F492135

General Info

Members Datasets Scaffolds Average Seq Length
1246 543 1018 203

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000031|Ga0105251_1000003124
Length 230
Sequence VKVSFTVHVFCAVLSIAWQVENQNIPWTCIMLTADLLLAFILFAFVSSITPGPNNTMLLSSGVNFGFNRTIPHMLGISCGFALMVLAVGFGLGAVFKAYPVLYTILRYAGAAYLLYLAYKIATSGPAKDSDVSKGKPMSYLGAAAFQWVNPKAWVMAVGAISTYTPMNGYFTNVAVIALVFGVVNLPAVSMWAGFGSLLRNVLRDPLWLRVFNGVMAALLVLSLYPLLEH

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231024 Pseudomonas sp. GM84 Isolate Nodule
16 2511231031 Pseudomonas sp. GM16 Isolate Nodule
17 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
18 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
19 2519103095 Burkholderia sp. KJ006 Isolate Nodule
20 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
21 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
22 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
23 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
24 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
25 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
26 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
27 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
28 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
29 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
30 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
31 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
32 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
33 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
34 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
35 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
36 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
37 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
38 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
39 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
40 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
41 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
42 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
43 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
44 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
45 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
48 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
49 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
50 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
51 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
52 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
53 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
54 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
55 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
56 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
57 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
58 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
59 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
60 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
61 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
62 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
63 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
64 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
65 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
66 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
67 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
68 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
69 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
70 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
71 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
72 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
73 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
74 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
75 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
76 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
77 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
78 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
79 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
80 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
81 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
82 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
83 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
84 2643221558 Rhizobium sp. Root149 Isolate Unclassified
85 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
86 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
87 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
88 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
89 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
90 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
91 2643221736 Bosea sp. Root483D1 Isolate Unclassified
92 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
93 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
94 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
95 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
96 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
97 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
98 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
99 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
100 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
101 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
102 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
103 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
104 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
105 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
106 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
107 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
108 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
109 2765235841 Pseudomonas putida AA7 Isolate Unclassified
110 2773857670 Pseudomonas sp. 478 Isolate Unclassified
111 2773857673 Pseudomonas sp. 443 Isolate Unclassified
112 2784132063 Pseudomonas sp. 424 Isolate Unclassified
113 2784132072 Pseudomonas sp. 460 Isolate Unclassified
114 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
115 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
116 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
117 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
118 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
119 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
120 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
121 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
122 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
123 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
124 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
125 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
126 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
127 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
128 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
129 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
130 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
131 2818991452 Burkholderia cepacia 561 Isolate Unclassified
132 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
133 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
134 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
135 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
136 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
137 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
138 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
139 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
140 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
141 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
142 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
143 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
144 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
145 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
146 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
147 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
148 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
149 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
150 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
151 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
152 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
153 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
154 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
155 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
156 2904564687 Burkholderia sp. 571 Isolate Unclassified
157 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
158 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
159 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
160 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
161 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
162 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
163 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
164 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
165 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
166 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
167 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
168 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
169 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
170 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
171 2928163908 Burkholderia sp. 567 Isolate Unclassified
172 2928170801 Burkholderia sp. 572 Isolate Unclassified
173 2928536128 Burkholderia sola 565 Isolate Unclassified
174 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
175 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
176 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
177 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
178 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
179 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
180 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
181 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
182 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
183 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
184 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
185 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
186 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
187 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
188 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
189 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
190 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
191 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
192 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
193 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
194 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
195 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
196 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
197 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
198 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
199 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
200 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
201 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
202 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
203 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
204 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
205 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
206 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
207 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
208 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
209 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
210 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
211 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
212 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
213 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
214 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
215 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
216 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
217 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
218 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
219 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
220 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
221 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
222 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
223 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
224 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
225 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
226 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
227 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
228 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
229 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
230 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
231 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
232 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
233 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
234 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
235 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
236 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
237 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
238 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
239 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
240 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
243 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
244 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
245 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
246 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
247 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
248 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
249 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
250 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
251 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
252 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
253 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
254 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
255 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
256 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
257 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
258 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
259 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
260 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
261 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
262 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
263 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
264 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
265 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
266 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
267 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
268 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
276 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
277 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
279 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
314 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
317 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
318 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
320 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
321 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
322 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
323 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
324 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
325 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
326 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
327 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
328 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
329 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
330 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
331 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
332 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
333 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
334 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
335 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
336 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
340 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
341 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
342 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
343 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
344 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
345 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
346 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
347 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
348 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
349 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
350 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
351 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
352 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
353 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
354 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
355 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
356 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
357 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
358 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
359 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
360 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
361 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
362 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
363 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
364 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
365 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
366 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
367 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
368 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
369 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
370 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
371 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
372 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
373 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
374 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
375 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
376 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
377 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
378 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
379 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
380 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
381 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
382 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
383 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
384 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
385 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
