_pu_bacteria | 2891048133 | 2891052154 | 196 |
| 93 | iso_pu_bacteria | 2511231006 | 2511268462 | 197 |
| 94 | iso_pu_bacteria | 2512047018 | 2512324865 | 197 |
| 95 | iso_pu_bacteria | 2582580891 | 2583790991 | 197 |
| 96 | iso_pu_bacteria | 2597489887 | 2597856864 | 197 |
| 97 | iso_pu_bacteria | 2599185185 | 2599483891 | 197 |
| 98 | iso_pu_bacteria | 2599185257 | 2599801537 | 197 |
| 99 | iso_pu_bacteria | 2600254931 | 2600365834 | 197 |
| 100 | iso_pu_bacteria | 2671180172 | 2671768486 | 197 |
| 101 | iso_pu_bacteria | 2740892503 | 2743736292 | 197 |
| 102 | iso_pu_bacteria | 2895511927 | 2895513300 | 197 |
| 103 | iso_pu_bacteria | 2908446538 | 2908449517 | 197 |
| 104 | iso_pu_bacteria | 2923153595 | 2923155306 | 197 |
| 105 | iso_pu_bacteria | 2946006987 | 2946009638 | 197 |
| 106 | iso_pu_bacteria | 2984286254 | 2984290732 | 197 |
| 107 | iso_pu_bacteria | 3007395558 | 3007400846 | 197 |
| 108 | iso_pu_bacteria | 8015687852 | 8015689524 | 197 |
| 109 | iso_pu_bacteria | 8055770955 | 8055772661 | 197 |
| 110 | 3300039093 | Ga0400489_31717 | Ga0400489_31717_106_702 | 198 |
| 111 | iso_pu_bacteria | 2597489888 | 2597864157 | 198 |
| 112 | iso_pu_bacteria | 2599185155 | 2599330644 | 198 |
| 113 | iso_pu_bacteria | 2599185189 | 2599507255 | 198 |
| 114 | iso_pu_bacteria | 2599185191 | 2599521683 | 198 |
| 115 | iso_pu_bacteria | 2600255296 | 2601691996 | 198 |
| 116 | iso_pu_bacteria | 2643221571 | 2643873936 | 198 |
| 117 | iso_pu_bacteria | 2643221713 | 2644620330 | 198 |
| 118 | iso_pu_bacteria | 2721755607 | 2723248859 | 198 |
| 119 | iso_pu_bacteria | 2826581358 | 2826585121 | 198 |
| 120 | iso_pu_bacteria | 2842815866 | 2842818655 | 198 |
| 121 | iso_pu_bacteria | 2842826826 | 2842827058 | 198 |
| 122 | iso_pu_bacteria | 2842837860 | 2842839148 | 198 |
| 123 | iso_pu_bacteria | 2842849001 | 2842854248 | 198 |
| 124 | iso_pu_bacteria | 2860867994 | 2860870728 | 198 |
| 125 | iso_pu_bacteria | 2946027586 | 2946030808 | 198 |
| 126 | iso_pu_bacteria | 2947233263 | 2947237954 | 198 |
| 127 | iso_pu_bacteria | 8054347763 | 8054352399 | 198 |
| 128 | iso_pu_bacteria | 8054503363 | 8054506487 | 198 |
| 129 | iso_pu_bacteria | 8055817908 | 8055821236 | 198 |
| 130 | iso_pu_bacteria | 8056131705 | 8056134896 | 198 |
| 131 | iso_pu_bacteria | 8056148874 | 8056150784 | 198 |
| 132 | 3300006058 | Ga0075432_10001643 | Ga0075432_100016433 | 199 |
| 133 | 3300027907 | Ga0207428_10482419 | Ga0207428_104824192 | 199 |
| 134 | 3300048913 | Ga0496110_0275727 | Ga0496110_0275727_95_694 | 199 |
| 135 | 3300048914 | Ga0496111_0003743 | Ga0496111_0003743_6975_7574 | 199 |
| 136 | 3300048925 | Ga0496122_0057594 | Ga0496122_0057594_1474_2073 | 199 |
| 137 | 3300048926 | Ga0496123_0009172 | Ga0496123_0009172_6178_6777 | 199 |
| 138 | 3300053087 | Ga0500643_000521 | Ga0500643_000521_7741_8355 | 199 |
| 139 | 3300053096 | Ga0500641_0000496 | Ga0500641_0000496_128_742 | 199 |
| 140 | 3300053153 | Ga0500616_0120588 | Ga0500616_0120588_282_896 | 199 |
| 141 | 3300053156 | Ga0500622_0162555 | Ga0500622_0162555_382_996 | 199 |
| 142 | 3300053730 | Ga0500645_001154 | Ga0500645_001154_10866_11480 | 199 |
| 143 | iso_pu_bacteria | 2582581311 | 2585293137 | 199 |
| 144 | iso_pu_bacteria | 2599185239 | 2599740364 | 199 |
| 145 | iso_pu_bacteria | 2599185240 | 2599749000 | 199 |
| 146 | iso_pu_bacteria | 2599185355 | 2600211053 | 199 |
| 147 | iso_pu_bacteria | 2675903129 | 2676747206 | 199 |
| 148 | iso_pu_bacteria | 2808606384 | 2808968831 | 199 |
| 149 | iso_pu_bacteria | 2808606390 | 2809003662 | 199 |
| 150 | iso_pu_bacteria | 2808606391 | 2809010939 | 199 |
| 151 | iso_pu_bacteria | 2816332253 | 2817257563 | 199 |
| 152 | iso_pu_bacteria | 2816332256 | 2817282033 | 199 |
| 153 | iso_pu_bacteria | 2816332286 | 2817451506 | 199 |
| 154 | iso_pu_bacteria | 2818991452 | 2819635366 | 199 |
| 155 | iso_pu_bacteria | 2863421361 | 2863425180 | 199 |
| 156 | iso_pu_bacteria | 2870068957 | 2870074153 | 199 |
| 157 | iso_pu_bacteria | 2904564687 | 2904571584 | 199 |
| 158 | iso_pu_bacteria | 2904571731 | 2904578640 | 199 |
| 159 | iso_pu_bacteria | 2909399089 | 2909402385 | 199 |
| 160 | iso_pu_bacteria | 2928157003 | 2928161036 | 199 |
| 161 | iso_pu_bacteria | 2928163908 | 2928166028 | 199 |
| 162 | iso_pu_bacteria | 2928170801 | 2928171039 | 199 |
| 163 | iso_pu_bacteria | 2928536128 | 2928536527 | 199 |
| 164 | iso_pu_bacteria | 2981990288 | 2981991291 | 199 |
| 165 | iso_pu_bacteria | 641736154 | 642413943 | 199 |
| 166 | iso_pu_bacteria | 8018845410 | 8018849164 | 199 |
| 167 | iso_pu_bacteria | 8020807995 | 8020811172 | 199 |
| 168 | iso_pu_bacteria | 8020938398 | 8020943720 | 199 |
| 169 | iso_pu_bacteria | 8020945358 | 8020950059 | 199 |
| 170 | iso_pu_bacteria | 8020953355 | 8020953773 | 199 |
| 171 | iso_pu_bacteria | 8021120328 | 8021123211 | 199 |
| 172 | iso_pu_bacteria | 8039098773 | 8039103024 | 199 |
| 173 | iso_pu_bacteria | 8040167225 | 8040168279 | 199 |
| 174 | iso_pu_bacteria | 8040173305 | 8040175935 | 199 |
| 175 | 3300009011 | Ga0105251_10066882 | Ga0105251_100668821 | 200 |
| 176 | 3300009036 | Ga0105244_10031584 | Ga0105244_100315842 | 200 |
| 177 | 3300013100 | Ga0157373_10017933 | Ga0157373_100179332 | 200 |
| 178 | 3300013104 | Ga0157370_10198950 | Ga0157370_101989502 | 200 |
| 179 | 3300015265 | Ga0182005_1026147 | Ga0182005_10261472 | 200 |
| 180 | 3300025728 | Ga0207655_1024503 | Ga0207655_10245032 | 200 |
| 181 | 3300025735 | Ga0207713_1000042 | Ga0207713_100004224 | 200 |
| 182 | 3300037418 | Ga0395900_0079296 | Ga0395900_0079296_1468_2079 | 200 |
| 183 | 3300042016 | Ga0439463_126636 | Ga0439463_126636_25_627 | 200 |
| 184 | 3300046453 | Ga0495627_005591 | Ga0495627_005591_3118_3720 | 200 |
| 185 | 3300046458 | Ga0495591_000064 | Ga0495591_000064_16243_16845 | 200 |
| 186 | 3300046458 | Ga0495591_000481 | Ga0495591_000481_26961_27563 | 200 |
| 187 | 3300046471 | Ga0495650_0001462 | Ga0495650_0001462_1342_1944 | 200 |
| 188 | 3300046474 | Ga0495605_0000191 | Ga0495605_0000191_49969_50571 | 200 |
| 189 | 3300046474 | Ga0495605_0027322 | Ga0495605_0027322_2301_2903 | 200 |
| 190 | 3300046474 | Ga0495605_0029904 | Ga0495605_0029904_1407_2009 | 200 |
| 191 | 3300046501 | Ga0495607_0000058 | Ga0495607_0000058_2804_3406 | 200 |
| 192 | 3300046506 | Ga0495583_0000465 | Ga0495583_0000465_34756_35358 | 200 |
| 193 | 3300046506 | Ga0495583_0001061 | Ga0495583_0001061_4116_4718 | 200 |
| 194 | 3300046506 | Ga0495583_0004020 | Ga0495583_0004020_5496_6098 | 200 |
| 195 | 3300046507 | Ga0495606_0000691 | Ga0495606_0000691_24879_25481 | 200 |
| 196 | 3300046507 | Ga0495606_0013017 | Ga0495606_0013017_1584_2186 | 200 |
| 197 | 3300046512 | Ga0495610_0003532 | Ga0495610_0003532_353_955 | 200 |
| 198 | 3300046515 | Ga0495620_0004194 | Ga0495620_0004194_1766_2368 | 200 |
| 199 | 3300046515 | Ga0495620_0075761 | Ga0495620_0075761_434_1036 | 200 |
| 200 | 3300046515 | Ga0495620_0221031 | Ga0495620_0221031_69_671 | 200 |
| 201 | 3300046519 | Ga0495632_0000162 | Ga0495632_0000162_24522_25124 | 200 |
| 202 | 3300046538 | Ga0495609_0000011 | Ga0495609_0000011_24614_25216 | 200 |
| 203 | 3300046538 | Ga0495609_0019639 | Ga0495609_0019639_1273_1875 | 200 |
| 204 | 3300046616 | Ga0495668_0135602 | Ga0495668_0135602_17_619 | 200 |
| 205 | 3300046616 | Ga0495668_0230155 | Ga0495668_0230155_121_738 | 200 |
| 206 | 3300046665 | Ga0495661_0000018 | Ga0495661_0000018_24695_25297 | 200 |
| 207 | 3300046665 | Ga0495661_0051854 | Ga0495661_0051854_1180_1782 | 200 |
| 208 | 3300046810 | Ga0495660_0025510 | Ga0495660_0025510_1118_1720 | 200 |
| 209 | 3300047469 | Ga0495673_0073449 | Ga0495673_0073449_807_1409 | 200 |
| 210 | 3300047469 | Ga0495673_0139864 | Ga0495673_0139864_131_733 | 200 |
| 211 | 3300047469 | Ga0495673_0145522 | Ga0495673_0145522_159_761 | 200 |
| 212 | 3300048904 | Ga0496101_0258484 | Ga0496101_0258484_188_790 | 200 |
| 213 | 3300048905 | Ga0496102_0118909 | Ga0496102_0118909_1069_1671 | 200 |
| 214 | 3300048913 | Ga0496110_0355037 | Ga0496110_0355037_182_784 | 200 |
| 215 | 3300048914 | Ga0496111_0282541 | Ga0496111_0282541_220_822 | 200 |
| 216 | 3300048918 | Ga0496115_0522910 | Ga0496115_0522910_257_868 | 200 |
| 217 | 3300048920 | Ga0496117_0083261 | Ga0496117_0083261_345_947 | 200 |
| 218 | 3300048921 | Ga0496118_0131082 | Ga0496118_0131082_965_1567 | 200 |
| 219 | 3300048921 | Ga0496118_0134133 | Ga0496118_0134133_516_1118 | 200 |
| 220 | 3300048923 | Ga0496120_0014298 | Ga0496120_0014298_3865_4467 | 200 |
| 221 | 3300048924 | Ga0496121_0002620 | Ga0496121_0002620_1408_2010 | 200 |
| 222 | 3300048924 | Ga0496121_0031729 | Ga0496121_0031729_3608_4210 | 200 |
| 223 | 3300048925 | Ga0496122_0000285 | Ga0496122_0000285_24287_24889 | 200 |
| 224 | 3300048925 | Ga0496122_0084045 | Ga0496122_0084045_631_1233 | 200 |
| 225 | 3300048926 | Ga0496123_0000232 | Ga0496123_0000232_88185_88787 | 200 |
| 226 | 3300048926 | Ga0496123_0047498 | Ga0496123_0047498_1055_1657 | 200 |
| 227 | 3300048927 | Ga0496124_0000845 | Ga0496124_0000845_47948_48550 | 200 |
| 228 | 3300048927 | Ga0496124_0029892 | Ga0496124_0029892_654_1256 | 200 |
| 229 | 3300053098 | Ga0500650_0196879 | Ga0500650_0196879_112_729 | 200 |
| 230 | 3300053104 | Ga0500556_0019834 | Ga0500556_0019834_690_1307 | 200 |
| 231 | 3300053108 | Ga0500562_003504 | Ga0500562_003504_131_748 | 200 |
| 232 | 3300053108 | Ga0500562_009216 | Ga0500562_009216_1106_1723 | 200 |
| 233 | 3300053153 | Ga0500616_0059483 | Ga0500616_0059483_677_1294 | 200 |
| 234 | 3300053156 | Ga0500622_0022117 | Ga0500622_0022117_2731_3348 | 200 |
| 235 | 3300053730 | Ga0500645_022142 | Ga0500645_022142_854_1471 | 200 |
| 236 | iso_pu_bacteria | 2511231004 | 2511257864 | 200 |
| 237 | iso_pu_bacteria | 2511231010 | 2511290661 | 200 |
| 238 | iso_pu_bacteria | 2511231011 | 2511296330 | 200 |
| 239 | iso_pu_bacteria | 2511231012 | 2511301025 | 200 |
| 240 | iso_pu_bacteria | 2511231014 | 2511315642 | 200 |
| 241 | iso_pu_bacteria | 2511231015 | 2511317734 | 200 |
| 242 | iso_pu_bacteria | 2511231017 | 2511333973 | 200 |
| 243 | iso_pu_bacteria | 2511231018 | 2511340166 | 200 |
| 244 | iso_pu_bacteria | 2511231019 | 2511346430 | 200 |
| 245 | iso_pu_bacteria | 2511231020 | 2511353355 | 200 |
| 246 | iso_pu_bacteria | 2511231023 | 2511367758 | 200 |
| 247 | iso_pu_bacteria | 2511231024 | 2511373764 | 200 |
| 248 | iso_pu_bacteria | 2511231031 | 2511415198 | 200 |
| 249 | iso_pu_bacteria | 2511231156 | 2511823797 | 200 |
| 250 | iso_pu_bacteria | 2554235132 | 2554815288 | 200 |
| 251 | iso_pu_bacteria | 2554235231 | 2555248507 | 200 |
| 252 | iso_pu_bacteria | 2599185160 | 2599354682 | 200 |
| 253 | iso_pu_bacteria | 2599185161 | 2599359605 | 200 |
| 254 | iso_pu_bacteria | 2599185162 | 2599365927 | 200 |
| 255 | iso_pu_bacteria | 2599185163 | 2599372717 | 200 |
| 256 | iso_pu_bacteria | 2599185164 | 2599379789 | 200 |
| 257 | iso_pu_bacteria | 2599185165 | 2599385232 | 200 |
| 258 | iso_pu_bacteria | 2599185166 | 2599391576 | 200 |
| 259 | iso_pu_bacteria | 2599185168 | 2599403342 | 200 |
| 260 | iso_pu_bacteria | 2599185181 | 2599461516 | 200 |
| 261 | iso_pu_bacteria | 2599185182 | 2599470059 | 200 |
| 262 | iso_pu_bacteria | 2599185186 | 2599490535 | 200 |
| 263 | iso_pu_bacteria | 2599185188 | 2599504437 | 200 |
| 264 | iso_pu_bacteria | 2599185212 | 2599615912 | 200 |
| 265 | iso_pu_bacteria | 2599185248 | 2599773105 | 200 |
| 266 | iso_pu_bacteria | 2599185289 | 2599889509 | 200 |
| 267 | iso_pu_bacteria | 2599185291 | 2599900907 | 200 |
| 268 | iso_pu_bacteria | 2599185300 | 2599933322 | 200 |
| 269 | iso_pu_bacteria | 2599185302 | 2599944218 | 200 |
| 270 | iso_pu_bacteria | 2599185304 | 2599956436 | 200 |
| 271 | iso_pu_bacteria | 2599185305 | 2599963315 | 200 |
| 272 | iso_pu_bacteria | 2599185306 | 2599969541 | 200 |
| 273 | iso_pu_bacteria | 2599185308 | 2599981083 | 200 |
| 274 | iso_pu_bacteria | 2599185309 | 2599985131 | 200 |
| 275 | iso_pu_bacteria | 2599185310 | 2599989242 | 200 |
| 276 | iso_pu_bacteria | 2599185311 | 2599994139 | 200 |
| 277 | iso_pu_bacteria | 2599185312 | 2600000361 | 200 |
| 278 | iso_pu_bacteria | 2599185313 | 2600008072 | 200 |
| 279 | iso_pu_bacteria | 2599185314 | 2600014930 | 200 |
| 280 | iso_pu_bacteria | 2599185315 | 2600019477 | 200 |
| 281 | iso_pu_bacteria | 2599185316 | 2600025966 | 200 |
| 282 | iso_pu_bacteria | 2599185317 | 2600032179 | 200 |
| 283 | iso_pu_bacteria | 2599185318 | 2600039374 | 200 |
| 284 | iso_pu_bacteria | 2599185319 | 2600042540 | 200 |
| 285 | iso_pu_bacteria | 2599185320 | 2600049435 | 200 |
| 286 | iso_pu_bacteria | 2599185321 | 2600053987 | 200 |
| 287 | iso_pu_bacteria | 2599185322 | 2600062117 | 200 |
| 288 | iso_pu_bacteria | 2599185323 | 2600065703 | 200 |
| 289 | iso_pu_bacteria | 2599185324 | 2600070910 | 200 |
| 290 | iso_pu_bacteria | 2599185325 | 2600079945 | 200 |
| 291 | iso_pu_bacteria | 2599185356 | 2600214134 | 200 |
| 292 | iso_pu_bacteria | 2600254930 | 2600361804 | 200 |
| 293 | iso_pu_bacteria | 2600255313 | 2601774300 | 200 |
| 294 | iso_pu_bacteria | 2600255318 | 2601796169 | 200 |
| 295 | iso_pu_bacteria | 2603880185 | 2606073318 | 200 |
| 296 | iso_pu_bacteria | 2603880199 | 2606127036 | 200 |
| 297 | iso_pu_bacteria | 2606217733 | 2608384416 | 200 |
| 298 | iso_pu_bacteria | 2623620443 | 2624481818 | 200 |
| 299 | iso_pu_bacteria | 2643221565 | 2643845530 | 200 |
| 300 | iso_pu_bacteria | 2643221589 | 2643956406 | 200 |
| 301 | iso_pu_bacteria | 2643221602 | 2644025552 | 200 |
| 302 | iso_pu_bacteria | 2643221650 | 2644285047 | 200 |
| 303 | iso_pu_bacteria | 2651869719 | 2652544835 | 200 |
| 304 | iso_pu_bacteria | 2667528170 | 2671093536 | 200 |
| 305 | iso_pu_bacteria | 2667528171 | 2671097263 | 200 |
| 306 | iso_pu_bacteria | 2667528176 | 2671130283 | 200 |
| 307 | iso_pu_bacteria | 2675903515 | 2678264354 | 200 |
| 308 | iso_pu_bacteria | 2713897148 | 2715751128 | 200 |
| 309 | iso_pu_bacteria | 2713897149 | 2715758119 | 200 |
| 310 | iso_pu_bacteria | 2718217725 | 2718635067 | 200 |
| 311 | iso_pu_bacteria | 2738543004 | 2739201871 | 200 |
| 312 | iso_pu_bacteria | 2738543015 | 2739259324 | 200 |
| 313 | iso_pu_bacteria | 2738543025 | 2739314170 | 200 |
| 314 | iso_pu_bacteria | 2744054620 | 2745004808 | 200 |
| 315 | iso_pu_bacteria | 2765235841 | 2765584281 | 200 |
| 316 | iso_pu_bacteria | 2773857670 | 2774123354 | 200 |
| 317 | iso_pu_bacteria | 2773857673 | 2774132726 | 200 |
| 318 | iso_pu_bacteria | 2784132063 | 2784263460 | 200 |
| 319 | iso_pu_bacteria | 2784132072 | 2784316104 | 200 |
| 320 | iso_pu_bacteria | 2791355520 | 2794596040 | 200 |
| 321 | iso_pu_bacteria | 2806310737 | 2807408349 | 200 |
| 322 | iso_pu_bacteria | 2806310745 | 2807456663 | 200 |
| 323 | iso_pu_bacteria | 2808606361 | 2808858726 | 200 |
| 324 | iso_pu_bacteria | 2808606376 | 2808924328 | 200 |
| 325 | iso_pu_bacteria | 2808606378 | 2808938863 | 200 |
| 326 | iso_pu_bacteria | 2808606380 | 2808946287 | 200 |
| 327 | iso_pu_bacteria | 2808606382 | 2808957374 | 200 |
| 328 | iso_pu_bacteria | 2808606383 | 2808967216 | 200 |
| 329 | iso_pu_bacteria | 2808606389 | 2809002027 | 200 |
| 330 | iso_pu_bacteria | 2808606445 | 2809218676 | 200 |
| 331 | iso_pu_bacteria | 2818991456 | 2819655561 | 200 |
| 332 | iso_pu_bacteria | 2818991464 | 2819702360 | 200 |
| 333 | iso_pu_bacteria | 2825651385 | 2825656704 | 200 |
| 334 | iso_pu_bacteria | 2842832357 | 2842836419 | 200 |
| 335 | iso_pu_bacteria | 2842843487 | 2842844533 | 200 |
| 336 | iso_pu_bacteria | 2842854478 | 2842859385 | 200 |
| 337 | iso_pu_bacteria | 2844665904 | 2844671703 | 200 |
| 338 | iso_pu_bacteria | 2852657418 | 2852662439 | 200 |
| 339 | iso_pu_bacteria | 2860339153 | 2860340712 | 200 |
| 340 | iso_pu_bacteria | 2878029506 | 2878033800 | 200 |
| 341 | iso_pu_bacteria | 2880230671 | 2880234427 | 200 |
| 342 | iso_pu_bacteria | 2904518522 | 2904523969 | 200 |
| 343 | iso_pu_bacteria | 2904550169 | 2904555603 | 200 |
| 344 | iso_pu_bacteria | 2913036834 | 2913040843 | 200 |
| 345 | iso_pu_bacteria | 2917070673 | 2917075017 | 200 |
| 346 | iso_pu_bacteria | 2919063839 | 2919068788 | 200 |
| 347 | iso_pu_bacteria | 2919155634 | 2919156410 | 200 |
| 348 | iso_pu_bacteria | 2919385768 | 2919387902 | 200 |
| 349 | iso_pu_bacteria | 2919456309 | 2919461170 | 200 |
| 350 | iso_pu_bacteria | 2919481497 | 2919487355 | 200 |
| 351 | iso_pu_bacteria | 2919487758 | 2919489916 | 200 |
| 352 | iso_pu_bacteria | 2923586266 | 2923589865 | 200 |
| 353 | iso_pu_bacteria | 2929144301 | 2929148332 | 200 |
| 354 | iso_pu_bacteria | 2931369376 | 2931374257 | 200 |
| 355 | iso_pu_bacteria | 2931396565 | 2931403265 | 200 |
| 356 | iso_pu_bacteria | 2935353572 | 2935356005 | 200 |
| 357 | iso_pu_bacteria | 2939636861 | 2939637714 | 200 |
| 358 | iso_pu_bacteria | 2939651529 | 2939655603 | 200 |
| 359 | iso_pu_bacteria | 2969304461 | 2969308577 | 200 |
| 360 | iso_pu_bacteria | 2974289157 | 2974290041 | 200 |
| 361 | iso_pu_bacteria | 2988728565 | 2988729956 | 200 |
| 362 | iso_pu_bacteria | 3007419365 | 3007424063 | 200 |
| 363 | iso_pu_bacteria | 3007511990 | 3007515578 | 200 |
| 364 | iso_pu_bacteria | 3007614139 | 3007617243 | 200 |
| 365 | iso_pu_bacteria | 3007619802 | 3007623776 | 200 |
| 366 | iso_pu_bacteria | 3007718800 | 3007718808 | 200 |
| 367 | iso_pu_bacteria | 3007803356 | 3007803956 | 200 |
| 368 | iso_pu_bacteria | 3007855910 | 3007857797 | 200 |
| 369 | iso_pu_bacteria | 3007861166 | 3007861182 | 200 |
| 370 | iso_pu_bacteria | 3007866637 | 3007868208 | 200 |
| 371 | iso_pu_bacteria | 3007872151 | 3007875127 | 200 |
| 372 | iso_pu_bacteria | 637000220 | 637321490 | 200 |
| 373 | iso_pu_bacteria | 8029995093 | 8029996987 | 200 |
| 374 | iso_pu_bacteria | 8054929484 | 8054932229 | 200 |
| 375 | iso_pu_bacteria | 8055878733 | 8055883304 | 200 |
| 376 | iso_pu_bacteria | 8056120720 | 8056123153 | 200 |
| 377 | iso_pu_bacteria | 8056125926 | 8056127675 | 200 |
| 378 | iso_pu_bacteria | 8056137416 | 8056140655 | 200 |
| 379 | iso_pu_bacteria | 8056143049 | 8056145032 | 200 |
| 380 | iso_pu_bacteria | 8056166840 | 8056167386 | 200 |
| 381 | iso_pu_bacteria | 8056172158 | 8056173372 | 200 |
| 382 | iso_pu_bacteria | 8056569372 | 8056572627 | 200 |
| 383 | 3300009011 | Ga0105251_10000031 | Ga0105251_1000003124 | 201 |
| 384 | 3300017792 | Ga0163161_10088392 | Ga0163161_100883923 | 201 |
| 385 | 3300041498 | Ga0451841_0467719 | Ga0451841_0467719_216_821 | 201 |
| 386 | 3300042016 | Ga0439463_002404 | Ga0439463_002404_49_726 | 201 |
| 387 | 3300044683 | Ga0466965_0137102 | Ga0466965_0137102_511_1122 | 201 |
| 388 | 3300046453 | Ga0495627_000013 | Ga0495627_000013_24209_24814 | 201 |
| 389 | 3300046458 | Ga0495591_000041 | Ga0495591_000041_129168_129773 | 201 |
| 390 | 3300046474 | Ga0495605_0001761 | Ga0495605_0001761_106_711 | 201 |
| 391 | 3300046501 | Ga0495607_0000936 | Ga0495607_0000936_691_1296 | 201 |
| 392 | 3300046507 | Ga0495606_0026021 | Ga0495606_0026021_2451_3056 | 201 |
| 393 | 3300046520 | Ga0495637_0000947 | Ga0495637_0000947_10410_11015 | 201 |
| 394 | 3300046530 | Ga0495654_0103381 | Ga0495654_0103381_606_1211 | 201 |
| 395 | 3300046542 | Ga0495597_0000004 | Ga0495597_0000004_25924_26529 | 201 |
| 396 | 3300046660 | Ga0495625_0296255 | Ga0495625_0296255_341_946 | 201 |
| 397 | 3300046810 | Ga0495660_0005400 | Ga0495660_0005400_4233_4838 | 201 |
| 398 | 3300047320 | Ga0495672_0001345 | Ga0495672_0001345_22838_23443 | 201 |
| 399 | 3300047320 | Ga0495672_0069864 | Ga0495672_0069864_1272_1877 | 201 |
| 400 | 3300047469 | Ga0495673_0000183 | Ga0495673_0000183_93024_93629 | 201 |
| 401 | 3300047470 | Ga0495681_0016972 | Ga0495681_0016972_2690_3295 | 201 |
| 402 | 3300048903 | Ga0496100_0793705 | Ga0496100_0793705_63_731 | 201 |
| 403 | 3300048920 | Ga0496117_0251105 | Ga0496117_0251105_133_738 | 201 |
| 404 | 3300048922 | Ga0496119_0169367 | Ga0496119_0169367_295_900 | 201 |
| 405 | 3300048925 | Ga0496122_0033675 | Ga0496122_0033675_1077_1682 | 201 |
| 406 | 3300049571 | Ga0501034_0002701 | Ga0501034_0002701_12965_13570 | 201 |
| 407 | 3300049573 | Ga0501037_0000642 | Ga0501037_0000642_6295_6900 | 201 |
| 408 | 3300049574 | Ga0501038_0008387 | Ga0501038_0008387_2916_3521 | 201 |
| 409 | 3300049575 | Ga0501039_0000426 | Ga0501039_0000426_10639_11244 | 201 |
| 410 | 3300049579 | Ga0501043_0160252 | Ga0501043_0160252_786_1391 | 201 |
| 411 | 3300049580 | Ga0501046_0004813 | Ga0501046_0004813_6218_6823 | 201 |
| 412 | 3300049581 | Ga0501047_0004014 | Ga0501047_0004014_5999_6604 | 201 |
| 413 | 3300049583 | Ga0501067_0010822 | Ga0501067_0010822_2187_2792 | 201 |
| 414 | 3300049742 | Ga0501080_0000620 | Ga0501080_0000620_1909_2514 | 201 |
| 415 | 3300049822 | Ga0501035_0000020 | Ga0501035_0000020_188588_189193 | 201 |
| 416 | 3300049823 | Ga0501044_0000397 | Ga0501044_0000397_7176_7781 | 201 |
| 417 | 3300053098 | Ga0500650_0234971 | Ga0500650_0234971_53_658 | 201 |
| 418 | 3300053140 | Ga0500573_0069783 | Ga0500573_0069783_590_1195 | 201 |
| 419 | 3300053153 | Ga0500616_0005812 | Ga0500616_0005812_4423_5028 | 201 |
| 420 | 3300060353 | Ga0501082_0004759 | Ga0501082_0004759_724_1329 | 201 |