386 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
387 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
388 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
389 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
390 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
391 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
392 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
393 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
394 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
395 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
398 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
399 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
400 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
401 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
402 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
403 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
404 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
405 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
406 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
407 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
408 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
409 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
410 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
411 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
412 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
413 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
414 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
415 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
416 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
417 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
418 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
419 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
420 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
421 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
422 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
423 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
424 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
425 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
426 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
427 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
428 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
429 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
430 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
431 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
432 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
433 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
434 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
435 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
436 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
437 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
438 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
439 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
440 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
441 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
442 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
443 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
444 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
445 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
446 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
447 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
448 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
449 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
450 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
451 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
452 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
453 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
454 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
455 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
456 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
457 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
458 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
459 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
460 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
461 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
462 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
463 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
464 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
465 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
466 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
467 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
468 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
469 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
470 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
471 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
472 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
473 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
474 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
475 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
476 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
477 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
478 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
482 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
491 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
494 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
497 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
498 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
499 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
500 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
501 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
502 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
503 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
504 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
505 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
506 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
507 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
508 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
509 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
510 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
511 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
512 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
513 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
514 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
515 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
516 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
517 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
518 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
519 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
520 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
521 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
522 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
523 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
524 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
525 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
526 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
527 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
528 8052494512 Pseudomonas putida LD6 Isolate Unclassified
529 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
530 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
531 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
532 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
533 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
534 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
535 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
536 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
537 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
538 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
539 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
540 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
541 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
542 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
543 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.7
Metatranscriptomes 0
Isolates 18.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 2.09
Rhizoplane 6.66
Rhizosphere 69.98
Stem 0
Stem Tuber 0
Unclassified 12.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_45 2124908027 Bacteria 78063
2 SwRhRL2b_contig_1587916 2162886007 Bacteria 1173
3 SwRhRL2b_contig_2309387 2162886007 Bacteria 1123
4 SwRhRL2b_contig_456895 2162886007 Bacteria 8526
5 JGI24739J22299_10001779 3300001989 Bacteria 8204
6 JGI24739J22299_10013520 3300001989 Bacteria 2979
7 JGI25162J39368_1000166 3300002737 Bacteria 72515
8 JGI25154J39366_1001189 3300002738 Bacteria 9928
9 JGI25163J39215_1000186 3300002771 Bacteria 24033
10 JGI25163J39215_1000638 3300002771 Bacteria 9499
11 JGI25164J39214_1000129 3300002772 Bacteria 72515
12 JGI25164J39214_1000415 3300002772 Bacteria 24254
13 JGI25165J46597_1000251 3300003214 Bacteria 72515
14 JGI25165J46597_1000756 3300003214 Bacteria 24824
15 rootH2_10030798 3300003320 Bacteria 12993
16 rootH2_10232438 3300003320 Bacteria 4415
17 Ga0055538_1000007 3300003751 Bacteria 399715
18 Ga0055539_1000011 3300003752 Bacteria 399747
19 Ga0055533_1000014 3300003756 Bacteria 399747
20 Ga0055532_1000009 3300003758 Bacteria 399537
21 Ga0055532_1000262 3300003758 Bacteria 35319
22 Ga0055532_1000320 3300003758 Bacteria 27644
23 Ga0055532_1002026 3300003758 Bacteria 4651
24 Ga0055525_1000016 3300003759 Bacteria 399724
25 Ga0055527_1000280 3300003760 Bacteria 30042
26 Ga0055527_1006864 3300003760 Bacteria 1411
27 Ga0055535_1000591 3300003761 Bacteria 30042
28 Ga0055535_1002021 3300003761 Bacteria 8279
29 Ga0055535_1008009 3300003761 Bacteria 1951
30 Ga0055542_1001740 3300003762 Bacteria 9278
31 Ga0055542_1002922 3300003762 Bacteria 5036
32 Ga0055529_1000978 3300003763 Bacteria 14276
33 Ga0055536_1000165 3300003781 Bacteria 56046
34 Ga0055536_1000268 3300003781 Bacteria 40054
35 Ga0055536_1009023 3300003781 Bacteria 4195
36 Ga0055536_1032350 3300003781 Bacteria 1353
37 Ga0055536_1068912 3300003781 Bacteria 705
38 Ga0055528_1003527 3300003790 Bacteria 7809
39 Ga0055530_10000259 3300003791 Bacteria 47742
40 Ga0055530_10000357 3300003791 Bacteria 41227
41 Ga0055530_10000450 3300003791 Bacteria 36555
42 Ga0055530_10008590 3300003791 Bacteria 4060
43 Ga0055540_1000105 3300003792 Bacteria 93593
44 Ga0055540_1000386 3300003792 Bacteria 36555
45 Ga0055540_1001210 3300003792 Bacteria 15871
46 Ga0055531_10000081 3300003794 Bacteria 103600
47 Ga0055541_1000008 3300003841 Bacteria 399724
48 Ga0055541_1014359 3300003841 Bacteria 1079
49 Ga0058692_1004472 3300003856 Bacteria 4138
50 Ga0058692_1021800 3300003856 Bacteria 1326
51 Ga0065714_10002494 3300005288 Bacteria 17407
52 Ga0065714_10002507 3300005288 Bacteria 15532
53 Ga0065714_10006419 3300005288 Bacteria 7218
54 Ga0065714_10023978 3300005288 Bacteria 1783
55 Ga0065714_10064719 3300005288 Bacteria 21761
56 Ga0065704_10072002 3300005289 Bacteria 9406
57 Ga0065704_10124139 3300005289 Bacteria 1722
58 Ga0065704_10263780 3300005289 Bacteria 959
59 Ga0065712_10001825 3300005290 Bacteria 5223
60 Ga0070658_10182062 3300005327 Bacteria 1768
61 Ga0070670_100000137 3300005331 Bacteria 68542
62 Ga0070666_10012704 3300005335 Bacteria 5321
63 Ga0070660_100000159 3300005339 Bacteria 43943
64 Ga0070661_100000749 3300005344 Bacteria 23450
65 Ga0070669_100013166 3300005353 Bacteria 5879
66 Ga0070659_100000223 3300005366 Bacteria 44089
67 Ga0070714_100725549 3300005435 Bacteria 960
68 Ga0070663_100001049 3300005455 Bacteria 15125
69 Ga0070664_100000861 3300005564 Bacteria 23450
70 Ga0068857_100412432 3300005577 Bacteria 1258
71 Ga0068852_100138430 3300005616 Bacteria 2250
72 Ga0068858_100062991 3300005842 Bacteria 3430
73 Ga0075364_10044785 3300006051 Bacteria 2879
74 Ga0075364_10460751 3300006051 Bacteria 869
75 Ga0075432_10001522 3300006058 Bacteria 7590
76 Ga0075432_10001643 3300006058 Bacteria 7361
77 Ga0075432_10008650 3300006058 Bacteria 3474
78 Ga0075432_10014180 3300006058 Bacteria 2714
79 Ga0075432_10047007 3300006058 Bacteria 1516
80 Ga0075432_10124702 3300006058 Bacteria 970
81 Ga0075432_10164104 3300006058 Bacteria 860
82 Ga0075432_10246428 3300006058 Bacteria 723
83 Ga0075369_10058202 3300006186 Bacteria 1683
84 Ga0099823_1000029 3300006944 Bacteria 69209
85 Ga0079104_1000094 3300006946 Bacteria 130202
86 Ga0079104_1000124 3300006946 Bacteria 110752
87 Ga0079104_1060811 3300006946 Bacteria 814
88 Ga0099826_10003718 3300006948 Bacteria 10473
89 Ga0105251_10000031 3300009011 Bacteria 124114
90 Ga0105251_10010585 3300009011 Bacteria 5337
91 Ga0105251_10032399 3300009011 Bacteria 2605
92 Ga0105251_10066882 3300009011 Bacteria 1679
93 Ga0105251_10122725 3300009011 Bacteria 1179
94 Ga0105244_10000738 3300009036 Bacteria 27985
95 Ga0105244_10000796 3300009036 Bacteria 26866
96 Ga0105244_10015652 3300009036 Bacteria 4344
97 Ga0105244_10015736 3300009036 Bacteria 4331
98 Ga0105244_10018334 3300009036 Bacteria 3928
99 Ga0105244_10031584 3300009036 Bacteria 2809
100 Ga0105244_10036257 3300009036 Bacteria 2584
101 Ga0105244_10039504 3300009036 Bacteria 2456
102 Ga0105244_10042678 3300009036 Bacteria 2343
103 Ga0105244_10043152 3300009036 Bacteria 2328
104 Ga0105244_10082108 3300009036 Bacteria 1594
105 Ga0105244_10102611 3300009036 Bacteria 1398
106 Ga0105250_10000560 3300009092 Bacteria 25085
107 Ga0105250_10000898 3300009092 Bacteria 17524
108 Ga0105250_10010202 3300009092 Bacteria 3920
109 Ga0105250_10013636 3300009092 Bacteria 3348
110 Ga0105250_10188130 3300009092 Bacteria 868
111 Ga0105250_10306551 3300009092 Bacteria 688
112 Ga0105240_10001196 3300009093 Bacteria 45244
113 Ga0105240_10003837 3300009093 Bacteria 23242
114 Ga0105240_10042007 3300009093 Bacteria 5829
115 Ga0105243_10000103 3300009148 Bacteria 97091
116 Ga0105243_10000125 3300009148 Bacteria 86522
117 Ga0105243_10020104 3300009148 Bacteria 5062
118 Ga0105243_10212345 3300009148 Bacteria 1705
119 Ga0105243_10214397 3300009148 Bacteria 1697
120 Ga0105242_10016730 3300009176 Bacteria 5705
121 Ga0105237_10004461 3300009545 Bacteria 16177
122 Ga0105237_10065380 3300009545 Bacteria 3633
123 Ga0105238_10117875 3300009551 Bacteria 2635
124 Ga0105238_10154380 3300009551 Bacteria 2270
125 Ga0105246_10000357 3300011119 Bacteria 24630
126 Ga0105246_10023370 3300011119 Bacteria 3999
127 Ga0157345_1000009 3300012498 Bacteria 55332
128 Ga0157345_1000928 3300012498 Bacteria 2175
129 Ga0157373_10000151 3300013100 Bacteria 55916
130 Ga0157373_10000225 3300013100 Bacteria 46142
131 Ga0157373_10006005 3300013100 Bacteria 9083
132 Ga0157373_10017933 3300013100 Bacteria 5154
133 Ga0157373_10020435 3300013100 Bacteria 4812
134 Ga0157373_10046441 3300013100 Bacteria 3099
135 Ga0157373_10072424 3300013100 Bacteria 2432
136 Ga0157373_10269277 3300013100 Bacteria 1206
137 Ga0157373_10365300 3300013100 Bacteria 1031
138 Ga0157373_10549411 3300013100 Bacteria 837
139 Ga0157371_10000463 3300013102 Bacteria 49682
140 Ga0157371_10004579 3300013102 Bacteria 12017
141 Ga0157371_10428980 3300013102 Bacteria 970
142 Ga0157370_10005821 3300013104 Bacteria 13777
143 Ga0157370_10082525 3300013104 Bacteria 3023
144 Ga0157370_10159805 3300013104 Bacteria 2097
145 Ga0157370_10198950 3300013104 Bacteria 1859
146 Ga0157370_10273552 3300013104 Bacteria 1560
147 Ga0157370_10554702 3300013104 Bacteria 1053
148 Ga0157370_10930684 3300013104 Bacteria 788
149 Ga0157369_10001402 3300013105 Bacteria 29596
150 Ga0157369_10005269 3300013105 Bacteria 15076
151 Ga0157369_10014332 3300013105 Bacteria 8953
152 Ga0157369_10014764 3300013105 Bacteria 8812
153 Ga0157369_10078365 3300013105 Bacteria 3540
154 Ga0157369_11454637 3300013105 Bacteria 697
155 Ga0163162_10000072 3300013306 Bacteria 92818
156 Ga0163162_10008712 3300013306 Bacteria 9871
157 Ga0163162_10077091 3300013306 Bacteria 3396
158 Ga0163162_10586450 3300013306 Bacteria 1241
159 Ga0157372_10019720 3300013307 Bacteria 7269
160 Ga0157375_10000139 3300013308 Bacteria 72260
161 Ga0157375_10002380 3300013308 Bacteria 16274
162 Ga0157375_10084113 3300013308 Bacteria 3229
163 Ga0157375_10354463 3300013308 Bacteria 1633
164 Ga0157375_10898380 3300013308 Bacteria 1030
165 Ga0182008_10001317 3300014497 Bacteria 16936
166 Ga0182008_10002359 3300014497 Bacteria 11888
167 Ga0182008_10006016 3300014497 Bacteria 6832
168 Ga0182008_10028516 3300014497 Bacteria 2823
169 Ga0182008_10230097 3300014497 Bacteria 951
170 Ga0182006_1002945 3300015261 Bacteria 9006
171 Ga0182006_1003352 3300015261 Bacteria 8246
172 Ga0182006_1015711 3300015261 Bacteria 3241
173 Ga0182007_10001953 3300015262 Bacteria 10662
174 Ga0182005_1000842 3300015265 Bacteria 13719
175 Ga0182005_1015984 3300015265 Bacteria 2089
176 Ga0182005_1026147 3300015265 Bacteria 1592
177 Ga0163161_10000156 3300017792 Bacteria 63154
178 Ga0163161_10003953 3300017792 Bacteria 10398
179 Ga0163161_10045752 3300017792 Bacteria 3157
180 Ga0163161_10050229 3300017792 Bacteria 3018
181 Ga0163161_10064565 3300017792 Bacteria 2670
182 Ga0163161_10088392 3300017792 Bacteria 2290
183 Ga0163161_10672240 3300017792 Bacteria 860
184 Ga0213875_10001893 3300021388 Bacteria 12940
185 Ga0209760_100227 3300025207 Bacteria 24289
186 Ga0209760_100434 3300025207 Bacteria 9846
187 Ga0209784_100023 3300025224 Bacteria 399841
188 Ga0209566_100019 3300025225 Bacteria 414836
189 Ga0209566_100443 3300025225 Bacteria 30572
190 Ga0209674_100034 3300025226 Bacteria 414903
191 Ga0209672_100012 3300025228 Bacteria 795742
192 Ga0209672_100063 3300025228 Bacteria 204903
193 Ga0209147_100007 3300025229 Bacteria 795684
194 Ga0209147_100027 3300025229 Bacteria 414610
195 Ga0209147_100077 3300025229 Bacteria 205964
196 Ga0209147_100119 3300025229 Bacteria 142860
197 Ga0209563_100037 3300025230 Bacteria 414903
198 Ga0207427_100047 3300025231 Bacteria 240409
199 Ga0207427_100074 3300025231 Bacteria 153455
200 Ga0209437_100006 3300025233 Bacteria 1042724
201 Ga0209437_100009 3300025233 Bacteria 915954
202 Ga0209258_100014 3300025242 Bacteria 720132
203 Ga0209258_100105 3300025242 Bacteria 207862
204 Ga0209258_100520 3300025242 Bacteria 37049
205 Ga0209646_1000110 3300025246 Bacteria 156257
206 Ga0209677_100021 3300025253 Bacteria 414954
207 Ga0209148_1000107 3300025254 Bacteria 207862
208 Ga0209148_1000337 3300025254 Bacteria 63295
209 Ga0209759_1001226 3300025256 Bacteria 15698
210 Ga0209233_1000032 3300025261 Bacteria 623596
211 Ga0209233_1000484 3300025261 Bacteria 24306
212 Ga0209455_1000100 3300025272 Bacteria 207862
213 Ga0209455_1000138 3300025272 Bacteria 141021
214 Ga0209673_1000101 3300025273 Bacteria 190230
215 Ga0209675_1006516 3300025291 Bacteria 4662
216 Ga0209676_1000010 3300025292 Bacteria 954025
217 Ga0209676_1000021 3300025292 Bacteria 609534
218 Ga0209676_1000646 3300025292 Bacteria 50033
219 Ga0209676_1000752 3300025292 Bacteria 43942