| 421 | 3300001989 | JGI24739J22299_10001779 | JGI24739J22299_100017796 | 202 |
| 422 | 3300001989 | JGI24739J22299_10013520 | JGI24739J22299_100135202 | 202 |
| 423 | 3300002738 | JGI25154J39366_1001189 | JGI25154J39366_10011891 | 202 |
| 424 | 3300003320 | rootH2_10030798 | rootH2_1003079813 | 202 |
| 425 | 3300003320 | rootH2_10232438 | rootH2_102324383 | 202 |
| 426 | 3300003751 | Ga0055538_1000007 | Ga0055538_1000007287 | 202 |
| 427 | 3300003752 | Ga0055539_1000011 | Ga0055539_1000011287 | 202 |
| 428 | 3300003756 | Ga0055533_1000014 | Ga0055533_1000014287 | 202 |
| 429 | 3300003758 | Ga0055532_1000009 | Ga0055532_1000009287 | 202 |
| 430 | 3300003758 | Ga0055532_1000262 | Ga0055532_100026234 | 202 |
| 431 | 3300003758 | Ga0055532_1000320 | Ga0055532_100032029 | 202 |
| 432 | 3300003758 | Ga0055532_1002026 | Ga0055532_10020264 | 202 |
| 433 | 3300003759 | Ga0055525_1000016 | Ga0055525_1000016287 | 202 |
| 434 | 3300003760 | Ga0055527_1000280 | Ga0055527_100028029 | 202 |
| 435 | 3300003760 | Ga0055527_1006864 | Ga0055527_10068642 | 202 |
| 436 | 3300003761 | Ga0055535_1000591 | Ga0055535_100059129 | 202 |
| 437 | 3300003761 | Ga0055535_1002021 | Ga0055535_10020218 | 202 |
| 438 | 3300003761 | Ga0055535_1008009 | Ga0055535_10080092 | 202 |
| 439 | 3300003762 | Ga0055542_1001740 | Ga0055542_10017407 | 202 |
| 440 | 3300003762 | Ga0055542_1002922 | Ga0055542_10029226 | 202 |
| 441 | 3300003763 | Ga0055529_1000978 | Ga0055529_10009787 | 202 |
| 442 | 3300003790 | Ga0055528_1003527 | Ga0055528_10035274 | 202 |
| 443 | 3300003841 | Ga0055541_1000008 | Ga0055541_1000008287 | 202 |
| 444 | 3300003841 | Ga0055541_1014359 | Ga0055541_10143591 | 202 |
| 445 | 3300003856 | Ga0058692_1004472 | Ga0058692_10044721 | 202 |
| 446 | 3300005288 | Ga0065714_10064719 | Ga0065714_100647195 | 202 |
| 447 | 3300005327 | Ga0070658_10182062 | Ga0070658_101820623 | 202 |
| 448 | 3300005331 | Ga0070670_100000137 | Ga0070670_10000013743 | 202 |
| 449 | 3300005335 | Ga0070666_10012704 | Ga0070666_100127042 | 202 |
| 450 | 3300005339 | Ga0070660_100000159 | Ga0070660_10000015942 | 202 |
| 451 | 3300005344 | Ga0070661_100000749 | Ga0070661_10000074914 | 202 |
| 452 | 3300005366 | Ga0070659_100000223 | Ga0070659_1000002234 | 202 |
| 453 | 3300005455 | Ga0070663_100001049 | Ga0070663_1000010493 | 202 |
| 454 | 3300005564 | Ga0070664_100000861 | Ga0070664_10000086115 | 202 |
| 455 | 3300005577 | Ga0068857_100412432 | Ga0068857_1004124323 | 202 |
| 456 | 3300005616 | Ga0068852_100138430 | Ga0068852_1001384302 | 202 |
| 457 | 3300005842 | Ga0068858_100062991 | Ga0068858_1000629913 | 202 |
| 458 | 3300009036 | Ga0105244_10000796 | Ga0105244_1000079616 | 202 |
| 459 | 3300009036 | Ga0105244_10018334 | Ga0105244_100183345 | 202 |
| 460 | 3300009036 | Ga0105244_10082108 | Ga0105244_100821083 | 202 |
| 461 | 3300009092 | Ga0105250_10013636 | Ga0105250_100136363 | 202 |
| 462 | 3300009093 | Ga0105240_10001196 | Ga0105240_100011968 | 202 |
| 463 | 3300009093 | Ga0105240_10042007 | Ga0105240_100420074 | 202 |
| 464 | 3300009148 | Ga0105243_10214397 | Ga0105243_102143973 | 202 |
| 465 | 3300009176 | Ga0105242_10016730 | Ga0105242_100167305 | 202 |
| 466 | 3300009545 | Ga0105237_10004461 | Ga0105237_1000446113 | 202 |
| 467 | 3300009545 | Ga0105237_10065380 | Ga0105237_100653801 | 202 |
| 468 | 3300009551 | Ga0105238_10154380 | Ga0105238_101543804 | 202 |
| 469 | 3300011119 | Ga0105246_10000357 | Ga0105246_1000035717 | 202 |
| 470 | 3300013100 | Ga0157373_10000225 | Ga0157373_1000022540 | 202 |
| 471 | 3300013100 | Ga0157373_10006005 | Ga0157373_100060059 | 202 |
| 472 | 3300013100 | Ga0157373_10046441 | Ga0157373_100464413 | 202 |
| 473 | 3300013105 | Ga0157369_10001402 | Ga0157369_1000140213 | 202 |
| 474 | 3300013105 | Ga0157369_10005269 | Ga0157369_100052694 | 202 |
| 475 | 3300013306 | Ga0163162_10077091 | Ga0163162_100770912 | 202 |
| 476 | 3300013308 | Ga0157375_10000139 | Ga0157375_1000013940 | 202 |
| 477 | 3300013308 | Ga0157375_10002380 | Ga0157375_100023808 | 202 |
| 478 | 3300015262 | Ga0182007_10001953 | Ga0182007_100019533 | 202 |
| 479 | 3300017792 | Ga0163161_10050229 | Ga0163161_100502293 | 202 |
| 480 | 3300021388 | Ga0213875_10001893 | Ga0213875_100018931 | 202 |
| 481 | 3300025224 | Ga0209784_100023 | Ga0209784_100023282 | 202 |
| 482 | 3300025225 | Ga0209566_100019 | Ga0209566_100019295 | 202 |
| 483 | 3300025225 | Ga0209566_100443 | Ga0209566_10044321 | 202 |
| 484 | 3300025226 | Ga0209674_100034 | Ga0209674_100034295 | 202 |
| 485 | 3300025228 | Ga0209672_100012 | Ga0209672_100012431 | 202 |
| 486 | 3300025228 | Ga0209672_100063 | Ga0209672_100063198 | 202 |
| 487 | 3300025229 | Ga0209147_100007 | Ga0209147_100007340 | 202 |
| 488 | 3300025229 | Ga0209147_100027 | Ga0209147_100027297 | 202 |
| 489 | 3300025229 | Ga0209147_100077 | Ga0209147_100077198 | 202 |
| 490 | 3300025229 | Ga0209147_100119 | Ga0209147_100119107 | 202 |
| 491 | 3300025230 | Ga0209563_100037 | Ga0209563_100037295 | 202 |
| 492 | 3300025242 | Ga0209258_100014 | Ga0209258_100014362 | 202 |
| 493 | 3300025242 | Ga0209258_100105 | Ga0209258_100105198 | 202 |
| 494 | 3300025242 | Ga0209258_100520 | Ga0209258_1005209 | 202 |
| 495 | 3300025246 | Ga0209646_1000110 | Ga0209646_1000110111 | 202 |
| 496 | 3300025253 | Ga0209677_100021 | Ga0209677_100021295 | 202 |
| 497 | 3300025254 | Ga0209148_1000107 | Ga0209148_1000107198 | 202 |
| 498 | 3300025254 | Ga0209148_1000337 | Ga0209148_10003371 | 202 |
| 499 | 3300025256 | Ga0209759_1001226 | Ga0209759_10012266 | 202 |
| 500 | 3300025272 | Ga0209455_1000100 | Ga0209455_1000100198 | 202 |
| 501 | 3300025272 | Ga0209455_1000138 | Ga0209455_1000138144 | 202 |
| 502 | 3300025273 | Ga0209673_1000101 | Ga0209673_1000101142 | 202 |
| 503 | 3300025295 | Ga0209564_1007842 | Ga0209564_10078426 | 202 |
| 504 | 3300025711 | Ga0207696_1012173 | Ga0207696_10121734 | 202 |
| 505 | 3300025728 | Ga0207655_1000074 | Ga0207655_1000074152 | 202 |
| 506 | 3300025728 | Ga0207655_1001930 | Ga0207655_100193013 | 202 |
| 507 | 3300025728 | Ga0207655_1018219 | Ga0207655_10182192 | 202 |
| 508 | 3300025735 | Ga0207713_1013609 | Ga0207713_10136093 | 202 |
| 509 | 3300025904 | Ga0207647_10005055 | Ga0207647_100050552 | 202 |
| 510 | 3300025909 | Ga0207705_10098965 | Ga0207705_100989653 | 202 |
| 511 | 3300025913 | Ga0207695_10000368 | Ga0207695_1000036833 | 202 |
| 512 | 3300025913 | Ga0207695_10043331 | Ga0207695_100433315 | 202 |
| 513 | 3300025914 | Ga0207671_10065834 | Ga0207671_100658344 | 202 |
| 514 | 3300025919 | Ga0207657_10000442 | Ga0207657_1000044243 | 202 |
| 515 | 3300025920 | Ga0207649_10000954 | Ga0207649_1000095410 | 202 |
| 516 | 3300025920 | Ga0207649_10107248 | Ga0207649_101072483 | 202 |
| 517 | 3300025924 | Ga0207694_10163663 | Ga0207694_101636632 | 202 |
| 518 | 3300025925 | Ga0207650_10001314 | Ga0207650_1000131411 | 202 |
| 519 | 3300025932 | Ga0207690_10000037 | Ga0207690_10000037107 | 202 |
| 520 | 3300025945 | Ga0207679_10000097 | Ga0207679_1000009768 | 202 |
| 521 | 3300025949 | Ga0207667_10136649 | Ga0207667_101366493 | 202 |
| 522 | 3300026035 | Ga0207703_10072389 | Ga0207703_100723893 | 202 |
| 523 | 3300026067 | Ga0207678_10000317 | Ga0207678_100003173 | 202 |
| 524 | 3300026116 | Ga0207674_10058378 | Ga0207674_100583785 | 202 |
| 525 | 3300027312 | Ga0209371_1000080 | Ga0209371_100008091 | 202 |
| 526 | 3300030500 | Ga0268256_1000160 | Ga0268256_100016042 | 202 |
| 527 | 3300031731 | Ga0307405_10000024 | Ga0307405_1000002436 | 202 |
| 528 | 3300037466 | Ga0395898_0139849 | Ga0395898_0139849_379_996 | 202 |
| 529 | 3300037853 | Ga0436364_0011200 | Ga0436364_0011200_13455_14063 | 202 |
| 530 | 3300039437 | Ga0436365_0907137 | Ga0436365_0907137_1167_1781 | 202 |
| 531 | 3300044656 | Ga0466969_0005486 | Ga0466969_0005486_970_1590 | 202 |
| 532 | 3300044658 | Ga0466972_0050894 | Ga0466972_0050894_696_1313 | 202 |
| 533 | 3300044683 | Ga0466965_0021841 | Ga0466965_0021841_558_1175 | 202 |
| 534 | 3300045976 | Ga0466967_0157347 | Ga0466967_0157347_1069_1686 | 202 |
| 535 | 3300046454 | Ga0495592_0128017 | Ga0495592_0128017_19_633 | 202 |
| 536 | 3300046458 | Ga0495591_003090 | Ga0495591_003090_5599_6207 | 202 |
| 537 | 3300046458 | Ga0495591_016768 | Ga0495591_016768_1882_2490 | 202 |
| 538 | 3300046471 | Ga0495650_0006670 | Ga0495650_0006670_5396_6004 | 202 |
| 539 | 3300046474 | Ga0495605_0000212 | Ga0495605_0000212_45632_46240 | 202 |
| 540 | 3300046499 | Ga0495594_0000125 | Ga0495594_0000125_13501_14109 | 202 |
| 541 | 3300046506 | Ga0495583_0000036 | Ga0495583_0000036_220017_220625 | 202 |
| 542 | 3300046507 | Ga0495606_0000724 | Ga0495606_0000724_32490_33098 | 202 |
| 543 | 3300046512 | Ga0495610_0010542 | Ga0495610_0010542_3160_3768 | 202 |
| 544 | 3300046512 | Ga0495610_0050357 | Ga0495610_0050357_1343_1951 | 202 |
| 545 | 3300046513 | Ga0495616_0143504 | Ga0495616_0143504_415_1023 | 202 |
| 546 | 3300046515 | Ga0495620_0000022 | Ga0495620_0000022_110324_110932 | 202 |
| 547 | 3300046515 | Ga0495620_0006752 | Ga0495620_0006752_2663_3271 | 202 |
| 548 | 3300046520 | Ga0495637_0036173 | Ga0495637_0036173_562_1170 | 202 |
| 549 | 3300046524 | Ga0495648_0006428 | Ga0495648_0006428_5430_6038 | 202 |
| 550 | 3300046530 | Ga0495654_0002862 | Ga0495654_0002862_5537_6145 | 202 |
| 551 | 3300046530 | Ga0495654_0002994 | Ga0495654_0002994_9826_10434 | 202 |
| 552 | 3300046538 | Ga0495609_0000631 | Ga0495609_0000631_24823_25431 | 202 |
| 553 | 3300046542 | Ga0495597_0039126 | Ga0495597_0039126_1331_1939 | 202 |
| 554 | 3300046558 | Ga0495633_0000140 | Ga0495633_0000140_25351_25959 | 202 |
| 555 | 3300046648 | Ga0495611_0001100 | Ga0495611_0001100_7912_8520 | 202 |
| 556 | 3300046665 | Ga0495661_0000313 | Ga0495661_0000313_33925_34533 | 202 |
| 557 | 3300046691 | Ga0495670_0003253 | Ga0495670_0003253_7097_7705 | 202 |
| 558 | 3300046694 | Ga0495649_0003972 | Ga0495649_0003972_8110_8718 | 202 |
| 559 | 3300046694 | Ga0495649_0086955 | Ga0495649_0086955_127_741 | 202 |
| 560 | 3300046794 | Ga0495589_0002566 | Ga0495589_0002566_5225_5833 | 202 |
| 561 | 3300046810 | Ga0495660_0002330 | Ga0495660_0002330_10809_11417 | 202 |
| 562 | 3300046810 | Ga0495660_0003946 | Ga0495660_0003946_2516_3124 | 202 |
| 563 | 3300047443 | Ga0495687_001177 | Ga0495687_001177_14330_14944 | 202 |
| 564 | 3300047446 | Ga0495679_000190 | Ga0495679_000190_7368_7976 | 202 |
| 565 | 3300047446 | Ga0495679_000211 | Ga0495679_000211_25609_26217 | 202 |
| 566 | 3300047446 | Ga0495679_000233 | Ga0495679_000233_11852_12460 | 202 |
| 567 | 3300047470 | Ga0495681_0077050 | Ga0495681_0077050_126_734 | 202 |
| 568 | 3300047472 | Ga0495686_0000029 | Ga0495686_0000029_135688_136308 | 202 |
| 569 | 3300048907 | Ga0496104_0229097 | Ga0496104_0229097_378_995 | 202 |
| 570 | 3300048909 | Ga0496106_0000001 | Ga0496106_0000001_70213_70827 | 202 |
| 571 | 3300048915 | Ga0496112_0020353 | Ga0496112_0020353_5570_6187 | 202 |
| 572 | 3300048921 | Ga0496118_0001876 | Ga0496118_0001876_28831_29448 | 202 |
| 573 | 3300048921 | Ga0496118_0076401 | Ga0496118_0076401_251_865 | 202 |
| 574 | 3300048924 | Ga0496121_0004114 | Ga0496121_0004114_2566_3180 | 202 |
| 575 | 3300048925 | Ga0496122_0002556 | Ga0496122_0002556_22998_23606 | 202 |
| 576 | 3300048926 | Ga0496123_0011036 | Ga0496123_0011036_553_1161 | 202 |
| 577 | 3300048927 | Ga0496124_0012251 | Ga0496124_0012251_4616_5224 | 202 |
| 578 | 3300048928 | Ga0496125_0008266 | Ga0496125_0008266_5121_5738 | 202 |
| 579 | 3300048929 | Ga0496126_0001078 | Ga0496126_0001078_5431_6045 | 202 |
| 580 | 3300049459 | Ga0495678_000037 | Ga0495678_000037_25372_25980 | 202 |
| 581 | 3300049568 | Ga0501031_0039731 | Ga0501031_0039731_1767_2426 | 202 |
| 582 | 3300049570 | Ga0501033_0147188 | Ga0501033_0147188_81_740 | 202 |
| 583 | 3300049573 | Ga0501037_0010929 | Ga0501037_0010929_502_1161 | 202 |
| 584 | 3300053125 | Ga0500618_022445 | Ga0500618_022445_601_1209 | 202 |
| 585 | 3300053161 | Ga0500634_0000091 | Ga0500634_0000091_11110_11718 | 202 |
| 586 | 3300061719 | Ga0466962_0095127 | Ga0466962_0095127_672_1289 | 202 |
| 587 | iso_pu_bacteria | 2519103095 | 2519460683 | 202 |
| 588 | 3300009093 | Ga0105240_10003837 | Ga0105240_1000383712 | 203 |
| 589 | 3300009551 | Ga0105238_10117875 | Ga0105238_101178752 | 203 |
| 590 | 3300025903 | Ga0207680_10412147 | Ga0207680_104121471 | 203 |
| 591 | 3300025913 | Ga0207695_10006884 | Ga0207695_1000688410 | 203 |
| 592 | 3300041407 | Ga0439447_000355 | Ga0439447_000355_8955_9566 | 203 |
| 593 | 3300041407 | Ga0439447_026239 | Ga0439447_026239_525_1136 | 203 |
| 594 | 3300042009 | Ga0439451_004155 | Ga0439451_004155_1674_2297 | 203 |
| 595 | 3300042010 | Ga0439452_033726 | Ga0439452_033726_497_1108 | 203 |
| 596 | 3300046458 | Ga0495591_008395 | Ga0495591_008395_3143_3754 | 203 |
| 597 | 3300046460 | Ga0495638_0026277 | Ga0495638_0026277_2453_3064 | 203 |
| 598 | 3300046471 | Ga0495650_0017460 | Ga0495650_0017460_273_884 | 203 |
| 599 | 3300046491 | Ga0495584_0039182 | Ga0495584_0039182_653_1264 | 203 |
| 600 | 3300046492 | Ga0495585_0075193 | Ga0495585_0075193_517_1146 | 203 |
| 601 | 3300046501 | Ga0495607_0003115 | Ga0495607_0003115_9098_9709 | 203 |
| 602 | 3300046507 | Ga0495606_0004452 | Ga0495606_0004452_4529_5140 | 203 |
| 603 | 3300046512 | Ga0495610_0006409 | Ga0495610_0006409_6671_7282 | 203 |
| 604 | 3300046513 | Ga0495616_0014318 | Ga0495616_0014318_1464_2075 | 203 |
| 605 | 3300046515 | Ga0495620_0002359 | Ga0495620_0002359_8864_9475 | 203 |
| 606 | 3300046519 | Ga0495632_0004406 | Ga0495632_0004406_1408_2019 | 203 |
| 607 | 3300046523 | Ga0495644_0081195 | Ga0495644_0081195_139_750 | 203 |
| 608 | 3300046524 | Ga0495648_0033010 | Ga0495648_0033010_1704_2315 | 203 |
| 609 | 3300046558 | Ga0495633_0053985 | Ga0495633_0053985_702_1313 | 203 |
| 610 | 3300046660 | Ga0495625_0010214 | Ga0495625_0010214_3222_3833 | 203 |
| 611 | 3300046665 | Ga0495661_0004385 | Ga0495661_0004385_8883_9494 | 203 |
| 612 | 3300046692 | Ga0495671_0147240 | Ga0495671_0147240_180_791 | 203 |
| 613 | 3300046694 | Ga0495649_0197132 | Ga0495649_0197132_320_931 | 203 |
| 614 | 3300047446 | Ga0495679_009097 | Ga0495679_009097_1694_2305 | 203 |
| 615 | 3300048091 | Ga0495626_0000144 | Ga0495626_0000144_8888_9499 | 203 |
| 616 | 3300049459 | Ga0495678_015339 | Ga0495678_015339_2261_2872 | 203 |
| 617 | 3300053087 | Ga0500643_001627 | Ga0500643_001627_11767_12393 | 203 |
| 618 | iso_pu_bacteria | 8052494512 | 8052497006 | 203 |
| 619 | 2124908027 | MRS2a_Contig_45 | MRS2a_00337060 | 204 |
| 620 | 2162886007 | SwRhRL2b_contig_456895 | SwRhRL2b_0491.00005940 | 204 |
| 621 | 3300002737 | JGI25162J39368_1000166 | JGI25162J39368_10001668 | 204 |
| 622 | 3300002771 | JGI25163J39215_1000186 | JGI25163J39215_100018613 | 204 |
| 623 | 3300002771 | JGI25163J39215_1000638 | JGI25163J39215_10006384 | 204 |
| 624 | 3300002772 | JGI25164J39214_1000129 | JGI25164J39214_100012969 | 204 |
| 625 | 3300002772 | JGI25164J39214_1000415 | JGI25164J39214_100041513 | 204 |
| 626 | 3300003214 | JGI25165J46597_1000251 | JGI25165J46597_100025169 | 204 |
| 627 | 3300003214 | JGI25165J46597_1000756 | JGI25165J46597_10007569 | 204 |
| 628 | 3300003781 | Ga0055536_1000268 | Ga0055536_100026824 | 204 |
| 629 | 3300003781 | Ga0055536_1032350 | Ga0055536_10323501 | 204 |
| 630 | 3300003781 | Ga0055536_1068912 | Ga0055536_10689121 | 204 |
| 631 | 3300003791 | Ga0055530_10000259 | Ga0055530_1000025910 | 204 |
| 632 | 3300003791 | Ga0055530_10000450 | Ga0055530_1000045033 | 204 |
| 633 | 3300003791 | Ga0055530_10008590 | Ga0055530_100085903 | 204 |
| 634 | 3300003792 | Ga0055540_1000105 | Ga0055540_100010510 | 204 |
| 635 | 3300003792 | Ga0055540_1000386 | Ga0055540_100038633 | 204 |
| 636 | 3300003794 | Ga0055531_10000081 | Ga0055531_1000008110 | 204 |
| 637 | 3300003856 | Ga0058692_1021800 | Ga0058692_10218002 | 204 |
| 638 | 3300005288 | Ga0065714_10002494 | Ga0065714_100024948 | 204 |
| 639 | 3300005288 | Ga0065714_10002507 | Ga0065714_1000250711 | 204 |
| 640 | 3300005288 | Ga0065714_10006419 | Ga0065714_1000641911 | 204 |
| 641 | 3300005288 | Ga0065714_10023978 | Ga0065714_100239783 | 204 |
| 642 | 3300005289 | Ga0065704_10072002 | Ga0065704_100720023 | 204 |
| 643 | 3300005289 | Ga0065704_10263780 | Ga0065704_102637801 | 204 |
| 644 | 3300005290 | Ga0065712_10001825 | Ga0065712_100018255 | 204 |
| 645 | 3300005353 | Ga0070669_100013166 | Ga0070669_1000131663 | 204 |
| 646 | 3300005435 | Ga0070714_100725549 | Ga0070714_1007255492 | 204 |
| 647 | 3300006051 | Ga0075364_10044785 | Ga0075364_100447851 | 204 |
| 648 | 3300006051 | Ga0075364_10460751 | Ga0075364_104607511 | 204 |
| 649 | 3300006058 | Ga0075432_10001522 | Ga0075432_100015222 | 204 |
| 650 | 3300006058 | Ga0075432_10008650 | Ga0075432_100086504 | 204 |
| 651 | 3300006058 | Ga0075432_10014180 | Ga0075432_100141802 | 204 |
| 652 | 3300006058 | Ga0075432_10047007 | Ga0075432_100470071 | 204 |
| 653 | 3300006058 | Ga0075432_10124702 | Ga0075432_101247021 | 204 |
| 654 | 3300006058 | Ga0075432_10164104 | Ga0075432_101641042 | 204 |
| 655 | 3300006058 | Ga0075432_10246428 | Ga0075432_102464281 | 204 |
| 656 | 3300006186 | Ga0075369_10058202 | Ga0075369_100582022 | 204 |
| 657 | 3300006946 | Ga0079104_1000094 | Ga0079104_10000949 | 204 |
| 658 | 3300006946 | Ga0079104_1000124 | Ga0079104_100012410 | 204 |
| 659 | 3300006946 | Ga0079104_1060811 | Ga0079104_10608111 | 204 |
| 660 | 3300006948 | Ga0099826_10003718 | Ga0099826_100037188 | 204 |
| 661 | 3300009011 | Ga0105251_10032399 | Ga0105251_100323994 | 204 |
| 662 | 3300009011 | Ga0105251_10122725 | Ga0105251_101227252 | 204 |
| 663 | 3300009036 | Ga0105244_10036257 | Ga0105244_100362574 | 204 |
| 664 | 3300009036 | Ga0105244_10042678 | Ga0105244_100426784 | 204 |
| 665 | 3300009036 | Ga0105244_10043152 | Ga0105244_100431524 | 204 |
| 666 | 3300009036 | Ga0105244_10102611 | Ga0105244_101026112 | 204 |
| 667 | 3300009092 | Ga0105250_10000560 | Ga0105250_100005608 | 204 |
| 668 | 3300009092 | Ga0105250_10000898 | Ga0105250_100008983 | 204 |
| 669 | 3300009092 | Ga0105250_10010202 | Ga0105250_100102024 | 204 |
| 670 | 3300009092 | Ga0105250_10188130 | Ga0105250_101881301 | 204 |
| 671 | 3300009148 | Ga0105243_10000103 | Ga0105243_1000010378 | 204 |
| 672 | 3300009148 | Ga0105243_10000125 | Ga0105243_100001259 | 204 |
| 673 | 3300009148 | Ga0105243_10212345 | Ga0105243_102123452 | 204 |
| 674 | 3300011119 | Ga0105246_10023370 | Ga0105246_100233702 | 204 |
| 675 | 3300012498 | Ga0157345_1000009 | Ga0157345_100000939 | 204 |
| 676 | 3300012498 | Ga0157345_1000928 | Ga0157345_10009282 | 204 |
| 677 | 3300013100 | Ga0157373_10000151 | Ga0157373_100001518 | 204 |
| 678 | 3300013100 | Ga0157373_10020435 | Ga0157373_100204353 | 204 |
| 679 | 3300013100 | Ga0157373_10072424 | Ga0157373_100724241 | 204 |
| 680 | 3300013100 | Ga0157373_10269277 | Ga0157373_102692772 | 204 |
| 681 | 3300013100 | Ga0157373_10365300 | Ga0157373_103653002 | 204 |
| 682 | 3300013100 | Ga0157373_10549411 | Ga0157373_105494111 | 204 |
| 683 | 3300013102 | Ga0157371_10000463 | Ga0157371_100004639 | 204 |
| 684 | 3300013102 | Ga0157371_10004579 | Ga0157371_100045799 | 204 |
| 685 | 3300013102 | Ga0157371_10428980 | Ga0157371_104289801 | 204 |
| 686 | 3300013104 | Ga0157370_10005821 | Ga0157370_1000582110 | 204 |
| 687 | 3300013104 | Ga0157370_10159805 | Ga0157370_101598052 | 204 |
| 688 | 3300013104 | Ga0157370_10273552 | Ga0157370_102735521 | 204 |
| 689 | 3300013104 | Ga0157370_10554702 | Ga0157370_105547021 | 204 |
| 690 | 3300013104 | Ga0157370_10930684 | Ga0157370_109306841 | 204 |
| 691 | 3300013105 | Ga0157369_10014332 | Ga0157369_100143324 | 204 |
| 692 | 3300013105 | Ga0157369_10014764 | Ga0157369_100147648 | 204 |
| 693 | 3300013105 | Ga0157369_10078365 | Ga0157369_100783652 | 204 |
| 694 | 3300013105 | Ga0157369_11454637 | Ga0157369_114546371 | 204 |
| 695 | 3300013306 | Ga0163162_10000072 | Ga0163162_1000007282 | 204 |
| 696 | 3300013306 | Ga0163162_10008712 | Ga0163162_1000871211 | 204 |
| 697 | 3300013306 | Ga0163162_10586450 | Ga0163162_105864502 | 204 |
| 698 | 3300013308 | Ga0157375_10084113 | Ga0157375_100841132 | 204 |
| 699 | 3300013308 | Ga0157375_10354463 | Ga0157375_103544632 | 204 |
| 700 | 3300013308 | Ga0157375_10898380 | Ga0157375_108983801 | 204 |
| 701 | 3300014497 | Ga0182008_10001317 | Ga0182008_1000131712 | 204 |
| 702 | 3300014497 | Ga0182008_10002359 | Ga0182008_1000235910 | 204 |
| 703 | 3300014497 | Ga0182008_10006016 | Ga0182008_100060165 | 204 |
| 704 | 3300014497 | Ga0182008_10028516 | Ga0182008_100285163 | 204 |
| 705 | 3300014497 | Ga0182008_10230097 | Ga0182008_102300972 | 204 |
| 706 | 3300015261 | Ga0182006_1002945 | Ga0182006_10029455 | 204 |
| 707 | 3300015261 | Ga0182006_1003352 | Ga0182006_10033528 | 204 |
| 708 | 3300015261 | Ga0182006_1015711 | Ga0182006_10157113 | 204 |
| 709 | 3300015265 | Ga0182005_1000842 | Ga0182005_100084210 | 204 |
| 710 | 3300015265 | Ga0182005_1015984 | Ga0182005_10159841 | 204 |
| 711 | 3300017792 | Ga0163161_10000156 | Ga0163161_1000015646 | 204 |
| 712 | 3300017792 | Ga0163161_10003953 | Ga0163161_100039534 | 204 |