220 Ga0209676_1007290 3300025292 Bacteria 5235
221 Ga0209676_1010061 3300025292 Bacteria 3991
222 Ga0209564_1007842 3300025295 Bacteria 5413
223 Ga0209050_1000081 3300025298 Bacteria 267533
224 Ga0209050_1000227 3300025298 Bacteria 123743
225 Ga0209050_1000363 3300025298 Bacteria 86923
226 Ga0209050_1000595 3300025298 Bacteria 57712
227 Ga0209051_1000164 3300025303 Bacteria 124186
228 Ga0209051_1000185 3300025303 Bacteria 110195
229 Ga0209051_1000407 3300025303 Bacteria 59487
230 Ga0209257_1000040 3300025304 Bacteria 538759
231 Ga0209257_1008247 3300025304 Bacteria 5996
232 Ga0207696_1000006 3300025711 Bacteria 616498
233 Ga0207696_1001567 3300025711 Bacteria 12168
234 Ga0207696_1002536 3300025711 Bacteria 8901
235 Ga0207696_1012173 3300025711 Bacteria 3052
236 Ga0207696_1013067 3300025711 Bacteria 2911
237 Ga0207696_1017693 3300025711 Bacteria 2356
238 Ga0207696_1018219 3300025711 Bacteria 2310
239 Ga0207696_1018265 3300025711 Bacteria 2306
240 Ga0207655_1000074 3300025728 Bacteria 232056
241 Ga0207655_1000551 3300025728 Bacteria 46983
242 Ga0207655_1000940 3300025728 Bacteria 30221
243 Ga0207655_1001227 3300025728 Bacteria 24729
244 Ga0207655_1001930 3300025728 Bacteria 17745
245 Ga0207655_1002591 3300025728 Bacteria 14398
246 Ga0207655_1004649 3300025728 Bacteria 9632
247 Ga0207655_1010235 3300025728 Bacteria 5709
248 Ga0207655_1011899 3300025728 Bacteria 5133
249 Ga0207655_1018219 3300025728 Bacteria 3740
250 Ga0207655_1020537 3300025728 Bacteria 3389
251 Ga0207655_1023881 3300025728 Bacteria 3015
252 Ga0207655_1024503 3300025728 Bacteria 2955
253 Ga0207655_1041659 3300025728 Bacteria 1965
254 Ga0207655_1060197 3300025728 Bacteria 1473
255 Ga0207655_1087869 3300025728 Bacteria 1102
256 Ga0207713_1000042 3300025735 Bacteria 242199
257 Ga0207713_1001221 3300025735 Bacteria 21470
258 Ga0207713_1001918 3300025735 Bacteria 15757
259 Ga0207713_1003241 3300025735 Bacteria 11226
260 Ga0207713_1006429 3300025735 Bacteria 7155
261 Ga0207713_1012331 3300025735 Bacteria 4578
262 Ga0207713_1013609 3300025735 Bacteria 4277
263 Ga0207713_1028640 3300025735 Bacteria 2508
264 Ga0207713_1101848 3300025735 Bacteria 990
265 Ga0207713_1102312 3300025735 Bacteria 987
266 Ga0207680_10412147 3300025903 Bacteria 956
267 Ga0207647_10005055 3300025904 Bacteria 9726
268 Ga0207705_10098965 3300025909 Bacteria 2143
269 Ga0207695_10000368 3300025913 Bacteria 103176
270 Ga0207695_10006884 3300025913 Bacteria 14629
271 Ga0207695_10043331 3300025913 Bacteria 4797
272 Ga0207671_10065834 3300025914 Bacteria 2696
273 Ga0207657_10000442 3300025919 Bacteria 43937
274 Ga0207649_10000954 3300025920 Bacteria 17951
275 Ga0207649_10107248 3300025920 Bacteria 1860
276 Ga0207681_10024058 3300025923 Bacteria 3904
277 Ga0207694_10163663 3300025924 Bacteria 1798
278 Ga0207650_10001314 3300025925 Bacteria 17994
279 Ga0207690_10000037 3300025932 Bacteria 142658
280 Ga0207706_10042785 3300025933 Bacteria 4014
281 Ga0207709_10000035 3300025935 Bacteria 300968
282 Ga0207709_10002421 3300025935 Bacteria 11739
283 Ga0207709_10012519 3300025935 Bacteria 4671
284 Ga0207661_10350006 3300025944 Bacteria 1333
285 Ga0207679_10000097 3300025945 Bacteria 75900
286 Ga0207667_10136649 3300025949 Bacteria 2524
287 Ga0207703_10072389 3300026035 Bacteria 2849
288 Ga0207678_10000317 3300026067 Bacteria 43506
289 Ga0207674_10058378 3300026116 Bacteria 3909
290 Ga0209281_1000077 3300027111 Bacteria 262887
291 Ga0209281_1000212 3300027111 Bacteria 130216
292 Ga0209281_1006513 3300027111 Bacteria 3039
293 Ga0209281_1011142 3300027111 Bacteria 2024
294 Ga0209389_1000091 3300027296 Bacteria 83421
295 Ga0209371_1000080 3300027312 Bacteria 185771
296 Ga0209371_1001552 3300027312 Bacteria 15166
297 Ga0209282_1012669 3300027666 Bacteria 5360
298 Ga0207428_10005837 3300027907 Bacteria 11419
299 Ga0207428_10054766 3300027907 Bacteria 3176
300 Ga0207428_10080023 3300027907 Bacteria 2554
301 Ga0207428_10482419 3300027907 Bacteria 902
302 Ga0268266_10099467 3300028379 Bacteria 2560
303 Ga0268256_1000160 3300030500 Bacteria 86682
304 Ga0268256_1002253 3300030500 Bacteria 10081
305 Ga0307511_10028132 3300030521 Bacteria 5113
306 Ga0316179_1039086 3300030734 Bacteria 2024
307 Ga0316178_1138063 3300030735 Bacteria 8679
308 Ga0316183_1077777 3300030742 Bacteria 1926
309 Ga0316183_1106054 3300030742 Bacteria 1594
310 Ga0307408_100002671 3300031548 Bacteria 12368
311 Ga0307408_100002956 3300031548 Bacteria 11780
312 Ga0307408_100436648 3300031548 Bacteria 1132
313 Ga0307408_100467367 3300031548 Bacteria 1097
314 Ga0307405_10000024 3300031731 Bacteria 127508
315 Ga0307405_10000624 3300031731 Bacteria 13604
316 Ga0307405_10002473 3300031731 Bacteria 8156
317 Ga0307405_10320653 3300031731 Bacteria 1183
318 Ga0307413_10013068 3300031824 Bacteria 4156
319 Ga0307413_10032714 3300031824 Bacteria 2951
320 Ga0307406_10053238 3300031901 Bacteria 2577
321 Ga0307407_10135080 3300031903 Bacteria 1583
322 Ga0307412_10000878 3300031911 Bacteria 17292
323 Ga0307412_10000944 3300031911 Bacteria 16618
324 Ga0307412_10001619 3300031911 Bacteria 12408
325 Ga0307412_11144039 3300031911 Bacteria 694
326 Ga0307414_10055195 3300032004 Bacteria 2780
327 Ga0307414_10137367 3300032004 Bacteria 1908
328 Ga0307414_10486470 3300032004 Bacteria 1089
329 Ga0307414_10967960 3300032004 Bacteria 782
330 Ga0307411_10008616 3300032005 Bacteria 5298
331 Ga0307411_10015363 3300032005 Bacteria 4297
332 Ga0307411_10020708 3300032005 Bacteria 3832
333 Ga0307510_10012774 3300033180 Bacteria 9967
334 Ga0373944_0024203 3300035089 Bacteria 1777
335 Ga0373946_0014580 3300035171 Bacteria 2965
336 Ga0373927_0000731 3300035695 Bacteria 25089
337 Ga0373947_0317631 3300035725 Bacteria 1041
338 Ga0373925_0000049 3300037068 Bacteria 128065
339 Ga0395900_0079296 3300037418 Bacteria 3374
340 Ga0395898_0139849 3300037466 Bacteria 2318
341 Ga0436364_0011200 3300037853 Bacteria 14393
342 Ga0237819_00585 3300038705 Bacteria 12172
343 Ga0400489_31717 3300039093 Bacteria 1122
344 Ga0436365_0907137 3300039437 Bacteria 2597
345 Ga0439438_001949 3300041405 Bacteria 9009
346 Ga0439438_002256 3300041405 Bacteria 8268
347 Ga0439438_002400 3300041405 Bacteria 7987
348 Ga0439438_002403 3300041405 Bacteria 7985
349 Ga0439438_002513 3300041405 Bacteria 7783
350 Ga0439438_002539 3300041405 Bacteria 7740
351 Ga0439438_003729 3300041405 Bacteria 6049
352 Ga0439438_015614 3300041405 Bacteria 2229
353 Ga0439447_000280 3300041407 Bacteria 18107
354 Ga0439447_000355 3300041407 Bacteria 16602
355 Ga0439447_000621 3300041407 Bacteria 13205
356 Ga0439447_000698 3300041407 Bacteria 12415
357 Ga0439447_003542 3300041407 Bacteria 5534
358 Ga0439447_003943 3300041407 Bacteria 5199
359 Ga0439447_006856 3300041407 Bacteria 3658
360 Ga0439447_016415 3300041407 Bacteria 2032
361 Ga0439447_026239 3300041407 Bacteria 1495
362 Ga0439466_0000181 3300041411 Bacteria 25115
363 Ga0439466_0000422 3300041411 Bacteria 16049
364 Ga0439466_0002836 3300041411 Bacteria 6784
365 Ga0439466_0009673 3300041411 Bacteria 3598
366 Ga0439466_0011006 3300041411 Bacteria 3353
367 Ga0439466_0013955 3300041411 Bacteria 2933
368 Ga0439466_0020081 3300041411 Bacteria 2386
369 Ga0439466_0043550 3300041411 Bacteria 1490
370 Ga0451797_0248178 3300041453 Bacteria 638
371 Ga0451841_0467719 3300041498 Bacteria 1004
372 Ga0439431_0013624 3300041997 Bacteria 1877
373 Ga0439445_0004818 3300042004 Bacteria 3063
374 Ga0439432_001312 3300042006 Bacteria 9416
375 Ga0439432_003675 3300042006 Bacteria 5675
376 Ga0439432_006504 3300042006 Bacteria 4171
377 Ga0439432_010421 3300042006 Bacteria 3216
378 Ga0439432_017024 3300042006 Bacteria 2441
379 Ga0439451_004155 3300042009 Bacteria 2936
380 Ga0439451_020469 3300042009 Bacteria 1334
381 Ga0439452_000091 3300042010 Bacteria 78007
382 Ga0439452_000172 3300042010 Bacteria 48128
383 Ga0439452_000309 3300042010 Bacteria 31187
384 Ga0439452_004717 3300042010 Bacteria 4513
385 Ga0439452_005180 3300042010 Bacteria 4240
386 Ga0439452_006684 3300042010 Bacteria 3593
387 Ga0439452_025368 3300042010 Bacteria 1505
388 Ga0439452_033726 3300042010 Bacteria 1241
389 Ga0439456_000810 3300042013 Bacteria 6331
390 Ga0439456_007282 3300042013 Bacteria 2267
391 Ga0439456_009090 3300042013 Bacteria 2052
392 Ga0439456_024071 3300042013 Bacteria 1291
393 Ga0439456_028274 3300042013 Bacteria 1196
394 Ga0439456_045321 3300042013 Bacteria 957
395 Ga0439463_000135 3300042016 Bacteria 18610
396 Ga0439463_002404 3300042016 Bacteria 4769
397 Ga0439463_050307 3300042016 Bacteria 1063
398 Ga0439463_126636 3300042016 Bacteria 660
399 Ga0450911_000025 3300042115 Bacteria 83941
400 Ga0450919_003138 3300042121 Bacteria 2100
401 Ga0450920_003350 3300042122 Bacteria 2769
402 Ga0450922_000181 3300042124 Bacteria 6527
403 Ga0450923_001551 3300042125 Bacteria 3088
404 Ga0450900_005759 3300042136 Bacteria 1476
405 Ga0450902_000571 3300042137 Bacteria 4674
406 Ga0450903_002442 3300042138 Bacteria 3311
407 Ga0450903_004051 3300042138 Bacteria 2513
408 Ga0450903_004391 3300042138 Bacteria 2411
409 Ga0450903_012557 3300042138 Bacteria 1352
410 Ga0450905_005175 3300042142 Bacteria 1748
411 Ga0450906_000612 3300042145 Bacteria 7613
412 Ga0450906_001636 3300042145 Bacteria 4918
413 Ga0450907_000038 3300042146 Bacteria 57421
414 Ga0450907_000855 3300042146 Bacteria 7381
415 Ga0450907_039969 3300042146 Bacteria 803
416 Ga0439446_0064553 3300042156 Bacteria 1111
417 Ga0450909_000065 3300042185 Bacteria 9292
418 Ga0439434_0000253 3300042435 Bacteria 15062
419 Ga0439460_0000460 3300042461 Bacteria 8801
420 Ga0439460_0001474 3300042461 Bacteria 5541
421 Ga0439440_0001144 3300042993 Bacteria 4745
422 Ga0439440_0003618 3300042993 Bacteria 2996
423 Ga0466969_0005486 3300044656 Bacteria 6747
424 Ga0466972_0050894 3300044658 Bacteria 1999
425 Ga0466965_0012175 3300044683 Bacteria 4043
426 Ga0466965_0021841 3300044683 Bacteria 3084
427 Ga0466965_0137102 3300044683 Bacteria 1272
428 Ga0451576_0230380 3300045051 Bacteria 1935
429 Ga0451576_0358142 3300045051 Bacteria 1528
430 Ga0466967_0157347 3300045976 Bacteria 2130
431 Ga0495617_004146 3300046452 Bacteria 5312
432 Ga0495617_004255 3300046452 Bacteria 5227
433 Ga0495617_008453 3300046452 Bacteria 3548
434 Ga0495617_009307 3300046452 Bacteria 3371
435 Ga0495617_026063 3300046452 Bacteria 1968
436 Ga0495617_028225 3300046452 Bacteria 1886
437 Ga0495617_042370 3300046452 Bacteria 1521
438 Ga0495627_000013 3300046453 Bacteria 332765
439 Ga0495627_000239 3300046453 Bacteria 57647
440 Ga0495627_000864 3300046453 Bacteria 21508
441 Ga0495627_002308 3300046453 Bacteria 9399
442 Ga0495627_004519 3300046453 Bacteria 5803
443 Ga0495627_005591 3300046453 Bacteria 5035
444 Ga0495592_0128017 3300046454 Bacteria 1779
445 Ga0495603_0018361 3300046455 Bacteria 4231
446 Ga0495603_0019564 3300046455 Bacteria 4098
447 Ga0495590_0013094 3300046457 Bacteria 3058
448 Ga0495590_0032480 3300046457 Bacteria 1825
449 Ga0495590_0041811 3300046457 Bacteria 1598
450 Ga0495590_0070549 3300046457 Bacteria 1225
451 Ga0495591_000041 3300046458 Bacteria 155639
452 Ga0495591_000064 3300046458 Bacteria 123820
453 Ga0495591_000107 3300046458 Bacteria 95742
454 Ga0495591_000287 3300046458 Bacteria 46879
455 Ga0495591_000481 3300046458 Bacteria 31694
456 Ga0495591_000774 3300046458 Bacteria 23026
457 Ga0495591_002390 3300046458 Bacteria 10506
458 Ga0495591_003090 3300046458 Bacteria 8818
459 Ga0495591_005561 3300046458 Bacteria 5796
460 Ga0495591_008395 3300046458 Bacteria 4233
461 Ga0495591_009734 3300046458 Bacteria 3788
462 Ga0495591_014040 3300046458 Bacteria 2898
463 Ga0495591_016768 3300046458 Bacteria 2537
464 Ga0495591_049195 3300046458 Bacteria 1159
465 Ga0495629_0351154 3300046459 Bacteria 1006
466 Ga0495638_0002189 3300046460 Bacteria 16352
467 Ga0495638_0003517 3300046460 Bacteria 12299
468 Ga0495638_0003771 3300046460 Bacteria 11778
469 Ga0495638_0015395 3300046460 Bacteria 5136
470 Ga0495638_0020618 3300046460 Bacteria 4353
471 Ga0495638_0026277 3300046460 Bacteria 3774
472 Ga0495638_0044924 3300046460 Bacteria 2781
473 Ga0495638_0073514 3300046460 Bacteria 2086
474 Ga0495638_0085793 3300046460 Bacteria 1903
475 Ga0495638_0094289 3300046460 Bacteria 1799
476 Ga0495638_0151464 3300046460 Bacteria 1345
477 Ga0495653_0000525 3300046463 Bacteria 29386
478 Ga0495653_0023268 3300046463 Bacteria 5009
479 Ga0495653_0037094 3300046463 Bacteria 3833
480 Ga0495650_0001462 3300046471 Bacteria 22659
481 Ga0495650_0003372 3300046471 Bacteria 11705
482 Ga0495650_0006289 3300046471 Bacteria 7430
483 Ga0495650_0006670 3300046471 Bacteria 7155
484 Ga0495650_0017460 3300046471 Bacteria 3597
485 Ga0495650_0029119 3300046471 Bacteria 2522
486 Ga0495650_0057982 3300046471 Bacteria 1565
487 Ga0495582_0002084 3300046473 Bacteria 11187
488 Ga0495605_0000191 3300046474 Bacteria 76513
489 Ga0495605_0000212 3300046474 Bacteria 71789
490 Ga0495605_0000309 3300046474 Bacteria 51425
491 Ga0495605_0001761 3300046474 Bacteria 13880
492 Ga0495605_0003411 3300046474 Bacteria 9468
493 Ga0495605_0027322 3300046474 Bacteria 2958
494 Ga0495605_0029904 3300046474 Bacteria 2797
495 Ga0495605_0044150 3300046474 Bacteria 2205
496 Ga0495605_0044664 3300046474 Bacteria 2189
497 Ga0495605_0045491 3300046474 Bacteria 2163
498 Ga0495605_0202154 3300046474 Bacteria 865
499 Ga0495639_0011149 3300046475 Bacteria 3871
500 Ga0495639_0022419 3300046475 Bacteria 2770
501 Ga0495584_0000505 3300046491 Bacteria 26765
502 Ga0495584_0002635 3300046491 Bacteria 10114
503 Ga0495584_0003226 3300046491 Bacteria 9051
504 Ga0495584_0009835 3300046491 Bacteria 4918
505 Ga0495584_0039182 3300046491 Bacteria 2394
506 Ga0495584_0053247 3300046491 Bacteria 2036
507 Ga0495584_0063235 3300046491 Bacteria 1860
508 Ga0495584_0127431 3300046491 Bacteria 1290
509 Ga0495584_0208913 3300046491 Bacteria 992
510 Ga0495585_0000228 3300046492 Bacteria 57922
511 Ga0495585_0004597 3300046492 Bacteria 8921
512 Ga0495585_0011533 3300046492 Bacteria 5229
513 Ga0495585_0066195 3300046492 Bacteria 1979
514 Ga0495585_0075193 3300046492 Bacteria 1837
515 Ga0495594_0000125 3300046499 Bacteria 35944
516 Ga0495594_0007936 3300046499 Bacteria 5458
517 Ga0495594_0008555 3300046499 Bacteria 5275
518 Ga0495594_0009339 3300046499 Bacteria 5066
519 Ga0495596_0000028 3300046500 Bacteria 103710
520 Ga0495596_0030659 3300046500 Bacteria 2151
521 Ga0495596_0037155 3300046500 Bacteria 1926
522 Ga0495607_0000058 3300046501 Bacteria 109864
523 Ga0495607_0000936 3300046501 Bacteria 27159
524 Ga0495607_0001376 3300046501 Bacteria 21622
525 Ga0495607_0001798 3300046501 Bacteria 18317
526 Ga0495607_0002668 3300046501 Bacteria 14272
527 Ga0495607_0003115 3300046501 Bacteria 12872
528 Ga0495607_0008043 3300046501 Bacteria 7241
529 Ga0495607_0012233 3300046501 Bacteria 5672
530 Ga0495607_0027603 3300046501 Bacteria 3507
531 Ga0495607_0035349 3300046501 Bacteria 3023
532 Ga0495607_0137465 3300046501 Bacteria 1264
533 Ga0495607_0169315 3300046501 Bacteria 1104
534 Ga0495607_0271837 3300046501 Bacteria 807
535 Ga0495583_0000036 3300046506 Bacteria 246077
536 Ga0495583_0000465 3300046506 Bacteria 59902
537 Ga0495583_0001061 3300046506 Bacteria 30742
538 Ga0495583_0004020 3300046506 Bacteria 10833
539 Ga0495583_0006457 3300046506 Bacteria 7665
540 Ga0495583_0015625 3300046506 Bacteria 4118
541 Ga0495606_0000691 3300046507 Bacteria 52384
542 Ga0495606_0000724 3300046507 Bacteria 51037
543 Ga0495606_0000782 3300046507 Bacteria 48702
544 Ga0495606_0000988 3300046507 Bacteria 41466
545 Ga0495606_0004452 3300046507 Bacteria 13991
546 Ga0495606_0004727 3300046507 Bacteria 13409
547 Ga0495606_0008677 3300046507 Bacteria 8759
548 Ga0495606_0009687 3300046507 Bacteria 8107
549 Ga0495606_0010638 3300046507 Bacteria 7609
550 Ga0495606_0013017 3300046507 Bacteria 6613
551 Ga0495606_0026021 3300046507 Bacteria 4175
552 Ga0495606_0026693 3300046507 Bacteria 4111
553 Ga0495606_0048957 3300046507 Bacteria 2775
554 Ga0495610_0003177 3300046512 Bacteria 13024
555 Ga0495610_0003532 3300046512 Bacteria 12113
556 Ga0495610_0006409 3300046512 Bacteria 8103
557 Ga0495610_0009530 3300046512 Bacteria 6127
558 Ga0495610_0010263 3300046512 Bacteria 5836
559 Ga0495610_0010542 3300046512 Bacteria 5731
560 Ga0495610_0013697 3300046512 Bacteria 4803
561 Ga0495610_0014956 3300046512 Bacteria 4532
562 Ga0495610_0018000 3300046512 Bacteria 4005
563 Ga0495610_0022822 3300046512 Bacteria 3414
564 Ga0495610_0050357 3300046512 Bacteria 2034
565 Ga0495610_0051532 3300046512 Bacteria 2002
566 Ga0495610_0068125 3300046512 Bacteria 1669
567 Ga0495616_0000168 3300046513 Bacteria 56324
568 Ga0495616_0001849 3300046513 Bacteria 14321
569 Ga0495616_0005394 3300046513 Bacteria 7877
570 Ga0495616_0008103 3300046513 Bacteria 6255
571 Ga0495616_0014318 3300046513 Bacteria 4443
572 Ga0495616_0035367 3300046513 Bacteria 2585
573 Ga0495616_0038241 3300046513 Bacteria 2464
574 Ga0495616_0053366 3300046513 Bacteria 2009
575 Ga0495616_0125305 3300046513 Bacteria 1182
576 Ga0495616_0143504 3300046513 Bacteria 1085
577 Ga0495620_0000006 3300046515 Bacteria 273098
578 Ga0495620_0000022 3300046515 Bacteria 136531
579 Ga0495620_0000184 3300046515 Bacteria 48200
580 Ga0495620_0001469 3300046515 Bacteria 14091
581 Ga0495620_0002359 3300046515 Bacteria 10941
582 Ga0495620_0004194 3300046515 Bacteria 8154
583 Ga0495620_0006752 3300046515 Bacteria 6276
584 Ga0495620_0014936 3300046515 Bacteria 3932
585 Ga0495620_0018385 3300046515 Bacteria 3462
586 Ga0495620_0030251 3300046515 Bacteria 2495
587 Ga0495620_0075761 3300046515 Bacteria 1368
588 Ga0495620_0221031 3300046515 Bacteria 725
589 Ga0495628_0065374 3300046516 Bacteria 2845
590 Ga0495630_0012152 3300046517 Bacteria 6244
591 Ga0495630_0024402 3300046517 Bacteria 4471
592 Ga0495630_0030578 3300046517 Bacteria 4007
593 Ga0495631_0000020 3300046518 Bacteria 92958
594 Ga0495631_0000221 3300046518 Bacteria 39142
595 Ga0495631_0003793 3300046518 Bacteria 8219
596 Ga0495631_0049788 3300046518 Bacteria 1833
597 Ga0495631_0058201 3300046518 Bacteria 1681
598 Ga0495631_0208088 3300046518 Bacteria 836
599 Ga0495632_0000074 3300046519 Bacteria 103136
600 Ga0495632_0000162 3300046519 Bacteria 69536
601 Ga0495632_0000222 3300046519 Bacteria 57787
602 Ga0495632_0002292 3300046519 Bacteria 14740
603 Ga0495632_0004343 3300046519 Bacteria 9656
604 Ga0495632_0004406 3300046519 Bacteria 9568
605 Ga0495632_0008780 3300046519 Bacteria 6157
606 Ga0495632_0015507 3300046519 Bacteria 4268
607 Ga0495632_0054147 3300046519 Bacteria 1967
608 Ga0495632_0133447 3300046519 Bacteria 1154
609 Ga0495637_0000089 3300046520 Bacteria 71239
610 Ga0495637_0000947 3300046520 Bacteria 18544
611 Ga0495637_0001443 3300046520 Bacteria 13998
612 Ga0495637_0002811 3300046520 Bacteria 9437
613 Ga0495637_0010044 3300046520 Bacteria 4596
614 Ga0495637_0016489 3300046520 Bacteria 3452
615 Ga0495637_0020019 3300046520 Bacteria 3082
616 Ga0495637_0033185 3300046520 Bacteria 2269
617 Ga0495637_0036173 3300046520 Bacteria 2152
618 Ga0495637_0185531 3300046520 Bacteria 769
619 Ga0495643_0000185 3300046522 Bacteria 99895