| 713 | 3300017792 | Ga0163161_10045752 | Ga0163161_100457524 | 204 |
| 714 | 3300017792 | Ga0163161_10064565 | Ga0163161_100645653 | 204 |
| 715 | 3300017792 | Ga0163161_10672240 | Ga0163161_106722402 | 204 |
| 716 | 3300025207 | Ga0209760_100227 | Ga0209760_1002278 | 204 |
| 717 | 3300025207 | Ga0209760_100434 | Ga0209760_1004348 | 204 |
| 718 | 3300025231 | Ga0207427_100047 | Ga0207427_1000478 | 204 |
| 719 | 3300025231 | Ga0207427_100074 | Ga0207427_1000748 | 204 |
| 720 | 3300025233 | Ga0209437_100006 | Ga0209437_1000068 | 204 |
| 721 | 3300025233 | Ga0209437_100009 | Ga0209437_1000098 | 204 |
| 722 | 3300025261 | Ga0209233_1000032 | Ga0209233_10000328 | 204 |
| 723 | 3300025261 | Ga0209233_1000484 | Ga0209233_10004848 | 204 |
| 724 | 3300025291 | Ga0209675_1006516 | Ga0209675_10065165 | 204 |
| 725 | 3300025292 | Ga0209676_1000010 | Ga0209676_100001010 | 204 |
| 726 | 3300025292 | Ga0209676_1000646 | Ga0209676_10006468 | 204 |
| 727 | 3300025292 | Ga0209676_1007290 | Ga0209676_10072903 | 204 |
| 728 | 3300025292 | Ga0209676_1010061 | Ga0209676_10100613 | 204 |
| 729 | 3300025298 | Ga0209050_1000081 | Ga0209050_1000081240 | 204 |
| 730 | 3300025298 | Ga0209050_1000227 | Ga0209050_10002278 | 204 |
| 731 | 3300025298 | Ga0209050_1000363 | Ga0209050_100036310 | 204 |
| 732 | 3300025303 | Ga0209051_1000164 | Ga0209051_10001649 | 204 |
| 733 | 3300025303 | Ga0209051_1000185 | Ga0209051_100018591 | 204 |
| 734 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040515 | 204 |
| 735 | 3300025304 | Ga0209257_1008247 | Ga0209257_10082474 | 204 |
| 736 | 3300025711 | Ga0207696_1001567 | Ga0207696_100156712 | 204 |
| 737 | 3300025711 | Ga0207696_1002536 | Ga0207696_10025363 | 204 |
| 738 | 3300025711 | Ga0207696_1013067 | Ga0207696_10130674 | 204 |
| 739 | 3300025711 | Ga0207696_1018219 | Ga0207696_10182192 | 204 |
| 740 | 3300025728 | Ga0207655_1000551 | Ga0207655_100055129 | 204 |
| 741 | 3300025728 | Ga0207655_1002591 | Ga0207655_100259110 | 204 |
| 742 | 3300025728 | Ga0207655_1004649 | Ga0207655_10046492 | 204 |
| 743 | 3300025728 | Ga0207655_1010235 | Ga0207655_10102357 | 204 |
| 744 | 3300025728 | Ga0207655_1011899 | Ga0207655_10118992 | 204 |
| 745 | 3300025728 | Ga0207655_1023881 | Ga0207655_10238813 | 204 |
| 746 | 3300025728 | Ga0207655_1060197 | Ga0207655_10601973 | 204 |
| 747 | 3300025728 | Ga0207655_1087869 | Ga0207655_10878691 | 204 |
| 748 | 3300025735 | Ga0207713_1001221 | Ga0207713_10012218 | 204 |
| 749 | 3300025735 | Ga0207713_1001918 | Ga0207713_100191810 | 204 |
| 750 | 3300025735 | Ga0207713_1003241 | Ga0207713_10032419 | 204 |
| 751 | 3300025735 | Ga0207713_1006429 | Ga0207713_10064292 | 204 |
| 752 | 3300025735 | Ga0207713_1028640 | Ga0207713_10286402 | 204 |
| 753 | 3300025735 | Ga0207713_1101848 | Ga0207713_11018482 | 204 |
| 754 | 3300025735 | Ga0207713_1102312 | Ga0207713_11023122 | 204 |
| 755 | 3300025923 | Ga0207681_10024058 | Ga0207681_100240584 | 204 |
| 756 | 3300025933 | Ga0207706_10042785 | Ga0207706_100427854 | 204 |
| 757 | 3300025935 | Ga0207709_10000035 | Ga0207709_1000003511 | 204 |
| 758 | 3300025935 | Ga0207709_10002421 | Ga0207709_100024219 | 204 |
| 759 | 3300027111 | Ga0209281_1000077 | Ga0209281_100007710 | 204 |
| 760 | 3300027111 | Ga0209281_1000212 | Ga0209281_1000212123 | 204 |
| 761 | 3300027111 | Ga0209281_1006513 | Ga0209281_10065132 | 204 |
| 762 | 3300027111 | Ga0209281_1011142 | Ga0209281_10111422 | 204 |
| 763 | 3300027312 | Ga0209371_1001552 | Ga0209371_100155213 | 204 |
| 764 | 3300027666 | Ga0209282_1012669 | Ga0209282_10126693 | 204 |
| 765 | 3300027907 | Ga0207428_10005837 | Ga0207428_1000583715 | 204 |
| 766 | 3300027907 | Ga0207428_10054766 | Ga0207428_100547661 | 204 |
| 767 | 3300027907 | Ga0207428_10080023 | Ga0207428_100800234 | 204 |
| 768 | 3300028379 | Ga0268266_10099467 | Ga0268266_100994671 | 204 |
| 769 | 3300030500 | Ga0268256_1002253 | Ga0268256_10022535 | 204 |
| 770 | 3300030521 | Ga0307511_10028132 | Ga0307511_100281326 | 204 |
| 771 | 3300030734 | Ga0316179_1039086 | Ga0316179_10390862 | 204 |
| 772 | 3300030735 | Ga0316178_1138063 | Ga0316178_113806312 | 204 |
| 773 | 3300030742 | Ga0316183_1077777 | Ga0316183_10777772 | 204 |
| 774 | 3300030742 | Ga0316183_1106054 | Ga0316183_11060542 | 204 |
| 775 | 3300031548 | Ga0307408_100002671 | Ga0307408_10000267112 | 204 |
| 776 | 3300031548 | Ga0307408_100002956 | Ga0307408_1000029562 | 204 |
| 777 | 3300031548 | Ga0307408_100436648 | Ga0307408_1004366482 | 204 |
| 778 | 3300031548 | Ga0307408_100467367 | Ga0307408_1004673672 | 204 |
| 779 | 3300031731 | Ga0307405_10000624 | Ga0307405_100006249 | 204 |
| 780 | 3300031731 | Ga0307405_10002473 | Ga0307405_100024733 | 204 |
| 781 | 3300031731 | Ga0307405_10320653 | Ga0307405_103206532 | 204 |
| 782 | 3300031824 | Ga0307413_10013068 | Ga0307413_100130684 | 204 |
| 783 | 3300031824 | Ga0307413_10032714 | Ga0307413_100327143 | 204 |
| 784 | 3300031901 | Ga0307406_10053238 | Ga0307406_100532385 | 204 |
| 785 | 3300031903 | Ga0307407_10135080 | Ga0307407_101350801 | 204 |
| 786 | 3300031911 | Ga0307412_10000878 | Ga0307412_1000087814 | 204 |
| 787 | 3300031911 | Ga0307412_10000944 | Ga0307412_1000094415 | 204 |
| 788 | 3300031911 | Ga0307412_10001619 | Ga0307412_1000161912 | 204 |
| 789 | 3300031911 | Ga0307412_11144039 | Ga0307412_111440391 | 204 |
| 790 | 3300032004 | Ga0307414_10055195 | Ga0307414_100551952 | 204 |
| 791 | 3300032004 | Ga0307414_10137367 | Ga0307414_101373673 | 204 |
| 792 | 3300032004 | Ga0307414_10486470 | Ga0307414_104864701 | 204 |
| 793 | 3300032004 | Ga0307414_10967960 | Ga0307414_109679601 | 204 |
| 794 | 3300032005 | Ga0307411_10008616 | Ga0307411_100086161 | 204 |
| 795 | 3300032005 | Ga0307411_10015363 | Ga0307411_100153633 | 204 |
| 796 | 3300032005 | Ga0307411_10020708 | Ga0307411_100207083 | 204 |
| 797 | 3300033180 | Ga0307510_10012774 | Ga0307510_100127744 | 204 |
| 798 | 3300038705 | Ga0237819_00585 | Ga0237819_00585_698_1312 | 204 |
| 799 | 3300041405 | Ga0439438_001949 | Ga0439438_001949_2979_3593 | 204 |
| 800 | 3300041405 | Ga0439438_002256 | Ga0439438_002256_5186_5800 | 204 |
| 801 | 3300041405 | Ga0439438_002400 | Ga0439438_002400_150_764 | 204 |
| 802 | 3300041405 | Ga0439438_002403 | Ga0439438_002403_150_764 | 204 |
| 803 | 3300041405 | Ga0439438_002513 | Ga0439438_002513_6793_7407 | 204 |
| 804 | 3300041405 | Ga0439438_002539 | Ga0439438_002539_6081_6695 | 204 |
| 805 | 3300041405 | Ga0439438_003729 | Ga0439438_003729_1728_2342 | 204 |
| 806 | 3300041405 | Ga0439438_015614 | Ga0439438_015614_1576_2190 | 204 |
| 807 | 3300041407 | Ga0439447_000280 | Ga0439447_000280_8753_9367 | 204 |
| 808 | 3300041407 | Ga0439447_000621 | Ga0439447_000621_7169_7783 | 204 |
| 809 | 3300041407 | Ga0439447_000698 | Ga0439447_000698_6578_7192 | 204 |
| 810 | 3300041407 | Ga0439447_003542 | Ga0439447_003542_4095_4709 | 204 |
| 811 | 3300041407 | Ga0439447_003943 | Ga0439447_003943_3525_4139 | 204 |
| 812 | 3300041407 | Ga0439447_006856 | Ga0439447_006856_2187_2810 | 204 |
| 813 | 3300041407 | Ga0439447_016415 | Ga0439447_016415_122_736 | 204 |
| 814 | 3300041411 | Ga0439466_0000422 | Ga0439466_0000422_9145_9759 | 204 |
| 815 | 3300041411 | Ga0439466_0002836 | Ga0439466_0002836_2920_3534 | 204 |
| 816 | 3300041411 | Ga0439466_0009673 | Ga0439466_0009673_1120_1734 | 204 |
| 817 | 3300041411 | Ga0439466_0011006 | Ga0439466_0011006_1489_2103 | 204 |
| 818 | 3300041411 | Ga0439466_0013955 | Ga0439466_0013955_1510_2133 | 204 |
| 819 | 3300041411 | Ga0439466_0020081 | Ga0439466_0020081_1669_2283 | 204 |
| 820 | 3300041411 | Ga0439466_0043550 | Ga0439466_0043550_398_1012 | 204 |
| 821 | 3300041997 | Ga0439431_0013624 | Ga0439431_0013624_879_1502 | 204 |
| 822 | 3300042004 | Ga0439445_0004818 | Ga0439445_0004818_1655_2269 | 204 |
| 823 | 3300042006 | Ga0439432_001312 | Ga0439432_001312_2012_2626 | 204 |
| 824 | 3300042006 | Ga0439432_006504 | Ga0439432_006504_587_1210 | 204 |
| 825 | 3300042006 | Ga0439432_010421 | Ga0439432_010421_1385_1999 | 204 |
| 826 | 3300042006 | Ga0439432_017024 | Ga0439432_017024_280_894 | 204 |
| 827 | 3300042009 | Ga0439451_020469 | Ga0439451_020469_708_1322 | 204 |
| 828 | 3300042010 | Ga0439452_000091 | Ga0439452_000091_68323_68937 | 204 |
| 829 | 3300042010 | Ga0439452_000172 | Ga0439452_000172_7019_7633 | 204 |
| 830 | 3300042010 | Ga0439452_000309 | Ga0439452_000309_7821_8435 | 204 |
| 831 | 3300042010 | Ga0439452_004717 | Ga0439452_004717_1491_2105 | 204 |
| 832 | 3300042010 | Ga0439452_005180 | Ga0439452_005180_416_1039 | 204 |
| 833 | 3300042010 | Ga0439452_006684 | Ga0439452_006684_2341_2955 | 204 |
| 834 | 3300042010 | Ga0439452_025368 | Ga0439452_025368_794_1408 | 204 |
| 835 | 3300042013 | Ga0439456_000810 | Ga0439456_000810_5438_6052 | 204 |
| 836 | 3300042013 | Ga0439456_007282 | Ga0439456_007282_625_1239 | 204 |
| 837 | 3300042013 | Ga0439456_009090 | Ga0439456_009090_381_995 | 204 |
| 838 | 3300042013 | Ga0439456_024071 | Ga0439456_024071_312_935 | 204 |
| 839 | 3300042013 | Ga0439456_045321 | Ga0439456_045321_273_902 | 204 |
| 840 | 3300042016 | Ga0439463_050307 | Ga0439463_050307_253_867 | 204 |
| 841 | 3300042115 | Ga0450911_000025 | Ga0450911_000025_7058_7672 | 204 |
| 842 | 3300042121 | Ga0450919_003138 | Ga0450919_003138_1059_1673 | 204 |
| 843 | 3300042122 | Ga0450920_003350 | Ga0450920_003350_1264_1878 | 204 |
| 844 | 3300042124 | Ga0450922_000181 | Ga0450922_000181_841_1455 | 204 |
| 845 | 3300042125 | Ga0450923_001551 | Ga0450923_001551_1717_2331 | 204 |
| 846 | 3300042136 | Ga0450900_005759 | Ga0450900_005759_27_647 | 204 |
| 847 | 3300042137 | Ga0450902_000571 | Ga0450902_000571_3964_4584 | 204 |
| 848 | 3300042138 | Ga0450903_002442 | Ga0450903_002442_993_1607 | 204 |
| 849 | 3300042138 | Ga0450903_004051 | Ga0450903_004051_465_1079 | 204 |
| 850 | 3300042138 | Ga0450903_004391 | Ga0450903_004391_1181_1795 | 204 |
| 851 | 3300042138 | Ga0450903_012557 | Ga0450903_012557_63_677 | 204 |
| 852 | 3300042145 | Ga0450906_000612 | Ga0450906_000612_2547_3161 | 204 |
| 853 | 3300042145 | Ga0450906_001636 | Ga0450906_001636_3813_4427 | 204 |
| 854 | 3300042146 | Ga0450907_000038 | Ga0450907_000038_8872_9486 | 204 |
| 855 | 3300042146 | Ga0450907_000855 | Ga0450907_000855_6448_7062 | 204 |
| 856 | 3300042146 | Ga0450907_039969 | Ga0450907_039969_43_657 | 204 |
| 857 | 3300042156 | Ga0439446_0064553 | Ga0439446_0064553_205_819 | 204 |
| 858 | 3300042185 | Ga0450909_000065 | Ga0450909_000065_1596_2210 | 204 |
| 859 | 3300042435 | Ga0439434_0000253 | Ga0439434_0000253_8937_9551 | 204 |