620 Ga0495643_0002208 3300046522 Bacteria 15866
621 Ga0495643_0003299 3300046522 Bacteria 11925
622 Ga0495643_0008354 3300046522 Bacteria 6562
623 Ga0495643_0011217 3300046522 Bacteria 5474
624 Ga0495643_0026753 3300046522 Bacteria 3249
625 Ga0495643_0061631 3300046522 Bacteria 1988
626 Ga0495643_0070710 3300046522 Bacteria 1832
627 Ga0495644_0001883 3300046523 Bacteria 8449
628 Ga0495644_0081195 3300046523 Bacteria 1222
629 Ga0495648_0000243 3300046524 Bacteria 61488
630 Ga0495648_0001614 3300046524 Bacteria 21924
631 Ga0495648_0002022 3300046524 Bacteria 19228
632 Ga0495648_0002271 3300046524 Bacteria 17946
633 Ga0495648_0003640 3300046524 Bacteria 13471
634 Ga0495648_0006325 3300046524 Bacteria 9687
635 Ga0495648_0006428 3300046524 Bacteria 9594
636 Ga0495648_0007373 3300046524 Bacteria 8810
637 Ga0495648_0007672 3300046524 Bacteria 8603
638 Ga0495648_0025015 3300046524 Bacteria 4051
639 Ga0495648_0033010 3300046524 Bacteria 3387
640 Ga0495648_0052554 3300046524 Bacteria 2474
641 Ga0495648_0086131 3300046524 Bacteria 1772
642 Ga0495648_0114050 3300046524 Bacteria 1464
643 Ga0495648_0257739 3300046524 Bacteria 838
644 Ga0495666_0001984 3300046526 Bacteria 10108
645 Ga0495666_0022868 3300046526 Bacteria 3093
646 Ga0495666_0039073 3300046526 Bacteria 2305
647 Ga0495642_0000033 3300046528 Bacteria 85849
648 Ga0495642_0000086 3300046528 Bacteria 53956
649 Ga0495654_0000111 3300046530 Bacteria 92977
650 Ga0495654_0002862 3300046530 Bacteria 10841
651 Ga0495654_0002994 3300046530 Bacteria 10567
652 Ga0495654_0003325 3300046530 Bacteria 9904
653 Ga0495654_0004462 3300046530 Bacteria 8300
654 Ga0495654_0007333 3300046530 Bacteria 6176
655 Ga0495654_0007655 3300046530 Bacteria 6013
656 Ga0495654_0010924 3300046530 Bacteria 4933
657 Ga0495654_0011790 3300046530 Bacteria 4719
658 Ga0495654_0018913 3300046530 Bacteria 3605
659 Ga0495654_0031970 3300046530 Bacteria 2669
660 Ga0495654_0103381 3300046530 Bacteria 1308
661 Ga0495654_0129448 3300046530 Bacteria 1134
662 Ga0495654_0157986 3300046530 Bacteria 997
663 Ga0495586_0002403 3300046535 Bacteria 10163
664 Ga0495587_0001739 3300046536 Bacteria 14536
665 Ga0495587_0003739 3300046536 Bacteria 10095
666 Ga0495609_0000011 3300046538 Bacteria 334377
667 Ga0495609_0000329 3300046538 Bacteria 41907
668 Ga0495609_0000631 3300046538 Bacteria 27394
669 Ga0495609_0001719 3300046538 Bacteria 14187
670 Ga0495609_0015134 3300046538 Bacteria 3614
671 Ga0495609_0019639 3300046538 Bacteria 3124
672 Ga0495609_0040845 3300046538 Bacteria 2086
673 Ga0495597_0000004 3300046542 Bacteria 307496
674 Ga0495597_0001453 3300046542 Bacteria 16962
675 Ga0495597_0003855 3300046542 Bacteria 8499
676 Ga0495597_0011117 3300046542 Bacteria 4370
677 Ga0495597_0012258 3300046542 Bacteria 4138
678 Ga0495597_0013089 3300046542 Bacteria 3982
679 Ga0495597_0019648 3300046542 Bacteria 3157
680 Ga0495597_0039126 3300046542 Bacteria 2124
681 Ga0495597_0088211 3300046542 Bacteria 1319
682 Ga0495645_0260393 3300046543 Bacteria 1149
683 Ga0495622_0000538 3300046557 Bacteria 22760
684 Ga0495622_0000911 3300046557 Bacteria 16047
685 Ga0495622_0027675 3300046557 Bacteria 2646
686 Ga0495622_0042954 3300046557 Bacteria 2101
687 Ga0495622_0068214 3300046557 Bacteria 1643
688 Ga0495633_0000140 3300046558 Bacteria 96787
689 Ga0495633_0001679 3300046558 Bacteria 16654
690 Ga0495633_0006318 3300046558 Bacteria 7056
691 Ga0495633_0016429 3300046558 Bacteria 3815
692 Ga0495633_0053985 3300046558 Bacteria 1891
693 Ga0495633_0134234 3300046558 Bacteria 1145
694 Ga0495668_0000814 3300046616 Bacteria 35749
695 Ga0495668_0001572 3300046616 Bacteria 21592
696 Ga0495668_0012939 3300046616 Bacteria 4939
697 Ga0495668_0135602 3300046616 Bacteria 1347
698 Ga0495668_0230155 3300046616 Bacteria 1015
699 Ga0495634_0062265 3300046642 Bacteria 2478
700 Ga0495611_0000107 3300046648 Bacteria 58046
701 Ga0495611_0001100 3300046648 Bacteria 14250
702 Ga0495611_0014337 3300046648 Bacteria 3385
703 Ga0495625_0001089 3300046660 Bacteria 35275
704 Ga0495625_0001350 3300046660 Bacteria 30319
705 Ga0495625_0003934 3300046660 Bacteria 14282
706 Ga0495625_0003974 3300046660 Bacteria 14180
707 Ga0495625_0010214 3300046660 Bacteria 7789
708 Ga0495625_0014514 3300046660 Bacteria 6279
709 Ga0495625_0296255 3300046660 Bacteria 1036
710 Ga0495625_0533201 3300046660 Bacteria 713
711 Ga0495625_0551019 3300046660 Bacteria 698
712 Ga0495635_0008476 3300046663 Bacteria 7180
713 Ga0495635_0021942 3300046663 Bacteria 4449
714 Ga0495659_0009818 3300046664 Bacteria 3062
715 Ga0495661_0000018 3300046665 Bacteria 200787
716 Ga0495661_0000313 3300046665 Bacteria 54614
717 Ga0495661_0004385 3300046665 Bacteria 10204
718 Ga0495661_0013508 3300046665 Bacteria 5483
719 Ga0495661_0014483 3300046665 Bacteria 5281
720 Ga0495661_0046274 3300046665 Bacteria 2657
721 Ga0495661_0051854 3300046665 Bacteria 2475
722 Ga0495661_0070924 3300046665 Bacteria 2037
723 Ga0495661_0123709 3300046665 Bacteria 1425
724 Ga0495588_0003508 3300046674 Bacteria 6841
725 Ga0495588_0008803 3300046674 Bacteria 4639
726 Ga0495588_0277440 3300046674 Bacteria 883
727 Ga0495623_0001644 3300046679 Bacteria 15015
728 Ga0495646_0003217 3300046680 Bacteria 10152
729 Ga0495669_0002058 3300046684 Bacteria 8248
730 Ga0495613_0006146 3300046689 Bacteria 8985
731 Ga0495613_0040121 3300046689 Bacteria 3469
732 Ga0495624_0000637 3300046690 Bacteria 27477
733 Ga0495624_0057096 3300046690 Bacteria 2455
734 Ga0495670_0000105 3300046691 Bacteria 37273
735 Ga0495670_0001677 3300046691 Bacteria 10876
736 Ga0495670_0001702 3300046691 Bacteria 10812
737 Ga0495670_0002656 3300046691 Bacteria 8825
738 Ga0495670_0003253 3300046691 Bacteria 8004
739 Ga0495670_0046903 3300046691 Bacteria 2159
740 Ga0495671_0001925 3300046692 Bacteria 13325
741 Ga0495671_0003981 3300046692 Bacteria 8933
742 Ga0495671_0004211 3300046692 Bacteria 8659
743 Ga0495671_0012446 3300046692 Bacteria 4646
744 Ga0495671_0016959 3300046692 Bacteria 3880
745 Ga0495671_0035561 3300046692 Bacteria 2528
746 Ga0495671_0047522 3300046692 Bacteria 2144
747 Ga0495671_0057448 3300046692 Bacteria 1925
748 Ga0495671_0147240 3300046692 Bacteria 1146
749 Ga0495671_0263208 3300046692 Bacteria 831
750 Ga0495649_0003035 3300046694 Bacteria 11518
751 Ga0495649_0003965 3300046694 Bacteria 9768
752 Ga0495649_0003972 3300046694 Bacteria 9762
753 Ga0495649_0005030 3300046694 Bacteria 8500
754 Ga0495649_0009234 3300046694 Bacteria 5875
755 Ga0495649_0013087 3300046694 Bacteria 4795
756 Ga0495649_0037104 3300046694 Bacteria 2675
757 Ga0495649_0086955 3300046694 Bacteria 1668
758 Ga0495649_0119919 3300046694 Bacteria 1391
759 Ga0495649_0154255 3300046694 Bacteria 1205
760 Ga0495649_0176877 3300046694 Bacteria 1114
761 Ga0495649_0197132 3300046694 Bacteria 1047
762 Ga0495649_0283316 3300046694 Bacteria 846
763 Ga0495589_0000278 3300046794 Bacteria 41647
764 Ga0495589_0002566 3300046794 Bacteria 10102
765 Ga0495589_0017355 3300046794 Bacteria 3694
766 Ga0495589_0036664 3300046794 Bacteria 2457
767 Ga0495600_0022484 3300046809 Bacteria 4048
768 Ga0495660_0000998 3300046810 Bacteria 20590
769 Ga0495660_0001470 3300046810 Bacteria 16027
770 Ga0495660_0001702 3300046810 Bacteria 14721
771 Ga0495660_0002330 3300046810 Bacteria 12173
772 Ga0495660_0003030 3300046810 Bacteria 10482
773 Ga0495660_0003946 3300046810 Bacteria 9066
774 Ga0495660_0005400 3300046810 Bacteria 7651
775 Ga0495660_0008214 3300046810 Bacteria 6117
776 Ga0495660_0012232 3300046810 Bacteria 4980
777 Ga0495660_0013937 3300046810 Bacteria 4659
778 Ga0495660_0025510 3300046810 Bacteria 3357
779 Ga0495660_0026415 3300046810 Bacteria 3292
780 Ga0495660_0065117 3300046810 Bacteria 1946
781 Ga0495660_0079872 3300046810 Bacteria 1717
782 Ga0495581_0013609 3300047315 Bacteria 4719
783 Ga0495604_0002977 3300047317 Bacteria 13559
784 Ga0495604_0019743 3300047317 Bacteria 5392
785 Ga0495604_0031966 3300047317 Bacteria 4172
786 Ga0495672_0000672 3300047320 Bacteria 37986
787 Ga0495672_0001345 3300047320 Bacteria 24376
788 Ga0495672_0003274 3300047320 Bacteria 14020
789 Ga0495672_0009799 3300047320 Bacteria 6895
790 Ga0495672_0017776 3300047320 Bacteria 4745
791 Ga0495672_0046378 3300047320 Bacteria 2592
792 Ga0495672_0065471 3300047320 Bacteria 2077
793 Ga0495672_0069864 3300047320 Bacteria 1992
794 Ga0495672_0140929 3300047320 Bacteria 1259
795 Ga0495672_0225265 3300047320 Bacteria 923
796 Ga0495676_0000286 3300047321 Bacteria 40855
797 Ga0495676_0096988 3300047321 Bacteria 2190
798 Ga0495680_0003972 3300047322 Bacteria 14287
799 Ga0495680_0007080 3300047322 Bacteria 10333
800 Ga0495680_0010401 3300047322 Bacteria 8302
801 Ga0495680_0408872 3300047322 Bacteria 935
802 Ga0495683_0000085 3300047323 Bacteria 93009
803 Ga0495683_0000270 3300047323 Bacteria 45608
804 Ga0495683_0009634 3300047323 Bacteria 5142
805 Ga0495683_0011491 3300047323 Bacteria 4655
806 Ga0495687_000375 3300047443 Bacteria 55715
807 Ga0495687_001177 3300047443 Bacteria 25211
808 Ga0495687_009480 3300047443 Bacteria 5435
809 Ga0495675_0023229 3300047444 Bacteria 3951
810 Ga0495675_0102852 3300047444 Bacteria 1786
811 Ga0495679_000190 3300047446 Bacteria 54219
812 Ga0495679_000211 3300047446 Bacteria 50030
813 Ga0495679_000233 3300047446 Bacteria 46629
814 Ga0495679_000689 3300047446 Bacteria 21996
815 Ga0495679_006729 3300047446 Bacteria 4902
816 Ga0495679_009097 3300047446 Bacteria 4000
817 Ga0495679_010665 3300047446 Bacteria 3595
818 Ga0495673_0000183 3300047469 Bacteria 101083
819 Ga0495673_0000297 3300047469 Bacteria 66473
820 Ga0495673_0000537 3300047469 Bacteria 39215
821 Ga0495673_0000628 3300047469 Bacteria 34725
822 Ga0495673_0002220 3300047469 Bacteria 13970
823 Ga0495673_0002230 3300047469 Bacteria 13918
824 Ga0495673_0009831 3300047469 Bacteria 5255
825 Ga0495673_0015998 3300047469 Bacteria 3847
826 Ga0495673_0051299 3300047469 Bacteria 1807
827 Ga0495673_0059258 3300047469 Bacteria 1646
828 Ga0495673_0073449 3300047469 Bacteria 1433
829 Ga0495673_0095150 3300047469 Bacteria 1211
830 Ga0495673_0139864 3300047469 Bacteria 944
831 Ga0495673_0145522 3300047469 Bacteria 920
832 Ga0495681_0000448 3300047470 Bacteria 31537
833 Ga0495681_0000856 3300047470 Bacteria 23410
834 Ga0495681_0002022 3300047470 Bacteria 14803
835 Ga0495681_0002233 3300047470 Bacteria 13928
836 Ga0495681_0002398 3300047470 Bacteria 13412
837 Ga0495681_0002965 3300047470 Bacteria 11958
838 Ga0495681_0003914 3300047470 Bacteria 10266
839 Ga0495681_0004992 3300047470 Bacteria 8949
840 Ga0495681_0012491 3300047470 Bacteria 4986
841 Ga0495681_0015669 3300047470 Bacteria 4281
842 Ga0495681_0016972 3300047470 Bacteria 4060
843 Ga0495681_0020296 3300047470 Bacteria 3608
844 Ga0495681_0032455 3300047470 Bacteria 2628
845 Ga0495681_0077050 3300047470 Bacteria 1497
846 Ga0495684_0231387 3300047471 Bacteria 1351
847 Ga0495686_0000029 3300047472 Bacteria 369110
848 Ga0495686_0005722 3300047472 Bacteria 9713
849 Ga0495686_0017829 3300047472 Bacteria 4778
850 Ga0495686_0059930 3300047472 Bacteria 2367
851 Ga0495686_0104466 3300047472 Bacteria 1705
852 Ga0495686_0108175 3300047472 Bacteria 1670
853 Ga0495593_0008535 3300047673 Bacteria 5956
854 Ga0495593_0014594 3300047673 Bacteria 4464
855 Ga0495593_0025676 3300047673 Bacteria 3260
856 Ga0495602_0030341 3300048088 Bacteria 5129
857 Ga0495626_0000144 3300048091 Bacteria 89793
858 Ga0495626_0000324 3300048091 Bacteria 50382
859 Ga0495626_0000420 3300048091 Bacteria 43492
860 Ga0495626_0000679 3300048091 Bacteria 32576
861 Ga0495626_0002781 3300048091 Bacteria 11730
862 Ga0495626_0021703 3300048091 Bacteria 3181
863 Ga0495626_0040258 3300048091 Bacteria 2208
864 Ga0495626_0094540 3300048091 Bacteria 1310
865 Ga0496100_0793705 3300048903 Bacteria 742
866 Ga0496101_0258484 3300048904 Bacteria 1358
867 Ga0496102_0118909 3300048905 Bacteria 2467
868 Ga0496103_0394662 3300048906 Bacteria 889
869 Ga0496104_0229097 3300048907 Bacteria 1770
870 Ga0496106_0000001 3300048909 Bacteria 497458
871 Ga0496106_0285170 3300048909 Bacteria 1323
872 Ga0496108_0204626 3300048911 Bacteria 1713
873 Ga0496110_0153118 3300048913 Bacteria 2088
874 Ga0496110_0231549 3300048913 Bacteria 1680
875 Ga0496110_0275727 3300048913 Bacteria 1531
876 Ga0496110_0355037 3300048913 Bacteria 1336
877 Ga0496111_0003743 3300048914 Bacteria 9472
878 Ga0496111_0282541 3300048914 Bacteria 1231
879 Ga0496112_0020353 3300048915 Bacteria 6289
880 Ga0496112_0109911 3300048915 Bacteria 2727
881 Ga0496114_0057296 3300048917 Bacteria 3253
882 Ga0496114_0077268 3300048917 Bacteria 2807
883 Ga0496115_0522910 3300048918 Bacteria 951
884 Ga0496116_0000168 3300048919 Bacteria 132462
885 Ga0496116_0000869 3300048919 Bacteria 37701
886 Ga0496116_0007948 3300048919 Bacteria 9295
887 Ga0496116_0008311 3300048919 Bacteria 9020
888 Ga0496116_0126930 3300048919 Bacteria 1463
889 Ga0496117_0000272 3300048920 Bacteria 96736
890 Ga0496117_0002072 3300048920 Bacteria 26520
891 Ga0496117_0004053 3300048920 Bacteria 16464
892 Ga0496117_0005260 3300048920 Bacteria 13734
893 Ga0496117_0007492 3300048920 Bacteria 10641
894 Ga0496117_0033297 3300048920 Bacteria 3899
895 Ga0496117_0083261 3300048920 Bacteria 2092
896 Ga0496117_0143808 3300048920 Bacteria 1423
897 Ga0496117_0251105 3300048920 Bacteria 965
898 Ga0496118_0001876 3300048921 Bacteria 30011
899 Ga0496118_0008366 3300048921 Bacteria 10704
900 Ga0496118_0017735 3300048921 Bacteria 6462
901 Ga0496118_0022749 3300048921 Bacteria 5465
902 Ga0496118_0040580 3300048921 Bacteria 3698
903 Ga0496118_0051411 3300048921 Bacteria 3152
904 Ga0496118_0076401 3300048921 Bacteria 2382
905 Ga0496118_0131082 3300048921 Bacteria 1610
906 Ga0496118_0134133 3300048921 Bacteria 1583
907 Ga0496119_0000016 3300048922 Bacteria 309806
908 Ga0496119_0025249 3300048922 Bacteria 4154
909 Ga0496119_0169367 3300048922 Bacteria 1155
910 Ga0496120_0000310 3300048923 Bacteria 81092
911 Ga0496120_0014298 3300048923 Bacteria 5298
912 Ga0496121_0000199 3300048924 Bacteria 132751
913 Ga0496121_0002620 3300048924 Bacteria 27128
914 Ga0496121_0004114 3300048924 Bacteria 19942
915 Ga0496121_0013203 3300048924 Bacteria 8900
916 Ga0496121_0018115 3300048924 Bacteria 7125
917 Ga0496121_0031729 3300048924 Bacteria 4819
918 Ga0496121_0166251 3300048924 Bacteria 1607
919 Ga0496122_0000285 3300048925 Bacteria 113073
920 Ga0496122_0001556 3300048925 Bacteria 36329
921 Ga0496122_0002556 3300048925 Bacteria 25569
922 Ga0496122_0003462 3300048925 Bacteria 20754
923 Ga0496122_0032233 3300048925 Bacteria 4338
924 Ga0496122_0033675 3300048925 Bacteria 4208
925 Ga0496122_0042353 3300048925 Bacteria 3584
926 Ga0496122_0057594 3300048925 Bacteria 2884
927 Ga0496122_0084045 3300048925 Bacteria 2204
928 Ga0496123_0000028 3300048926 Bacteria 306006
929 Ga0496123_0000232 3300048926 Bacteria 113073
930 Ga0496123_0006867 3300048926 Bacteria 10900
931 Ga0496123_0009172 3300048926 Bacteria 8945
932 Ga0496123_0009973 3300048926 Bacteria 8465
933 Ga0496123_0011036 3300048926 Bacteria 7887
934 Ga0496123_0023832 3300048926 Bacteria 4673
935 Ga0496123_0047498 3300048926 Bacteria 2899
936 Ga0496123_0205838 3300048926 Bacteria 1004
937 Ga0496124_0000845 3300048927 Bacteria 49946
938 Ga0496124_0003855 3300048927 Bacteria 17946
939 Ga0496124_0006097 3300048927 Bacteria 13258
940 Ga0496124_0012251 3300048927 Bacteria 8477
941 Ga0496124_0016579 3300048927 Bacteria 6993
942 Ga0496124_0017941 3300048927 Bacteria 6651
943 Ga0496124_0029892 3300048927 Bacteria 4846
944 Ga0496124_0052275 3300048927 Bacteria 3471
945 Ga0496124_0065967 3300048927 Bacteria 3016
946 Ga0496124_0068180 3300048927 Bacteria 2958
947 Ga0496124_0178626 3300048927 Bacteria 1636
948 Ga0496124_0316514 3300048927 Bacteria 1119
949 Ga0496124_0355513 3300048927 Bacteria 1034
950 Ga0496125_0000038 3300048928 Bacteria 328120
951 Ga0496125_0006102 3300048928 Bacteria 13154
952 Ga0496125_0008266 3300048928 Bacteria 10927
953 Ga0496125_0014915 3300048928 Bacteria 7547
954 Ga0496125_0016068 3300048928 Bacteria 7204
955 Ga0496125_0069656 3300048928 Bacteria 2758
956 Ga0496126_0001078 3300048929 Bacteria 45930
957 Ga0496126_0847537 3300048929 Bacteria 697
958 Ga0495678_000037 3300049459 Bacteria 197851
959 Ga0495678_000309 3300049459 Bacteria 52491
960 Ga0495678_000573 3300049459 Bacteria 34988
961 Ga0495678_004351 3300049459 Bacteria 8231
962 Ga0495678_004855 3300049459 Bacteria 7615
963 Ga0495678_014755 3300049459 Bacteria 3621
964 Ga0495678_014771 3300049459 Bacteria 3619
965 Ga0495678_015339 3300049459 Bacteria 3529
966 Ga0495678_018439 3300049459 Bacteria 3137
967 Ga0495678_033073 3300049459 Bacteria 2137
968 Ga0495678_034781 3300049459 Bacteria 2070
969 Ga0495678_078501 3300049459 Bacteria 1191
970 Ga0495682_0000020 3300049460 Bacteria 210849
971 Ga0495682_0002232 3300049460 Bacteria 9338
972 Ga0501031_0039731 3300049568 Bacteria 3071
973 Ga0501033_0147188 3300049570 Bacteria 1700
974 Ga0501034_0000154 3300049571 Bacteria 129750
975 Ga0501034_0002701 3300049571 Bacteria 20885
976 Ga0501037_0000642 3300049573 Bacteria 27029
977 Ga0501037_0010929 3300049573 Bacteria 6672
978 Ga0501038_0008387 3300049574 Bacteria 9503
979 Ga0501039_0000426 3300049575 Bacteria 30431
980 Ga0501043_0160252 3300049579 Bacteria 1758
981 Ga0501046_0004813 3300049580 Bacteria 12171
982 Ga0501047_0004014 3300049581 Bacteria 13833
983 Ga0501048_0000754 3300049582 Bacteria 23695
984 Ga0501067_0010822 3300049583 Bacteria 5046
985 Ga0501080_0000620 3300049742 Bacteria 28124
986 Ga0501241_000265 3300049758 Bacteria 11675
987 Ga0501241_016342 3300049758 Bacteria 1353
988 Ga0501035_0000020 3300049822 Bacteria 221605
989 Ga0501044_0000397 3300049823 Bacteria 54054
990 Ga0501226_000854 3300049853 Bacteria 4082
991 nmdc:mga03683_56220_c1 3300050489 Bacteria 1654
992 nmdc:mga00v17_32906_c1 3300050491 Bacteria 3068
993 nmdc:mga00v17_394140_c1 3300050491 Bacteria 900
994 nmdc:mga08x19_199240_c1 3300050514 Bacteria 1372
995 Ga0500643_000521 3300053087 Bacteria 27149
996 Ga0500643_001627 3300053087 Bacteria 12551
997 Ga0500641_0000496 3300053096 Bacteria 14224
998 Ga0500650_0196879 3300053098 Bacteria 919
999 Ga0500650_0234971 3300053098 Bacteria 826
1000 Ga0500556_0019834 3300053104 Bacteria 2143
1001 Ga0500562_003504 3300053108 Bacteria 3935
1002 Ga0500562_009216 3300053108 Bacteria 2495
1003 Ga0500572_000566 3300053111 Bacteria 12617
1004 Ga0500595_106409 3300053119 Bacteria 800
1005 Ga0500618_022445 3300053125 Bacteria 1534
1006 Ga0500659_0001554 3300053135 Bacteria 14414
1007 Ga0500573_0069783 3300053140 Bacteria 2005
1008 Ga0500616_0005812 3300053153 Bacteria 8279
1009 Ga0500616_0059483 3300053153 Bacteria 1984
1010 Ga0500616_0120588 3300053153 Bacteria 1253
1011 Ga0500616_0184955 3300053153 Bacteria 935
1012 Ga0500622_0022117 3300053156 Bacteria 3372
1013 Ga0500622_0162555 3300053156 Bacteria 1046
1014 Ga0500634_0000091 3300053161 Bacteria 34955
1015 Ga0500645_001154 3300053730 Bacteria 14234
1016 Ga0500645_022142 3300053730 Bacteria 1957
1017 Ga0501082_0004759 3300060353 Bacteria 11845