| 860 | 3300042461 | Ga0439460_0000460 | Ga0439460_0000460_3469_4083 | 204 |
| 861 | 3300042461 | Ga0439460_0001474 | Ga0439460_0001474_1763_2377 | 204 |
| 862 | 3300042993 | Ga0439440_0003618 | Ga0439440_0003618_1959_2573 | 204 |
| 863 | 3300046452 | Ga0495617_004146 | Ga0495617_004146_272_886 | 204 |
| 864 | 3300046452 | Ga0495617_004255 | Ga0495617_004255_1371_1985 | 204 |
| 865 | 3300046452 | Ga0495617_008453 | Ga0495617_008453_112_726 | 204 |
| 866 | 3300046452 | Ga0495617_009307 | Ga0495617_009307_1795_2409 | 204 |
| 867 | 3300046452 | Ga0495617_026063 | Ga0495617_026063_1289_1903 | 204 |
| 868 | 3300046452 | Ga0495617_028225 | Ga0495617_028225_463_1101 | 204 |
| 869 | 3300046452 | Ga0495617_042370 | Ga0495617_042370_573_1187 | 204 |
| 870 | 3300046453 | Ga0495627_000239 | Ga0495627_000239_6869_7483 | 204 |
| 871 | 3300046453 | Ga0495627_000864 | Ga0495627_000864_13870_14508 | 204 |
| 872 | 3300046453 | Ga0495627_002308 | Ga0495627_002308_2702_3316 | 204 |
| 873 | 3300046453 | Ga0495627_004519 | Ga0495627_004519_2267_2881 | 204 |
| 874 | 3300046455 | Ga0495603_0018361 | Ga0495603_0018361_917_1531 | 204 |
| 875 | 3300046455 | Ga0495603_0019564 | Ga0495603_0019564_2466_3080 | 204 |
| 876 | 3300046457 | Ga0495590_0013094 | Ga0495590_0013094_332_946 | 204 |
| 877 | 3300046457 | Ga0495590_0032480 | Ga0495590_0032480_249_863 | 204 |
| 878 | 3300046457 | Ga0495590_0041811 | Ga0495590_0041811_448_1062 | 204 |
| 879 | 3300046457 | Ga0495590_0070549 | Ga0495590_0070549_69_683 | 204 |
| 880 | 3300046458 | Ga0495591_000107 | Ga0495591_000107_88209_88847 | 204 |
| 881 | 3300046458 | Ga0495591_000287 | Ga0495591_000287_7020_7634 | 204 |
| 882 | 3300046458 | Ga0495591_000774 | Ga0495591_000774_6910_7524 | 204 |
| 883 | 3300046458 | Ga0495591_002390 | Ga0495591_002390_6893_7507 | 204 |
| 884 | 3300046458 | Ga0495591_005561 | Ga0495591_005561_4829_5443 | 204 |
| 885 | 3300046458 | Ga0495591_009734 | Ga0495591_009734_330_944 | 204 |
| 886 | 3300046458 | Ga0495591_014040 | Ga0495591_014040_107_721 | 204 |
| 887 | 3300046458 | Ga0495591_049195 | Ga0495591_049195_100_714 | 204 |
| 888 | 3300046459 | Ga0495629_0351154 | Ga0495629_0351154_280_894 | 204 |
| 889 | 3300046460 | Ga0495638_0002189 | Ga0495638_0002189_8733_9347 | 204 |
| 890 | 3300046460 | Ga0495638_0003517 | Ga0495638_0003517_7007_7621 | 204 |
| 891 | 3300046460 | Ga0495638_0003771 | Ga0495638_0003771_4426_5040 | 204 |
| 892 | 3300046460 | Ga0495638_0015395 | Ga0495638_0015395_3043_3657 | 204 |
| 893 | 3300046460 | Ga0495638_0020618 | Ga0495638_0020618_3549_4163 | 204 |
| 894 | 3300046460 | Ga0495638_0044924 | Ga0495638_0044924_662_1276 | 204 |
| 895 | 3300046460 | Ga0495638_0073514 | Ga0495638_0073514_141_755 | 204 |
| 896 | 3300046460 | Ga0495638_0085793 | Ga0495638_0085793_861_1475 | 204 |
| 897 | 3300046460 | Ga0495638_0094289 | Ga0495638_0094289_945_1559 | 204 |
| 898 | 3300046460 | Ga0495638_0151464 | Ga0495638_0151464_535_1149 | 204 |
| 899 | 3300046463 | Ga0495653_0000525 | Ga0495653_0000525_21971_22585 | 204 |
| 900 | 3300046463 | Ga0495653_0023268 | Ga0495653_0023268_2395_3009 | 204 |
| 901 | 3300046463 | Ga0495653_0037094 | Ga0495653_0037094_1916_2530 | 204 |
| 902 | 3300046471 | Ga0495650_0003372 | Ga0495650_0003372_8852_9466 | 204 |
| 903 | 3300046471 | Ga0495650_0006289 | Ga0495650_0006289_6350_6964 | 204 |
| 904 | 3300046471 | Ga0495650_0029119 | Ga0495650_0029119_1279_1893 | 204 |
| 905 | 3300046471 | Ga0495650_0057982 | Ga0495650_0057982_918_1532 | 204 |
| 906 | 3300046473 | Ga0495582_0002084 | Ga0495582_0002084_1754_2368 | 204 |
| 907 | 3300046474 | Ga0495605_0000309 | Ga0495605_0000309_9133_9747 | 204 |
| 908 | 3300046474 | Ga0495605_0003411 | Ga0495605_0003411_6896_7534 | 204 |
| 909 | 3300046474 | Ga0495605_0044150 | Ga0495605_0044150_208_822 | 204 |
| 910 | 3300046474 | Ga0495605_0044664 | Ga0495605_0044664_1551_2165 | 204 |
| 911 | 3300046474 | Ga0495605_0045491 | Ga0495605_0045491_300_914 | 204 |
| 912 | 3300046474 | Ga0495605_0202154 | Ga0495605_0202154_33_647 | 204 |
| 913 | 3300046475 | Ga0495639_0011149 | Ga0495639_0011149_1114_1728 | 204 |
| 914 | 3300046475 | Ga0495639_0022419 | Ga0495639_0022419_1864_2478 | 204 |
| 915 | 3300046491 | Ga0495584_0000505 | Ga0495584_0000505_8868_9482 | 204 |
| 916 | 3300046491 | Ga0495584_0002635 | Ga0495584_0002635_6271_6885 | 204 |
| 917 | 3300046491 | Ga0495584_0003226 | Ga0495584_0003226_1529_2143 | 204 |
| 918 | 3300046491 | Ga0495584_0009835 | Ga0495584_0009835_24_638 | 204 |
| 919 | 3300046491 | Ga0495584_0053247 | Ga0495584_0053247_1368_1982 | 204 |
| 920 | 3300046491 | Ga0495584_0063235 | Ga0495584_0063235_53_667 | 204 |
| 921 | 3300046491 | Ga0495584_0127431 | Ga0495584_0127431_131_745 | 204 |
| 922 | 3300046491 | Ga0495584_0208913 | Ga0495584_0208913_256_870 | 204 |
| 923 | 3300046492 | Ga0495585_0000228 | Ga0495585_0000228_50181_50795 | 204 |
| 924 | 3300046492 | Ga0495585_0004597 | Ga0495585_0004597_1306_1920 | 204 |
| 925 | 3300046492 | Ga0495585_0011533 | Ga0495585_0011533_3125_3739 | 204 |
| 926 | 3300046492 | Ga0495585_0066195 | Ga0495585_0066195_1222_1836 | 204 |
| 927 | 3300046499 | Ga0495594_0007936 | Ga0495594_0007936_2654_3268 | 204 |
| 928 | 3300046499 | Ga0495594_0008555 | Ga0495594_0008555_3682_4296 | 204 |
| 929 | 3300046499 | Ga0495594_0009339 | Ga0495594_0009339_1754_2368 | 204 |
| 930 | 3300046500 | Ga0495596_0000028 | Ga0495596_0000028_6909_7523 | 204 |
| 931 | 3300046500 | Ga0495596_0030659 | Ga0495596_0030659_1177_1791 | 204 |
| 932 | 3300046500 | Ga0495596_0037155 | Ga0495596_0037155_1130_1744 | 204 |
| 933 | 3300046501 | Ga0495607_0001376 | Ga0495607_0001376_6925_7539 | 204 |
| 934 | 3300046501 | Ga0495607_0001798 | Ga0495607_0001798_10690_11304 | 204 |
| 935 | 3300046501 | Ga0495607_0002668 | Ga0495607_0002668_6787_7401 | 204 |
| 936 | 3300046501 | Ga0495607_0008043 | Ga0495607_0008043_4755_5369 | 204 |
| 937 | 3300046501 | Ga0495607_0012233 | Ga0495607_0012233_352_966 | 204 |
| 938 | 3300046501 | Ga0495607_0027603 | Ga0495607_0027603_1672_2310 | 204 |
| 939 | 3300046501 | Ga0495607_0035349 | Ga0495607_0035349_552_1166 | 204 |
| 940 | 3300046501 | Ga0495607_0137465 | Ga0495607_0137465_324_938 | 204 |
| 941 | 3300046501 | Ga0495607_0169315 | Ga0495607_0169315_66_680 | 204 |
| 942 | 3300046501 | Ga0495607_0271837 | Ga0495607_0271837_109_723 | 204 |
| 943 | 3300046506 | Ga0495583_0006457 | Ga0495583_0006457_6562_7176 | 204 |
| 944 | 3300046506 | Ga0495583_0015625 | Ga0495583_0015625_816_1430 | 204 |
| 945 | 3300046507 | Ga0495606_0000782 | Ga0495606_0000782_47927_48541 | 204 |
| 946 | 3300046507 | Ga0495606_0000988 | Ga0495606_0000988_33959_34573 | 204 |
| 947 | 3300046507 | Ga0495606_0004727 | Ga0495606_0004727_8898_9512 | 204 |
| 948 | 3300046507 | Ga0495606_0008677 | Ga0495606_0008677_6997_7611 | 204 |
| 949 | 3300046507 | Ga0495606_0009687 | Ga0495606_0009687_489_1103 | 204 |
| 950 | 3300046507 | Ga0495606_0010638 | Ga0495606_0010638_3243_3857 | 204 |
| 951 | 3300046507 | Ga0495606_0026693 | Ga0495606_0026693_512_1126 | 204 |
| 952 | 3300046507 | Ga0495606_0048957 | Ga0495606_0048957_1120_1734 | 204 |
| 953 | 3300046512 | Ga0495610_0003177 | Ga0495610_0003177_6963_7577 | 204 |
| 954 | 3300046512 | Ga0495610_0009530 | Ga0495610_0009530_5391_6005 | 204 |
| 955 | 3300046512 | Ga0495610_0010263 | Ga0495610_0010263_3252_3866 | 204 |
| 956 | 3300046512 | Ga0495610_0013697 | Ga0495610_0013697_123_737 | 204 |
| 957 | 3300046512 | Ga0495610_0014956 | Ga0495610_0014956_1456_2070 | 204 |
| 958 | 3300046512 | Ga0495610_0018000 | Ga0495610_0018000_90_704 | 204 |
| 959 | 3300046512 | Ga0495610_0022822 | Ga0495610_0022822_2560_3174 | 204 |
| 960 | 3300046512 | Ga0495610_0051532 | Ga0495610_0051532_832_1446 | 204 |
| 961 | 3300046512 | Ga0495610_0068125 | Ga0495610_0068125_964_1578 | 204 |
| 962 | 3300046513 | Ga0495616_0000168 | Ga0495616_0000168_48123_48761 | 204 |
| 963 | 3300046513 | Ga0495616_0001849 | Ga0495616_0001849_6990_7604 | 204 |
| 964 | 3300046513 | Ga0495616_0005394 | Ga0495616_0005394_1559_2173 | 204 |
| 965 | 3300046513 | Ga0495616_0008103 | Ga0495616_0008103_170_784 | 204 |
| 966 | 3300046513 | Ga0495616_0035367 | Ga0495616_0035367_1389_2003 | 204 |
| 967 | 3300046513 | Ga0495616_0038241 | Ga0495616_0038241_1384_1998 | 204 |
| 968 | 3300046513 | Ga0495616_0053366 | Ga0495616_0053366_144_758 | 204 |
| 969 | 3300046513 | Ga0495616_0125305 | Ga0495616_0125305_520_1134 | 204 |
| 970 | 3300046515 | Ga0495620_0000184 | Ga0495620_0000184_7015_7629 | 204 |
| 971 | 3300046515 | Ga0495620_0001469 | Ga0495620_0001469_9125_9739 | 204 |
| 972 | 3300046515 | Ga0495620_0014936 | Ga0495620_0014936_3045_3659 | 204 |
| 973 | 3300046515 | Ga0495620_0018385 | Ga0495620_0018385_1929_2543 | 204 |
| 974 | 3300046515 | Ga0495620_0030251 | Ga0495620_0030251_280_894 | 204 |
| 975 | 3300046516 | Ga0495628_0065374 | Ga0495628_0065374_1271_1885 | 204 |
| 976 | 3300046517 | Ga0495630_0012152 | Ga0495630_0012152_409_1023 | 204 |
| 977 | 3300046517 | Ga0495630_0024402 | Ga0495630_0024402_833_1447 | 204 |
| 978 | 3300046517 | Ga0495630_0030578 | Ga0495630_0030578_564_1178 | 204 |
| 979 | 3300046518 | Ga0495631_0000020 | Ga0495631_0000020_8852_9466 | 204 |
| 980 | 3300046518 | Ga0495631_0000221 | Ga0495631_0000221_31486_32100 | 204 |
| 981 | 3300046518 | Ga0495631_0003793 | Ga0495631_0003793_4528_5142 | 204 |
| 982 | 3300046518 | Ga0495631_0049788 | Ga0495631_0049788_430_1044 | 204 |
| 983 | 3300046518 | Ga0495631_0058201 | Ga0495631_0058201_39_653 | 204 |
| 984 | 3300046518 | Ga0495631_0208088 | Ga0495631_0208088_142_756 | 204 |
| 985 | 3300046519 | Ga0495632_0000222 | Ga0495632_0000222_50266_50880 | 204 |
| 986 | 3300046519 | Ga0495632_0002292 | Ga0495632_0002292_4792_5406 | 204 |
| 987 | 3300046519 | Ga0495632_0004343 | Ga0495632_0004343_2023_2661 | 204 |
| 988 | 3300046519 | Ga0495632_0008780 | Ga0495632_0008780_3744_4358 | 204 |
| 989 | 3300046519 | Ga0495632_0015507 | Ga0495632_0015507_2993_3607 | 204 |
| 990 | 3300046519 | Ga0495632_0054147 | Ga0495632_0054147_1319_1933 | 204 |
| 991 | 3300046519 | Ga0495632_0133447 | Ga0495632_0133447_433_1047 | 204 |
| 992 | 3300046520 | Ga0495637_0000089 | Ga0495637_0000089_63683_64297 | 204 |
| 993 | 3300046520 | Ga0495637_0001443 | Ga0495637_0001443_4326_4940 | 204 |
| 994 | 3300046520 | Ga0495637_0002811 | Ga0495637_0002811_3860_4474 | 204 |
| 995 | 3300046520 | Ga0495637_0010044 | Ga0495637_0010044_3893_4507 | 204 |
| 996 | 3300046520 | Ga0495637_0016489 | Ga0495637_0016489_113_727 | 204 |
| 997 | 3300046520 | Ga0495637_0020019 | Ga0495637_0020019_66_680 | 204 |
| 998 | 3300046520 | Ga0495637_0033185 | Ga0495637_0033185_701_1315 | 204 |
| 999 | 3300046520 | Ga0495637_0185531 | Ga0495637_0185531_66_680 | 204 |
| 1000 | 3300046522 | Ga0495643_0002208 | Ga0495643_0002208_14661_15275 | 204 |
| 1001 | 3300046522 | Ga0495643_0003299 | Ga0495643_0003299_7439_8053 | 204 |
| 1002 | 3300046522 | Ga0495643_0008354 | Ga0495643_0008354_5717_6331 | 204 |
| 1003 | 3300046522 | Ga0495643_0011217 | Ga0495643_0011217_2398_3012 | 204 |
| 1004 | 3300046522 | Ga0495643_0026753 | Ga0495643_0026753_1968_2582 | 204 |
| 1005 | 3300046522 | Ga0495643_0061631 | Ga0495643_0061631_1285_1899 | 204 |
| 1006 | 3300046522 | Ga0495643_0070710 | Ga0495643_0070710_817_1431 | 204 |
| 1007 | 3300046523 | Ga0495644_0001883 | Ga0495644_0001883_7261_7875 | 204 |
| 1008 | 3300046524 | Ga0495648_0001614 | Ga0495648_0001614_6887_7501 | 204 |
| 1009 | 3300046524 | Ga0495648_0002022 | Ga0495648_0002022_9672_10286 | 204 |
| 1010 | 3300046524 | Ga0495648_0002271 | Ga0495648_0002271_8435_9049 | 204 |
| 1011 | 3300046524 | Ga0495648_0003640 | Ga0495648_0003640_5716_6330 | 204 |
| 1012 | 3300046524 | Ga0495648_0006325 | Ga0495648_0006325_5770_6384 | 204 |
| 1013 | 3300046524 | Ga0495648_0007373 | Ga0495648_0007373_5463_6101 | 204 |
| 1014 | 3300046524 | Ga0495648_0007672 | Ga0495648_0007672_1100_1714 | 204 |
| 1015 | 3300046524 | Ga0495648_0025015 | Ga0495648_0025015_413_1027 | 204 |
| 1016 | 3300046524 | Ga0495648_0052554 | Ga0495648_0052554_173_787 | 204 |
| 1017 | 3300046524 | Ga0495648_0086131 | Ga0495648_0086131_96_710 | 204 |
| 1018 | 3300046524 | Ga0495648_0114050 | Ga0495648_0114050_90_704 | 204 |
| 1019 | 3300046524 | Ga0495648_0257739 | Ga0495648_0257739_67_681 | 204 |
| 1020 | 3300046526 | Ga0495666_0001984 | Ga0495666_0001984_525_1139 | 204 |
| 1021 | 3300046526 | Ga0495666_0022868 | Ga0495666_0022868_154_768 | 204 |
| 1022 | 3300046526 | Ga0495666_0039073 | Ga0495666_0039073_19_633 | 204 |
| 1023 | 3300046528 | Ga0495642_0000033 | Ga0495642_0000033_8915_9529 | 204 |
| 1024 | 3300046528 | Ga0495642_0000086 | Ga0495642_0000086_44171_44785 | 204 |
| 1025 | 3300046530 | Ga0495654_0000111 | Ga0495654_0000111_85427_86065 | 204 |
| 1026 | 3300046530 | Ga0495654_0003325 | Ga0495654_0003325_3315_3929 | 204 |
| 1027 | 3300046530 | Ga0495654_0004462 | Ga0495654_0004462_2275_2889 | 204 |
| 1028 | 3300046530 | Ga0495654_0007333 | Ga0495654_0007333_123_737 | 204 |
| 1029 | 3300046530 | Ga0495654_0007655 | Ga0495654_0007655_2189_2803 | 204 |
| 1030 | 3300046530 | Ga0495654_0010924 | Ga0495654_0010924_3238_3852 | 204 |
| 1031 | 3300046530 | Ga0495654_0011790 | Ga0495654_0011790_1742_2356 | 204 |
| 1032 | 3300046530 | Ga0495654_0018913 | Ga0495654_0018913_2674_3288 | 204 |
| 1033 | 3300046530 | Ga0495654_0031970 | Ga0495654_0031970_172_786 | 204 |
| 1034 | 3300046530 | Ga0495654_0129448 | Ga0495654_0129448_465_1079 | 204 |
| 1035 | 3300046530 | Ga0495654_0157986 | Ga0495654_0157986_30_644 | 204 |
| 1036 | 3300046535 | Ga0495586_0002403 | Ga0495586_0002403_4441_5055 | 204 |
| 1037 | 3300046536 | Ga0495587_0001739 | Ga0495587_0001739_6893_7507 | 204 |
| 1038 | 3300046536 | Ga0495587_0003739 | Ga0495587_0003739_2670_3284 | 204 |
| 1039 | 3300046538 | Ga0495609_0000329 | Ga0495609_0000329_6990_7604 | 204 |
| 1040 | 3300046538 | Ga0495609_0001719 | Ga0495609_0001719_6690_7304 | 204 |
| 1041 | 3300046538 | Ga0495609_0015134 | Ga0495609_0015134_1368_1982 | 204 |
| 1042 | 3300046538 | Ga0495609_0040845 | Ga0495609_0040845_488_1102 | 204 |
| 1043 | 3300046542 | Ga0495597_0001453 | Ga0495597_0001453_6995_7609 | 204 |
| 1044 | 3300046542 | Ga0495597_0003855 | Ga0495597_0003855_6484_7098 | 204 |
| 1045 | 3300046542 | Ga0495597_0011117 | Ga0495597_0011117_725_1339 | 204 |
| 1046 | 3300046542 | Ga0495597_0012258 | Ga0495597_0012258_2463_3077 | 204 |
| 1047 | 3300046542 | Ga0495597_0013089 | Ga0495597_0013089_422_1036 | 204 |
| 1048 | 3300046542 | Ga0495597_0019648 | Ga0495597_0019648_2336_2950 | 204 |
| 1049 | 3300046542 | Ga0495597_0088211 | Ga0495597_0088211_465_1079 | 204 |
| 1050 | 3300046557 | Ga0495622_0000538 | Ga0495622_0000538_13128_13742 | 204 |
| 1051 | 3300046557 | Ga0495622_0000911 | Ga0495622_0000911_8551_9165 | 204 |
| 1052 | 3300046557 | Ga0495622_0027675 | Ga0495622_0027675_1207_1821 | 204 |
| 1053 | 3300046557 | Ga0495622_0042954 | Ga0495622_0042954_1033_1647 | 204 |
| 1054 | 3300046557 | Ga0495622_0068214 | Ga0495622_0068214_689_1306 | 204 |
| 1055 | 3300046558 | Ga0495633_0001679 | Ga0495633_0001679_7103_7717 | 204 |
| 1056 | 3300046558 | Ga0495633_0006318 | Ga0495633_0006318_4167_4781 | 204 |
| 1057 | 3300046558 | Ga0495633_0016429 | Ga0495633_0016429_1771_2385 | 204 |
| 1058 | 3300046558 | Ga0495633_0134234 | Ga0495633_0134234_326_940 | 204 |
| 1059 | 3300046616 | Ga0495668_0000814 | Ga0495668_0000814_28227_28841 | 204 |
| 1060 | 3300046616 | Ga0495668_0001572 | Ga0495668_0001572_7004_7618 | 204 |
| 1061 | 3300046616 | Ga0495668_0012939 | Ga0495668_0012939_2082_2696 | 204 |
| 1062 | 3300046642 | Ga0495634_0062265 | Ga0495634_0062265_858_1472 | 204 |
| 1063 | 3300046648 | Ga0495611_0000107 | Ga0495611_0000107_50387_51001 | 204 |
| 1064 | 3300046648 | Ga0495611_0014337 | Ga0495611_0014337_1609_2223 | 204 |
| 1065 | 3300046660 | Ga0495625_0001089 | Ga0495625_0001089_27504_28142 | 204 |
| 1066 | 3300046660 | Ga0495625_0001350 | Ga0495625_0001350_1023_1637 | 204 |
| 1067 | 3300046660 | Ga0495625_0003934 | Ga0495625_0003934_4621_5235 | 204 |
| 1068 | 3300046660 | Ga0495625_0003974 | Ga0495625_0003974_12111_12725 | 204 |
| 1069 | 3300046660 | Ga0495625_0014514 | Ga0495625_0014514_4552_5166 | 204 |
| 1070 | 3300046660 | Ga0495625_0533201 | Ga0495625_0533201_34_648 | 204 |
| 1071 | 3300046660 | Ga0495625_0551019 | Ga0495625_0551019_29_643 | 204 |
| 1072 | 3300046663 | Ga0495635_0008476 | Ga0495635_0008476_613_1227 | 204 |
| 1073 | 3300046663 | Ga0495635_0021942 | Ga0495635_0021942_3332_3946 | 204 |
| 1074 | 3300046664 | Ga0495659_0009818 | Ga0495659_0009818_1323_1937 | 204 |
| 1075 | 3300046665 | Ga0495661_0013508 | Ga0495661_0013508_4090_4704 | 204 |
| 1076 | 3300046665 | Ga0495661_0014483 | Ga0495661_0014483_2986_3600 | 204 |
| 1077 | 3300046665 | Ga0495661_0046274 | Ga0495661_0046274_1301_1915 | 204 |
| 1078 | 3300046665 | Ga0495661_0070924 | Ga0495661_0070924_1392_2006 | 204 |
| 1079 | 3300046665 | Ga0495661_0123709 | Ga0495661_0123709_335_949 | 204 |
| 1080 | 3300046674 | Ga0495588_0003508 | Ga0495588_0003508_241_855 | 204 |
| 1081 | 3300046674 | Ga0495588_0008803 | Ga0495588_0008803_3234_3848 | 204 |
| 1082 | 3300046674 | Ga0495588_0277440 | Ga0495588_0277440_181_795 | 204 |
| 1083 | 3300046679 | Ga0495623_0001644 | Ga0495623_0001644_13127_13741 | 204 |
| 1084 | 3300046680 | Ga0495646_0003217 | Ga0495646_0003217_4158_4772 | 204 |
| 1085 | 3300046684 | Ga0495669_0002058 | Ga0495669_0002058_3672_4286 | 204 |
| 1086 | 3300046689 | Ga0495613_0006146 | Ga0495613_0006146_7052_7666 | 204 |
| 1087 | 3300046689 | Ga0495613_0040121 | Ga0495613_0040121_2087_2701 | 204 |
| 1088 | 3300046690 | Ga0495624_0000637 | Ga0495624_0000637_19934_20548 | 204 |
| 1089 | 3300046690 | Ga0495624_0057096 | Ga0495624_0057096_1415_2029 | 204 |
| 1090 | 3300046691 | Ga0495670_0000105 | Ga0495670_0000105_29776_30390 | 204 |
| 1091 | 3300046691 | Ga0495670_0001677 | Ga0495670_0001677_10183_10797 | 204 |
| 1092 | 3300046691 | Ga0495670_0001702 | Ga0495670_0001702_8958_9572 | 204 |
| 1093 | 3300046691 | Ga0495670_0002656 | Ga0495670_0002656_1209_1823 | 204 |
| 1094 | 3300046691 | Ga0495670_0046903 | Ga0495670_0046903_458_1072 | 204 |
| 1095 | 3300046692 | Ga0495671_0001925 | Ga0495671_0001925_4251_4889 | 204 |
| 1096 | 3300046692 | Ga0495671_0003981 | Ga0495671_0003981_1320_1934 | 204 |
| 1097 | 3300046692 | Ga0495671_0004211 | Ga0495671_0004211_2247_2861 | 204 |
| 1098 | 3300046692 | Ga0495671_0012446 | Ga0495671_0012446_3750_4364 | 204 |
| 1099 | 3300046692 | Ga0495671_0016959 | Ga0495671_0016959_3144_3758 | 204 |
| 1100 | 3300046692 | Ga0495671_0035561 | Ga0495671_0035561_1256_1870 | 204 |
| 1101 | 3300046692 | Ga0495671_0047522 | Ga0495671_0047522_999_1613 | 204 |
| 1102 | 3300046692 | Ga0495671_0057448 | Ga0495671_0057448_888_1502 | 204 |
| 1103 | 3300046692 | Ga0495671_0263208 | Ga0495671_0263208_65_679 | 204 |
| 1104 | 3300046694 | Ga0495649_0003035 | Ga0495649_0003035_2012_2626 | 204 |
| 1105 | 3300046694 | Ga0495649_0003965 | Ga0495649_0003965_2135_2773 | 204 |
| 1106 | 3300046694 | Ga0495649_0005030 | Ga0495649_0005030_4366_4980 | 204 |
| 1107 | 3300046694 | Ga0495649_0009234 | Ga0495649_0009234_4572_5186 | 204 |
| 1108 | 3300046694 | Ga0495649_0013087 | Ga0495649_0013087_1442_2056 | 204 |
| 1109 | 3300046694 | Ga0495649_0037104 | Ga0495649_0037104_659_1273 | 204 |
| 1110 | 3300046694 | Ga0495649_0119919 | Ga0495649_0119919_33_647 | 204 |
| 1111 | 3300046694 | Ga0495649_0154255 | Ga0495649_0154255_81_695 | 204 |
| 1112 | 3300046694 | Ga0495649_0176877 | Ga0495649_0176877_468_1082 | 204 |
| 1113 | 3300046694 | Ga0495649_0283316 | Ga0495649_0283316_33_647 | 204 |
| 1114 | 3300046794 | Ga0495589_0000278 | Ga0495589_0000278_7014_7628 | 204 |
| 1115 | 3300046794 | Ga0495589_0017355 | Ga0495589_0017355_271_885 | 204 |
| 1116 | 3300046794 | Ga0495589_0036664 | Ga0495589_0036664_1307_1921 | 204 |
| 1117 | 3300046809 | Ga0495600_0022484 | Ga0495600_0022484_2905_3519 | 204 |
| 1118 | 3300046810 | Ga0495660_0000998 | Ga0495660_0000998_6890_7504 | 204 |
| 1119 | 3300046810 | Ga0495660_0001470 | Ga0495660_0001470_6865_7503 | 204 |
| 1120 | 3300046810 | Ga0495660_0001702 | Ga0495660_0001702_14017_14631 | 204 |
| 1121 | 3300046810 | Ga0495660_0003030 | Ga0495660_0003030_3231_3845 | 204 |
| 1122 | 3300046810 | Ga0495660_0008214 | Ga0495660_0008214_1788_2402 | 204 |
| 1123 | 3300046810 | Ga0495660_0012232 | Ga0495660_0012232_2949_3563 | 204 |
| 1124 | 3300046810 | Ga0495660_0013937 | Ga0495660_0013937_2804_3418 | 204 |
| 1125 | 3300046810 | Ga0495660_0026415 | Ga0495660_0026415_843_1457 | 204 |
| 1126 | 3300046810 | Ga0495660_0065117 | Ga0495660_0065117_115_729 | 204 |
| 1127 | 3300046810 | Ga0495660_0079872 | Ga0495660_0079872_1048_1662 | 204 |
| 1128 | 3300047315 | Ga0495581_0013609 | Ga0495581_0013609_2447_3061 | 204 |
| 1129 | 3300047317 | Ga0495604_0002977 | Ga0495604_0002977_3903_4517 | 204 |
| 1130 | 3300047317 | Ga0495604_0019743 | Ga0495604_0019743_717_1331 | 204 |
| 1131 | 3300047317 | Ga0495604_0031966 | Ga0495604_0031966_2771_3385 | 204 |
| 1132 | 3300047320 | Ga0495672_0000672 | Ga0495672_0000672_30443_31057 | 204 |