1018 Ga0466962_0095127 3300061719 Bacteria 1428

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0847537 Ga0496126_0847537_144_674 176
2 3300053119 Ga0500595_106409 Ga0500595_106409_260_790 176
3 3300044683 Ga0466965_0012175 Ga0466965_0012175_1194_1853 180
4 3300049582 Ga0501048_0000754 Ga0501048_0000754_7755_8360 184
5 iso_pu_bacteria 2929189879 2929192710 184
6 3300025711 Ga0207696_1018265 Ga0207696_10182652 185
7 3300041453 Ga0451797_0248178 Ga0451797_0248178_59_625 185
8 3300025944 Ga0207661_10350006 Ga0207661_103500061 187
9 iso_pu_bacteria 2899275550 2899275657 187
10 2162886007 SwRhRL2b_contig_1587916 SwRhRL2b_0328.00011640 189
11 3300005289 Ga0065704_10124139 Ga0065704_101241392 189
12 3300006944 Ga0099823_1000029 Ga0099823_100002948 189
13 3300009011 Ga0105251_10010585 Ga0105251_100105851 189
14 3300009036 Ga0105244_10015652 Ga0105244_100156525 189
15 3300009148 Ga0105243_10020104 Ga0105243_100201042 189
16 3300025728 Ga0207655_1041659 Ga0207655_10416592 189
17 3300025935 Ga0207709_10012519 Ga0207709_100125192 189
18 3300027296 Ga0209389_1000091 Ga0209389_100009111 189
19 3300042006 Ga0439432_003675 Ga0439432_003675_4604_5233 189
20 3300042142 Ga0450905_005175 Ga0450905_005175_1052_1681 189
21 3300046515 Ga0495620_0000006 Ga0495620_0000006_18164_18793 189
22 3300046519 Ga0495632_0000074 Ga0495632_0000074_91151_91780 189
23 3300046522 Ga0495643_0000185 Ga0495643_0000185_87521_88150 189
24 3300046524 Ga0495648_0000243 Ga0495648_0000243_48841_49470 189
25 3300048906 Ga0496103_0394662 Ga0496103_0394662_149_769 189
26 3300048919 Ga0496116_0126930 Ga0496116_0126930_85_714 189
27 3300048920 Ga0496117_0000272 Ga0496117_0000272_29157_29786 189
28 3300049571 Ga0501034_0000154 Ga0501034_0000154_17951_18580 189
29 3300053135 Ga0500659_0001554 Ga0500659_0001554_9654_10283 189
30 3300009092 Ga0105250_10306551 Ga0105250_103065511 190
31 3300046543 Ga0495645_0260393 Ga0495645_0260393_68_733 190
32 3300003781 Ga0055536_1000165 Ga0055536_100016510 191
33 3300003791 Ga0055530_10000357 Ga0055530_1000035710 191
34 3300003792 Ga0055540_1001210 Ga0055540_100121015 191
35 3300025292 Ga0209676_1000021 Ga0209676_1000021254 191
36 3300025298 Ga0209050_1000595 Ga0209050_100059510 191
37 3300025303 Ga0209051_1000407 Ga0209051_100040751 191
38 3300041411 Ga0439466_0000181 Ga0439466_0000181_18477_19082 191
39 3300042013 Ga0439456_028274 Ga0439456_028274_28_633 191
40 3300042016 Ga0439463_000135 Ga0439463_000135_3584_4189 191
41 3300042993 Ga0439440_0001144 Ga0439440_0001144_3557_4162 191
42 3300048928 Ga0496125_0069656 Ga0496125_0069656_15_590 191
43 3300049460 Ga0495682_0000020 Ga0495682_0000020_7452_8060 191
44 3300053153 Ga0500616_0184955 Ga0500616_0184955_168_773 191
45 3300045051 Ga0451576_0230380 Ga0451576_0230380_672_1250 192
46 3300009036 Ga0105244_10039504 Ga0105244_100395044 193
47 iso_pu_bacteria 2643221558 2643813925 193
48 2162886007 SwRhRL2b_contig_2309387 SwRhRL2b_0467.00004360 194
49 3300003781 Ga0055536_1009023 Ga0055536_10090233 194
50 3300009036 Ga0105244_10000738 Ga0105244_1000073810 194
51 3300009036 Ga0105244_10015736 Ga0105244_100157364 194
52 3300013104 Ga0157370_10082525 Ga0157370_100825252 194
53 3300013307 Ga0157372_10019720 Ga0157372_100197203 194
54 3300025292 Ga0209676_1000752 Ga0209676_100075222 194
55 3300025711 Ga0207696_1000006 Ga0207696_1000006261 194
56 3300025711 Ga0207696_1017693 Ga0207696_10176931 194
57 3300025728 Ga0207655_1000940 Ga0207655_100094023 194
58 3300025728 Ga0207655_1001227 Ga0207655_10012279 194
59 3300025728 Ga0207655_1020537 Ga0207655_10205372 194
60 3300025735 Ga0207713_1012331 Ga0207713_10123314 194
61 3300048911 Ga0496108_0204626 Ga0496108_0204626_84_710 194
62 3300048913 Ga0496110_0153118 Ga0496110_0153118_546_1175 194
63 3300048917 Ga0496114_0057296 Ga0496114_0057296_662_1291 194
64 3300048920 Ga0496117_0004053 Ga0496117_0004053_4147_4776 194
65 3300048921 Ga0496118_0022749 Ga0496118_0022749_656_1285 194
66 3300048922 Ga0496119_0000016 Ga0496119_0000016_215182_215805 194
67 3300048923 Ga0496120_0000310 Ga0496120_0000310_12900_13523 194
68 3300048924 Ga0496121_0018115 Ga0496121_0018115_1558_2187 194
69 3300048925 Ga0496122_0001556 Ga0496122_0001556_19063_19692 194
70 3300048925 Ga0496122_0042353 Ga0496122_0042353_640_1269 194
71 3300048926 Ga0496123_0000028 Ga0496123_0000028_17519_18148 194
72 3300048926 Ga0496123_0205838 Ga0496123_0205838_244_873 194
73 3300048927 Ga0496124_0003855 Ga0496124_0003855_8421_9050 194
74 3300048927 Ga0496124_0006097 Ga0496124_0006097_7479_8099 194
75 3300048927 Ga0496124_0052275 Ga0496124_0052275_781_1410 194
76 3300048927 Ga0496124_0065967 Ga0496124_0065967_371_1000 194
77 3300048927 Ga0496124_0316514 Ga0496124_0316514_95_724 194
78 3300048928 Ga0496125_0000038 Ga0496125_0000038_32149_32778 194
79 3300048928 Ga0496125_0006102 Ga0496125_0006102_2886_3515 194
80 3300048928 Ga0496125_0016068 Ga0496125_0016068_6476_7105 194
81 iso_pu_bacteria 2643221736 2644743280 194
82 iso_pu_bacteria 2728369097 2729148181 194
83 iso_pu_bacteria 640427133 640487744 194
84 iso_pu_bacteria 651053060 651175679 194
85 3300035089 Ga0373944_0024203 Ga0373944_0024203_622_1239 195
86 3300035171 Ga0373946_0014580 Ga0373946_0014580_311_928 195
87 3300035695 Ga0373927_0000731 Ga0373927_0000731_7075_7692 195
88 3300035725 Ga0373947_0317631 Ga0373947_0317631_97_714 195
89 3300037068 Ga0373925_0000049 Ga0373925_0000049_116762_117379 195
90 3300045051 Ga0451576_0358142 Ga0451576_0358142_351_944 196
91 iso_pu_bacteria 2599185307 2599973711 196
92 iso_pu_bacteria 2891048133 2891052154 196
93 iso_pu_bacteria 2511231006 2511268462 197
94 iso_pu_bacteria 2512047018 2512324865 197
95 iso_pu_bacteria 2582580891 2583790991 197
96 iso_pu_bacteria 2597489887 2597856864 197
97 iso_pu_bacteria 2599185185 2599483891 197
98 iso_pu_bacteria 2599185257 2599801537 197
99 iso_pu_bacteria 2600254931 2600365834 197
100 iso_pu_bacteria 2671180172 2671768486 197
101 iso_pu_bacteria 2740892503 2743736292 197
102 iso_pu_bacteria 2895511927 2895513300 197
103 iso_pu_bacteria 2908446538 2908449517 197
104 iso_pu_bacteria 2923153595 2923155306 197
105 iso_pu_bacteria 2946006987 2946009638 197
106 iso_pu_bacteria 2984286254 2984290732 197
107 iso_pu_bacteria 3007395558 3007400846 197
108 iso_pu_bacteria 8015687852 8015689524 197
109 iso_pu_bacteria 8055770955 8055772661 197
110 3300039093 Ga0400489_31717 Ga0400489_31717_106_702 198
111 iso_pu_bacteria 2597489888 2597864157 198
112 iso_pu_bacteria 2599185155 2599330644 198
113 iso_pu_bacteria 2599185189 2599507255 198
114 iso_pu_bacteria 2599185191 2599521683 198
115 iso_pu_bacteria 2600255296 2601691996 198
116 iso_pu_bacteria 2643221571 2643873936 198
117 iso_pu_bacteria 2643221713 2644620330 198
118 iso_pu_bacteria 2721755607 2723248859 198
119 iso_pu_bacteria 2826581358 2826585121 198
120 iso_pu_bacteria 2842815866 2842818655 198
121 iso_pu_bacteria 2842826826 2842827058 198
122 iso_pu_bacteria 2842837860 2842839148 198
123 iso_pu_bacteria 2842849001 2842854248 198
124 iso_pu_bacteria 2860867994 2860870728 198
125 iso_pu_bacteria 2946027586 2946030808 198
126 iso_pu_bacteria 2947233263 2947237954 198
127 iso_pu_bacteria 8054347763 8054352399 198
128 iso_pu_bacteria 8054503363 8054506487 198
129 iso_pu_bacteria 8055817908 8055821236 198
130 iso_pu_bacteria 8056131705 8056134896 198
131 iso_pu_bacteria 8056148874 8056150784 198
132 3300006058 Ga0075432_10001643 Ga0075432_100016433 199
133 3300027907 Ga0207428_10482419 Ga0207428_104824192 199
134 3300048913 Ga0496110_0275727 Ga0496110_0275727_95_694 199
135 3300048914 Ga0496111_0003743 Ga0496111_0003743_6975_7574 199
136 3300048925 Ga0496122_0057594 Ga0496122_0057594_1474_2073 199
137 3300048926 Ga0496123_0009172 Ga0496123_0009172_6178_6777 199
138 3300053087 Ga0500643_000521 Ga0500643_000521_7741_8355 199
139 3300053096 Ga0500641_0000496 Ga0500641_0000496_128_742 199
140 3300053153 Ga0500616_0120588 Ga0500616_0120588_282_896 199
141 3300053156 Ga0500622_0162555 Ga0500622_0162555_382_996 199
142 3300053730 Ga0500645_001154 Ga0500645_001154_10866_11480 199
143 iso_pu_bacteria 2582581311 2585293137 199
144 iso_pu_bacteria 2599185239 2599740364 199
145 iso_pu_bacteria 2599185240 2599749000 199
146 iso_pu_bacteria 2599185355 2600211053 199
147 iso_pu_bacteria 2675903129 2676747206 199
148 iso_pu_bacteria 2808606384 2808968831 199
149 iso_pu_bacteria 2808606390 2809003662 199
150 iso_pu_bacteria 2808606391 2809010939 199
151 iso_pu_bacteria 2816332253 2817257563 199
152 iso_pu_bacteria 2816332256 2817282033 199
153 iso_pu_bacteria 2816332286 2817451506 199
154 iso_pu_bacteria 2818991452 2819635366 199
155 iso_pu_bacteria 2863421361 2863425180 199
156 iso_pu_bacteria 2870068957 2870074153 199
157 iso_pu_bacteria 2904564687 2904571584 199
158 iso_pu_bacteria 2904571731 2904578640 199
159 iso_pu_bacteria 2909399089 2909402385 199
160 iso_pu_bacteria 2928157003 2928161036 199
161 iso_pu_bacteria 2928163908 2928166028 199
162 iso_pu_bacteria 2928170801 2928171039 199
163 iso_pu_bacteria 2928536128 2928536527 199
164 iso_pu_bacteria 2981990288 2981991291 199
165 iso_pu_bacteria 641736154 642413943 199
166 iso_pu_bacteria 8018845410 8018849164 199
167 iso_pu_bacteria 8020807995 8020811172 199
168 iso_pu_bacteria 8020938398 8020943720 199
169 iso_pu_bacteria 8020945358 8020950059 199
170 iso_pu_bacteria 8020953355 8020953773 199
171 iso_pu_bacteria 8021120328 8021123211 199
172 iso_pu_bacteria 8039098773 8039103024 199
173 iso_pu_bacteria 8040167225 8040168279 199
174 iso_pu_bacteria 8040173305 8040175935 199
175 3300009011 Ga0105251_10066882 Ga0105251_100668821 200
176 3300009036 Ga0105244_10031584 Ga0105244_100315842 200
177 3300013100 Ga0157373_10017933 Ga0157373_100179332 200
178 3300013104 Ga0157370_10198950 Ga0157370_101989502 200
179 3300015265 Ga0182005_1026147 Ga0182005_10261472 200
180 3300025728 Ga0207655_1024503 Ga0207655_10245032 200
181 3300025735 Ga0207713_1000042 Ga0207713_100004224 200
182 3300037418 Ga0395900_0079296 Ga0395900_0079296_1468_2079 200
183 3300042016 Ga0439463_126636 Ga0439463_126636_25_627 200
184 3300046453 Ga0495627_005591 Ga0495627_005591_3118_3720 200
185 3300046458 Ga0495591_000064 Ga0495591_000064_16243_16845 200
186 3300046458 Ga0495591_000481 Ga0495591_000481_26961_27563 200
187 3300046471 Ga0495650_0001462 Ga0495650_0001462_1342_1944 200
188 3300046474 Ga0495605_0000191 Ga0495605_0000191_49969_50571 200
189 3300046474 Ga0495605_0027322 Ga0495605_0027322_2301_2903 200
190 3300046474 Ga0495605_0029904 Ga0495605_0029904_1407_2009 200
191 3300046501 Ga0495607_0000058 Ga0495607_0000058_2804_3406 200
192 3300046506 Ga0495583_0000465 Ga0495583_0000465_34756_35358 200
193 3300046506 Ga0495583_0001061 Ga0495583_0001061_4116_4718 200
194 3300046506 Ga0495583_0004020 Ga0495583_0004020_5496_6098 200
195 3300046507 Ga0495606_0000691 Ga0495606_0000691_24879_25481 200
196 3300046507 Ga0495606_0013017 Ga0495606_0013017_1584_2186 200
197 3300046512 Ga0495610_0003532 Ga0495610_0003532_353_955 200
198 3300046515 Ga0495620_0004194 Ga0495620_0004194_1766_2368 200
199 3300046515 Ga0495620_0075761 Ga0495620_0075761_434_1036 200
200 3300046515 Ga0495620_0221031 Ga0495620_0221031_69_671 200
201 3300046519 Ga0495632_0000162 Ga0495632_0000162_24522_25124 200
202 3300046538 Ga0495609_0000011 Ga0495609_0000011_24614_25216 200
203 3300046538 Ga0495609_0019639 Ga0495609_0019639_1273_1875 200
204 3300046616 Ga0495668_0135602 Ga0495668_0135602_17_619 200
205 3300046616 Ga0495668_0230155 Ga0495668_0230155_121_738 200
206 3300046665 Ga0495661_0000018 Ga0495661_0000018_24695_25297 200
207 3300046665 Ga0495661_0051854 Ga0495661_0051854_1180_1782 200
208 3300046810 Ga0495660_0025510 Ga0495660_0025510_1118_1720 200
209 3300047469 Ga0495673_0073449 Ga0495673_0073449_807_1409 200
210 3300047469 Ga0495673_0139864 Ga0495673_0139864_131_733 200
211 3300047469 Ga0495673_0145522 Ga0495673_0145522_159_761 200
212 3300048904 Ga0496101_0258484 Ga0496101_0258484_188_790 200
213 3300048905 Ga0496102_0118909 Ga0496102_0118909_1069_1671 200
214 3300048913 Ga0496110_0355037 Ga0496110_0355037_182_784 200
215 3300048914 Ga0496111_0282541 Ga0496111_0282541_220_822 200
216 3300048918 Ga0496115_0522910 Ga0496115_0522910_257_868 200
217 3300048920 Ga0496117_0083261 Ga0496117_0083261_345_947 200
218 3300048921 Ga0496118_0131082 Ga0496118_0131082_965_1567 200
219 3300048921 Ga0496118_0134133 Ga0496118_0134133_516_1118 200
220 3300048923 Ga0496120_0014298 Ga0496120_0014298_3865_4467 200
221 3300048924 Ga0496121_0002620 Ga0496121_0002620_1408_2010 200
222 3300048924 Ga0496121_0031729 Ga0496121_0031729_3608_4210 200
223 3300048925 Ga0496122_0000285 Ga0496122_0000285_24287_24889 200
224 3300048925 Ga0496122_0084045 Ga0496122_0084045_631_1233 200
225 3300048926 Ga0496123_0000232 Ga0496123_0000232_88185_88787 200
226 3300048926 Ga0496123_0047498 Ga0496123_0047498_1055_1657 200
227 3300048927 Ga0496124_0000845 Ga0496124_0000845_47948_48550 200
228 3300048927 Ga0496124_0029892 Ga0496124_0029892_654_1256 200
229 3300053098 Ga0500650_0196879 Ga0500650_0196879_112_729 200
230 3300053104 Ga0500556_0019834 Ga0500556_0019834_690_1307 200
231 3300053108 Ga0500562_003504 Ga0500562_003504_131_748 200
232 3300053108 Ga0500562_009216 Ga0500562_009216_1106_1723 200
233 3300053153 Ga0500616_0059483 Ga0500616_0059483_677_1294 200
234 3300053156 Ga0500622_0022117 Ga0500622_0022117_2731_3348 200
235 3300053730 Ga0500645_022142 Ga0500645_022142_854_1471 200
236 iso_pu_bacteria 2511231004 2511257864 200
237 iso_pu_bacteria 2511231010 2511290661 200
238 iso_pu_bacteria 2511231011 2511296330 200
239 iso_pu_bacteria 2511231012 2511301025 200
240 iso_pu_bacteria 2511231014 2511315642 200
241 iso_pu_bacteria 2511231015 2511317734 200
242 iso_pu_bacteria 2511231017 2511333973 200
243 iso_pu_bacteria 2511231018 2511340166 200
244 iso_pu_bacteria 2511231019 2511346430 200
245 iso_pu_bacteria 2511231020 2511353355 200
246 iso_pu_bacteria 2511231023 2511367758 200
247 iso_pu_bacteria 2511231024 2511373764 200
248 iso_pu_bacteria 2511231031 2511415198 200
249 iso_pu_bacteria 2511231156 2511823797 200
250 iso_pu_bacteria 2554235132 2554815288 200
251 iso_pu_bacteria 2554235231 2555248507 200
252 iso_pu_bacteria 2599185160 2599354682 200
253 iso_pu_bacteria 2599185161 2599359605 200
254 iso_pu_bacteria 2599185162 2599365927 200
255 iso_pu_bacteria 2599185163 2599372717 200
256 iso_pu_bacteria 2599185164 2599379789 200
257 iso_pu_bacteria 2599185165 2599385232 200
258 iso_pu_bacteria 2599185166 2599391576 200
259 iso_pu_bacteria 2599185168 2599403342 200
260 iso_pu_bacteria 2599185181 2599461516 200
261 iso_pu_bacteria 2599185182 2599470059 200
262 iso_pu_bacteria 2599185186 2599490535 200
263 iso_pu_bacteria 2599185188 2599504437 200
264 iso_pu_bacteria 2599185212 2599615912 200
265 iso_pu_bacteria 2599185248 2599773105 200
266 iso_pu_bacteria 2599185289 2599889509 200
267 iso_pu_bacteria 2599185291 2599900907 200
268 iso_pu_bacteria 2599185300 2599933322 200
269 iso_pu_bacteria 2599185302 2599944218 200
270 iso_pu_bacteria 2599185304 2599956436 200
271 iso_pu_bacteria 2599185305 2599963315 200
272 iso_pu_bacteria 2599185306 2599969541 200
273 iso_pu_bacteria 2599185308 2599981083 200
274 iso_pu_bacteria 2599185309 2599985131 200
275 iso_pu_bacteria 2599185310 2599989242 200
276 iso_pu_bacteria 2599185311 2599994139 200
277 iso_pu_bacteria 2599185312 2600000361 200
278 iso_pu_bacteria 2599185313 2600008072 200
279 iso_pu_bacteria 2599185314 2600014930 200
280 iso_pu_bacteria 2599185315 2600019477 200
281 iso_pu_bacteria 2599185316 2600025966 200
282 iso_pu_bacteria 2599185317 2600032179 200
283 iso_pu_bacteria 2599185318 2600039374 200
284 iso_pu_bacteria 2599185319 2600042540 200
285 iso_pu_bacteria 2599185320 2600049435 200
286 iso_pu_bacteria 2599185321 2600053987 200
287 iso_pu_bacteria 2599185322 2600062117 200
288 iso_pu_bacteria 2599185323 2600065703 200
289 iso_pu_bacteria 2599185324 2600070910 200
290 iso_pu_bacteria 2599185325 2600079945 200
291 iso_pu_bacteria 2599185356 2600214134 200
292 iso_pu_bacteria 2600254930 2600361804 200
293 iso_pu_bacteria 2600255313 2601774300 200
294 iso_pu_bacteria 2600255318 2601796169 200
295 iso_pu_bacteria 2603880185 2606073318 200
296 iso_pu_bacteria 2603880199 2606127036 200
297 iso_pu_bacteria 2606217733 2608384416 200
298 iso_pu_bacteria 2623620443 2624481818 200
299 iso_pu_bacteria 2643221565 2643845530 200
300 iso_pu_bacteria 2643221589 2643956406 200
301 iso_pu_bacteria 2643221602 2644025552 200
302 iso_pu_bacteria 2643221650 2644285047 200
303 iso_pu_bacteria 2651869719 2652544835 200
304 iso_pu_bacteria 2667528170 2671093536 200
305 iso_pu_bacteria 2667528171 2671097263 200
306 iso_pu_bacteria 2667528176 2671130283 200
307 iso_pu_bacteria 2675903515 2678264354 200
308 iso_pu_bacteria 2713897148 2715751128 200
309 iso_pu_bacteria 2713897149 2715758119 200
310 iso_pu_bacteria 2718217725 2718635067 200
311 iso_pu_bacteria 2738543004 2739201871 200
312 iso_pu_bacteria 2738543015 2739259324 200
313 iso_pu_bacteria 2738543025 2739314170 200
314 iso_pu_bacteria 2744054620 2745004808 200
315 iso_pu_bacteria 2765235841 2765584281 200
316 iso_pu_bacteria 2773857670 2774123354 200
317 iso_pu_bacteria 2773857673 2774132726 200
318 iso_pu_bacteria 2784132063 2784263460 200
319 iso_pu_bacteria 2784132072 2784316104 200
320 iso_pu_bacteria 2791355520 2794596040 200
321 iso_pu_bacteria 2806310737 2807408349 200
322 iso_pu_bacteria 2806310745 2807456663 200
323 iso_pu_bacteria 2808606361 2808858726 200
324 iso_pu_bacteria 2808606376 2808924328 200
325 iso_pu_bacteria 2808606378 2808938863 200
326 iso_pu_bacteria 2808606380 2808946287 200
327 iso_pu_bacteria 2808606382 2808957374 200
328 iso_pu_bacteria 2808606383 2808967216 200
329 iso_pu_bacteria 2808606389 2809002027 200
330 iso_pu_bacteria 2808606445 2809218676 200
331 iso_pu_bacteria 2818991456 2819655561 200
332 iso_pu_bacteria 2818991464 2819702360 200
333 iso_pu_bacteria 2825651385 2825656704 200
334 iso_pu_bacteria 2842832357 2842836419 200
335 iso_pu_bacteria 2842843487 2842844533 200
336 iso_pu_bacteria 2842854478 2842859385 200
337 iso_pu_bacteria 2844665904 2844671703 200
338 iso_pu_bacteria 2852657418 2852662439 200
339 iso_pu_bacteria 2860339153 2860340712 200
340 iso_pu_bacteria 2878029506 2878033800 200
341 iso_pu_bacteria 2880230671 2880234427 200
342 iso_pu_bacteria 2904518522 2904523969 200
343 iso_pu_bacteria 2904550169 2904555603 200
344 iso_pu_bacteria 2913036834 2913040843 200
345 iso_pu_bacteria 2917070673 2917075017 200
346 iso_pu_bacteria 2919063839 2919068788 200
347 iso_pu_bacteria 2919155634 2919156410 200
348 iso_pu_bacteria 2919385768 2919387902 200
349 iso_pu_bacteria 2919456309 2919461170 200
350 iso_pu_bacteria 2919481497 2919487355 200
351 iso_pu_bacteria 2919487758 2919489916 200
352 iso_pu_bacteria 2923586266 2923589865 200
353 iso_pu_bacteria 2929144301 2929148332 200
354 iso_pu_bacteria 2931369376 2931374257 200
355 iso_pu_bacteria 2931396565 2931403265 200
356 iso_pu_bacteria 2935353572 2935356005 200
357 iso_pu_bacteria 2939636861 2939637714 200
358 iso_pu_bacteria 2939651529 2939655603 200
359 iso_pu_bacteria 2969304461 2969308577 200
360 iso_pu_bacteria 2974289157 2974290041 200
361 iso_pu_bacteria 2988728565 2988729956 200
362 iso_pu_bacteria 3007419365 3007424063 200
363 iso_pu_bacteria 3007511990 3007515578 200
364 iso_pu_bacteria 3007614139 3007617243 200
365 iso_pu_bacteria 3007619802 3007623776 200
366 iso_pu_bacteria 3007718800 3007718808 200
367 iso_pu_bacteria 3007803356 3007803956 200
368 iso_pu_bacteria 3007855910 3007857797 200
369 iso_pu_bacteria 3007861166 3007861182 200
370 iso_pu_bacteria 3007866637 3007868208 200
371 iso_pu_bacteria 3007872151 3007875127 200
372 iso_pu_bacteria 637000220 637321490 200
373 iso_pu_bacteria 8029995093 8029996987 200
374 iso_pu_bacteria 8054929484 8054932229 200
375 iso_pu_bacteria 8055878733 8055883304 200
376 iso_pu_bacteria 8056120720 8056123153 200
377 iso_pu_bacteria 8056125926 8056127675 200
378 iso_pu_bacteria 8056137416 8056140655 200
379 iso_pu_bacteria 8056143049 8056145032 200
380 iso_pu_bacteria 8056166840 8056167386 200
381 iso_pu_bacteria 8056172158 8056173372 200
382 iso_pu_bacteria 8056569372 8056572627 200
383 3300009011 Ga0105251_10000031 Ga0105251_1000003124 201
384 3300017792 Ga0163161_10088392 Ga0163161_100883923 201
385 3300041498 Ga0451841_0467719 Ga0451841_0467719_216_821 201
386 3300042016 Ga0439463_002404 Ga0439463_002404_49_726 201
387 3300044683 Ga0466965_0137102 Ga0466965_0137102_511_1122 201
388 3300046453 Ga0495627_000013 Ga0495627_000013_24209_24814 201
389 3300046458 Ga0495591_000041 Ga0495591_000041_129168_129773 201
390 3300046474 Ga0495605_0001761 Ga0495605_0001761_106_711 201
391 3300046501 Ga0495607_0000936 Ga0495607_0000936_691_1296 201
392 3300046507 Ga0495606_0026021 Ga0495606_0026021_2451_3056 201
393 3300046520 Ga0495637_0000947 Ga0495637_0000947_10410_11015 201
394 3300046530 Ga0495654_0103381 Ga0495654_0103381_606_1211 201
395 3300046542 Ga0495597_0000004 Ga0495597_0000004_25924_26529 201
396 3300046660 Ga0495625_0296255 Ga0495625_0296255_341_946 201
397 3300046810 Ga0495660_0005400 Ga0495660_0005400_4233_4838 201
398 3300047320 Ga0495672_0001345 Ga0495672_0001345_22838_23443 201
399 3300047320 Ga0495672_0069864 Ga0495672_0069864_1272_1877 201
400 3300047469 Ga0495673_0000183 Ga0495673_0000183_93024_93629 201
401 3300047470 Ga0495681_0016972 Ga0495681_0016972_2690_3295 201
402 3300048903 Ga0496100_0793705 Ga0496100_0793705_63_731 201
403 3300048920 Ga0496117_0251105 Ga0496117_0251105_133_738 201
404 3300048922 Ga0496119_0169367 Ga0496119_0169367_295_900 201
405 3300048925 Ga0496122_0033675 Ga0496122_0033675_1077_1682 201
406 3300049571 Ga0501034_0002701 Ga0501034_0002701_12965_13570 201
407 3300049573 Ga0501037_0000642 Ga0501037_0000642_6295_6900 201
408 3300049574 Ga0501038_0008387 Ga0501038_0008387_2916_3521 201
409 3300049575 Ga0501039_0000426 Ga0501039_0000426_10639_11244 201
410 3300049579 Ga0501043_0160252 Ga0501043_0160252_786_1391 201
411 3300049580 Ga0501046_0004813 Ga0501046_0004813_6218_6823 201
412 3300049581 Ga0501047_0004014 Ga0501047_0004014_5999_6604 201
413 3300049583 Ga0501067_0010822 Ga0501067_0010822_2187_2792 201
414 3300049742 Ga0501080_0000620 Ga0501080_0000620_1909_2514 201
415 3300049822 Ga0501035_0000020 Ga0501035_0000020_188588_189193 201
416 3300049823 Ga0501044_0000397 Ga0501044_0000397_7176_7781 201
417 3300053098 Ga0500650_0234971 Ga0500650_0234971_53_658 201
418 3300053140 Ga0500573_0069783 Ga0500573_0069783_590_1195 201
419 3300053153 Ga0500616_0005812 Ga0500616_0005812_4423_5028 201
420 3300060353 Ga0501082_0004759 Ga0501082_0004759_724_1329 201
421 3300001989 JGI24739J22299_10001779 JGI24739J22299_100017796 202
422 3300001989 JGI24739J22299_10013520 JGI24739J22299_100135202 202
423 3300002738 JGI25154J39366_1001189 JGI25154J39366_10011891 202
424 3300003320 rootH2_10030798 rootH2_1003079813 202
425 3300003320 rootH2_10232438 rootH2_102324383 202
426 3300003751 Ga0055538_1000007 Ga0055538_1000007287 202
427 3300003752 Ga0055539_1000011 Ga0055539_1000011287 202
428 3300003756 Ga0055533_1000014 Ga0055533_1000014287 202
429 3300003758 Ga0055532_1000009 Ga0055532_1000009287 202
430 3300003758 Ga0055532_1000262 Ga0055532_100026234 202
431 3300003758 Ga0055532_1000320 Ga0055532_100032029 202
432 3300003758 Ga0055532_1002026 Ga0055532_10020264 202
433 3300003759 Ga0055525_1000016 Ga0055525_1000016287 202
434 3300003760 Ga0055527_1000280 Ga0055527_100028029 202
435 3300003760 Ga0055527_1006864 Ga0055527_10068642 202
436 3300003761 Ga0055535_1000591 Ga0055535_100059129 202
437 3300003761 Ga0055535_1002021 Ga0055535_10020218 202
438 3300003761 Ga0055535_1008009 Ga0055535_10080092 202
439 3300003762 Ga0055542_1001740 Ga0055542_10017407 202
440 3300003762 Ga0055542_1002922 Ga0055542_10029226 202
441 3300003763 Ga0055529_1000978 Ga0055529_10009787 202
442 3300003790 Ga0055528_1003527 Ga0055528_10035274 202
443 3300003841 Ga0055541_1000008 Ga0055541_1000008287 202
444 3300003841 Ga0055541_1014359 Ga0055541_10143591 202
445 3300003856 Ga0058692_1004472 Ga0058692_10044721 202
446 3300005288 Ga0065714_10064719 Ga0065714_100647195 202
447 3300005327 Ga0070658_10182062 Ga0070658_101820623 202
448 3300005331 Ga0070670_100000137 Ga0070670_10000013743 202
449 3300005335 Ga0070666_10012704 Ga0070666_100127042 202
450 3300005339 Ga0070660_100000159 Ga0070660_10000015942 202
451 3300005344 Ga0070661_100000749 Ga0070661_10000074914 202
452 3300005366 Ga0070659_100000223 Ga0070659_1000002234 202
453 3300005455 Ga0070663_100001049 Ga0070663_1000010493 202
454 3300005564 Ga0070664_100000861 Ga0070664_10000086115 202
455 3300005577 Ga0068857_100412432 Ga0068857_1004124323 202
456 3300005616 Ga0068852_100138430 Ga0068852_1001384302 202
457 3300005842 Ga0068858_100062991 Ga0068858_1000629913 202
458 3300009036 Ga0105244_10000796 Ga0105244_1000079616 202
459 3300009036 Ga0105244_10018334 Ga0105244_100183345 202
460 3300009036 Ga0105244_10082108 Ga0105244_100821083 202
461 3300009092 Ga0105250_10013636 Ga0105250_100136363 202
462 3300009093 Ga0105240_10001196 Ga0105240_100011968 202
463 3300009093 Ga0105240_10042007 Ga0105240_100420074 202
464 3300009148 Ga0105243_10214397 Ga0105243_102143973 202
465 3300009176 Ga0105242_10016730 Ga0105242_100167305 202
466 3300009545 Ga0105237_10004461 Ga0105237_1000446113 202
467 3300009545 Ga0105237_10065380 Ga0105237_100653801 202
468 3300009551 Ga0105238_10154380 Ga0105238_101543804 202
469 3300011119 Ga0105246_10000357 Ga0105246_1000035717 202
470 3300013100 Ga0157373_10000225 Ga0157373_1000022540 202
471 3300013100 Ga0157373_10006005 Ga0157373_100060059 202
472 3300013100 Ga0157373_10046441 Ga0157373_100464413 202
473 3300013105 Ga0157369_10001402 Ga0157369_1000140213 202
474 3300013105 Ga0157369_10005269 Ga0157369_100052694 202
475 3300013306 Ga0163162_10077091 Ga0163162_100770912 202
476 3300013308 Ga0157375_10000139 Ga0157375_1000013940 202
477 3300013308 Ga0157375_10002380 Ga0157375_100023808 202
478 3300015262 Ga0182007_10001953 Ga0182007_100019533 202
479 3300017792 Ga0163161_10050229 Ga0163161_100502293 202
480 3300021388 Ga0213875_10001893 Ga0213875_100018931 202
481 3300025224 Ga0209784_100023 Ga0209784_100023282 202
482 3300025225 Ga0209566_100019 Ga0209566_100019295 202
483 3300025225 Ga0209566_100443 Ga0209566_10044321 202
484 3300025226 Ga0209674_100034 Ga0209674_100034295 202
485 3300025228 Ga0209672_100012 Ga0209672_100012431 202
486 3300025228 Ga0209672_100063 Ga0209672_100063198 202
487 3300025229 Ga0209147_100007 Ga0209147_100007340 202
488 3300025229 Ga0209147_100027 Ga0209147_100027297 202
489 3300025229 Ga0209147_100077 Ga0209147_100077198 202
490 3300025229 Ga0209147_100119 Ga0209147_100119107 202
491 3300025230 Ga0209563_100037 Ga0209563_100037295 202
492 3300025242 Ga0209258_100014 Ga0209258_100014362 202
493 3300025242 Ga0209258_100105 Ga0209258_100105198 202
494 3300025242 Ga0209258_100520 Ga0209258_1005209 202
495 3300025246 Ga0209646_1000110 Ga0209646_1000110111 202
496 3300025253 Ga0209677_100021 Ga0209677_100021295 202
497 3300025254 Ga0209148_1000107 Ga0209148_1000107198 202
498 3300025254 Ga0209148_1000337 Ga0209148_10003371 202
499 3300025256 Ga0209759_1001226 Ga0209759_10012266 202
500 3300025272 Ga0209455_1000100 Ga0209455_1000100198 202
501 3300025272 Ga0209455_1000138 Ga0209455_1000138144 202
502 3300025273 Ga0209673_1000101 Ga0209673_1000101142 202
503 3300025295 Ga0209564_1007842 Ga0209564_10078426 202
504 3300025711 Ga0207696_1012173 Ga0207696_10121734 202
505 3300025728 Ga0207655_1000074 Ga0207655_1000074152 202
506 3300025728 Ga0207655_1001930 Ga0207655_100193013 202
507 3300025728 Ga0207655_1018219 Ga0207655_10182192 202
508 3300025735 Ga0207713_1013609 Ga0207713_10136093 202
509 3300025904 Ga0207647_10005055 Ga0207647_100050552 202
510 3300025909 Ga0207705_10098965 Ga0207705_100989653 202
511 3300025913 Ga0207695_10000368 Ga0207695_1000036833 202
512 3300025913 Ga0207695_10043331 Ga0207695_100433315 202
513 3300025914 Ga0207671_10065834 Ga0207671_100658344 202
514 3300025919 Ga0207657_10000442 Ga0207657_1000044243 202
515 3300025920 Ga0207649_10000954 Ga0207649_1000095410 202
516 3300025920 Ga0207649_10107248 Ga0207649_101072483 202
517 3300025924 Ga0207694_10163663 Ga0207694_101636632 202
518 3300025925 Ga0207650_10001314 Ga0207650_1000131411 202
519 3300025932 Ga0207690_10000037 Ga0207690_10000037107 202
520 3300025945 Ga0207679_10000097 Ga0207679_1000009768 202
521 3300025949 Ga0207667_10136649 Ga0207667_101366493 202
522 3300026035 Ga0207703_10072389 Ga0207703_100723893 202
523 3300026067 Ga0207678_10000317 Ga0207678_100003173 202
524 3300026116 Ga0207674_10058378 Ga0207674_100583785 202
525 3300027312 Ga0209371_1000080 Ga0209371_100008091 202
526 3300030500 Ga0268256_1000160 Ga0268256_100016042 202
527 3300031731 Ga0307405_10000024 Ga0307405_1000002436 202
528 3300037466 Ga0395898_0139849 Ga0395898_0139849_379_996 202
529 3300037853 Ga0436364_0011200 Ga0436364_0011200_13455_14063 202
530 3300039437 Ga0436365_0907137 Ga0436365_0907137_1167_1781 202
531 3300044656 Ga0466969_0005486 Ga0466969_0005486_970_1590 202
532 3300044658 Ga0466972_0050894 Ga0466972_0050894_696_1313 202
533 3300044683 Ga0466965_0021841 Ga0466965_0021841_558_1175 202
534 3300045976 Ga0466967_0157347 Ga0466967_0157347_1069_1686 202
535 3300046454 Ga0495592_0128017 Ga0495592_0128017_19_633 202
536 3300046458 Ga0495591_003090 Ga0495591_003090_5599_6207 202
537 3300046458 Ga0495591_016768 Ga0495591_016768_1882_2490 202
538 3300046471 Ga0495650_0006670 Ga0495650_0006670_5396_6004 202
539 3300046474 Ga0495605_0000212 Ga0495605_0000212_45632_46240 202
540 3300046499 Ga0495594_0000125 Ga0495594_0000125_13501_14109 202
541 3300046506 Ga0495583_0000036 Ga0495583_0000036_220017_220625 202
542 3300046507 Ga0495606_0000724 Ga0495606_0000724_32490_33098 202
543 3300046512 Ga0495610_0010542 Ga0495610_0010542_3160_3768 202
544 3300046512 Ga0495610_0050357 Ga0495610_0050357_1343_1951 202
545 3300046513 Ga0495616_0143504 Ga0495616_0143504_415_1023 202
546 3300046515 Ga0495620_0000022 Ga0495620_0000022_110324_110932 202
547 3300046515 Ga0495620_0006752 Ga0495620_0006752_2663_3271 202
548 3300046520 Ga0495637_0036173 Ga0495637_0036173_562_1170 202
549 3300046524 Ga0495648_0006428 Ga0495648_0006428_5430_6038 202
550 3300046530 Ga0495654_0002862 Ga0495654_0002862_5537_6145 202
551 3300046530 Ga0495654_0002994 Ga0495654_0002994_9826_10434 202
552 3300046538 Ga0495609_0000631 Ga0495609_0000631_24823_25431 202
553 3300046542 Ga0495597_0039126 Ga0495597_0039126_1331_1939 202
554 3300046558 Ga0495633_0000140 Ga0495633_0000140_25351_25959 202
555 3300046648 Ga0495611_0001100 Ga0495611_0001100_7912_8520 202
556 3300046665 Ga0495661_0000313 Ga0495661_0000313_33925_34533 202
557 3300046691 Ga0495670_0003253 Ga0495670_0003253_7097_7705 202
558 3300046694 Ga0495649_0003972 Ga0495649_0003972_8110_8718 202
559 3300046694 Ga0495649_0086955 Ga0495649_0086955_127_741 202
560 3300046794 Ga0495589_0002566 Ga0495589_0002566_5225_5833 202
561 3300046810 Ga0495660_0002330 Ga0495660_0002330_10809_11417 202
562 3300046810 Ga0495660_0003946 Ga0495660_0003946_2516_3124 202
563 3300047443 Ga0495687_001177 Ga0495687_001177_14330_14944 202
564 3300047446 Ga0495679_000190 Ga0495679_000190_7368_7976 202
565 3300047446 Ga0495679_000211 Ga0495679_000211_25609_26217 202
566 3300047446 Ga0495679_000233 Ga0495679_000233_11852_12460 202
567 3300047470 Ga0495681_0077050 Ga0495681_0077050_126_734 202
568 3300047472 Ga0495686_0000029 Ga0495686_0000029_135688_136308 202
569 3300048907 Ga0496104_0229097 Ga0496104_0229097_378_995 202
570 3300048909 Ga0496106_0000001 Ga0496106_0000001_70213_70827 202
571 3300048915 Ga0496112_0020353 Ga0496112_0020353_5570_6187 202
572 3300048921 Ga0496118_0001876 Ga0496118_0001876_28831_29448 202
573 3300048921 Ga0496118_0076401 Ga0496118_0076401_251_865 202
574 3300048924 Ga0496121_0004114 Ga0496121_0004114_2566_3180 202
575 3300048925 Ga0496122_0002556 Ga0496122_0002556_22998_23606 202
576 3300048926 Ga0496123_0011036 Ga0496123_0011036_553_1161 202
577 3300048927 Ga0496124_0012251 Ga0496124_0012251_4616_5224 202
578 3300048928 Ga0496125_0008266 Ga0496125_0008266_5121_5738 202
579 3300048929 Ga0496126_0001078 Ga0496126_0001078_5431_6045 202
580 3300049459 Ga0495678_000037 Ga0495678_000037_25372_25980 202
581 3300049568 Ga0501031_0039731 Ga0501031_0039731_1767_2426 202
582 3300049570 Ga0501033_0147188 Ga0501033_0147188_81_740 202
583 3300049573 Ga0501037_0010929 Ga0501037_0010929_502_1161 202
584 3300053125 Ga0500618_022445 Ga0500618_022445_601_1209 202
585 3300053161 Ga0500634_0000091 Ga0500634_0000091_11110_11718 202
586 3300061719 Ga0466962_0095127 Ga0466962_0095127_672_1289 202
587 iso_pu_bacteria 2519103095 2519460683 202
588 3300009093 Ga0105240_10003837 Ga0105240_1000383712 203
589 3300009551 Ga0105238_10117875 Ga0105238_101178752 203
590 3300025903 Ga0207680_10412147 Ga0207680_104121471 203
591 3300025913 Ga0207695_10006884 Ga0207695_1000688410 203
592 3300041407 Ga0439447_000355 Ga0439447_000355_8955_9566 203
593 3300041407 Ga0439447_026239 Ga0439447_026239_525_1136 203
594 3300042009 Ga0439451_004155 Ga0439451_004155_1674_2297 203
595 3300042010 Ga0439452_033726 Ga0439452_033726_497_1108 203
596 3300046458 Ga0495591_008395 Ga0495591_008395_3143_3754 203
597 3300046460 Ga0495638_0026277 Ga0495638_0026277_2453_3064 203
598 3300046471 Ga0495650_0017460 Ga0495650_0017460_273_884 203
599 3300046491 Ga0495584_0039182 Ga0495584_0039182_653_1264 203
600 3300046492 Ga0495585_0075193 Ga0495585_0075193_517_1146 203
601 3300046501 Ga0495607_0003115 Ga0495607_0003115_9098_9709 203
602 3300046507 Ga0495606_0004452 Ga0495606_0004452_4529_5140 203
603 3300046512 Ga0495610_0006409 Ga0495610_0006409_6671_7282 203
604 3300046513 Ga0495616_0014318 Ga0495616_0014318_1464_2075 203
605 3300046515 Ga0495620_0002359 Ga0495620_0002359_8864_9475 203
606 3300046519 Ga0495632_0004406 Ga0495632_0004406_1408_2019 203
607 3300046523 Ga0495644_0081195 Ga0495644_0081195_139_750 203
608 3300046524 Ga0495648_0033010 Ga0495648_0033010_1704_2315 203
609 3300046558 Ga0495633_0053985 Ga0495633_0053985_702_1313 203
610 3300046660 Ga0495625_0010214 Ga0495625_0010214_3222_3833 203
611 3300046665 Ga0495661_0004385 Ga0495661_0004385_8883_9494 203
612 3300046692 Ga0495671_0147240 Ga0495671_0147240_180_791 203
613 3300046694 Ga0495649_0197132 Ga0495649_0197132_320_931 203
614 3300047446 Ga0495679_009097 Ga0495679_009097_1694_2305 203
615 3300048091 Ga0495626_0000144 Ga0495626_0000144_8888_9499 203
616 3300049459 Ga0495678_015339 Ga0495678_015339_2261_2872 203
617 3300053087 Ga0500643_001627 Ga0500643_001627_11767_12393 203
618 iso_pu_bacteria 8052494512 8052497006 203
619 2124908027 MRS2a_Contig_45 MRS2a_00337060 204
620 2162886007 SwRhRL2b_contig_456895 SwRhRL2b_0491.00005940 204
621 3300002737 JGI25162J39368_1000166 JGI25162J39368_10001668 204
622 3300002771 JGI25163J39215_1000186 JGI25163J39215_100018613 204
623 3300002771 JGI25163J39215_1000638 JGI25163J39215_10006384 204
624 3300002772 JGI25164J39214_1000129 JGI25164J39214_100012969 204
625 3300002772 JGI25164J39214_1000415 JGI25164J39214_100041513 204
626 3300003214 JGI25165J46597_1000251 JGI25165J46597_100025169 204
627 3300003214 JGI25165J46597_1000756 JGI25165J46597_10007569 204
628 3300003781 Ga0055536_1000268 Ga0055536_100026824 204
629 3300003781 Ga0055536_1032350 Ga0055536_10323501 204
630 3300003781 Ga0055536_1068912 Ga0055536_10689121 204
631 3300003791 Ga0055530_10000259 Ga0055530_1000025910 204
632 3300003791 Ga0055530_10000450 Ga0055530_1000045033 204
633 3300003791 Ga0055530_10008590 Ga0055530_100085903 204
634 3300003792 Ga0055540_1000105 Ga0055540_100010510 204
635 3300003792 Ga0055540_1000386 Ga0055540_100038633 204
636 3300003794 Ga0055531_10000081 Ga0055531_1000008110 204
637 3300003856 Ga0058692_1021800 Ga0058692_10218002 204
638 3300005288 Ga0065714_10002494 Ga0065714_100024948 204
639 3300005288 Ga0065714_10002507 Ga0065714_1000250711 204
640 3300005288 Ga0065714_10006419 Ga0065714_1000641911 204
641 3300005288 Ga0065714_10023978 Ga0065714_100239783 204
642 3300005289 Ga0065704_10072002 Ga0065704_100720023 204
643 3300005289 Ga0065704_10263780 Ga0065704_102637801 204
644 3300005290 Ga0065712_10001825 Ga0065712_100018255 204
645 3300005353 Ga0070669_100013166 Ga0070669_1000131663 204
646 3300005435 Ga0070714_100725549 Ga0070714_1007255492 204
647 3300006051 Ga0075364_10044785 Ga0075364_100447851 204
648 3300006051 Ga0075364_10460751 Ga0075364_104607511 204
649 3300006058 Ga0075432_10001522 Ga0075432_100015222 204
650 3300006058 Ga0075432_10008650 Ga0075432_100086504 204
651 3300006058 Ga0075432_10014180 Ga0075432_100141802 204
652 3300006058 Ga0075432_10047007 Ga0075432_100470071 204
653 3300006058 Ga0075432_10124702 Ga0075432_101247021 204
654 3300006058 Ga0075432_10164104 Ga0075432_101641042 204
655 3300006058 Ga0075432_10246428 Ga0075432_102464281 204
656 3300006186 Ga0075369_10058202 Ga0075369_100582022 204
657 3300006946 Ga0079104_1000094 Ga0079104_10000949 204
658 3300006946 Ga0079104_1000124 Ga0079104_100012410 204
659 3300006946 Ga0079104_1060811 Ga0079104_10608111 204
660 3300006948 Ga0099826_10003718 Ga0099826_100037188 204
661 3300009011 Ga0105251_10032399 Ga0105251_100323994 204
662 3300009011 Ga0105251_10122725 Ga0105251_101227252 204
663 3300009036 Ga0105244_10036257 Ga0105244_100362574 204
664 3300009036 Ga0105244_10042678 Ga0105244_100426784 204
665 3300009036 Ga0105244_10043152 Ga0105244_100431524 204
666 3300009036 Ga0105244_10102611 Ga0105244_101026112 204
667 3300009092 Ga0105250_10000560 Ga0105250_100005608 204
668 3300009092 Ga0105250_10000898 Ga0105250_100008983 204
669 3300009092 Ga0105250_10010202 Ga0105250_100102024 204
670 3300009092 Ga0105250_10188130 Ga0105250_101881301 204
671 3300009148 Ga0105243_10000103 Ga0105243_1000010378 204
672 3300009148 Ga0105243_10000125 Ga0105243_100001259 204
673 3300009148 Ga0105243_10212345 Ga0105243_102123452 204
674 3300011119 Ga0105246_10023370 Ga0105246_100233702 204
675 3300012498 Ga0157345_1000009 Ga0157345_100000939 204
676 3300012498 Ga0157345_1000928 Ga0157345_10009282 204
677 3300013100 Ga0157373_10000151 Ga0157373_100001518 204
678 3300013100 Ga0157373_10020435 Ga0157373_100204353 204
679 3300013100 Ga0157373_10072424 Ga0157373_100724241 204
680 3300013100 Ga0157373_10269277 Ga0157373_102692772 204
681 3300013100 Ga0157373_10365300 Ga0157373_103653002 204
682 3300013100 Ga0157373_10549411 Ga0157373_105494111 204
683 3300013102 Ga0157371_10000463 Ga0157371_100004639 204
684 3300013102 Ga0157371_10004579 Ga0157371_100045799 204
685 3300013102 Ga0157371_10428980 Ga0157371_104289801 204
686 3300013104 Ga0157370_10005821 Ga0157370_1000582110 204
687 3300013104 Ga0157370_10159805 Ga0157370_101598052 204
688 3300013104 Ga0157370_10273552 Ga0157370_102735521 204
689 3300013104 Ga0157370_10554702 Ga0157370_105547021 204
690 3300013104 Ga0157370_10930684 Ga0157370_109306841 204
691 3300013105 Ga0157369_10014332 Ga0157369_100143324 204
692 3300013105 Ga0157369_10014764 Ga0157369_100147648 204
693 3300013105 Ga0157369_10078365 Ga0157369_100783652 204
694 3300013105 Ga0157369_11454637 Ga0157369_114546371 204
695 3300013306 Ga0163162_10000072 Ga0163162_1000007282 204
696 3300013306 Ga0163162_10008712 Ga0163162_1000871211 204
697 3300013306 Ga0163162_10586450 Ga0163162_105864502 204
698 3300013308 Ga0157375_10084113 Ga0157375_100841132 204
699 3300013308 Ga0157375_10354463 Ga0157375_103544632 204
700 3300013308 Ga0157375_10898380 Ga0157375_108983801 204
701 3300014497 Ga0182008_10001317 Ga0182008_1000131712 204
702 3300014497 Ga0182008_10002359 Ga0182008_1000235910 204
703 3300014497 Ga0182008_10006016 Ga0182008_100060165 204
704 3300014497 Ga0182008_10028516 Ga0182008_100285163 204
705 3300014497 Ga0182008_10230097 Ga0182008_102300972 204
706 3300015261 Ga0182006_1002945 Ga0182006_10029455 204
707 3300015261 Ga0182006_1003352 Ga0182006_10033528 204
708 3300015261 Ga0182006_1015711 Ga0182006_10157113 204
709 3300015265 Ga0182005_1000842 Ga0182005_100084210 204
710 3300015265 Ga0182005_1015984 Ga0182005_10159841 204
711 3300017792 Ga0163161_10000156 Ga0163161_1000015646 204
712 3300017792 Ga0163161_10003953 Ga0163161_100039534 204
713 3300017792 Ga0163161_10045752 Ga0163161_100457524 204
714 3300017792 Ga0163161_10064565 Ga0163161_100645653 204
715 3300017792 Ga0163161_10672240 Ga0163161_106722402 204
716 3300025207 Ga0209760_100227 Ga0209760_1002278 204
717 3300025207 Ga0209760_100434 Ga0209760_1004348 204
718 3300025231 Ga0207427_100047 Ga0207427_1000478 204
719 3300025231 Ga0207427_100074 Ga0207427_1000748 204
720 3300025233 Ga0209437_100006 Ga0209437_1000068 204
721 3300025233 Ga0209437_100009 Ga0209437_1000098 204
722 3300025261 Ga0209233_1000032 Ga0209233_10000328 204
723 3300025261 Ga0209233_1000484 Ga0209233_10004848 204
724 3300025291 Ga0209675_1006516 Ga0209675_10065165 204
725 3300025292 Ga0209676_1000010 Ga0209676_100001010 204
726 3300025292 Ga0209676_1000646 Ga0209676_10006468 204
727 3300025292 Ga0209676_1007290 Ga0209676_10072903 204
728 3300025292 Ga0209676_1010061 Ga0209676_10100613 204
729 3300025298 Ga0209050_1000081 Ga0209050_1000081240 204
730 3300025298 Ga0209050_1000227 Ga0209050_10002278 204
731 3300025298 Ga0209050_1000363 Ga0209050_100036310 204
732 3300025303 Ga0209051_1000164 Ga0209051_10001649 204
733 3300025303 Ga0209051_1000185 Ga0209051_100018591 204
734 3300025304 Ga0209257_1000040 Ga0209257_1000040515 204
735 3300025304 Ga0209257_1008247 Ga0209257_10082474 204
736 3300025711 Ga0207696_1001567 Ga0207696_100156712 204
737 3300025711 Ga0207696_1002536 Ga0207696_10025363 204
738 3300025711 Ga0207696_1013067 Ga0207696_10130674 204
739 3300025711 Ga0207696_1018219 Ga0207696_10182192 204
740 3300025728 Ga0207655_1000551 Ga0207655_100055129 204
741 3300025728 Ga0207655_1002591 Ga0207655_100259110 204
742 3300025728 Ga0207655_1004649 Ga0207655_10046492 204
743 3300025728 Ga0207655_1010235 Ga0207655_10102357 204
744 3300025728 Ga0207655_1011899 Ga0207655_10118992 204
745 3300025728 Ga0207655_1023881 Ga0207655_10238813 204
746 3300025728 Ga0207655_1060197 Ga0207655_10601973 204
747 3300025728 Ga0207655_1087869 Ga0207655_10878691 204
748 3300025735 Ga0207713_1001221 Ga0207713_10012218 204
749 3300025735 Ga0207713_1001918 Ga0207713_100191810 204
750 3300025735 Ga0207713_1003241 Ga0207713_10032419 204
751 3300025735 Ga0207713_1006429 Ga0207713_10064292 204
752 3300025735 Ga0207713_1028640 Ga0207713_10286402 204
753 3300025735 Ga0207713_1101848 Ga0207713_11018482 204
754 3300025735 Ga0207713_1102312 Ga0207713_11023122 204
755 3300025923 Ga0207681_10024058 Ga0207681_100240584 204
756 3300025933 Ga0207706_10042785 Ga0207706_100427854 204
757 3300025935 Ga0207709_10000035 Ga0207709_1000003511 204
758 3300025935 Ga0207709_10002421 Ga0207709_100024219 204
759 3300027111 Ga0209281_1000077 Ga0209281_100007710 204
760 3300027111 Ga0209281_1000212 Ga0209281_1000212123 204
761 3300027111 Ga0209281_1006513 Ga0209281_10065132 204
762 3300027111 Ga0209281_1011142 Ga0209281_10111422 204
763 3300027312 Ga0209371_1001552 Ga0209371_100155213 204
764 3300027666 Ga0209282_1012669 Ga0209282_10126693 204
765 3300027907 Ga0207428_10005837 Ga0207428_1000583715 204
766 3300027907 Ga0207428_10054766 Ga0207428_100547661 204
767 3300027907 Ga0207428_10080023 Ga0207428_100800234 204
768 3300028379 Ga0268266_10099467 Ga0268266_100994671 204
769 3300030500 Ga0268256_1002253 Ga0268256_10022535 204
770 3300030521 Ga0307511_10028132 Ga0307511_100281326 204
771 3300030734 Ga0316179_1039086 Ga0316179_10390862 204
772 3300030735 Ga0316178_1138063 Ga0316178_113806312 204
773 3300030742 Ga0316183_1077777 Ga0316183_10777772 204
774 3300030742 Ga0316183_1106054 Ga0316183_11060542 204
775 3300031548 Ga0307408_100002671 Ga0307408_10000267112 204
776 3300031548 Ga0307408_100002956 Ga0307408_1000029562 204
777 3300031548 Ga0307408_100436648 Ga0307408_1004366482 204
778 3300031548 Ga0307408_100467367 Ga0307408_1004673672 204
779 3300031731 Ga0307405_10000624 Ga0307405_100006249 204
780 3300031731 Ga0307405_10002473 Ga0307405_100024733 204
781 3300031731 Ga0307405_10320653 Ga0307405_103206532 204
782 3300031824 Ga0307413_10013068 Ga0307413_100130684 204
783 3300031824 Ga0307413_10032714 Ga0307413_100327143 204
784 3300031901 Ga0307406_10053238 Ga0307406_100532385 204
785 3300031903 Ga0307407_10135080 Ga0307407_101350801 204
786 3300031911 Ga0307412_10000878 Ga0307412_1000087814 204
787 3300031911 Ga0307412_10000944 Ga0307412_1000094415 204
788 3300031911 Ga0307412_10001619 Ga0307412_1000161912 204
789 3300031911 Ga0307412_11144039 Ga0307412_111440391 204
790 3300032004 Ga0307414_10055195 Ga0307414_100551952 204
791 3300032004 Ga0307414_10137367 Ga0307414_101373673 204
792 3300032004 Ga0307414_10486470 Ga0307414_104864701 204
793 3300032004 Ga0307414_10967960 Ga0307414_109679601 204
794 3300032005 Ga0307411_10008616 Ga0307411_100086161 204
795 3300032005 Ga0307411_10015363 Ga0307411_100153633 204
796 3300032005 Ga0307411_10020708 Ga0307411_100207083 204
797 3300033180 Ga0307510_10012774 Ga0307510_100127744 204
798 3300038705 Ga0237819_00585 Ga0237819_00585_698_1312 204
799 3300041405 Ga0439438_001949 Ga0439438_001949_2979_3593 204
800 3300041405 Ga0439438_002256 Ga0439438_002256_5186_5800 204
801 3300041405 Ga0439438_002400 Ga0439438_002400_150_764 204
802 3300041405 Ga0439438_002403 Ga0439438_002403_150_764 204
803 3300041405 Ga0439438_002513 Ga0439438_002513_6793_7407 204
804 3300041405 Ga0439438_002539 Ga0439438_002539_6081_6695 204
805 3300041405 Ga0439438_003729 Ga0439438_003729_1728_2342 204
806 3300041405 Ga0439438_015614 Ga0439438_015614_1576_2190 204
807 3300041407 Ga0439447_000280 Ga0439447_000280_8753_9367 204
808 3300041407 Ga0439447_000621 Ga0439447_000621_7169_7783 204
809 3300041407 Ga0439447_000698 Ga0439447_000698_6578_7192 204
810 3300041407 Ga0439447_003542 Ga0439447_003542_4095_4709 204
811 3300041407 Ga0439447_003943 Ga0439447_003943_3525_4139 204
812 3300041407 Ga0439447_006856 Ga0439447_006856_2187_2810 204
813 3300041407 Ga0439447_016415 Ga0439447_016415_122_736 204
814 3300041411 Ga0439466_0000422 Ga0439466_0000422_9145_9759 204
815 3300041411 Ga0439466_0002836 Ga0439466_0002836_2920_3534 204
816 3300041411 Ga0439466_0009673 Ga0439466_0009673_1120_1734 204
817 3300041411 Ga0439466_0011006 Ga0439466_0011006_1489_2103 204
818 3300041411 Ga0439466_0013955 Ga0439466_0013955_1510_2133 204
819 3300041411 Ga0439466_0020081 Ga0439466_0020081_1669_2283 204
820 3300041411 Ga0439466_0043550 Ga0439466_0043550_398_1012 204
821 3300041997 Ga0439431_0013624 Ga0439431_0013624_879_1502 204
822 3300042004 Ga0439445_0004818 Ga0439445_0004818_1655_2269 204
823 3300042006 Ga0439432_001312 Ga0439432_001312_2012_2626 204
824 3300042006 Ga0439432_006504 Ga0439432_006504_587_1210 204
825 3300042006 Ga0439432_010421 Ga0439432_010421_1385_1999 204
826 3300042006 Ga0439432_017024 Ga0439432_017024_280_894 204
827 3300042009 Ga0439451_020469 Ga0439451_020469_708_1322 204
828 3300042010 Ga0439452_000091 Ga0439452_000091_68323_68937 204
829 3300042010 Ga0439452_000172 Ga0439452_000172_7019_7633 204
830 3300042010 Ga0439452_000309 Ga0439452_000309_7821_8435 204
831 3300042010 Ga0439452_004717 Ga0439452_004717_1491_2105 204
832 3300042010 Ga0439452_005180 Ga0439452_005180_416_1039 204
833 3300042010 Ga0439452_006684 Ga0439452_006684_2341_2955 204
834 3300042010 Ga0439452_025368 Ga0439452_025368_794_1408 204
835 3300042013 Ga0439456_000810 Ga0439456_000810_5438_6052 204
836 3300042013 Ga0439456_007282 Ga0439456_007282_625_1239 204
837 3300042013 Ga0439456_009090 Ga0439456_009090_381_995 204
838 3300042013 Ga0439456_024071 Ga0439456_024071_312_935 204
839 3300042013 Ga0439456_045321 Ga0439456_045321_273_902 204
840 3300042016 Ga0439463_050307 Ga0439463_050307_253_867 204
841 3300042115 Ga0450911_000025 Ga0450911_000025_7058_7672 204
842 3300042121 Ga0450919_003138 Ga0450919_003138_1059_1673 204
843 3300042122 Ga0450920_003350 Ga0450920_003350_1264_1878 204
844 3300042124 Ga0450922_000181 Ga0450922_000181_841_1455 204
845 3300042125 Ga0450923_001551 Ga0450923_001551_1717_2331 204
846 3300042136 Ga0450900_005759 Ga0450900_005759_27_647 204
847 3300042137 Ga0450902_000571 Ga0450902_000571_3964_4584 204
848 3300042138 Ga0450903_002442 Ga0450903_002442_993_1607 204
849 3300042138 Ga0450903_004051 Ga0450903_004051_465_1079 204
850 3300042138 Ga0450903_004391 Ga0450903_004391_1181_1795 204
851 3300042138 Ga0450903_012557 Ga0450903_012557_63_677 204
852 3300042145 Ga0450906_000612 Ga0450906_000612_2547_3161 204
853 3300042145 Ga0450906_001636 Ga0450906_001636_3813_4427 204
854 3300042146 Ga0450907_000038 Ga0450907_000038_8872_9486 204
855 3300042146 Ga0450907_000855 Ga0450907_000855_6448_7062 204
856 3300042146 Ga0450907_039969 Ga0450907_039969_43_657 204
857 3300042156 Ga0439446_0064553 Ga0439446_0064553_205_819 204
858 3300042185 Ga0450909_000065 Ga0450909_000065_1596_2210 204
859 3300042435 Ga0439434_0000253 Ga0439434_0000253_8937_9551 204
860 3300042461 Ga0439460_0000460 Ga0439460_0000460_3469_4083 204
861 3300042461 Ga0439460_0001474 Ga0439460_0001474_1763_2377 204
862 3300042993 Ga0439440_0003618 Ga0439440_0003618_1959_2573 204
863 3300046452 Ga0495617_004146 Ga0495617_004146_272_886 204
864 3300046452 Ga0495617_004255 Ga0495617_004255_1371_1985 204
865 3300046452 Ga0495617_008453 Ga0495617_008453_112_726 204
866 3300046452 Ga0495617_009307 Ga0495617_009307_1795_2409 204
867 3300046452 Ga0495617_026063 Ga0495617_026063_1289_1903 204
868 3300046452 Ga0495617_028225 Ga0495617_028225_463_1101 204
869 3300046452 Ga0495617_042370 Ga0495617_042370_573_1187 204
870 3300046453 Ga0495627_000239 Ga0495627_000239_6869_7483 204
871 3300046453 Ga0495627_000864 Ga0495627_000864_13870_14508 204
872 3300046453 Ga0495627_002308 Ga0495627_002308_2702_3316 204
873 3300046453 Ga0495627_004519 Ga0495627_004519_2267_2881 204
874 3300046455 Ga0495603_0018361 Ga0495603_0018361_917_1531 204
875 3300046455 Ga0495603_0019564 Ga0495603_0019564_2466_3080 204
876 3300046457 Ga0495590_0013094 Ga0495590_0013094_332_946 204
877 3300046457 Ga0495590_0032480 Ga0495590_0032480_249_863 204
878 3300046457 Ga0495590_0041811 Ga0495590_0041811_448_1062 204
879 3300046457 Ga0495590_0070549 Ga0495590_0070549_69_683 204
880 3300046458 Ga0495591_000107 Ga0495591_000107_88209_88847 204
881 3300046458 Ga0495591_000287 Ga0495591_000287_7020_7634 204
882 3300046458 Ga0495591_000774 Ga0495591_000774_6910_7524 204
883 3300046458 Ga0495591_002390 Ga0495591_002390_6893_7507 204
884 3300046458 Ga0495591_005561 Ga0495591_005561_4829_5443 204
885 3300046458 Ga0495591_009734 Ga0495591_009734_330_944 204
886 3300046458 Ga0495591_014040 Ga0495591_014040_107_721 204
887 3300046458 Ga0495591_049195 Ga0495591_049195_100_714 204
888 3300046459 Ga0495629_0351154 Ga0495629_0351154_280_894 204
889 3300046460 Ga0495638_0002189 Ga0495638_0002189_8733_9347 204
890 3300046460 Ga0495638_0003517 Ga0495638_0003517_7007_7621 204
891 3300046460 Ga0495638_0003771 Ga0495638_0003771_4426_5040 204
892 3300046460 Ga0495638_0015395 Ga0495638_0015395_3043_3657 204
893 3300046460 Ga0495638_0020618 Ga0495638_0020618_3549_4163 204
894 3300046460 Ga0495638_0044924 Ga0495638_0044924_662_1276 204
895 3300046460 Ga0495638_0073514 Ga0495638_0073514_141_755 204
896 3300046460 Ga0495638_0085793 Ga0495638_0085793_861_1475 204
897 3300046460 Ga0495638_0094289 Ga0495638_0094289_945_1559 204
898 3300046460 Ga0495638_0151464 Ga0495638_0151464_535_1149 204
899 3300046463 Ga0495653_0000525 Ga0495653_0000525_21971_22585 204
900 3300046463 Ga0495653_0023268 Ga0495653_0023268_2395_3009 204
901 3300046463 Ga0495653_0037094 Ga0495653_0037094_1916_2530 204
902 3300046471 Ga0495650_0003372 Ga0495650_0003372_8852_9466 204
903 3300046471 Ga0495650_0006289 Ga0495650_0006289_6350_6964 204
904 3300046471 Ga0495650_0029119 Ga0495650_0029119_1279_1893 204
905 3300046471 Ga0495650_0057982 Ga0495650_0057982_918_1532 204
906 3300046473 Ga0495582_0002084 Ga0495582_0002084_1754_2368 204
907 3300046474 Ga0495605_0000309 Ga0495605_0000309_9133_9747 204
908 3300046474 Ga0495605_0003411 Ga0495605_0003411_6896_7534 204
909 3300046474 Ga0495605_0044150 Ga0495605_0044150_208_822 204
910 3300046474 Ga0495605_0044664 Ga0495605_0044664_1551_2165 204
911 3300046474 Ga0495605_0045491 Ga0495605_0045491_300_914 204
912 3300046474 Ga0495605_0202154 Ga0495605_0202154_33_647 204
913 3300046475 Ga0495639_0011149 Ga0495639_0011149_1114_1728 204
914 3300046475 Ga0495639_0022419 Ga0495639_0022419_1864_2478 204
915 3300046491 Ga0495584_0000505 Ga0495584_0000505_8868_9482 204
916 3300046491 Ga0495584_0002635 Ga0495584_0002635_6271_6885 204
917 3300046491 Ga0495584_0003226 Ga0495584_0003226_1529_2143 204
918 3300046491 Ga0495584_0009835 Ga0495584_0009835_24_638 204
919 3300046491 Ga0495584_0053247 Ga0495584_0053247_1368_1982 204
920 3300046491 Ga0495584_0063235 Ga0495584_0063235_53_667 204
921 3300046491 Ga0495584_0127431 Ga0495584_0127431_131_745 204
922 3300046491 Ga0495584_0208913 Ga0495584_0208913_256_870 204
923 3300046492 Ga0495585_0000228 Ga0495585_0000228_50181_50795 204
924 3300046492 Ga0495585_0004597 Ga0495585_0004597_1306_1920 204
925 3300046492 Ga0495585_0011533 Ga0495585_0011533_3125_3739 204
926 3300046492 Ga0495585_0066195 Ga0495585_0066195_1222_1836 204
927 3300046499 Ga0495594_0007936 Ga0495594_0007936_2654_3268 204
928 3300046499 Ga0495594_0008555 Ga0495594_0008555_3682_4296 204
929 3300046499 Ga0495594_0009339 Ga0495594_0009339_1754_2368 204
930 3300046500 Ga0495596_0000028 Ga0495596_0000028_6909_7523 204
931 3300046500 Ga0495596_0030659 Ga0495596_0030659_1177_1791 204
932 3300046500 Ga0495596_0037155 Ga0495596_0037155_1130_1744 204
933 3300046501 Ga0495607_0001376 Ga0495607_0001376_6925_7539 204
934 3300046501 Ga0495607_0001798 Ga0495607_0001798_10690_11304 204
935 3300046501 Ga0495607_0002668 Ga0495607_0002668_6787_7401 204
936 3300046501 Ga0495607_0008043 Ga0495607_0008043_4755_5369 204
937 3300046501 Ga0495607_0012233 Ga0495607_0012233_352_966 204
938 3300046501 Ga0495607_0027603 Ga0495607_0027603_1672_2310 204
939 3300046501 Ga0495607_0035349 Ga0495607_0035349_552_1166 204
940 3300046501 Ga0495607_0137465 Ga0495607_0137465_324_938 204
941 3300046501 Ga0495607_0169315 Ga0495607_0169315_66_680 204
942 3300046501 Ga0495607_0271837 Ga0495607_0271837_109_723 204
943 3300046506 Ga0495583_0006457 Ga0495583_0006457_6562_7176 204
944 3300046506 Ga0495583_0015625 Ga0495583_0015625_816_1430 204
945 3300046507 Ga0495606_0000782 Ga0495606_0000782_47927_48541 204
946 3300046507 Ga0495606_0000988 Ga0495606_0000988_33959_34573 204
947 3300046507 Ga0495606_0004727 Ga0495606_0004727_8898_9512 204
948 3300046507 Ga0495606_0008677 Ga0495606_0008677_6997_7611 204
949 3300046507 Ga0495606_0009687 Ga0495606_0009687_489_1103 204
950 3300046507 Ga0495606_0010638 Ga0495606_0010638_3243_3857 204
951 3300046507 Ga0495606_0026693 Ga0495606_0026693_512_1126 204
952 3300046507 Ga0495606_0048957 Ga0495606_0048957_1120_1734 204
953 3300046512 Ga0495610_0003177 Ga0495610_0003177_6963_7577 204
954 3300046512 Ga0495610_0009530 Ga0495610_0009530_5391_6005 204
955 3300046512 Ga0495610_0010263 Ga0495610_0010263_3252_3866 204
956 3300046512 Ga0495610_0013697 Ga0495610_0013697_123_737 204
957 3300046512 Ga0495610_0014956 Ga0495610_0014956_1456_2070 204
958 3300046512 Ga0495610_0018000 Ga0495610_0018000_90_704 204
959 3300046512 Ga0495610_0022822 Ga0495610_0022822_2560_3174 204
960 3300046512 Ga0495610_0051532 Ga0495610_0051532_832_1446 204
961 3300046512 Ga0495610_0068125 Ga0495610_0068125_964_1578 204
962 3300046513 Ga0495616_0000168 Ga0495616_0000168_48123_48761 204
963 3300046513 Ga0495616_0001849 Ga0495616_0001849_6990_7604 204
964 3300046513 Ga0495616_0005394 Ga0495616_0005394_1559_2173 204
965 3300046513 Ga0495616_0008103 Ga0495616_0008103_170_784 204
966 3300046513 Ga0495616_0035367 Ga0495616_0035367_1389_2003 204
967 3300046513 Ga0495616_0038241 Ga0495616_0038241_1384_1998 204
968 3300046513 Ga0495616_0053366 Ga0495616_0053366_144_758 204
969 3300046513 Ga0495616_0125305 Ga0495616_0125305_520_1134 204
970 3300046515 Ga0495620_0000184 Ga0495620_0000184_7015_7629 204
971 3300046515 Ga0495620_0001469 Ga0495620_0001469_9125_9739 204
972 3300046515 Ga0495620_0014936 Ga0495620_0014936_3045_3659 204
973 3300046515 Ga0495620_0018385 Ga0495620_0018385_1929_2543 204
974 3300046515 Ga0495620_0030251 Ga0495620_0030251_280_894 204
975 3300046516 Ga0495628_0065374 Ga0495628_0065374_1271_1885 204
976 3300046517 Ga0495630_0012152 Ga0495630_0012152_409_1023 204
977 3300046517 Ga0495630_0024402 Ga0495630_0024402_833_1447 204
978 3300046517 Ga0495630_0030578 Ga0495630_0030578_564_1178 204
979 3300046518 Ga0495631_0000020 Ga0495631_0000020_8852_9466 204
980 3300046518 Ga0495631_0000221 Ga0495631_0000221_31486_32100 204
981 3300046518 Ga0495631_0003793 Ga0495631_0003793_4528_5142 204
982 3300046518 Ga0495631_0049788 Ga0495631_0049788_430_1044 204
983 3300046518 Ga0495631_0058201 Ga0495631_0058201_39_653 204
984 3300046518 Ga0495631_0208088 Ga0495631_0208088_142_756 204
985 3300046519 Ga0495632_0000222 Ga0495632_0000222_50266_50880 204
986 3300046519 Ga0495632_0002292 Ga0495632_0002292_4792_5406 204
987 3300046519 Ga0495632_0004343 Ga0495632_0004343_2023_2661 204
988 3300046519 Ga0495632_0008780 Ga0495632_0008780_3744_4358 204
989 3300046519 Ga0495632_0015507 Ga0495632_0015507_2993_3607 204
990 3300046519 Ga0495632_0054147 Ga0495632_0054147_1319_1933 204
991 3300046519 Ga0495632_0133447 Ga0495632_0133447_433_1047 204
992 3300046520 Ga0495637_0000089 Ga0495637_0000089_63683_64297 204
993 3300046520 Ga0495637_0001443 Ga0495637_0001443_4326_4940 204
994 3300046520 Ga0495637_0002811 Ga0495637_0002811_3860_4474 204
995 3300046520 Ga0495637_0010044 Ga0495637_0010044_3893_4507 204
996 3300046520 Ga0495637_0016489 Ga0495637_0016489_113_727 204
997 3300046520 Ga0495637_0020019 Ga0495637_0020019_66_680 204
998 3300046520 Ga0495637_0033185 Ga0495637_0033185_701_1315 204
999 3300046520 Ga0495637_0185531 Ga0495637_0185531_66_680 204
1000 3300046522 Ga0495643_0002208 Ga0495643_0002208_14661_15275 204
1001 3300046522 Ga0495643_0003299 Ga0495643_0003299_7439_8053 204
1002 3300046522 Ga0495643_0008354 Ga0495643_0008354_5717_6331 204
1003 3300046522 Ga0495643_0011217 Ga0495643_0011217_2398_3012 204
1004 3300046522 Ga0495643_0026753 Ga0495643_0026753_1968_2582 204
1005 3300046522 Ga0495643_0061631 Ga0495643_0061631_1285_1899 204
1006 3300046522 Ga0495643_0070710 Ga0495643_0070710_817_1431 204
1007 3300046523 Ga0495644_0001883 Ga0495644_0001883_7261_7875 204
1008 3300046524 Ga0495648_0001614 Ga0495648_0001614_6887_7501 204
1009 3300046524 Ga0495648_0002022 Ga0495648_0002022_9672_10286 204
1010 3300046524 Ga0495648_0002271 Ga0495648_0002271_8435_9049 204
1011 3300046524 Ga0495648_0003640 Ga0495648_0003640_5716_6330 204
1012 3300046524 Ga0495648_0006325 Ga0495648_0006325_5770_6384 204
1013 3300046524 Ga0495648_0007373 Ga0495648_0007373_5463_6101 204
1014 3300046524 Ga0495648_0007672 Ga0495648_0007672_1100_1714 204
1015 3300046524 Ga0495648_0025015 Ga0495648_0025015_413_1027 204
1016 3300046524 Ga0495648_0052554 Ga0495648_0052554_173_787 204
1017 3300046524 Ga0495648_0086131 Ga0495648_0086131_96_710 204
1018 3300046524 Ga0495648_0114050 Ga0495648_0114050_90_704 204
1019 3300046524 Ga0495648_0257739 Ga0495648_0257739_67_681 204
1020 3300046526 Ga0495666_0001984 Ga0495666_0001984_525_1139 204
1021 3300046526 Ga0495666_0022868 Ga0495666_0022868_154_768 204
1022 3300046526 Ga0495666_0039073 Ga0495666_0039073_19_633 204
1023 3300046528 Ga0495642_0000033 Ga0495642_0000033_8915_9529 204
1024 3300046528 Ga0495642_0000086 Ga0495642_0000086_44171_44785 204
1025 3300046530 Ga0495654_0000111 Ga0495654_0000111_85427_86065 204
1026 3300046530 Ga0495654_0003325 Ga0495654_0003325_3315_3929 204
1027 3300046530 Ga0495654_0004462 Ga0495654_0004462_2275_2889 204
1028 3300046530 Ga0495654_0007333 Ga0495654_0007333_123_737 204
1029 3300046530 Ga0495654_0007655 Ga0495654_0007655_2189_2803 204
1030 3300046530 Ga0495654_0010924 Ga0495654_0010924_3238_3852 204
1031 3300046530 Ga0495654_0011790 Ga0495654_0011790_1742_2356 204
1032 3300046530 Ga0495654_0018913 Ga0495654_0018913_2674_3288 204
1033 3300046530 Ga0495654_0031970 Ga0495654_0031970_172_786 204
1034 3300046530 Ga0495654_0129448 Ga0495654_0129448_465_1079 204
1035 3300046530 Ga0495654_0157986 Ga0495654_0157986_30_644 204
1036 3300046535 Ga0495586_0002403 Ga0495586_0002403_4441_5055 204
1037 3300046536 Ga0495587_0001739 Ga0495587_0001739_6893_7507 204
1038 3300046536 Ga0495587_0003739 Ga0495587_0003739_2670_3284 204
1039 3300046538 Ga0495609_0000329 Ga0495609_0000329_6990_7604 204
1040 3300046538 Ga0495609_0001719 Ga0495609_0001719_6690_7304 204
1041 3300046538 Ga0495609_0015134 Ga0495609_0015134_1368_1982 204
1042 3300046538 Ga0495609_0040845 Ga0495609_0040845_488_1102 204
1043 3300046542 Ga0495597_0001453 Ga0495597_0001453_6995_7609 204
1044 3300046542 Ga0495597_0003855 Ga0495597_0003855_6484_7098 204
1045 3300046542 Ga0495597_0011117 Ga0495597_0011117_725_1339 204
1046 3300046542 Ga0495597_0012258 Ga0495597_0012258_2463_3077 204
1047 3300046542 Ga0495597_0013089 Ga0495597_0013089_422_1036 204
1048 3300046542 Ga0495597_0019648 Ga0495597_0019648_2336_2950 204
1049 3300046542 Ga0495597_0088211 Ga0495597_0088211_465_1079 204
1050 3300046557 Ga0495622_0000538 Ga0495622_0000538_13128_13742 204
1051 3300046557 Ga0495622_0000911 Ga0495622_0000911_8551_9165 204
1052 3300046557 Ga0495622_0027675 Ga0495622_0027675_1207_1821 204
1053 3300046557 Ga0495622_0042954 Ga0495622_0042954_1033_1647 204
1054 3300046557 Ga0495622_0068214 Ga0495622_0068214_689_1306 204
1055 3300046558 Ga0495633_0001679 Ga0495633_0001679_7103_7717 204
1056 3300046558 Ga0495633_0006318 Ga0495633_0006318_4167_4781 204
1057 3300046558 Ga0495633_0016429 Ga0495633_0016429_1771_2385 204
1058 3300046558 Ga0495633_0134234 Ga0495633_0134234_326_940 204
1059 3300046616 Ga0495668_0000814 Ga0495668_0000814_28227_28841 204
1060 3300046616 Ga0495668_0001572 Ga0495668_0001572_7004_7618 204
1061 3300046616 Ga0495668_0012939 Ga0495668_0012939_2082_2696 204
1062 3300046642 Ga0495634_0062265 Ga0495634_0062265_858_1472 204
1063 3300046648 Ga0495611_0000107 Ga0495611_0000107_50387_51001 204
1064 3300046648 Ga0495611_0014337 Ga0495611_0014337_1609_2223 204
1065 3300046660 Ga0495625_0001089 Ga0495625_0001089_27504_28142 204
1066 3300046660 Ga0495625_0001350 Ga0495625_0001350_1023_1637 204
1067 3300046660 Ga0495625_0003934 Ga0495625_0003934_4621_5235 204
1068 3300046660 Ga0495625_0003974 Ga0495625_0003974_12111_12725 204
1069 3300046660 Ga0495625_0014514 Ga0495625_0014514_4552_5166 204
1070 3300046660 Ga0495625_0533201 Ga0495625_0533201_34_648 204
1071 3300046660 Ga0495625_0551019 Ga0495625_0551019_29_643 204
1072 3300046663 Ga0495635_0008476 Ga0495635_0008476_613_1227 204
1073 3300046663 Ga0495635_0021942 Ga0495635_0021942_3332_3946 204
1074 3300046664 Ga0495659_0009818 Ga0495659_0009818_1323_1937 204
1075 3300046665 Ga0495661_0013508 Ga0495661_0013508_4090_4704 204
1076 3300046665 Ga0495661_0014483 Ga0495661_0014483_2986_3600 204
1077 3300046665 Ga0495661_0046274 Ga0495661_0046274_1301_1915 204
1078 3300046665 Ga0495661_0070924 Ga0495661_0070924_1392_2006 204
1079 3300046665 Ga0495661_0123709 Ga0495661_0123709_335_949 204
1080 3300046674 Ga0495588_0003508 Ga0495588_0003508_241_855 204
1081 3300046674 Ga0495588_0008803 Ga0495588_0008803_3234_3848 204
1082 3300046674 Ga0495588_0277440 Ga0495588_0277440_181_795 204
1083 3300046679 Ga0495623_0001644 Ga0495623_0001644_13127_13741 204
1084 3300046680 Ga0495646_0003217 Ga0495646_0003217_4158_4772 204
1085 3300046684 Ga0495669_0002058 Ga0495669_0002058_3672_4286 204
1086 3300046689 Ga0495613_0006146 Ga0495613_0006146_7052_7666 204
1087 3300046689 Ga0495613_0040121 Ga0495613_0040121_2087_2701 204
1088 3300046690 Ga0495624_0000637 Ga0495624_0000637_19934_20548 204
1089 3300046690 Ga0495624_0057096 Ga0495624_0057096_1415_2029 204
1090 3300046691 Ga0495670_0000105 Ga0495670_0000105_29776_30390 204
1091 3300046691 Ga0495670_0001677 Ga0495670_0001677_10183_10797 204
1092 3300046691 Ga0495670_0001702 Ga0495670_0001702_8958_9572 204
1093 3300046691 Ga0495670_0002656 Ga0495670_0002656_1209_1823 204
1094 3300046691 Ga0495670_0046903 Ga0495670_0046903_458_1072 204
1095 3300046692 Ga0495671_0001925 Ga0495671_0001925_4251_4889 204
1096 3300046692 Ga0495671_0003981 Ga0495671_0003981_1320_1934 204
1097 3300046692 Ga0495671_0004211 Ga0495671_0004211_2247_2861 204
1098 3300046692 Ga0495671_0012446 Ga0495671_0012446_3750_4364 204
1099 3300046692 Ga0495671_0016959 Ga0495671_0016959_3144_3758 204
1100 3300046692 Ga0495671_0035561 Ga0495671_0035561_1256_1870 204
1101 3300046692 Ga0495671_0047522 Ga0495671_0047522_999_1613 204
1102 3300046692 Ga0495671_0057448 Ga0495671_0057448_888_1502 204
1103 3300046692 Ga0495671_0263208 Ga0495671_0263208_65_679 204
1104 3300046694 Ga0495649_0003035 Ga0495649_0003035_2012_2626 204
1105 3300046694 Ga0495649_0003965 Ga0495649_0003965_2135_2773 204
1106 3300046694 Ga0495649_0005030 Ga0495649_0005030_4366_4980 204
1107 3300046694 Ga0495649_0009234 Ga0495649_0009234_4572_5186 204
1108 3300046694 Ga0495649_0013087 Ga0495649_0013087_1442_2056 204
1109 3300046694 Ga0495649_0037104 Ga0495649_0037104_659_1273 204
1110 3300046694 Ga0495649_0119919 Ga0495649_0119919_33_647 204
1111 3300046694 Ga0495649_0154255 Ga0495649_0154255_81_695 204
1112 3300046694 Ga0495649_0176877 Ga0495649_0176877_468_1082 204
1113 3300046694 Ga0495649_0283316 Ga0495649_0283316_33_647 204
1114 3300046794 Ga0495589_0000278 Ga0495589_0000278_7014_7628 204
1115 3300046794 Ga0495589_0017355 Ga0495589_0017355_271_885 204
1116 3300046794 Ga0495589_0036664 Ga0495589_0036664_1307_1921 204
1117 3300046809 Ga0495600_0022484 Ga0495600_0022484_2905_3519 204
1118 3300046810 Ga0495660_0000998 Ga0495660_0000998_6890_7504 204
1119 3300046810 Ga0495660_0001470 Ga0495660_0001470_6865_7503 204
1120 3300046810 Ga0495660_0001702 Ga0495660_0001702_14017_14631 204
1121 3300046810 Ga0495660_0003030 Ga0495660_0003030_3231_3845 204
1122 3300046810 Ga0495660_0008214 Ga0495660_0008214_1788_2402 204
1123 3300046810 Ga0495660_0012232 Ga0495660_0012232_2949_3563 204
1124 3300046810 Ga0495660_0013937 Ga0495660_0013937_2804_3418 204
1125 3300046810 Ga0495660_0026415 Ga0495660_0026415_843_1457 204
1126 3300046810 Ga0495660_0065117 Ga0495660_0065117_115_729 204
1127 3300046810 Ga0495660_0079872 Ga0495660_0079872_1048_1662 204
1128 3300047315 Ga0495581_0013609 Ga0495581_0013609_2447_3061 204
1129 3300047317 Ga0495604_0002977 Ga0495604_0002977_3903_4517 204
1130 3300047317 Ga0495604_0019743 Ga0495604_0019743_717_1331 204
1131 3300047317 Ga0495604_0031966 Ga0495604_0031966_2771_3385 204
1132 3300047320 Ga0495672_0000672 Ga0495672_0000672_30443_31057 204
1133 3300047320 Ga0495672_0003274 Ga0495672_0003274_6166_6780 204
1134 3300047320 Ga0495672_0009799 Ga0495672_0009799_4546_5160 204
1135 3300047320 Ga0495672_0017776 Ga0495672_0017776_2558_3172 204
1136 3300047320 Ga0495672_0046378 Ga0495672_0046378_414_1028 204
1137 3300047320 Ga0495672_0065471 Ga0495672_0065471_1374_1988 204
1138 3300047320 Ga0495672_0140929 Ga0495672_0140929_90_704 204
1139 3300047320 Ga0495672_0225265 Ga0495672_0225265_118_732 204
1140 3300047321 Ga0495676_0000286 Ga0495676_0000286_33243_33857 204
1141 3300047321 Ga0495676_0096988 Ga0495676_0096988_1185_1799 204
1142 3300047322 Ga0495680_0003972 Ga0495680_0003972_4846_5460 204
1143 3300047322 Ga0495680_0007080 Ga0495680_0007080_6875_7489 204
1144 3300047322 Ga0495680_0010401 Ga0495680_0010401_4201_4815 204
1145 3300047322 Ga0495680_0408872 Ga0495680_0408872_259_873 204
1146 3300047323 Ga0495683_0000085 Ga0495683_0000085_8886_9500 204
1147 3300047323 Ga0495683_0000270 Ga0495683_0000270_40255_40869 204
1148 3300047323 Ga0495683_0009634 Ga0495683_0009634_4212_4826 204
1149 3300047323 Ga0495683_0011491 Ga0495683_0011491_1698_2312 204
1150 3300047443 Ga0495687_000375 Ga0495687_000375_46230_46844 204
1151 3300047443 Ga0495687_009480 Ga0495687_009480_4421_5035 204
1152 3300047444 Ga0495675_0023229 Ga0495675_0023229_1916_2530 204
1153 3300047444 Ga0495675_0102852 Ga0495675_0102852_236_850 204
1154 3300047446 Ga0495679_000689 Ga0495679_000689_336_974 204
1155 3300047446 Ga0495679_006729 Ga0495679_006729_2782_3396 204
1156 3300047446 Ga0495679_010665 Ga0495679_010665_2704_3318 204
1157 3300047469 Ga0495673_0000297 Ga0495673_0000297_58936_59550 204
1158 3300047469 Ga0495673_0000537 Ga0495673_0000537_31655_32293 204
1159 3300047469 Ga0495673_0000628 Ga0495673_0000628_9104_9718 204
1160 3300047469 Ga0495673_0002220 Ga0495673_0002220_7918_8532 204
1161 3300047469 Ga0495673_0002230 Ga0495673_0002230_6629_7243 204
1162 3300047469 Ga0495673_0009831 Ga0495673_0009831_1063_1677 204
1163 3300047469 Ga0495673_0015998 Ga0495673_0015998_3003_3617 204
1164 3300047469 Ga0495673_0051299 Ga0495673_0051299_1093_1707 204
1165 3300047469 Ga0495673_0059258 Ga0495673_0059258_35_649 204
1166 3300047469 Ga0495673_0095150 Ga0495673_0095150_467_1081 204
1167 3300047470 Ga0495681_0000448 Ga0495681_0000448_8786_9400 204
1168 3300047470 Ga0495681_0000856 Ga0495681_0000856_15897_16511 204
1169 3300047470 Ga0495681_0002022 Ga0495681_0002022_795_1409 204
1170 3300047470 Ga0495681_0002233 Ga0495681_0002233_6597_7211 204
1171 3300047470 Ga0495681_0002398 Ga0495681_0002398_241_855 204
1172 3300047470 Ga0495681_0002965 Ga0495681_0002965_4236_4850 204
1173 3300047470 Ga0495681_0003914 Ga0495681_0003914_2802_3416 204
1174 3300047470 Ga0495681_0004992 Ga0495681_0004992_1358_1972 204
1175 3300047470 Ga0495681_0012491 Ga0495681_0012491_2262_2876 204
1176 3300047470 Ga0495681_0015669 Ga0495681_0015669_2935_3549 204
1177 3300047470 Ga0495681_0020296 Ga0495681_0020296_2755_3369 204
1178 3300047470 Ga0495681_0032455 Ga0495681_0032455_650_1264 204
1179 3300047471 Ga0495684_0231387 Ga0495684_0231387_718_1332 204
1180 3300047472 Ga0495686_0005722 Ga0495686_0005722_144_758 204
1181 3300047472 Ga0495686_0017829 Ga0495686_0017829_2540_3154 204
1182 3300047472 Ga0495686_0059930 Ga0495686_0059930_620_1234 204
1183 3300047472 Ga0495686_0104466 Ga0495686_0104466_451_1065 204
1184 3300047472 Ga0495686_0108175 Ga0495686_0108175_504_1118 204
1185 3300047673 Ga0495593_0008535 Ga0495593_0008535_3148_3762 204
1186 3300047673 Ga0495593_0014594 Ga0495593_0014594_433_1047 204
1187 3300047673 Ga0495593_0025676 Ga0495593_0025676_1473_2087 204
1188 3300048088 Ga0495602_0030341 Ga0495602_0030341_634_1248 204
1189 3300048091 Ga0495626_0000324 Ga0495626_0000324_42853_43467 204
1190 3300048091 Ga0495626_0000420 Ga0495626_0000420_9124_9738 204
1191 3300048091 Ga0495626_0000679 Ga0495626_0000679_6913_7551 204
1192 3300048091 Ga0495626_0002781 Ga0495626_0002781_9002_9616 204
1193 3300048091 Ga0495626_0021703 Ga0495626_0021703_2540_3154 204
1194 3300048091 Ga0495626_0040258 Ga0495626_0040258_1341_1955 204
1195 3300048091 Ga0495626_0094540 Ga0495626_0094540_219_833 204
1196 3300048909 Ga0496106_0285170 Ga0496106_0285170_623_1258 204
1197 3300048913 Ga0496110_0231549 Ga0496110_0231549_514_1128 204
1198 3300048915 Ga0496112_0109911 Ga0496112_0109911_212_826 204
1199 3300048917 Ga0496114_0077268 Ga0496114_0077268_2051_2677 204
1200 3300048919 Ga0496116_0000168 Ga0496116_0000168_7010_7624 204
1201 3300048919 Ga0496116_0000869 Ga0496116_0000869_7068_7682 204
1202 3300048919 Ga0496116_0007948 Ga0496116_0007948_7099_7713 204
1203 3300048919 Ga0496116_0008311 Ga0496116_0008311_1304_1939 204
1204 3300048920 Ga0496117_0002072 Ga0496117_0002072_18917_19531 204
1205 3300048920 Ga0496117_0005260 Ga0496117_0005260_1983_2612 204
1206 3300048920 Ga0496117_0007492 Ga0496117_0007492_2918_3532 204
1207 3300048920 Ga0496117_0033297 Ga0496117_0033297_919_1533 204
1208 3300048920 Ga0496117_0143808 Ga0496117_0143808_210_845 204
1209 3300048921 Ga0496118_0008366 Ga0496118_0008366_7105_7719 204
1210 3300048921 Ga0496118_0017735 Ga0496118_0017735_4337_4972 204
1211 3300048921 Ga0496118_0040580 Ga0496118_0040580_868_1482 204
1212 3300048921 Ga0496118_0051411 Ga0496118_0051411_557_1186 204
1213 3300048922 Ga0496119_0025249 Ga0496119_0025249_1336_1971 204
1214 3300048924 Ga0496121_0000199 Ga0496121_0000199_124989_125603 204
1215 3300048924 Ga0496121_0013203 Ga0496121_0013203_1324_1959 204
1216 3300048924 Ga0496121_0166251 Ga0496121_0166251_661_1275 204
1217 3300048925 Ga0496122_0003462 Ga0496122_0003462_7051_7665 204
1218 3300048925 Ga0496122_0032233 Ga0496122_0032233_2991_3605 204
1219 3300048926 Ga0496123_0006867 Ga0496123_0006867_3226_3840 204
1220 3300048926 Ga0496123_0009973 Ga0496123_0009973_4924_5538 204
1221 3300048926 Ga0496123_0023832 Ga0496123_0023832_3459_4094 204
1222 3300048927 Ga0496124_0016579 Ga0496124_0016579_1258_1872 204
1223 3300048927 Ga0496124_0017941 Ga0496124_0017941_1938_2558 204
1224 3300048927 Ga0496124_0068180 Ga0496124_0068180_2261_2875 204
1225 3300048927 Ga0496124_0178626 Ga0496124_0178626_19_633 204
1226 3300048927 Ga0496124_0355513 Ga0496124_0355513_29_664 204
1227 3300048928 Ga0496125_0014915 Ga0496125_0014915_1342_1956 204
1228 3300049459 Ga0495678_000309 Ga0495678_000309_50363_50977 204
1229 3300049459 Ga0495678_000573 Ga0495678_000573_6913_7551 204
1230 3300049459 Ga0495678_004351 Ga0495678_004351_5489_6103 204
1231 3300049459 Ga0495678_004855 Ga0495678_004855_3060_3674 204
1232 3300049459 Ga0495678_014755 Ga0495678_014755_208_822 204
1233 3300049459 Ga0495678_014771 Ga0495678_014771_93_707 204
1234 3300049459 Ga0495678_018439 Ga0495678_018439_618_1232 204
1235 3300049459 Ga0495678_033073 Ga0495678_033073_1329_1943 204
1236 3300049459 Ga0495678_034781 Ga0495678_034781_1439_2053 204
1237 3300049459 Ga0495678_078501 Ga0495678_078501_557_1171 204
1238 3300049460 Ga0495682_0002232 Ga0495682_0002232_7020_7634 204
1239 3300049758 Ga0501241_000265 Ga0501241_000265_9625_10239 204
1240 3300049758 Ga0501241_016342 Ga0501241_016342_322_936 204
1241 3300049853 Ga0501226_000854 Ga0501226_000854_881_1495 204
1242 3300050489 nmdc:mga03683_56220_c1 nmdc:mga03683_56220_c1_550_1164 204
1243 3300050491 nmdc:mga00v17_32906_c1 nmdc:mga00v17_32906_c1_2382_2996 204
1244 3300050491 nmdc:mga00v17_394140_c1 nmdc:mga00v17_394140_c1_111_725 204
1245 3300050514 nmdc:mga08x19_199240_c1 nmdc:mga08x19_199240_c1_411_1025 204
1246 3300053111 Ga0500572_000566 Ga0500572_000566_7043_7657 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

45

223

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.5048 1 191
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4787 1 191
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4334 7 200
7l17-assembly1.cif.gz_A crystal structure of sugar-bound melibiose permease melb 0.4037 2 204
7l17-assembly1.cif.gz_A crystal structure of sugar-bound melibiose permease melb 0.3997 2 204
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.531 10 194 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5279 38 193 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5207 10 194 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5184 1 202 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5122 1 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-U1SQ08-F1-model_v4 Membrane protein 0.9789 1 197 GO:0005886
GO:0015171
GO:0033228
AF-A0A3S3N8D3-F1-model_v4 LysE family translocator 0.9772 4 199 GO:0005886
GO:0015171
GO:0033228
AF-A0A7W6BR73-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9761 4 199 GO:0005886
GO:0015171
GO:0033228
AF-A0A5E4TR75-F1-model_v4 Cysteine/O-acetylserine efflux protein 0.9759 3 200 GO:0005886
GO:0015171
GO:0033228
AF-A0A316EXY4-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9748 6 199 GO:0005886
GO:0015171
GO:0033228

Feature Viewer

pLDDT pTM Quality
85.76 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map