| 1133 | 3300047320 | Ga0495672_0003274 | Ga0495672_0003274_6166_6780 | 204 |
| 1134 | 3300047320 | Ga0495672_0009799 | Ga0495672_0009799_4546_5160 | 204 |
| 1135 | 3300047320 | Ga0495672_0017776 | Ga0495672_0017776_2558_3172 | 204 |
| 1136 | 3300047320 | Ga0495672_0046378 | Ga0495672_0046378_414_1028 | 204 |
| 1137 | 3300047320 | Ga0495672_0065471 | Ga0495672_0065471_1374_1988 | 204 |
| 1138 | 3300047320 | Ga0495672_0140929 | Ga0495672_0140929_90_704 | 204 |
| 1139 | 3300047320 | Ga0495672_0225265 | Ga0495672_0225265_118_732 | 204 |
| 1140 | 3300047321 | Ga0495676_0000286 | Ga0495676_0000286_33243_33857 | 204 |
| 1141 | 3300047321 | Ga0495676_0096988 | Ga0495676_0096988_1185_1799 | 204 |
| 1142 | 3300047322 | Ga0495680_0003972 | Ga0495680_0003972_4846_5460 | 204 |
| 1143 | 3300047322 | Ga0495680_0007080 | Ga0495680_0007080_6875_7489 | 204 |
| 1144 | 3300047322 | Ga0495680_0010401 | Ga0495680_0010401_4201_4815 | 204 |
| 1145 | 3300047322 | Ga0495680_0408872 | Ga0495680_0408872_259_873 | 204 |
| 1146 | 3300047323 | Ga0495683_0000085 | Ga0495683_0000085_8886_9500 | 204 |
| 1147 | 3300047323 | Ga0495683_0000270 | Ga0495683_0000270_40255_40869 | 204 |
| 1148 | 3300047323 | Ga0495683_0009634 | Ga0495683_0009634_4212_4826 | 204 |
| 1149 | 3300047323 | Ga0495683_0011491 | Ga0495683_0011491_1698_2312 | 204 |
| 1150 | 3300047443 | Ga0495687_000375 | Ga0495687_000375_46230_46844 | 204 |
| 1151 | 3300047443 | Ga0495687_009480 | Ga0495687_009480_4421_5035 | 204 |
| 1152 | 3300047444 | Ga0495675_0023229 | Ga0495675_0023229_1916_2530 | 204 |
| 1153 | 3300047444 | Ga0495675_0102852 | Ga0495675_0102852_236_850 | 204 |
| 1154 | 3300047446 | Ga0495679_000689 | Ga0495679_000689_336_974 | 204 |
| 1155 | 3300047446 | Ga0495679_006729 | Ga0495679_006729_2782_3396 | 204 |
| 1156 | 3300047446 | Ga0495679_010665 | Ga0495679_010665_2704_3318 | 204 |
| 1157 | 3300047469 | Ga0495673_0000297 | Ga0495673_0000297_58936_59550 | 204 |
| 1158 | 3300047469 | Ga0495673_0000537 | Ga0495673_0000537_31655_32293 | 204 |
| 1159 | 3300047469 | Ga0495673_0000628 | Ga0495673_0000628_9104_9718 | 204 |
| 1160 | 3300047469 | Ga0495673_0002220 | Ga0495673_0002220_7918_8532 | 204 |
| 1161 | 3300047469 | Ga0495673_0002230 | Ga0495673_0002230_6629_7243 | 204 |
| 1162 | 3300047469 | Ga0495673_0009831 | Ga0495673_0009831_1063_1677 | 204 |
| 1163 | 3300047469 | Ga0495673_0015998 | Ga0495673_0015998_3003_3617 | 204 |
| 1164 | 3300047469 | Ga0495673_0051299 | Ga0495673_0051299_1093_1707 | 204 |
| 1165 | 3300047469 | Ga0495673_0059258 | Ga0495673_0059258_35_649 | 204 |
| 1166 | 3300047469 | Ga0495673_0095150 | Ga0495673_0095150_467_1081 | 204 |
| 1167 | 3300047470 | Ga0495681_0000448 | Ga0495681_0000448_8786_9400 | 204 |
| 1168 | 3300047470 | Ga0495681_0000856 | Ga0495681_0000856_15897_16511 | 204 |
| 1169 | 3300047470 | Ga0495681_0002022 | Ga0495681_0002022_795_1409 | 204 |
| 1170 | 3300047470 | Ga0495681_0002233 | Ga0495681_0002233_6597_7211 | 204 |
| 1171 | 3300047470 | Ga0495681_0002398 | Ga0495681_0002398_241_855 | 204 |
| 1172 | 3300047470 | Ga0495681_0002965 | Ga0495681_0002965_4236_4850 | 204 |
| 1173 | 3300047470 | Ga0495681_0003914 | Ga0495681_0003914_2802_3416 | 204 |
| 1174 | 3300047470 | Ga0495681_0004992 | Ga0495681_0004992_1358_1972 | 204 |
| 1175 | 3300047470 | Ga0495681_0012491 | Ga0495681_0012491_2262_2876 | 204 |
| 1176 | 3300047470 | Ga0495681_0015669 | Ga0495681_0015669_2935_3549 | 204 |
| 1177 | 3300047470 | Ga0495681_0020296 | Ga0495681_0020296_2755_3369 | 204 |
| 1178 | 3300047470 | Ga0495681_0032455 | Ga0495681_0032455_650_1264 | 204 |
| 1179 | 3300047471 | Ga0495684_0231387 | Ga0495684_0231387_718_1332 | 204 |
| 1180 | 3300047472 | Ga0495686_0005722 | Ga0495686_0005722_144_758 | 204 |
| 1181 | 3300047472 | Ga0495686_0017829 | Ga0495686_0017829_2540_3154 | 204 |
| 1182 | 3300047472 | Ga0495686_0059930 | Ga0495686_0059930_620_1234 | 204 |
| 1183 | 3300047472 | Ga0495686_0104466 | Ga0495686_0104466_451_1065 | 204 |
| 1184 | 3300047472 | Ga0495686_0108175 | Ga0495686_0108175_504_1118 | 204 |
| 1185 | 3300047673 | Ga0495593_0008535 | Ga0495593_0008535_3148_3762 | 204 |
| 1186 | 3300047673 | Ga0495593_0014594 | Ga0495593_0014594_433_1047 | 204 |
| 1187 | 3300047673 | Ga0495593_0025676 | Ga0495593_0025676_1473_2087 | 204 |
| 1188 | 3300048088 | Ga0495602_0030341 | Ga0495602_0030341_634_1248 | 204 |
| 1189 | 3300048091 | Ga0495626_0000324 | Ga0495626_0000324_42853_43467 | 204 |
| 1190 | 3300048091 | Ga0495626_0000420 | Ga0495626_0000420_9124_9738 | 204 |
| 1191 | 3300048091 | Ga0495626_0000679 | Ga0495626_0000679_6913_7551 | 204 |
| 1192 | 3300048091 | Ga0495626_0002781 | Ga0495626_0002781_9002_9616 | 204 |
| 1193 | 3300048091 | Ga0495626_0021703 | Ga0495626_0021703_2540_3154 | 204 |
| 1194 | 3300048091 | Ga0495626_0040258 | Ga0495626_0040258_1341_1955 | 204 |
| 1195 | 3300048091 | Ga0495626_0094540 | Ga0495626_0094540_219_833 | 204 |
| 1196 | 3300048909 | Ga0496106_0285170 | Ga0496106_0285170_623_1258 | 204 |
| 1197 | 3300048913 | Ga0496110_0231549 | Ga0496110_0231549_514_1128 | 204 |
| 1198 | 3300048915 | Ga0496112_0109911 | Ga0496112_0109911_212_826 | 204 |
| 1199 | 3300048917 | Ga0496114_0077268 | Ga0496114_0077268_2051_2677 | 204 |
| 1200 | 3300048919 | Ga0496116_0000168 | Ga0496116_0000168_7010_7624 | 204 |
| 1201 | 3300048919 | Ga0496116_0000869 | Ga0496116_0000869_7068_7682 | 204 |
| 1202 | 3300048919 | Ga0496116_0007948 | Ga0496116_0007948_7099_7713 | 204 |
| 1203 | 3300048919 | Ga0496116_0008311 | Ga0496116_0008311_1304_1939 | 204 |
| 1204 | 3300048920 | Ga0496117_0002072 | Ga0496117_0002072_18917_19531 | 204 |
| 1205 | 3300048920 | Ga0496117_0005260 | Ga0496117_0005260_1983_2612 | 204 |
| 1206 | 3300048920 | Ga0496117_0007492 | Ga0496117_0007492_2918_3532 | 204 |
| 1207 | 3300048920 | Ga0496117_0033297 | Ga0496117_0033297_919_1533 | 204 |
| 1208 | 3300048920 | Ga0496117_0143808 | Ga0496117_0143808_210_845 | 204 |
| 1209 | 3300048921 | Ga0496118_0008366 | Ga0496118_0008366_7105_7719 | 204 |
| 1210 | 3300048921 | Ga0496118_0017735 | Ga0496118_0017735_4337_4972 | 204 |
| 1211 | 3300048921 | Ga0496118_0040580 | Ga0496118_0040580_868_1482 | 204 |
| 1212 | 3300048921 | Ga0496118_0051411 | Ga0496118_0051411_557_1186 | 204 |
| 1213 | 3300048922 | Ga0496119_0025249 | Ga0496119_0025249_1336_1971 | 204 |
| 1214 | 3300048924 | Ga0496121_0000199 | Ga0496121_0000199_124989_125603 | 204 |
| 1215 | 3300048924 | Ga0496121_0013203 | Ga0496121_0013203_1324_1959 | 204 |
| 1216 | 3300048924 | Ga0496121_0166251 | Ga0496121_0166251_661_1275 | 204 |
| 1217 | 3300048925 | Ga0496122_0003462 | Ga0496122_0003462_7051_7665 | 204 |
| 1218 | 3300048925 | Ga0496122_0032233 | Ga0496122_0032233_2991_3605 | 204 |
| 1219 | 3300048926 | Ga0496123_0006867 | Ga0496123_0006867_3226_3840 | 204 |
| 1220 | 3300048926 | Ga0496123_0009973 | Ga0496123_0009973_4924_5538 | 204 |
| 1221 | 3300048926 | Ga0496123_0023832 | Ga0496123_0023832_3459_4094 | 204 |
| 1222 | 3300048927 | Ga0496124_0016579 | Ga0496124_0016579_1258_1872 | 204 |
| 1223 | 3300048927 | Ga0496124_0017941 | Ga0496124_0017941_1938_2558 | 204 |
| 1224 | 3300048927 | Ga0496124_0068180 | Ga0496124_0068180_2261_2875 | 204 |
| 1225 | 3300048927 | Ga0496124_0178626 | Ga0496124_0178626_19_633 | 204 |
| 1226 | 3300048927 | Ga0496124_0355513 | Ga0496124_0355513_29_664 | 204 |
| 1227 | 3300048928 | Ga0496125_0014915 | Ga0496125_0014915_1342_1956 | 204 |
| 1228 | 3300049459 | Ga0495678_000309 | Ga0495678_000309_50363_50977 | 204 |
| 1229 | 3300049459 | Ga0495678_000573 | Ga0495678_000573_6913_7551 | 204 |
| 1230 | 3300049459 | Ga0495678_004351 | Ga0495678_004351_5489_6103 | 204 |
| 1231 | 3300049459 | Ga0495678_004855 | Ga0495678_004855_3060_3674 | 204 |
| 1232 | 3300049459 | Ga0495678_014755 | Ga0495678_014755_208_822 | 204 |
| 1233 | 3300049459 | Ga0495678_014771 | Ga0495678_014771_93_707 | 204 |
| 1234 | 3300049459 | Ga0495678_018439 | Ga0495678_018439_618_1232 | 204 |
| 1235 | 3300049459 | Ga0495678_033073 | Ga0495678_033073_1329_1943 | 204 |
| 1236 | 3300049459 | Ga0495678_034781 | Ga0495678_034781_1439_2053 | 204 |
| 1237 | 3300049459 | Ga0495678_078501 | Ga0495678_078501_557_1171 | 204 |
| 1238 | 3300049460 | Ga0495682_0002232 | Ga0495682_0002232_7020_7634 | 204 |
| 1239 | 3300049758 | Ga0501241_000265 | Ga0501241_000265_9625_10239 | 204 |
| 1240 | 3300049758 | Ga0501241_016342 | Ga0501241_016342_322_936 | 204 |
| 1241 | 3300049853 | Ga0501226_000854 | Ga0501226_000854_881_1495 | 204 |
| 1242 | 3300050489 | nmdc:mga03683_56220_c1 | nmdc:mga03683_56220_c1_550_1164 | 204 |
| 1243 | 3300050491 | nmdc:mga00v17_32906_c1 | nmdc:mga00v17_32906_c1_2382_2996 | 204 |
| 1244 | 3300050491 | nmdc:mga00v17_394140_c1 | nmdc:mga00v17_394140_c1_111_725 | 204 |
| 1245 | 3300050514 | nmdc:mga08x19_199240_c1 | nmdc:mga08x19_199240_c1_411_1025 | 204 |
| 1246 | 3300053111 | Ga0500572_000566 | Ga0500572_000566_7043_7657 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.5048 | 1 | 191 |
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.4787 | 1 | 191 |
| 6ob6-assembly2.cif.gz_B | human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned | 0.4334 | 7 | 200 |
| 7l17-assembly1.cif.gz_A | crystal structure of sugar-bound melibiose permease melb | 0.4037 | 2 | 204 |
| 7l17-assembly1.cif.gz_A | crystal structure of sugar-bound melibiose permease melb | 0.3997 | 2 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.531 | 10 | 194 | 1.20.1250.20 |
| af_P76264_30_182_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5279 | 38 | 193 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5207 | 10 | 194 | 1.20.1250.20 |
| af_C6TIG3_1_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5184 | 1 | 202 | 1.20.1250.20 |
| af_C6TIG3_1_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5122 | 1 | 202 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U1SQ08-F1-model_v4 | Membrane protein | 0.9789 | 1 | 197 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A3S3N8D3-F1-model_v4 | LysE family translocator | 0.9772 | 4 | 199 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A7W6BR73-F1-model_v4 | Threonine/homoserine/homoserine lactone efflux protein | 0.9761 | 4 | 199 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A5E4TR75-F1-model_v4 | Cysteine/O-acetylserine efflux protein | 0.9759 | 3 | 200 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A316EXY4-F1-model_v4 | Threonine/homoserine/homoserine lactone efflux protein | 0.9748 | 6 | 199 |
GO:0005886
GO:0015171 GO:0033228 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar