F492126
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1245 | 367 | 2490 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10986374|Ga0207708_109863742 |
| Length | 213 |
| Sequence | MRCRRCSACSNRRRFILMRDLTLTDVERLQTAAAADAFHMDEETFRAFYDRTARPVWAYLSRITGDRQLADDLLQETYYRFLRADRGYSSDAHRRNYLFRIATNLVRDGRRRRRPDLVAVPEETDPDALRSPDDVAGHTVLRADLSRAMASLSSREQAMLWLAYAQGSSHDEIAEALGLKTSSIKLLLFRARRRLARLLRGDDPAPAGERIRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 247 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 248 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 249 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 250 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 251 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 252 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 253 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 254 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 257 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 258 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 259 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 365 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0 |
| Rhizoplane | 2.57 |
| Rhizosphere | 94.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207708_10986374 | 3300026075 | Bacteria | 732 |
| 2 | JGI24743J22301_10041785 | 3300001991 | Bacteria | 922 |
| 3 | Ga0065712_10001425 | 3300005290 | Bacteria | 11319 |
| 4 | Ga0065712_10001466 | 3300005290 | Bacteria | 6138 |
| 5 | Ga0065712_10087531 | 3300005290 | Bacteria | 2571 |
| 6 | Ga0065712_10120804 | 3300005290 | Bacteria | 1674 |
| 7 | Ga0065712_10199682 | 3300005290 | Unclassified | 1113 |
| 8 | Ga0065712_10228392 | 3300005290 | Bacteria | 1019 |
| 9 | Ga0065712_10265115 | 3300005290 | Bacteria | 928 |
| 10 | Ga0065715_10004672 | 3300005293 | Bacteria | 4638 |
| 11 | Ga0065715_10014152 | 3300005293 | Bacteria | 2276 |
| 12 | Ga0065715_10034745 | 3300005293 | Unclassified | 1423 |
| 13 | Ga0065715_10100094 | 3300005293 | Bacteria | 3337 |
| 14 | Ga0065715_10156913 | 3300005293 | Bacteria | 1655 |
| 15 | Ga0065715_10401699 | 3300005293 | Bacteria | 881 |
| 16 | Ga0065707_10092711 | 3300005295 | Unclassified | 3729 |
| 17 | Ga0065707_10142124 | 3300005295 | Bacteria | 1759 |
| 18 | Ga0070658_10175669 | 3300005327 | Bacteria | 1801 |
| 19 | Ga0070676_10017287 | 3300005328 | Bacteria | 3992 |
| 20 | Ga0070676_10060969 | 3300005328 | Bacteria | 2241 |
| 21 | Ga0070676_10163335 | 3300005328 | Unclassified | 1435 |
| 22 | Ga0070683_100033184 | 3300005329 | Bacteria | 4706 |
| 23 | Ga0070690_100008400 | 3300005330 | Bacteria | 5945 |
| 24 | Ga0070690_100008723 | 3300005330 | Bacteria | 5849 |
| 25 | Ga0070690_100057885 | 3300005330 | Bacteria | 2488 |
| 26 | Ga0070690_100100381 | 3300005330 | Bacteria | 1918 |
| 27 | Ga0070690_100123056 | 3300005330 | Bacteria | 1743 |
| 28 | Ga0070690_100127327 | 3300005330 | Unclassified | 1716 |
| 29 | Ga0070670_100002235 | 3300005331 | Bacteria | 15919 |
| 30 | Ga0070670_100008786 | 3300005331 | Bacteria | 8622 |
| 31 | Ga0070670_100043002 | 3300005331 | Bacteria | 3884 |
| 32 | Ga0070670_100064058 | 3300005331 | Bacteria | 3154 |
| 33 | Ga0070670_100171175 | 3300005331 | Unclassified | 1883 |
| 34 | Ga0070670_100589823 | 3300005331 | Unclassified | 994 |
| 35 | Ga0070677_10000772 | 3300005333 | Bacteria | 10656 |
| 36 | Ga0070677_10006220 | 3300005333 | Bacteria | 3964 |
| 37 | Ga0070677_10013563 | 3300005333 | Unclassified | 2853 |
| 38 | Ga0070677_10017008 | 3300005333 | Bacteria | 2597 |
| 39 | Ga0070677_10080690 | 3300005333 | Bacteria | 1391 |
| 40 | Ga0070677_10207619 | 3300005333 | Bacteria | 949 |
| 41 | Ga0070677_10237691 | 3300005333 | Bacteria | 898 |
| 42 | Ga0068869_100011211 | 3300005334 | Bacteria | 5873 |
| 43 | Ga0068869_100014741 | 3300005334 | Bacteria | 5227 |
| 44 | Ga0068869_100073561 | 3300005334 | Bacteria | 2534 |
| 45 | Ga0068869_100487949 | 3300005334 | Bacteria | 1027 |
| 46 | Ga0068869_100630795 | 3300005334 | Unclassified | 908 |
| 47 | Ga0068869_100761597 | 3300005334 | Bacteria | 830 |
| 48 | Ga0068869_100820566 | 3300005334 | Unclassified | 800 |
| 49 | Ga0070666_10007972 | 3300005335 | Bacteria | 6548 |
| 50 | Ga0070666_10014705 | 3300005335 | Bacteria | 4985 |
| 51 | Ga0070666_10024305 | 3300005335 | Bacteria | 3946 |
| 52 | Ga0070666_10031837 | 3300005335 | Bacteria | 3483 |
| 53 | Ga0070666_10174796 | 3300005335 | Unclassified | 1505 |
| 54 | Ga0070680_100173954 | 3300005336 | Bacteria | 1812 |
| 55 | Ga0070680_100311822 | 3300005336 | Bacteria | 1335 |
| 56 | Ga0070682_100480798 | 3300005337 | Unclassified | 958 |
| 57 | Ga0068868_100011691 | 3300005338 | Bacteria | 6394 |
| 58 | Ga0068868_100046177 | 3300005338 | Unclassified | 3410 |
| 59 | Ga0068868_100088896 | 3300005338 | Bacteria | 2486 |
| 60 | Ga0068868_100563628 | 3300005338 | Bacteria | 1005 |
| 61 | Ga0068868_100672500 | 3300005338 | Unclassified | 924 |
| 62 | Ga0068868_101044871 | 3300005338 | Bacteria | 749 |
| 63 | Ga0070660_100589037 | 3300005339 | Unclassified | 929 |
| 64 | Ga0070689_100051305 | 3300005340 | Bacteria | 3189 |
| 65 | Ga0070689_100093153 | 3300005340 | Bacteria | 2377 |
| 66 | Ga0070689_100269108 | 3300005340 | Bacteria | 1410 |
| 67 | Ga0070689_100277490 | 3300005340 | Bacteria | 1389 |
| 68 | Ga0070689_100452667 | 3300005340 | Unclassified | 1092 |
| 69 | Ga0070689_100830268 | 3300005340 | Unclassified | 814 |
| 70 | Ga0070691_10016828 | 3300005341 | Unclassified | 3363 |
| 71 | Ga0070687_100017374 | 3300005343 | Bacteria | 3306 |
| 72 | Ga0070687_100018319 | 3300005343 | Bacteria | 3237 |
| 73 | Ga0070687_100021683 | 3300005343 | Bacteria | 3025 |
| 74 | Ga0070687_100075765 | 3300005343 | Unclassified | 1820 |
| 75 | Ga0070687_100148634 | 3300005343 | Bacteria | 1373 |
| 76 | Ga0070687_100550856 | 3300005343 | Bacteria | 785 |
| 77 | Ga0070687_100659143 | 3300005343 | Bacteria | 726 |
| 78 | Ga0070661_100052734 | 3300005344 | Bacteria | 2977 |
| 79 | Ga0070661_100251344 | 3300005344 | Bacteria | 1364 |
| 80 | Ga0070661_100562919 | 3300005344 | Bacteria | 918 |
| 81 | Ga0070692_10079946 | 3300005345 | Bacteria | 1759 |
| 82 | Ga0070692_10088347 | 3300005345 | Viruses | 1681 |
| 83 | Ga0070668_100010474 | 3300005347 | Bacteria | 6892 |
| 84 | Ga0070668_100123145 | 3300005347 | Bacteria | 2075 |
| 85 | Ga0070669_100001320 | 3300005353 | Bacteria | 17879 |
| 86 | Ga0070669_100005676 | 3300005353 | Bacteria | 9003 |
| 87 | Ga0070669_100059354 | 3300005353 | Unclassified | 2809 |
| 88 | Ga0070669_100059574 | 3300005353 | Unclassified | 2803 |
| 89 | Ga0070669_100063968 | 3300005353 | Bacteria | 2708 |
| 90 | Ga0070669_100067143 | 3300005353 | Bacteria | 2645 |
| 91 | Ga0070669_100149514 | 3300005353 | Unclassified | 1807 |
| 92 | Ga0070669_100365976 | 3300005353 | Unclassified | 1173 |
| 93 | Ga0070669_100441568 | 3300005353 | Bacteria | 1071 |
| 94 | Ga0070675_100000041 | 3300005354 | Bacteria | 78345 |
| 95 | Ga0070675_100000966 | 3300005354 | Bacteria | 20540 |
| 96 | Ga0070675_100001113 | 3300005354 | Bacteria | 19368 |
| 97 | Ga0070675_100019768 | 3300005354 | Bacteria | 5371 |
| 98 | Ga0070675_100020745 | 3300005354 | Bacteria | 5244 |
| 99 | Ga0070675_100025710 | 3300005354 | Bacteria | 4720 |
| 100 | Ga0070675_100065265 | 3300005354 | Bacteria | 3010 |
| 101 | Ga0070675_100084896 | 3300005354 | Bacteria | 2644 |
| 102 | Ga0070675_100096968 | 3300005354 | Bacteria | 2478 |
| 103 | Ga0070675_100106727 | 3300005354 | Bacteria | 2364 |
| 104 | Ga0070675_100117366 | 3300005354 | Bacteria | 2258 |
| 105 | Ga0070675_100221643 | 3300005354 | Bacteria | 1647 |
| 106 | Ga0070675_100295681 | 3300005354 | Bacteria | 1426 |
| 107 | Ga0070675_100701092 | 3300005354 | Bacteria | 922 |
| 108 | Ga0070671_100010422 | 3300005355 | Bacteria | 7454 |
| 109 | Ga0070671_100013948 | 3300005355 | Bacteria | 6485 |
| 110 | Ga0070671_100077256 | 3300005355 | Bacteria | 2782 |
| 111 | Ga0070671_100082788 | 3300005355 | Bacteria | 2683 |
| 112 | Ga0070671_100123745 | 3300005355 | Bacteria | 2177 |
| 113 | Ga0070671_100183739 | 3300005355 | Bacteria | 1771 |
| 114 | Ga0070671_100318102 | 3300005355 | Unclassified | 1326 |
| 115 | Ga0070671_100592848 | 3300005355 | Bacteria | 957 |
| 116 | Ga0070671_100599072 | 3300005355 | Bacteria | 952 |
| 117 | Ga0070674_100000975 | 3300005356 | Bacteria | 14912 |
| 118 | Ga0070674_100029900 | 3300005356 | Unclassified | 3596 |
| 119 | Ga0070674_100073012 | 3300005356 | Bacteria | 2431 |
| 120 | Ga0070674_100159651 | 3300005356 | Bacteria | 1709 |
| 121 | Ga0070674_100201967 | 3300005356 | Bacteria | 1535 |
| 122 | Ga0070674_100672365 | 3300005356 | Unclassified | 882 |
| 123 | Ga0070673_100003896 | 3300005364 | Bacteria | 9379 |
| 124 | Ga0070673_100013593 | 3300005364 | Bacteria | 5640 |
| 125 | Ga0070673_100048023 | 3300005364 | Bacteria | 3325 |
| 126 | Ga0070673_100058958 | 3300005364 | Unclassified | 3037 |
| 127 | Ga0070673_100098402 | 3300005364 | Unclassified | 2404 |
| 128 | Ga0070673_100204355 | 3300005364 | Unclassified | 1702 |
| 129 | Ga0070673_100221736 | 3300005364 | Bacteria | 1637 |
| 130 | Ga0070673_100813635 | 3300005364 | Bacteria | 863 |
| 131 | Ga0070673_100842139 | 3300005364 | Unclassified | 848 |
| 132 | Ga0070688_100018439 | 3300005365 | Unclassified | 4027 |
| 133 | Ga0070688_100021110 | 3300005365 | Bacteria | 3799 |
| 134 | Ga0070688_100105490 | 3300005365 | Bacteria | 1865 |
| 135 | Ga0070688_100113673 | 3300005365 | Unclassified | 1804 |
| 136 | Ga0070688_100128879 | 3300005365 | Unclassified | 1704 |
| 137 | Ga0070688_100764148 | 3300005365 | Bacteria | 753 |
| 138 | Ga0070659_100135027 | 3300005366 | Bacteria | 2006 |
| 139 | Ga0070659_100139449 | 3300005366 | Bacteria | 1974 |
| 140 | Ga0070659_100149279 | 3300005366 | Bacteria | 1906 |
| 141 | Ga0070659_100239826 | 3300005366 | Unclassified | 1500 |
| 142 | Ga0070659_100347749 | 3300005366 | Unclassified | 1243 |
| 143 | Ga0070667_100001662 | 3300005367 | Bacteria | 19859 |
| 144 | Ga0070667_100042990 | 3300005367 | Bacteria | 3791 |
| 145 | Ga0070667_100190019 | 3300005367 | Bacteria | 1819 |
| 146 | Ga0070667_100323262 | 3300005367 | Bacteria | 1392 |
| 147 | Ga0070709_10148887 | 3300005434 | Unclassified | 1616 |
| 148 | Ga0070709_10406301 | 3300005434 | Bacteria | 1018 |
| 149 | Ga0070714_100396568 | 3300005435 | Unclassified | 1303 |
| 150 | Ga0070713_100076553 | 3300005436 | Bacteria | 2842 |
| 151 | Ga0070713_100337680 | 3300005436 | Unclassified | 1395 |
| 152 | Ga0070701_10009195 | 3300005438 | Bacteria | 4320 |
| 153 | Ga0070701_10017328 | 3300005438 | Bacteria | 3365 |
| 154 | Ga0070701_10118491 | 3300005438 | Bacteria | 1488 |
| 155 | Ga0070701_10198865 | 3300005438 | Unclassified | 1183 |
| 156 | Ga0070701_10548991 | 3300005438 | Bacteria | 758 |
| 157 | Ga0070701_10782801 | 3300005438 | Unclassified | 649 |
| 158 | Ga0070711_100082815 | 3300005439 | Unclassified | 2291 |
| 159 | Ga0070705_100066205 | 3300005440 | Bacteria | 2166 |
| 160 | Ga0070705_100101948 | 3300005440 | Bacteria | 1814 |
| 161 | Ga0070705_100364958 | 3300005440 | Bacteria | 1058 |
| 162 | Ga0070700_100002881 | 3300005441 | Bacteria | 8842 |
| 163 | Ga0070700_100110496 | 3300005441 | Bacteria | 1827 |
| 164 | Ga0070700_100280714 | 3300005441 | Unclassified | 1207 |
| 165 | Ga0070700_100296829 | 3300005441 | Bacteria | 1178 |
| 166 | Ga0070694_100037022 | 3300005444 | Bacteria | 3235 |
| 167 | Ga0070694_100044691 | 3300005444 | Unclassified | 2965 |
| 168 | Ga0070694_100283238 | 3300005444 | Unclassified | 1264 |
| 169 | Ga0070694_100488482 | 3300005444 | Bacteria | 978 |
| 170 | Ga0070708_100011343 | 3300005445 | Bacteria | 7247 |
| 171 | Ga0070708_100266125 | 3300005445 | Unclassified | 1612 |
| 172 | Ga0070663_100315008 | 3300005455 | Bacteria | 1256 |
| 173 | Ga0070678_100012647 | 3300005456 | Bacteria | 5259 |
| 174 | Ga0070678_100032193 | 3300005456 | Unclassified | 3627 |
| 175 | Ga0070678_100080804 | 3300005456 | Bacteria | 2463 |
| 176 | Ga0070678_100103734 | 3300005456 | Bacteria | 2210 |
| 177 | Ga0070678_100106421 | 3300005456 | Unclassified | 2186 |
| 178 | Ga0070678_100336324 | 3300005456 | Bacteria | 1294 |
| 179 | Ga0070678_100360914 | 3300005456 | Bacteria | 1252 |
| 180 | Ga0070662_100068747 | 3300005457 | Bacteria | 2605 |
| 181 | Ga0070662_100092723 | 3300005457 | Bacteria | 2271 |
| 182 | Ga0070662_100151407 | 3300005457 | Bacteria | 1806 |
| 183 | Ga0070662_100160132 | 3300005457 | Bacteria | 1760 |
| 184 | Ga0070662_100342683 | 3300005457 | Bacteria | 1223 |
| 185 | Ga0070662_100751315 | 3300005457 | Bacteria | 827 |
| 186 | Ga0070681_10002773 | 3300005458 | Bacteria | 16173 |
| 187 | Ga0070681_10128282 | 3300005458 | Bacteria | 2469 |
| 188 | Ga0070681_10836785 | 3300005458 | Unclassified | 838 |
| 189 | Ga0068867_100016445 | 3300005459 | Bacteria | 5252 |
| 190 | Ga0068867_100027611 | 3300005459 | Unclassified | 4081 |
| 191 | Ga0068867_100037310 | 3300005459 | Bacteria | 3532 |
| 192 | Ga0068867_100158324 | 3300005459 | Bacteria | 1784 |
| 193 | Ga0068867_100593721 | 3300005459 | Unclassified | 965 |
| 194 | Ga0068867_100839927 | 3300005459 | Bacteria | 822 |
| 195 | Ga0070685_10015539 | 3300005466 | Bacteria | 4044 |
| 196 | Ga0070685_10062897 | 3300005466 | Bacteria | 2177 |
| 197 | Ga0070685_10087931 | 3300005466 | Bacteria | 1875 |
| 198 | Ga0070685_10139490 | 3300005466 | Bacteria | 1525 |
| 199 | Ga0070685_10348447 | 3300005466 | Unclassified | 1012 |
| 200 | Ga0070706_100310608 | 3300005467 | Bacteria | 1471 |
| 201 | Ga0070706_100453027 | 3300005467 | Bacteria | 1194 |
| 202 | Ga0070707_100067781 | 3300005468 | Bacteria | 3434 |
| 203 | Ga0070707_100125281 | 3300005468 | Bacteria | 2495 |
| 204 | Ga0070707_100130192 | 3300005468 | Bacteria | 2447 |
| 205 | Ga0070698_100063259 | 3300005471 | Bacteria | 3732 |
| 206 | Ga0070699_100065554 | 3300005518 | Bacteria | 3152 |
| 207 | Ga0070699_100082331 | 3300005518 | Bacteria | 2806 |
| 208 | Ga0070699_100191586 | 3300005518 | Bacteria | 1817 |
| 209 | Ga0070699_100267360 | 3300005518 | Bacteria | 1530 |
| 210 | Ga0070699_100319368 | 3300005518 | Bacteria | 1395 |
| 211 | Ga0070699_100528942 | 3300005518 | Bacteria | 1072 |
| 212 | Ga0070679_100278150 | 3300005530 | Bacteria | 1627 |
| 213 | Ga0070684_100122026 | 3300005535 | Unclassified | 2345 |
| 214 | Ga0070684_100432528 | 3300005535 | Unclassified | 1215 |
| 215 | Ga0070697_100582902 | 3300005536 | Bacteria | 982 |
| 216 | Ga0070697_100657686 | 3300005536 | Bacteria | 923 |
| 217 | Ga0068853_100139726 | 3300005539 | Bacteria | 2174 |
| 218 | Ga0068853_100520562 | 3300005539 | Bacteria | 1124 |
| 219 | Ga0070672_100010398 | 3300005543 | Bacteria | 6455 |
| 220 | Ga0070672_100040103 | 3300005543 | Bacteria | 3591 |
| 221 | Ga0070672_100095539 | 3300005543 | Bacteria | 2404 |
| 222 | Ga0070672_100120595 | 3300005543 | Unclassified | 2146 |
| 223 | Ga0070672_100169190 | 3300005543 | Unclassified | 1816 |
| 224 | Ga0070672_100174422 | 3300005543 | Unclassified | 1789 |
| 225 | Ga0070672_100213634 | 3300005543 | Bacteria | 1616 |
| 226 | Ga0070672_100276157 | 3300005543 | Unclassified | 1420 |
| 227 | Ga0070672_100480868 | 3300005543 | Bacteria | 1072 |
| 228 | Ga0070686_100024364 | 3300005544 | Bacteria | 3626 |
| 229 | Ga0070686_100028194 | 3300005544 | Bacteria | 3404 |
| 230 | Ga0070686_100051088 | 3300005544 | Bacteria | 2630 |
| 231 | Ga0070686_100209760 | 3300005544 | Bacteria | 1401 |
| 232 | Ga0070686_100332216 | 3300005544 | Bacteria | 1137 |
| 233 | Ga0070686_100341679 | 3300005544 | Bacteria | 1122 |
| 234 | Ga0070686_100369605 | 3300005544 | Bacteria | 1082 |
| 235 | Ga0070695_100052916 | 3300005545 | Bacteria | 2610 |
| 236 | Ga0070695_100094419 | 3300005545 | Bacteria | 2003 |
| 237 | Ga0070695_100763016 | 3300005545 | Bacteria | 772 |
| 238 | Ga0070695_100815177 | 3300005545 | Bacteria | 749 |
| 239 | Ga0070696_100019995 | 3300005546 | Bacteria | 4539 |
| 240 | Ga0070696_100612907 | 3300005546 | Bacteria | 879 |
| 241 | Ga0070693_100247540 | 3300005547 | Bacteria | 1180 |
| 242 | Ga0070665_100018260 | 3300005548 | Bacteria | 7035 |
| 243 | Ga0070665_100105660 | 3300005548 | Bacteria | 2818 |
| 244 | Ga0070665_100150467 | 3300005548 | Bacteria | 2330 |
| 245 | Ga0070665_100238302 | 3300005548 | Bacteria | 1820 |
| 246 | Ga0070704_100004428 | 3300005549 | Bacteria | 8113 |
| 247 | Ga0070704_100020336 | 3300005549 | Bacteria | 4279 |
| 248 | Ga0070704_100099608 | 3300005549 | Bacteria | 2186 |
| 249 | Ga0070704_100566205 | 3300005549 | Bacteria | 995 |
| 250 | Ga0070704_101086892 | 3300005549 | Bacteria | 726 |
| 251 | Ga0068855_100136660 | 3300005563 | Bacteria | 2796 |
| 252 | Ga0070664_100038559 | 3300005564 | Bacteria | 4023 |
| 253 | Ga0070664_100080800 | 3300005564 | Bacteria | 2800 |
| 254 | Ga0070664_100152348 | 3300005564 | Unclassified | 2042 |
| 255 | Ga0070664_100157706 | 3300005564 | Bacteria | 2006 |
| 256 | Ga0070664_100400368 | 3300005564 | Unclassified | 1255 |
| 257 | Ga0070664_100622455 | 3300005564 | Bacteria | 1002 |
| 258 | Ga0070664_100944925 | 3300005564 | Unclassified | 809 |
| 259 | Ga0068857_100073910 | 3300005577 | Bacteria | 3038 |
| 260 | Ga0068857_100185274 | 3300005577 | Bacteria | 1895 |
| 261 | Ga0068854_100001952 | 3300005578 | Bacteria | 12592 |
| 262 | Ga0068854_100009138 | 3300005578 | Bacteria | 6391 |
| 263 | Ga0068854_100181412 | 3300005578 | Bacteria | 1645 |
| 264 | Ga0068854_100238424 | 3300005578 | Bacteria | 1447 |
| 265 | Ga0070702_100029033 | 3300005615 | Bacteria | 3003 |
| 266 | Ga0070702_100031150 | 3300005615 | Bacteria | 2916 |
| 267 | Ga0070702_100114318 | 3300005615 | Unclassified | 1679 |
| 268 | Ga0070702_100117379 | 3300005615 | Bacteria | 1660 |
| 269 | Ga0070702_100159646 | 3300005615 | Bacteria | 1456 |
| 270 | Ga0070702_100985880 | 3300005615 | Bacteria | 666 |
| 271 | Ga0068852_100014483 | 3300005616 | Bacteria | 6073 |
| 272 | Ga0068852_100645653 | 3300005616 | Unclassified | 1065 |
| 273 | Ga0068852_100840973 | 3300005616 | Bacteria | 933 |
| 274 | Ga0068859_100001994 | 3300005617 | Bacteria | 20841 |
| 275 | Ga0068859_100014294 | 3300005617 | Bacteria | 7962 |
| 276 | Ga0068859_100060044 | 3300005617 | Bacteria | 3832 |
| 277 | Ga0068859_100090633 | 3300005617 | Bacteria | 3108 |
| 278 | Ga0068859_100090833 | 3300005617 | Bacteria | 3105 |
| 279 | Ga0068859_100094523 | 3300005617 | Bacteria | 3041 |
| 280 | Ga0068859_100240129 | 3300005617 | Bacteria | 1901 |
| 281 | Ga0068859_100431179 | 3300005617 | Bacteria | 1415 |
| 282 | Ga0068859_100453087 | 3300005617 | Unclassified | 1379 |
| 283 | Ga0068859_100527499 | 3300005617 | Bacteria | 1276 |
| 284 | Ga0068859_100618922 | 3300005617 | Unclassified | 1175 |
| 285 | Ga0068859_100991028 | 3300005617 | Bacteria | 923 |
| 286 | Ga0068859_101137338 | 3300005617 | Unclassified | 859 |
| 287 | Ga0068859_101510468 | 3300005617 | Unclassified | 741 |
| 288 | Ga0068864_100028317 | 3300005618 | Bacteria | 4734 |
| 289 | Ga0068864_100035116 | 3300005618 | Bacteria | 4267 |
| 290 | Ga0068864_100045694 | 3300005618 | Bacteria | 3757 |
| 291 | Ga0068864_100097777 | 3300005618 | Bacteria | 2599 |
| 292 | Ga0068864_100111429 | 3300005618 | Bacteria | 2438 |
| 293 | Ga0068864_100165513 | 3300005618 | Bacteria | 2013 |
| 294 | Ga0068864_100339027 | 3300005618 | Unclassified | 1416 |
| 295 | Ga0068864_100560066 | 3300005618 | Unclassified | 1106 |
| 296 | Ga0068864_100778261 | 3300005618 | Bacteria | 939 |
| 297 | Ga0068866_10009040 | 3300005718 | Unclassified | 4222 |
| 298 | Ga0068866_10197045 | 3300005718 | Unclassified | 1201 |
| 299 | Ga0068861_100013994 | 3300005719 | Bacteria | 5624 |
| 300 | Ga0068861_100044224 | 3300005719 | Bacteria | 3347 |
| 301 | Ga0068861_100228247 | 3300005719 | Bacteria | 1577 |
| 302 | Ga0068861_100261639 | 3300005719 | Bacteria | 1481 |
| 303 | Ga0068861_100373319 | 3300005719 | Bacteria | 1258 |
| 304 | Ga0068861_100535858 | 3300005719 | Unclassified | 1064 |
| 305 | Ga0068861_100652814 | 3300005719 | Unclassified | 972 |
| 306 | Ga0068861_101252054 | 3300005719 | Bacteria | 719 |
| 307 | Ga0068861_101352461 | 3300005719 | Unclassified | 694 |
| 308 | Ga0068861_101399310 | 3300005719 | Bacteria | 683 |
| 309 | Ga0068870_10073291 | 3300005840 | Bacteria | 1873 |
| 310 | Ga0068870_10099776 | 3300005840 | Bacteria | 1639 |
| 311 | Ga0068870_10099790 | 3300005840 | Unclassified | 1639 |
| 312 | Ga0068870_10185190 | 3300005840 | Bacteria | 1253 |
| 313 | Ga0068870_10454214 | 3300005840 | Bacteria | 845 |
| 314 | Ga0068863_100000686 | 3300005841 | Bacteria | 34055 |
| 315 | Ga0068863_100030370 | 3300005841 | Bacteria | 5161 |
| 316 | Ga0068863_100047497 | 3300005841 | Bacteria | 4071 |
| 317 | Ga0068863_100089746 | 3300005841 | Bacteria | 2915 |
| 318 | Ga0068863_100190317 | 3300005841 | Bacteria | 1972 |
| 319 | Ga0068863_100579113 | 3300005841 | Bacteria | 1110 |
| 320 | Ga0068863_100644068 | 3300005841 | Bacteria | 1051 |
| 321 | Ga0068863_100820425 | 3300005841 | Bacteria | 928 |
| 322 | Ga0068858_100009448 | 3300005842 | Bacteria | 9300 |
| 323 | Ga0068858_100011524 | 3300005842 | Bacteria | 8343 |
| 324 | Ga0068858_100106449 | 3300005842 | Bacteria | 2618 |
| 325 | Ga0068858_100211026 | 3300005842 | Bacteria | 1837 |
| 326 | Ga0068858_100539005 | 3300005842 | Bacteria | 1129 |
| 327 | Ga0068858_100940366 | 3300005842 | Unclassified | 846 |
| 328 | Ga0068860_100073558 | 3300005843 | Bacteria | 3249 |
| 329 | Ga0068860_100183305 | 3300005843 | Bacteria | 2024 |
| 330 | Ga0068860_100189619 | 3300005843 | Bacteria | 1989 |
| 331 | Ga0068860_100240083 | 3300005843 | Unclassified | 1762 |
| 332 | Ga0068860_100381527 | 3300005843 | Unclassified | 1391 |
| 333 | Ga0068862_100003841 | 3300005844 | Bacteria | 12795 |
| 334 | Ga0068862_100034545 | 3300005844 | Bacteria | 4279 |
| 335 | Ga0068862_100047450 | 3300005844 | Bacteria | 3666 |
| 336 | Ga0068862_100096158 | 3300005844 | Unclassified | 2585 |
| 337 | Ga0068862_100231417 | 3300005844 | Bacteria | 1677 |
| 338 | Ga0068862_100432253 | 3300005844 | Bacteria | 1237 |
| 339 | Ga0068862_100726390 | 3300005844 | Bacteria | 964 |
| 340 | Ga0068862_101471782 | 3300005844 | Unclassified | 686 |
| 341 | Ga0081455_10049924 | 3300005937 | Unclassified | 3603 |
| 342 | Ga0081455_10167809 | 3300005937 | Bacteria | 1675 |
| 343 | Ga0070717_10175180 | 3300006028 | Bacteria | 1867 |
| 344 | Ga0075365_10000686 | 3300006038 | Bacteria | 13598 |
| 345 | Ga0075365_10124605 | 3300006038 | Bacteria | 1780 |
| 346 | Ga0075368_10176244 | 3300006042 | Unclassified | 900 |
| 347 | Ga0075363_100072433 | 3300006048 | Unclassified | 1874 |
| 348 | Ga0075364_10071890 | 3300006051 | Bacteria | 2279 |
| 349 | Ga0075364_10122807 | 3300006051 | Bacteria | 1739 |
| 350 | Ga0075364_10328804 | 3300006051 | Bacteria | 1041 |
| 351 | Ga0075432_10052427 | 3300006058 | Bacteria | 1441 |
| 352 | Ga0070715_10022043 | 3300006163 | Unclassified | 2479 |
| 353 | Ga0070716_100042763 | 3300006173 | Bacteria | 2531 |
| 354 | Ga0075362_10295589 | 3300006177 | Bacteria | 803 |
| 355 | Ga0075367_10123584 | 3300006178 | Unclassified | 1596 |
| 356 | Ga0075366_10031369 | 3300006195 | Bacteria | 3127 |
| 357 | Ga0075366_10050323 | 3300006195 | Bacteria | 2473 |
| 358 | Ga0075366_10052416 | 3300006195 | Unclassified | 2424 |
| 359 | Ga0075366_10135602 | 3300006195 | Bacteria | 1486 |
| 360 | Ga0075366_10210083 | 3300006195 | Bacteria | 1185 |
| 361 | Ga0097621_100001726 | 3300006237 | Bacteria | 14936 |
| 362 | Ga0097621_100004004 | 3300006237 | Bacteria | 10214 |
| 363 | Ga0097621_100015342 | 3300006237 | Bacteria | 5762 |
| 364 | Ga0097621_100121588 | 3300006237 | Bacteria | 2214 |
| 365 | Ga0097621_100179045 | 3300006237 | Bacteria | 1831 |
| 366 | Ga0097621_100239490 | 3300006237 | Unclassified | 1586 |
| 367 | Ga0097621_100250825 | 3300006237 | Unclassified | 1550 |
| 368 | Ga0097621_100588768 | 3300006237 | Bacteria | 1016 |
| 369 | Ga0075370_10044219 | 3300006353 | Bacteria | 2517 |
| 370 | Ga0075370_10063181 | 3300006353 | Bacteria | 2110 |
| 371 | Ga0068871_100025709 | 3300006358 | Bacteria | 4584 |
| 372 | Ga0068871_100033333 | 3300006358 | Bacteria | 4078 |
| 373 | Ga0068871_100035150 | 3300006358 | Bacteria | 3980 |
| 374 | Ga0068871_100088656 | 3300006358 | Bacteria | 2574 |
| 375 | Ga0068871_100169841 | 3300006358 | Bacteria | 1869 |
| 376 | Ga0068871_100358602 | 3300006358 | Unclassified | 1291 |
| 377 | Ga0068871_100383587 | 3300006358 | Unclassified | 1249 |
| 378 | Ga0068871_100450951 | 3300006358 | Bacteria | 1153 |
| 379 | Ga0068871_100539255 | 3300006358 | Unclassified | 1055 |
| 380 | Ga0068871_100640983 | 3300006358 | Bacteria | 969 |
| 381 | Ga0075428_100001137 | 3300006844 | Bacteria | 28418 |
| 382 | Ga0075428_100008320 | 3300006844 | Bacteria | 11496 |
| 383 | Ga0075428_100033183 | 3300006844 | Bacteria | 5700 |
| 384 | Ga0075428_100145716 | 3300006844 | Bacteria | 2574 |
| 385 | Ga0075428_100331019 | 3300006844 | Bacteria | 1636 |
| 386 | Ga0075428_100459578 | 3300006844 | Bacteria | 1363 |
| 387 | Ga0075428_100579289 | 3300006844 | Unclassified | 1199 |
| 388 | Ga0075430_100058650 | 3300006846 | Unclassified | 3236 |
| 389 | Ga0075430_100142674 | 3300006846 | Bacteria | 1995 |
| 390 | Ga0075430_100215907 | 3300006846 | Bacteria | 1592 |
| 391 | Ga0075430_100245059 | 3300006846 | Bacteria | 1485 |
| 392 | Ga0075430_100266751 | 3300006846 | Bacteria | 1417 |
| 393 | Ga0075431_100000264 | 3300006847 | Bacteria | 40417 |
| 394 | Ga0075431_100002177 | 3300006847 | Bacteria | 18724 |
| 395 | Ga0075431_100023284 | 3300006847 | Bacteria | 6336 |
| 396 | Ga0075431_100044213 | 3300006847 | Bacteria | 4594 |
| 397 | Ga0075431_100069929 | 3300006847 | Bacteria | 3621 |
| 398 | Ga0075431_100071962 | 3300006847 | Bacteria | 3568 |
| 399 | Ga0075431_101082462 | 3300006847 | Unclassified | 767 |
| 400 | Ga0075431_101174703 | 3300006847 | Unclassified | 731 |
| 401 | Ga0075433_10001958 | 3300006852 | Bacteria | 15487 |
| 402 | Ga0075433_10055579 | 3300006852 | Unclassified | 3456 |
| 403 | Ga0075433_10083029 | 3300006852 | Bacteria | 2827 |
| 404 | Ga0075433_10105734 | 3300006852 | Bacteria | 2494 |
| 405 | Ga0075433_10123040 | 3300006852 | Bacteria | 2304 |
| 406 | Ga0075433_10175406 | 3300006852 | Bacteria | 1908 |
| 407 | Ga0075434_100010137 | 3300006871 | Bacteria | 8825 |
| 408 | Ga0075434_100065503 | 3300006871 | Bacteria | 3618 |
| 409 | Ga0075434_100145562 | 3300006871 | Bacteria | 2390 |
| 410 | Ga0075434_100167944 | 3300006871 | Bacteria | 2214 |
| 411 | Ga0075434_100320579 | 3300006871 | Bacteria | 1570 |
| 412 | Ga0075434_100385311 | 3300006871 | Unclassified | 1423 |
| 413 | Ga0075429_100002904 | 3300006880 | Bacteria | 14530 |
| 414 | Ga0075429_100003455 | 3300006880 | Bacteria | 13490 |
| 415 | Ga0075429_100006362 | 3300006880 | Bacteria | 10219 |
| 416 | Ga0075429_100073377 | 3300006880 | Unclassified | 2981 |
| 417 | Ga0075429_100080189 | 3300006880 | Unclassified | 2845 |
| 418 | Ga0075429_100587332 | 3300006880 | Bacteria | 976 |
| 419 | Ga0075429_100718273 | 3300006880 | Bacteria | 875 |
| 420 | Ga0075429_100980044 | 3300006880 | Unclassified | 739 |
| 421 | Ga0068865_100026156 | 3300006881 | Bacteria | 3845 |
| 422 | Ga0068865_100031202 | 3300006881 | Unclassified | 3552 |
| 423 | Ga0068865_100036436 | 3300006881 | Unclassified | 3317 |
| 424 | Ga0068865_100148678 | 3300006881 | Bacteria | 1775 |
| 425 | Ga0068865_100332304 | 3300006881 | Bacteria | 1226 |
| 426 | Ga0068865_100400066 | 3300006881 | Unclassified | 1125 |
| 427 | Ga0068865_100681097 | 3300006881 | Unclassified | 877 |
| 428 | Ga0068865_100830437 | 3300006881 | Unclassified | 799 |
| 429 | Ga0075436_100015708 | 3300006914 | Bacteria | 5183 |
| 430 | Ga0075436_100023330 | 3300006914 | Bacteria | 4249 |
| 431 | Ga0075436_100028798 | 3300006914 | Bacteria | 3821 |
| 432 | Ga0075436_100415496 | 3300006914 | Unclassified | 976 |
| 433 | Ga0097620_100001994 | 3300006931 | Bacteria | 20841 |
| 434 | Ga0097620_100014294 | 3300006931 | Bacteria | 7962 |
| 435 | Ga0097620_100060046 | 3300006931 | Bacteria | 3832 |
| 436 | Ga0097620_100090629 | 3300006931 | Bacteria | 3108 |
| 437 | Ga0097620_100090831 | 3300006931 | Bacteria | 3105 |
| 438 | Ga0097620_100094523 | 3300006931 | Bacteria | 3041 |
| 439 | Ga0097620_100240141 | 3300006931 | Bacteria | 1901 |
| 440 | Ga0097620_100431177 | 3300006931 | Bacteria | 1415 |
| 441 | Ga0097620_100453104 | 3300006931 | Unclassified | 1379 |
| 442 | Ga0097620_100527475 | 3300006931 | Bacteria | 1276 |
| 443 | Ga0097620_100618863 | 3300006931 | Unclassified | 1175 |
| 444 | Ga0097620_100991106 | 3300006931 | Bacteria | 923 |
| 445 | Ga0097620_101137318 | 3300006931 | Unclassified | 859 |
| 446 | Ga0097620_101510774 | 3300006931 | Unclassified | 741 |
| 447 | Ga0075435_100000143 | 3300007076 | Bacteria | 40414 |
| 448 | Ga0075435_100026041 | 3300007076 | Bacteria | 4560 |
| 449 | Ga0075435_100032672 | 3300007076 | Bacteria | 4111 |
| 450 | Ga0075435_100043385 | 3300007076 | Bacteria | 3600 |
| 451 | Ga0075435_100085897 | 3300007076 | Unclassified | 2590 |
| 452 | Ga0075435_100108419 | 3300007076 | Bacteria | 2307 |
| 453 | Ga0075435_100488442 | 3300007076 | Bacteria | 1064 |
| 454 | Ga0105240_10032751 | 3300009093 | Bacteria | 6725 |
| 455 | Ga0105240_10176047 | 3300009093 | Bacteria | 2529 |
| 456 | Ga0105240_11031045 | 3300009093 | Unclassified | 878 |
| 457 | Ga0105240_11379699 | 3300009093 | Bacteria | 741 |
| 458 | Ga0111539_10000863 | 3300009094 | Bacteria | 39542 |
| 459 | Ga0111539_10001510 | 3300009094 | Bacteria | 31058 |
| 460 | Ga0111539_10001878 | 3300009094 | Bacteria | 27899 |
| 461 | Ga0111539_10002502 | 3300009094 | Bacteria | 24351 |
| 462 | Ga0111539_10019477 | 3300009094 | Bacteria | 8374 |
| 463 | Ga0111539_10024974 | 3300009094 | Bacteria | 7324 |
| 464 | Ga0111539_10138605 | 3300009094 | Bacteria | 2849 |
| 465 | Ga0111539_10139310 | 3300009094 | Bacteria | 2841 |
| 466 | Ga0111539_10277731 | 3300009094 | Bacteria | 1949 |
| 467 | Ga0111539_10302208 | 3300009094 | Bacteria | 1862 |
| 468 | Ga0111539_10406134 | 3300009094 | Bacteria | 1586 |
| 469 | Ga0111539_10620462 | 3300009094 | Unclassified | 1259 |
| 470 | Ga0111539_10826383 | 3300009094 | Bacteria | 1078 |
| 471 | Ga0105245_10045126 | 3300009098 | Bacteria | 3935 |
| 472 | Ga0105245_10444429 | 3300009098 | Bacteria | 1304 |
| 473 | Ga0114129_10004403 | 3300009147 | Bacteria | 19866 |
| 474 | Ga0114129_10006326 | 3300009147 | Bacteria | 16793 |
| 475 | Ga0114129_10017377 | 3300009147 | Bacteria | 10243 |
| 476 | Ga0114129_10018860 | 3300009147 | Bacteria | 9826 |
| 477 | Ga0114129_10024344 | 3300009147 | Bacteria | 8578 |
| 478 | Ga0114129_10074952 | 3300009147 | Bacteria | 4712 |
| 479 | Ga0114129_10077917 | 3300009147 | Unclassified | 4610 |
| 480 | Ga0114129_10090318 | 3300009147 | Bacteria | 4247 |
| 481 | Ga0114129_10119362 | 3300009147 | Unclassified | 3632 |
| 482 | Ga0114129_10141331 | 3300009147 | Bacteria | 3299 |
| 483 | Ga0114129_10165241 | 3300009147 | Unclassified | 3021 |
| 484 | Ga0114129_10192062 | 3300009147 | Archaea | 2772 |
| 485 | Ga0114129_11616100 | 3300009147 | Bacteria | 793 |
| 486 | Ga0105243_10016838 | 3300009148 | Bacteria | 5525 |
| 487 | Ga0105243_10069469 | 3300009148 | Bacteria | 2842 |
| 488 | Ga0105243_10374135 | 3300009148 | Unclassified | 1315 |
| 489 | Ga0105243_11085762 | 3300009148 | Unclassified | 808 |
| 490 | Ga0105243_11086379 | 3300009148 | Unclassified | 807 |
| 491 | Ga0105243_11812897 | 3300009148 | Unclassified | 641 |
| 492 | Ga0105241_10043620 | 3300009174 | Bacteria | 3397 |
| 493 | Ga0105242_10009992 | 3300009176 | Bacteria | 7266 |
| 494 | Ga0105242_10041319 | 3300009176 | Bacteria | 3719 |
| 495 | Ga0105242_10054914 | 3300009176 | Bacteria | 3258 |
| 496 | Ga0105248_10000243 | 3300009177 | Bacteria | 62970 |
| 497 | Ga0105248_10017073 | 3300009177 | Bacteria | 7994 |
| 498 | Ga0105248_10025998 | 3300009177 | Bacteria | 6511 |
| 499 | Ga0105248_10046378 | 3300009177 | Bacteria | 4870 |
| 500 | Ga0105248_10056375 | 3300009177 | Bacteria | 4408 |
| 501 | Ga0105248_10136884 | 3300009177 | Unclassified | 2763 |
| 502 | Ga0105248_10220619 | 3300009177 | Unclassified | 2135 |
| 503 | Ga0105248_10250745 | 3300009177 | Bacteria | 1993 |
| 504 | Ga0105248_10458448 | 3300009177 | Bacteria | 1437 |
| 505 | Ga0105248_10676764 | 3300009177 | Unclassified | 1164 |
| 506 | Ga0105248_10862059 | 3300009177 | Bacteria | 1022 |
| 507 | Ga0105248_11170598 | 3300009177 | Bacteria | 869 |
| 508 | Ga0105237_10877910 | 3300009545 | Unclassified | 904 |
| 509 | Ga0105238_10010542 | 3300009551 | Bacteria | 9281 |
| 510 | Ga0105238_10208692 | 3300009551 | Bacteria | 1929 |
| 511 | Ga0105249_10009614 | 3300009553 | Bacteria | 8473 |
| 512 | Ga0105249_10092474 | 3300009553 | Bacteria | 2832 |
| 513 | Ga0105249_10178588 | 3300009553 | Bacteria | 2064 |
| 514 | Ga0105249_11675024 | 3300009553 | Unclassified | 708 |
| 515 | Ga0105239_10135613 | 3300010375 | Bacteria | 2740 |
| 516 | Ga0105239_11115625 | 3300010375 | Bacteria | 908 |
| 517 | Ga0105246_10226429 | 3300011119 | Unclassified | 1469 |
| 518 | Ga0105246_10345440 | 3300011119 | Bacteria | 1218 |
| 519 | Ga0157371_10247019 | 3300013102 | Bacteria | 1284 |
| 520 | Ga0157370_10079849 | 3300013104 | Bacteria | 3081 |
| 521 | Ga0157370_10320138 | 3300013104 | Bacteria | 1430 |
| 522 | Ga0157369_10496811 | 3300013105 | Bacteria | 1262 |
| 523 | Ga0157369_10513350 | 3300013105 | Unclassified | 1240 |
| 524 | Ga0157374_10113917 | 3300013296 | Bacteria | 2603 |
| 525 | Ga0157374_10254045 | 3300013296 | Bacteria | 1730 |
| 526 | Ga0157378_10023312 | 3300013297 | Bacteria | 5448 |
| 527 | Ga0157378_10151836 | 3300013297 | Bacteria | 2159 |
| 528 | Ga0157378_10191924 | 3300013297 | Bacteria | 1927 |
| 529 | Ga0157378_10252980 | 3300013297 | Bacteria | 1687 |
| 530 | Ga0157378_10293176 | 3300013297 | Bacteria | 1572 |
| 531 | Ga0163162_10005885 | 3300013306 | Bacteria | 11864 |
| 532 | Ga0163162_10032921 | 3300013306 | Bacteria | 5148 |
| 533 | Ga0163162_10056136 | 3300013306 | Bacteria | 3967 |
| 534 | Ga0163162_10431291 | 3300013306 | Unclassified | 1450 |
| 535 | Ga0163162_10445013 | 3300013306 | Bacteria | 1428 |
| 536 | Ga0157375_10000157 | 3300013308 | Bacteria | 64518 |
| 537 | Ga0157375_10005598 | 3300013308 | Bacteria | 10935 |
| 538 | Ga0157375_10042515 | 3300013308 | Bacteria | 4398 |
| 539 | Ga0157375_10075376 | 3300013308 | Bacteria | 3398 |
| 540 | Ga0157375_10082389 | 3300013308 | Unclassified | 3259 |
| 541 | Ga0157375_10197476 | 3300013308 | Bacteria | 2167 |
| 542 | Ga0157375_10209186 | 3300013308 | Bacteria | 2108 |
| 543 | Ga0157375_10247575 | 3300013308 | Unclassified | 1943 |
| 544 | Ga0157375_10416127 | 3300013308 | Bacteria | 1510 |
| 545 | Ga0157375_10449231 | 3300013308 | Bacteria | 1455 |
| 546 | Ga0157375_10555034 | 3300013308 | Unclassified | 1310 |
| 547 | Ga0157375_10712990 | 3300013308 | Bacteria | 1156 |
| 548 | Ga0157375_11114325 | 3300013308 | Bacteria | 924 |
| 549 | Ga0157375_12202309 | 3300013308 | Unclassified | 657 |
| 550 | Ga0163163_10001712 | 3300014325 | Bacteria | 18499 |
| 551 | Ga0163163_10022232 | 3300014325 | Bacteria | 6000 |
| 552 | Ga0163163_10242089 | 3300014325 | Bacteria | 1854 |
| 553 | Ga0163163_10254285 | 3300014325 | Bacteria | 1808 |
| 554 | Ga0163163_10891453 | 3300014325 | Unclassified | 953 |
| 555 | Ga0163163_10937332 | 3300014325 | Unclassified | 929 |
| 556 | Ga0157380_10000377 | 3300014326 | Bacteria | 26856 |
| 557 | Ga0157380_10012562 | 3300014326 | Bacteria | 6146 |
| 558 | Ga0157380_10032399 | 3300014326 | Bacteria | 4020 |
| 559 | Ga0157380_10103717 | 3300014326 | Unclassified | 2374 |
| 560 | Ga0157380_10109354 | 3300014326 | Unclassified | 2319 |
| 561 | Ga0157380_10286362 | 3300014326 | Unclassified | 1510 |
| 562 | Ga0157380_10462442 | 3300014326 | Bacteria | 1222 |
| 563 | Ga0157380_10549810 | 3300014326 | Bacteria | 1132 |
| 564 | Ga0157380_10565719 | 3300014326 | Bacteria | 1118 |
| 565 | Ga0157377_10016508 | 3300014745 | Bacteria | 3799 |
| 566 | Ga0157377_10017173 | 3300014745 | Bacteria | 3739 |
| 567 | Ga0157377_10022871 | 3300014745 | Unclassified | 3306 |
| 568 | Ga0157377_10033863 | 3300014745 | Bacteria | 2791 |
| 569 | Ga0157377_10055345 | 3300014745 | Bacteria | 2249 |
| 570 | Ga0157377_10514667 | 3300014745 | Unclassified | 839 |
| 571 | Ga0157379_10000094 | 3300014968 | Bacteria | 59552 |
| 572 | Ga0157379_10045095 | 3300014968 | Bacteria | 3936 |
| 573 | Ga0157376_10070534 | 3300014969 | Bacteria | 2966 |
| 574 | Ga0157376_10133088 | 3300014969 | Bacteria | 2222 |
| 575 | Ga0157376_10199253 | 3300014969 | Bacteria | 1841 |
| 576 | Ga0157376_10205636 | 3300014969 | Bacteria | 1814 |
| 577 | Ga0157376_10231921 | 3300014969 | Bacteria | 1715 |
| 578 | Ga0157376_10351615 | 3300014969 | Unclassified | 1410 |
| 579 | Ga0157376_10472887 | 3300014969 | Bacteria | 1227 |
| 580 | Ga0163161_10067595 | 3300017792 | Bacteria | 2610 |
| 581 | Ga0163161_10112660 | 3300017792 | Bacteria | 2035 |
| 582 | Ga0163161_10305829 | 3300017792 | Unclassified | 1253 |
| 583 | Ga0163161_10931516 | 3300017792 | Unclassified | 738 |
| 584 | Ga0163161_11090587 | 3300017792 | Bacteria | 686 |
| 585 | Ga0206349_1746695 | 3300020075 | Bacteria | 1461 |
| 586 | Ga0206352_10238537 | 3300020078 | Unclassified | 1121 |
| 587 | Ga0206350_10890321 | 3300020080 | Unclassified | 1797 |
| 588 | Ga0206350_11229116 | 3300020080 | Bacteria | 1778 |
| 589 | Ga0224712_10048712 | 3300022467 | Unclassified | 1637 |
| 590 | Ga0207697_10002446 | 3300025315 | Bacteria | 9620 |
| 591 | Ga0207697_10053017 | 3300025315 | Bacteria | 1679 |
| 592 | Ga0207656_10013876 | 3300025321 | Bacteria | 3092 |
| 593 | Ga0207656_10269448 | 3300025321 | Bacteria | 838 |
| 594 | Ga0207682_10005509 | 3300025893 | Bacteria | 5155 |
| 595 | Ga0207682_10008532 | 3300025893 | Bacteria | 4049 |
| 596 | Ga0207682_10028997 | 3300025893 | Bacteria | 2212 |
| 597 | Ga0207682_10168593 | 3300025893 | Bacteria | 995 |
| 598 | Ga0207642_10173157 | 3300025899 | Unclassified | 1170 |
| 599 | Ga0207642_10197180 | 3300025899 | Unclassified | 1109 |
| 600 | Ga0207688_10002119 | 3300025901 | Bacteria | 10660 |
| 601 | Ga0207688_10015491 | 3300025901 | Bacteria | 4134 |
| 602 | Ga0207688_10017988 | 3300025901 | Bacteria | 3846 |
| 603 | Ga0207688_10044651 | 3300025901 | Bacteria | 2470 |
| 604 | Ga0207688_10205537 | 3300025901 | Bacteria | 1182 |
| 605 | Ga0207688_10223183 | 3300025901 | Bacteria | 1136 |
| 606 | Ga0207680_10006504 | 3300025903 | Bacteria | 5655 |
| 607 | Ga0207680_10041886 | 3300025903 | Unclassified | 2675 |
| 608 | Ga0207680_10155353 | 3300025903 | Bacteria | 1529 |
| 609 | Ga0207680_10224199 | 3300025903 | Bacteria | 1290 |
| 610 | Ga0207680_10330322 | 3300025903 | Bacteria | 1068 |
| 611 | Ga0207647_10083612 | 3300025904 | Bacteria | 1911 |
| 612 | Ga0207699_10324886 | 3300025906 | Bacteria | 1080 |
| 613 | Ga0207645_10006284 | 3300025907 | Bacteria | 8539 |
| 614 | Ga0207645_10015758 | 3300025907 | Bacteria | 5012 |
| 615 | Ga0207645_10018352 | 3300025907 | Bacteria | 4604 |
| 616 | Ga0207645_10265510 | 3300025907 | Bacteria | 1137 |
| 617 | Ga0207645_10282600 | 3300025907 | Bacteria | 1102 |
| 618 | Ga0207643_10000504 | 3300025908 | Bacteria | 24971 |
| 619 | Ga0207643_10023869 | 3300025908 | Bacteria | 3374 |
| 620 | Ga0207643_10025171 | 3300025908 | Unclassified | 3288 |
| 621 | Ga0207643_10050749 | 3300025908 | Bacteria | 2353 |
| 622 | Ga0207684_10380105 | 3300025910 | Bacteria | 1215 |
| 623 | Ga0207707_10292363 | 3300025912 | Bacteria | 1409 |
| 624 | Ga0207695_10246300 | 3300025913 | Bacteria | 1687 |
| 625 | Ga0207695_10344338 | 3300025913 | Bacteria | 1378 |
| 626 | Ga0207695_10592310 | 3300025913 | Bacteria | 990 |
| 627 | Ga0207663_10150774 | 3300025916 | Unclassified | 1631 |
| 628 | Ga0207660_10247083 | 3300025917 | Bacteria | 1407 |
| 629 | Ga0207660_10513884 | 3300025917 | Unclassified | 972 |
| 630 | Ga0207660_10748610 | 3300025917 | Bacteria | 797 |
| 631 | Ga0207662_10003633 | 3300025918 | Bacteria | 7981 |
| 632 | Ga0207662_10003706 | 3300025918 | Bacteria | 7915 |
| 633 | Ga0207662_10007609 | 3300025918 | Bacteria | 5903 |
| 634 | Ga0207662_10034337 | 3300025918 | Bacteria | 2960 |
| 635 | Ga0207662_10072941 | 3300025918 | Bacteria | 2082 |
| 636 | Ga0207662_10155479 | 3300025918 | Bacteria | 1457 |
| 637 | Ga0207662_10174296 | 3300025918 | Unclassified | 1381 |
| 638 | Ga0207662_10215120 | 3300025918 | Bacteria | 1249 |
| 639 | Ga0207662_10491530 | 3300025918 | Unclassified | 844 |
| 640 | Ga0207657_10189724 | 3300025919 | Bacteria | 1659 |
| 641 | Ga0207657_10973590 | 3300025919 | Unclassified | 652 |
| 642 | Ga0207649_10048813 | 3300025920 | Bacteria | 2611 |
| 643 | Ga0207649_10174251 | 3300025920 | Bacteria | 1501 |
| 644 | Ga0207649_10181047 | 3300025920 | Bacteria | 1475 |
| 645 | Ga0207652_10539812 | 3300025921 | Bacteria | 1048 |
| 646 | Ga0207652_10666928 | 3300025921 | Bacteria | 929 |
| 647 | Ga0207646_10066022 | 3300025922 | Bacteria | 3230 |
| 648 | Ga0207646_10410902 | 3300025922 | Bacteria | 1222 |
| 649 | Ga0207681_10012475 | 3300025923 | Bacteria | 5244 |
| 650 | Ga0207681_10020425 | 3300025923 | Bacteria | 4197 |
| 651 | Ga0207681_10029586 | 3300025923 | Bacteria | 3560 |
| 652 | Ga0207681_10044289 | 3300025923 | Unclassified | 2982 |
| 653 | Ga0207681_10433839 | 3300025923 | Unclassified | 1066 |
| 654 | Ga0207681_10573517 | 3300025923 | Bacteria | 930 |
| 655 | Ga0207694_10049833 | 3300025924 | Bacteria | 3242 |
| 656 | Ga0207650_10002282 | 3300025925 | Bacteria | 13376 |
| 657 | Ga0207650_10012158 | 3300025925 | Bacteria | 5933 |
| 658 | Ga0207650_10029076 | 3300025925 | Bacteria | 3969 |
| 659 | Ga0207650_10043144 | 3300025925 | Unclassified | 3310 |
| 660 | Ga0207650_10139685 | 3300025925 | Unclassified | 1903 |
| 661 | Ga0207650_10472166 | 3300025925 | Bacteria | 1046 |
| 662 | Ga0207650_10481983 | 3300025925 | Bacteria | 1035 |
| 663 | Ga0207650_10509787 | 3300025925 | Unclassified | 1006 |
| 664 | Ga0207659_10000562 | 3300025926 | Bacteria | 22290 |
| 665 | Ga0207659_10001703 | 3300025926 | Bacteria | 13047 |
| 666 | Ga0207659_10003966 | 3300025926 | Bacteria | 8930 |
| 667 | Ga0207659_10008601 | 3300025926 | Bacteria | 6348 |
| 668 | Ga0207659_10008609 | 3300025926 | Bacteria | 6345 |
| 669 | Ga0207659_10012648 | 3300025926 | Bacteria | 5380 |
| 670 | Ga0207659_10025134 | 3300025926 | Unclassified | 3998 |
| 671 | Ga0207659_10027948 | 3300025926 | Bacteria | 3827 |
| 672 | Ga0207659_10119951 | 3300025926 | Bacteria | 2014 |
| 673 | Ga0207659_10131825 | 3300025926 | Bacteria | 1930 |
| 674 | Ga0207659_10230165 | 3300025926 | Bacteria | 1494 |
| 675 | Ga0207659_11123158 | 3300025926 | Unclassified | 676 |
| 676 | Ga0207687_10127827 | 3300025927 | Bacteria | 1911 |
| 677 | Ga0207700_10010397 | 3300025928 | Bacteria | 5870 |
| 678 | Ga0207664_10207856 | 3300025929 | Unclassified | 1692 |
| 679 | Ga0207644_10017499 | 3300025931 | Bacteria | 4842 |
| 680 | Ga0207644_10038073 | 3300025931 | Bacteria | 3386 |
| 681 | Ga0207644_10041886 | 3300025931 | Bacteria | 3242 |
| 682 | Ga0207644_10060165 | 3300025931 | Bacteria | 2748 |
| 683 | Ga0207644_10169812 | 3300025931 | Bacteria | 1702 |
| 684 | Ga0207690_10282167 | 3300025932 | Bacteria | 1294 |
| 685 | Ga0207690_10347892 | 3300025932 | Unclassified | 1171 |
| 686 | Ga0207690_11080708 | 3300025932 | Viruses | 668 |
| 687 | Ga0207706_10001744 | 3300025933 | Bacteria | 21354 |
| 688 | Ga0207706_10011372 | 3300025933 | Bacteria | 8110 |
| 689 | Ga0207706_10019140 | 3300025933 | Bacteria | 6159 |
| 690 | Ga0207706_10087453 | 3300025933 | Bacteria | 2740 |
| 691 | Ga0207706_10187264 | 3300025933 | Bacteria | 1817 |
| 692 | Ga0207706_10257004 | 3300025933 | Bacteria | 1525 |
| 693 | Ga0207706_10311570 | 3300025933 | Bacteria | 1370 |
| 694 | Ga0207686_10013110 | 3300025934 | Bacteria | 4578 |
| 695 | Ga0207686_10031969 | 3300025934 | Bacteria | 3129 |
| 696 | Ga0207709_10043504 | 3300025935 | Unclassified | 2708 |
| 697 | Ga0207709_10190881 | 3300025935 | Unclassified | 1455 |
| 698 | Ga0207670_10053120 | 3300025936 | Unclassified | 2728 |
| 699 | Ga0207670_10058305 | 3300025936 | Bacteria | 2622 |
| 700 | Ga0207670_10121597 | 3300025936 | Bacteria | 1899 |
| 701 | Ga0207670_10214103 | 3300025936 | Bacteria | 1471 |
| 702 | Ga0207670_10300615 | 3300025936 | Bacteria | 1256 |
| 703 | Ga0207669_10000046 | 3300025937 | Bacteria | 62654 |
| 704 | Ga0207669_10005417 | 3300025937 | Bacteria | 5724 |
| 705 | Ga0207669_10079882 | 3300025937 | Bacteria | 2090 |
| 706 | Ga0207669_10093496 | 3300025937 | Bacteria | 1965 |
| 707 | Ga0207669_10751398 | 3300025937 | Bacteria | 805 |
| 708 | Ga0207669_10898358 | 3300025937 | Bacteria | 740 |
| 709 | Ga0207704_10016619 | 3300025938 | Bacteria | 3787 |
| 710 | Ga0207704_10036752 | 3300025938 | Bacteria | 2820 |
| 711 | Ga0207704_10065346 | 3300025938 | Unclassified | 2277 |
| 712 | Ga0207704_10655021 | 3300025938 | Bacteria | 865 |
| 713 | Ga0207704_11074798 | 3300025938 | Bacteria | 683 |
| 714 | Ga0207665_10114638 | 3300025939 | Unclassified | 1897 |
| 715 | Ga0207691_10001339 | 3300025940 | Bacteria | 24573 |
| 716 | Ga0207691_10005966 | 3300025940 | Bacteria | 11768 |
| 717 | Ga0207691_10016966 | 3300025940 | Bacteria | 6910 |
| 718 | Ga0207691_10024791 | 3300025940 | Bacteria | 5638 |
| 719 | Ga0207691_10051009 | 3300025940 | Bacteria | 3785 |
| 720 | Ga0207691_10067575 | 3300025940 | Bacteria | 3231 |
| 721 | Ga0207691_10088911 | 3300025940 | Unclassified | 2770 |
| 722 | Ga0207691_10089175 | 3300025940 | Bacteria | 2766 |
| 723 | Ga0207691_10099770 | 3300025940 | Bacteria | 2592 |
| 724 | Ga0207691_10152862 | 3300025940 | Unclassified | 2028 |
| 725 | Ga0207691_10185243 | 3300025940 | Unclassified | 1818 |
| 726 | Ga0207691_10229627 | 3300025940 | Bacteria | 1607 |
| 727 | Ga0207691_10562834 | 3300025940 | Unclassified | 966 |
| 728 | Ga0207691_10620048 | 3300025940 | Bacteria | 915 |
| 729 | Ga0207691_10621913 | 3300025940 | Unclassified | 913 |
| 730 | Ga0207711_10000570 | 3300025941 | Bacteria | 37542 |
| 731 | Ga0207711_10026483 | 3300025941 | Bacteria | 4866 |
| 732 | Ga0207711_10044603 | 3300025941 | Bacteria | 3786 |
| 733 | Ga0207711_10048405 | 3300025941 | Bacteria | 3637 |
| 734 | Ga0207711_10146429 | 3300025941 | Unclassified | 2128 |
| 735 | Ga0207711_10148090 | 3300025941 | Bacteria | 2116 |
| 736 | Ga0207711_10372205 | 3300025941 | Bacteria | 1325 |
| 737 | Ga0207711_10417248 | 3300025941 | Bacteria | 1248 |
| 738 | Ga0207711_11017775 | 3300025941 | Bacteria | 768 |
| 739 | Ga0207711_11065547 | 3300025941 | Bacteria | 749 |
| 740 | Ga0207689_10002152 | 3300025942 | Bacteria | 18532 |
| 741 | Ga0207689_10007933 | 3300025942 | Bacteria | 9272 |
| 742 | Ga0207689_10072939 | 3300025942 | Bacteria | 2820 |
| 743 | Ga0207689_10078527 | 3300025942 | Bacteria | 2712 |
| 744 | Ga0207689_10267269 | 3300025942 | Bacteria | 1416 |
| 745 | Ga0207689_10284241 | 3300025942 | Bacteria | 1370 |
| 746 | Ga0207689_10711130 | 3300025942 | Bacteria | 847 |
| 747 | Ga0207661_10081711 | 3300025944 | Bacteria | 2670 |
| 748 | Ga0207679_10027338 | 3300025945 | Bacteria | 3944 |
| 749 | Ga0207679_10038212 | 3300025945 | Bacteria | 3419 |
| 750 | Ga0207679_10084256 | 3300025945 | Unclassified | 2439 |
| 751 | Ga0207679_10171446 | 3300025945 | Bacteria | 1787 |
| 752 | Ga0207679_10307373 | 3300025945 | Bacteria | 1369 |
| 753 | Ga0207679_10315704 | 3300025945 | Bacteria | 1351 |
| 754 | Ga0207679_10455285 | 3300025945 | Unclassified | 1135 |
| 755 | Ga0207679_10653057 | 3300025945 | Unclassified | 951 |
| 756 | Ga0207667_10156356 | 3300025949 | Bacteria | 2346 |
| 757 | Ga0207651_10002765 | 3300025960 | Bacteria | 8422 |
| 758 | Ga0207651_10004530 | 3300025960 | Bacteria | 7021 |
| 759 | Ga0207651_10008951 | 3300025960 | Bacteria | 5438 |
| 760 | Ga0207651_10069210 | 3300025960 | Unclassified | 2491 |
| 761 | Ga0207651_10103548 | 3300025960 | Bacteria | 2118 |
| 762 | Ga0207651_10477790 | 3300025960 | Bacteria | 1074 |
| 763 | Ga0207651_10764184 | 3300025960 | Unclassified | 855 |
| 764 | Ga0207712_10005227 | 3300025961 | Bacteria | 8207 |
| 765 | Ga0207712_10308001 | 3300025961 | Bacteria | 1302 |
| 766 | Ga0207712_10402510 | 3300025961 | Bacteria | 1151 |
| 767 | Ga0207712_10652384 | 3300025961 | Unclassified | 915 |
| 768 | Ga0207668_10224120 | 3300025972 | Bacteria | 1512 |
| 769 | Ga0207668_10710976 | 3300025972 | Bacteria | 884 |
| 770 | Ga0207668_11242802 | 3300025972 | Bacteria | 670 |
| 771 | Ga0207640_10632464 | 3300025981 | Bacteria | 910 |
| 772 | Ga0207640_11442012 | 3300025981 | Unclassified | 617 |
| 773 | Ga0207658_10001809 | 3300025986 | Bacteria | 16012 |
| 774 | Ga0207658_10004182 | 3300025986 | Bacteria | 10057 |
| 775 | Ga0207658_10019015 | 3300025986 | Bacteria | 4752 |
| 776 | Ga0207658_10046295 | 3300025986 | Bacteria | 3176 |
| 777 | Ga0207658_10177695 | 3300025986 | Bacteria | 1759 |
| 778 | Ga0207658_10602860 | 3300025986 | Bacteria | 987 |
| 779 | Ga0207677_10024856 | 3300026023 | Bacteria | 3728 |
| 780 | Ga0207677_10178254 | 3300026023 | Bacteria | 1669 |
| 781 | Ga0207677_10317732 | 3300026023 | Bacteria | 1293 |
| 782 | Ga0207677_10540729 | 3300026023 | Bacteria | 1014 |
| 783 | Ga0207677_10548257 | 3300026023 | Unclassified | 1007 |
| 784 | Ga0207703_10021318 | 3300026035 | Bacteria | 5073 |
| 785 | Ga0207703_10273489 | 3300026035 | Bacteria | 1531 |
| 786 | Ga0207703_11112159 | 3300026035 | Bacteria | 759 |
| 787 | Ga0207639_10193001 | 3300026041 | Bacteria | 1741 |
| 788 | Ga0207639_10603402 | 3300026041 | Bacteria | 1012 |
| 789 | Ga0207678_10140070 | 3300026067 | Bacteria | 2064 |
| 790 | Ga0207678_10149473 | 3300026067 | Bacteria | 1994 |
| 791 | Ga0207678_10526191 | 3300026067 | Bacteria | 1032 |
| 792 | Ga0207678_10610587 | 3300026067 | Bacteria | 956 |
| 793 | Ga0207708_10003860 | 3300026075 | Bacteria | 11028 |
| 794 | Ga0207708_10031951 | 3300026075 | Bacteria | 3998 |
| 795 | Ga0207708_10061192 | 3300026075 | Unclassified | 2874 |
| 796 | Ga0207708_10104867 | 3300026075 | Bacteria | 2191 |
| 797 | Ga0207708_10853132 | 3300026075 | Bacteria | 786 |
| 798 | Ga0207641_10001737 | 3300026088 | Bacteria | 21033 |
| 799 | Ga0207641_10012859 | 3300026088 | Bacteria | 6864 |
| 800 | Ga0207641_10033218 | 3300026088 | Bacteria | 4287 |
| 801 | Ga0207641_10328759 | 3300026088 | Bacteria | 1451 |
| 802 | Ga0207641_10591142 | 3300026088 | Bacteria | 1086 |
| 803 | Ga0207641_10688877 | 3300026088 | Unclassified | 1006 |
| 804 | Ga0207641_10883811 | 3300026088 | Bacteria | 887 |
| 805 | Ga0207648_10000406 | 3300026089 | Bacteria | 47912 |
| 806 | Ga0207648_10001967 | 3300026089 | Bacteria | 22450 |
| 807 | Ga0207648_10078570 | 3300026089 | Bacteria | 2879 |
| 808 | Ga0207648_10504305 | 3300026089 | Unclassified | 1107 |
| 809 | Ga0207648_10813938 | 3300026089 | Unclassified | 870 |
| 810 | Ga0207648_11192386 | 3300026089 | Unclassified | 715 |
| 811 | Ga0207676_10053072 | 3300026095 | Unclassified | 3172 |
| 812 | Ga0207676_10090437 | 3300026095 | Bacteria | 2512 |
| 813 | Ga0207676_10098634 | 3300026095 | Bacteria | 2416 |
| 814 | Ga0207676_10102685 | 3300026095 | Bacteria | 2374 |
| 815 | Ga0207676_10112249 | 3300026095 | Bacteria | 2283 |
| 816 | Ga0207676_10231505 | 3300026095 | Bacteria | 1652 |
| 817 | Ga0207676_10385286 | 3300026095 | Bacteria | 1306 |
| 818 | Ga0207676_11266812 | 3300026095 | Bacteria | 732 |
| 819 | Ga0207674_10021532 | 3300026116 | Bacteria | 6941 |
| 820 | Ga0207674_10133016 | 3300026116 | Bacteria | 2450 |
| 821 | Ga0207674_10323555 | 3300026116 | Bacteria | 1491 |
| 822 | Ga0207675_100004384 | 3300026118 | Bacteria | 13641 |
| 823 | Ga0207675_100005257 | 3300026118 | Bacteria | 12452 |
| 824 | Ga0207675_100011559 | 3300026118 | Bacteria | 8254 |
| 825 | Ga0207675_100088924 | 3300026118 | Bacteria | 2902 |
| 826 | Ga0207675_100278461 | 3300026118 | Bacteria | 1625 |
| 827 | Ga0207675_100369385 | 3300026118 | Bacteria | 1409 |
| 828 | Ga0207675_100440432 | 3300026118 | Bacteria | 1290 |
| 829 | Ga0207675_100672403 | 3300026118 | Unclassified | 1043 |
| 830 | Ga0207683_10020732 | 3300026121 | Bacteria | 5624 |
| 831 | Ga0207683_10026613 | 3300026121 | Bacteria | 4994 |
| 832 | Ga0207683_10033110 | 3300026121 | Bacteria | 4489 |
| 833 | Ga0207683_10049831 | 3300026121 | Bacteria | 3667 |
| 834 | Ga0207683_10052214 | 3300026121 | Unclassified | 3582 |
| 835 | Ga0207683_10083014 | 3300026121 | Unclassified | 2847 |
| 836 | Ga0207683_10134784 | 3300026121 | Bacteria | 2223 |
| 837 | Ga0207683_10141677 | 3300026121 | Bacteria | 2167 |
| 838 | Ga0207683_10194589 | 3300026121 | Bacteria | 1842 |
| 839 | Ga0207683_10347697 | 3300026121 | Bacteria | 1360 |
| 840 | Ga0207683_10654751 | 3300026121 | Bacteria | 973 |
| 841 | Ga0207698_10107111 | 3300026142 | Bacteria | 2333 |
| 842 | Ga0207698_10240799 | 3300026142 | Bacteria | 1649 |
| 843 | Ga0207698_10795415 | 3300026142 | Bacteria | 948 |
| 844 | Ga0209995_1021268 | 3300027471 | Unclassified | 1075 |
| 845 | Ga0209995_1021843 | 3300027471 | Unclassified | 1061 |
| 846 | Ga0209968_1017417 | 3300027526 | Bacteria | 1146 |
| 847 | Ga0207428_10004450 | 3300027907 | Bacteria | 13313 |
| 848 | Ga0207428_10019879 | 3300027907 | Bacteria | 5719 |
| 849 | Ga0207428_10056608 | 3300027907 | Unclassified | 3115 |
| 850 | Ga0207428_10115662 | 3300027907 | Unclassified | 2060 |
| 851 | Ga0207428_10217673 | 3300027907 | Bacteria | 1433 |
| 852 | Ga0207428_10386187 | 3300027907 | Bacteria | 1026 |
| 853 | Ga0268266_10026474 | 3300028379 | Bacteria | 4935 |
| 854 | Ga0268266_10084162 | 3300028379 | Unclassified | 2777 |
| 855 | Ga0268266_10339990 | 3300028379 | Bacteria | 1409 |
| 856 | Ga0268266_10661553 | 3300028379 | Bacteria | 1006 |
| 857 | Ga0268265_10225525 | 3300028380 | Unclassified | 1643 |
| 858 | Ga0268265_10291426 | 3300028380 | Unclassified | 1465 |
| 859 | Ga0268265_10326993 | 3300028380 | Bacteria | 1391 |
| 860 | Ga0268265_10377243 | 3300028380 | Unclassified | 1303 |
| 861 | Ga0268265_10544352 | 3300028380 | Bacteria | 1101 |
| 862 | Ga0268265_10594225 | 3300028380 | Unclassified | 1057 |
| 863 | Ga0268264_10002691 | 3300028381 | Bacteria | 15520 |
| 864 | Ga0268264_10074468 | 3300028381 | Bacteria | 2884 |
| 865 | Ga0268264_10362762 | 3300028381 | Bacteria | 1382 |
| 866 | Ga0268264_10437228 | 3300028381 | Bacteria | 1265 |
| 867 | Ga0268264_10525498 | 3300028381 | Bacteria | 1157 |
| 868 | Ga0268264_10542218 | 3300028381 | Bacteria | 1140 |
| 869 | Ga0268264_10907914 | 3300028381 | Bacteria | 884 |
| 870 | Ga0268264_10913604 | 3300028381 | Unclassified | 881 |
| 871 | Ga0307408_100154756 | 3300031548 | Bacteria | 1814 |
| 872 | Ga0307408_100455000 | 3300031548 | Bacteria | 1111 |
| 873 | Ga0307516_10407669 | 3300031730 | Bacteria | 1018 |
| 874 | Ga0307405_10200528 | 3300031731 | Unclassified | 1449 |
| 875 | Ga0307413_10063423 | 3300031824 | Unclassified | 2291 |
| 876 | Ga0307410_10838689 | 3300031852 | Unclassified | 784 |
| 877 | Ga0307406_10106255 | 3300031901 | Unclassified | 1923 |
| 878 | Ga0307407_10070361 | 3300031903 | Unclassified | 2080 |
| 879 | Ga0307407_10199389 | 3300031903 | Bacteria | 1340 |
| 880 | Ga0307407_10259917 | 3300031903 | Bacteria | 1194 |
| 881 | Ga0307409_100204253 | 3300031995 | Unclassified | 1770 |
| 882 | Ga0307409_100545561 | 3300031995 | Bacteria | 1137 |
| 883 | Ga0307409_101029004 | 3300031995 | Bacteria | 843 |
| 884 | Ga0307409_101693629 | 3300031995 | Bacteria | 661 |
| 885 | Ga0307416_100042027 | 3300032002 | Bacteria | 3565 |
| 886 | Ga0307416_100752114 | 3300032002 | Unclassified | 1067 |
| 887 | Ga0307416_101087484 | 3300032002 | Bacteria | 904 |
| 888 | Ga0307416_101340545 | 3300032002 | Unclassified | 821 |
| 889 | Ga0307414_10175792 | 3300032004 | Bacteria | 1717 |
| 890 | Ga0307414_10768743 | 3300032004 | Bacteria | 877 |
| 891 | Ga0307411_10103836 | 3300032005 | Bacteria | 2017 |
| 892 | Ga0307411_10107278 | 3300032005 | Bacteria | 1990 |
| 893 | Ga0307411_10295633 | 3300032005 | Bacteria | 1296 |
| 894 | Ga0307411_11228603 | 3300032005 | Unclassified | 680 |
| 895 | Ga0373930_0009710 | 3300034816 | Unclassified | 1707 |
| 896 | Ga0373948_0054856 | 3300034817 | Bacteria | 864 |
| 897 | Ga0373950_0038156 | 3300034818 | Unclassified | 911 |
| 898 | Ga0373958_0000117 | 3300034819 | Bacteria | 8616 |
| 899 | Ga0373958_0133263 | 3300034819 | Bacteria | 610 |
| 900 | Ga0373938_0000089 | 3300034957 | Bacteria | 12374 |
| 901 | Ga0373928_0114491 | 3300035084 | Unclassified | 717 |
| 902 | Ga0373929_0000318 | 3300035085 | Bacteria | 8905 |
| 903 | Ga0373934_0000231 | 3300035086 | Bacteria | 20333 |
| 904 | Ga0373940_0000090 | 3300035088 | Bacteria | 10846 |
| 905 | Ga0373949_0001074 | 3300035090 | Bacteria | 8350 |
| 906 | Ga0373949_0022133 | 3300035090 | Unclassified | 1463 |
| 907 | Ga0373951_0000324 | 3300035091 | Bacteria | 14868 |
| 908 | Ga0373952_0000153 | 3300035092 | Bacteria | 10190 |
| 909 | Ga0373923_0154539 | 3300035111 | Unclassified | 1044 |
| 910 | Ga0373932_0000097 | 3300035112 | Bacteria | 23296 |
| 911 | Ga0373932_0094743 | 3300035112 | Unclassified | 963 |
| 912 | Ga0373932_0184376 | 3300035112 | Unclassified | 734 |
| 913 | Ga0373939_0000186 | 3300035114 | Bacteria | 17245 |
| 914 | Ga0373939_0041938 | 3300035114 | Bacteria | 1382 |
| 915 | Ga0373945_0201557 | 3300035116 | Unclassified | 826 |
| 916 | Ga0373953_0024611 | 3300035117 | Archaea | 2291 |
| 917 | Ga0373953_0052976 | 3300035117 | Unclassified | 1643 |
| 918 | Ga0373953_0122369 | 3300035117 | Unclassified | 1106 |
| 919 | Ga0373956_0002311 | 3300035119 | Bacteria | 7844 |
| 920 | Ga0373957_0002935 | 3300035120 | Bacteria | 4941 |
| 921 | Ga0373960_0000411 | 3300035121 | Bacteria | 8397 |
| 922 | Ga0373960_0236059 | 3300035121 | Bacteria | 659 |
| 923 | Ga0373943_0008218 | 3300035170 | Bacteria | 4683 |
| 924 | Ga0373946_0052851 | 3300035171 | Unclassified | 1705 |
| 925 | Ga0373946_0136521 | 3300035171 | Bacteria | 1133 |
| 926 | Ga0373955_0001686 | 3300035172 | Bacteria | 9447 |
| 927 | Ga0373955_0600358 | 3300035172 | Unclassified | 674 |
| 928 | Ga0373942_0123273 | 3300035207 | Bacteria | 812 |
| 929 | Ga0373942_0205389 | 3300035207 | Unclassified | 655 |
| 930 | Ga0373961_0004500 | 3300035241 | Bacteria | 3370 |
| 931 | Ga0373961_0005962 | 3300035241 | Bacteria | 2927 |
| 932 | Ga0373962_0000903 | 3300035242 | Bacteria | 6789 |
| 933 | Ga0373962_0022498 | 3300035242 | Bacteria | 1672 |
| 934 | Ga0373962_0054654 | 3300035242 | Unclassified | 1158 |
| 935 | Ga0373924_0024094 | 3300035410 | Unclassified | 2395 |
| 936 | Ga0373931_0000899 | 3300035691 | Bacteria | 12585 |
| 937 | Ga0373931_0074711 | 3300035691 | Bacteria | 1857 |
| 938 | Ga0373931_0177519 | 3300035691 | Bacteria | 1259 |
| 939 | Ga0373935_0102755 | 3300035692 | Unclassified | 1886 |
| 940 | Ga0373927_0058119 | 3300035695 | Unclassified | 2501 |
| 941 | Ga0373933_0032115 | 3300035724 | Bacteria | 3050 |
| 942 | Ga0373933_0067655 | 3300035724 | Unclassified | 2168 |
| 943 | Ga0373947_0006250 | 3300035725 | Bacteria | 6925 |
| 944 | Ga0373937_0000754 | 3300036401 | Bacteria | 27969 |
| 945 | Ga0373937_0054986 | 3300036401 | Bacteria | 3653 |
| 946 | Ga0373937_0207500 | 3300036401 | Unclassified | 1843 |
| 947 | Ga0373937_0784497 | 3300036401 | Unclassified | 900 |
| 948 | Ga0373937_0848123 | 3300036401 | Bacteria | 862 |
| 949 | Ga0373937_1086821 | 3300036401 | Unclassified | 748 |
| 950 | Ga0373925_0014515 | 3300037068 | Bacteria | 5694 |
| 951 | Ga0373925_0317100 | 3300037068 | Unclassified | 1261 |
| 952 | Ga0395900_0626532 | 3300037418 | Bacteria | 1014 |
| 953 | Ga0395898_1434220 | 3300037466 | Bacteria | 617 |
| 954 | Ga0436364_0766115 | 3300037853 | Unclassified | 1621 |
| 955 | Ga0436365_0920024 | 3300039437 | Bacteria | 1573 |
| 956 | Ga0436363_0770679 | 3300039450 | Bacteria | 1081 |
| 957 | Ga0439453_0018744 | 3300041408 | Bacteria | 1226 |
| 958 | Ga0450920_008136 | 3300042122 | Bacteria | 1913 |
| 959 | Ga0450920_053990 | 3300042122 | Bacteria | 808 |
| 960 | Ga0450923_033576 | 3300042125 | Bacteria | 1055 |
| 961 | Ga0450923_072948 | 3300042125 | Bacteria | 763 |
| 962 | Ga0450894_006397 | 3300042131 | Bacteria | 1519 |
| 963 | Ga0450895_005024 | 3300042132 | Bacteria | 1058 |
| 964 | Ga0450896_004202 | 3300042133 | Bacteria | 1948 |
| 965 | Ga0450896_011157 | 3300042133 | Bacteria | 1263 |
| 966 | Ga0450896_012559 | 3300042133 | Bacteria | 1199 |
| 967 | Ga0450906_038422 | 3300042145 | Bacteria | 845 |
| 968 | Ga0439458_0063582 | 3300042157 | Bacteria | 924 |
| 969 | Ga0450908_008084 | 3300042184 | Unclassified | 1973 |
| 970 | Ga0450908_038218 | 3300042184 | Bacteria | 832 |
| 971 | Ga0450908_039236 | 3300042184 | Bacteria | 821 |
| 972 | Ga0439434_0091513 | 3300042435 | Unclassified | 973 |
| 973 | Ga0439435_0002337 | 3300042436 | Unclassified | 3744 |
| 974 | Ga0439435_0022536 | 3300042436 | Bacteria | 1645 |
| 975 | Ga0439435_0061092 | 3300042436 | Bacteria | 1098 |
| 976 | Ga0439435_0116445 | 3300042436 | Bacteria | 833 |
| 977 | Ga0439444_0088411 | 3300042437 | Bacteria | 688 |
| 978 | Ga0439460_0048231 | 3300042461 | Unclassified | 1270 |
| 979 | Ga0439460_0184487 | 3300042461 | Unclassified | 706 |
| 980 | Ga0450918_067527 | 3300042531 | Bacteria | 668 |
| 981 | Ga0451577_0064556 | 3300042876 | Bacteria | 3265 |
| 982 | Ga0451576_0101356 | 3300045051 | Bacteria | 2994 |
| 983 | Ga0451576_0639658 | 3300045051 | Bacteria | 1118 |
| 984 | Ga0495592_0011747 | 3300046454 | Bacteria | 6633 |
| 985 | Ga0495603_0244308 | 3300046455 | Bacteria | 1034 |
| 986 | Ga0495603_0457422 | 3300046455 | Bacteria | 731 |
| 987 | Ga0495629_0086549 | 3300046459 | Bacteria | 2186 |
| 988 | Ga0495629_0207074 | 3300046459 | Bacteria | 1355 |
| 989 | Ga0495638_0084454 | 3300046460 | Bacteria | 1921 |
| 990 | Ga0495651_0171601 | 3300046462 | Archaea | 1544 |
| 991 | Ga0495653_0327596 | 3300046463 | Bacteria | 991 |
| 992 | Ga0495580_0126714 | 3300046472 | Bacteria | 1772 |
| 993 | Ga0495582_0169544 | 3300046473 | Bacteria | 1243 |
| 994 | Ga0495582_0195985 | 3300046473 | Unclassified | 1153 |
| 995 | Ga0495664_0161975 | 3300046477 | Unclassified | 1357 |
| 996 | Ga0495585_0402274 | 3300046492 | Bacteria | 659 |
| 997 | Ga0495594_0210922 | 3300046499 | Bacteria | 1107 |
| 998 | Ga0495608_0021077 | 3300046511 | Bacteria | 4476 |
| 999 | Ga0495628_0008926 | 3300046516 | Bacteria | 8575 |
| 1000 | Ga0495630_0014918 | 3300046517 | Bacteria | 5666 |
| 1001 | Ga0495663_0172109 | 3300046525 | Unclassified | 747 |
| 1002 | Ga0495642_0286678 | 3300046528 | Bacteria | 721 |
| 1003 | Ga0495652_0061937 | 3300046529 | Unclassified | 3157 |
| 1004 | Ga0495640_0229910 | 3300046533 | Bacteria | 1167 |
| 1005 | Ga0495586_0041000 | 3300046535 | Archaea | 2493 |
| 1006 | Ga0495586_0045676 | 3300046535 | Bacteria | 2361 |
| 1007 | Ga0495587_0142413 | 3300046536 | Bacteria | 1368 |
| 1008 | Ga0495598_0001701 | 3300046537 | Bacteria | 4413 |
| 1009 | Ga0495598_0058503 | 3300046537 | Bacteria | 1182 |
| 1010 | Ga0495621_0002944 | 3300046539 | Bacteria | 4640 |
| 1011 | Ga0495621_0043534 | 3300046539 | Bacteria | 1584 |
| 1012 | Ga0495645_0021246 | 3300046543 | Unclassified | 4690 |
| 1013 | Ga0495645_0096591 | 3300046543 | Bacteria | 2105 |
| 1014 | Ga0495667_0235338 | 3300046559 | Bacteria | 1167 |
| 1015 | Ga0495656_0019412 | 3300046615 | Unclassified | 2624 |
| 1016 | Ga0495635_0189583 | 3300046663 | Unclassified | 1396 |
| 1017 | Ga0495659_0051572 | 3300046664 | Bacteria | 1499 |
| 1018 | Ga0495659_0118879 | 3300046664 | Unclassified | 1039 |
| 1019 | Ga0495659_0181957 | 3300046664 | Bacteria | 856 |
| 1020 | Ga0495659_0221778 | 3300046664 | Bacteria | 781 |
| 1021 | Ga0495657_0123357 | 3300046675 | Unclassified | 1630 |
| 1022 | Ga0495647_0031369 | 3300046681 | Unclassified | 1976 |
| 1023 | Ga0495658_0118485 | 3300046683 | Bacteria | 1599 |
| 1024 | Ga0495669_0018284 | 3300046684 | Bacteria | 3012 |
| 1025 | Ga0495669_0193953 | 3300046684 | Bacteria | 970 |
| 1026 | Ga0495669_0349706 | 3300046684 | Bacteria | 714 |
| 1027 | Ga0495613_0001137 | 3300046689 | Bacteria | 20241 |
| 1028 | Ga0495613_0066686 | 3300046689 | Bacteria | 2628 |
| 1029 | Ga0495613_0184772 | 3300046689 | Bacteria | 1475 |
| 1030 | Ga0495670_0102190 | 3300046691 | Bacteria | 1477 |
| 1031 | Ga0495670_0208711 | 3300046691 | Unclassified | 1036 |
| 1032 | Ga0495600_0176397 | 3300046809 | Unclassified | 1378 |
| 1033 | Ga0495600_0524723 | 3300046809 | Unclassified | 726 |
| 1034 | Ga0495581_0062421 | 3300047315 | Bacteria | 2153 |
| 1035 | Ga0495604_0019458 | 3300047317 | Bacteria | 5434 |
| 1036 | Ga0495636_0140934 | 3300047318 | Bacteria | 1077 |
| 1037 | Ga0495636_0251190 | 3300047318 | Unclassified | 818 |
| 1038 | Ga0495674_0029085 | 3300047319 | Bacteria | 5034 |
| 1039 | Ga0495684_0000105 | 3300047471 | Bacteria | 59779 |
| 1040 | Ga0495684_0073898 | 3300047471 | Bacteria | 2590 |
| 1041 | Ga0496100_0033152 | 3300048903 | Bacteria | 3230 |
| 1042 | Ga0496101_0325812 | 3300048904 | Unclassified | 1205 |
| 1043 | Ga0496101_0573680 | 3300048904 | Bacteria | 892 |
| 1044 | Ga0496102_0029100 | 3300048905 | Bacteria | 4939 |
| 1045 | Ga0496103_0034029 | 3300048906 | Unclassified | 3115 |
| 1046 | Ga0496103_0547796 | 3300048906 | Unclassified | 739 |
| 1047 | Ga0496104_0093682 | 3300048907 | Unclassified | 2873 |
| 1048 | Ga0496104_0550687 | 3300048907 | Unclassified | 1064 |
| 1049 | Ga0496106_0021008 | 3300048909 | Bacteria | 4846 |
| 1050 | Ga0496106_0035262 | 3300048909 | Bacteria | 3741 |
| 1051 | Ga0496106_0409201 | 3300048909 | Unclassified | 1090 |
| 1052 | Ga0496106_0495610 | 3300048909 | Bacteria | 981 |
| 1053 | Ga0496106_0646302 | 3300048909 | Unclassified | 845 |
| 1054 | Ga0496106_0778122 | 3300048909 | Bacteria | 760 |
| 1055 | Ga0496107_0035276 | 3300048910 | Bacteria | 3586 |
| 1056 | Ga0496107_0504659 | 3300048910 | Bacteria | 897 |
| 1057 | Ga0496108_0069842 | 3300048911 | Unclassified | 2964 |
| 1058 | Ga0496108_0203464 | 3300048911 | Bacteria | 1718 |
| 1059 | Ga0496108_0326893 | 3300048911 | Bacteria | 1337 |
| 1060 | Ga0496108_0392625 | 3300048911 | Unclassified | 1212 |
| 1061 | Ga0496109_0056691 | 3300048912 | Unclassified | 3575 |
| 1062 | Ga0496109_0144174 | 3300048912 | Bacteria | 2228 |
| 1063 | Ga0496109_0655800 | 3300048912 | Bacteria | 986 |
| 1064 | Ga0496110_0046746 | 3300048913 | Bacteria | 3787 |
| 1065 | Ga0496110_0176173 | 3300048913 | Bacteria | 1941 |
| 1066 | Ga0496110_0271202 | 3300048913 | Bacteria | 1545 |
| 1067 | Ga0496112_0013866 | 3300048915 | Bacteria | 7456 |
| 1068 | Ga0496112_0109520 | 3300048915 | Bacteria | 2732 |
| 1069 | Ga0496112_0247050 | 3300048915 | Bacteria | 1736 |
| 1070 | Ga0496113_0058750 | 3300048916 | Unclassified | 2895 |
| 1071 | Ga0496113_0906206 | 3300048916 | Unclassified | 697 |
| 1072 | Ga0496114_0000887 | 3300048917 | Bacteria | 22393 |
| 1073 | Ga0501031_0043361 | 3300049568 | Bacteria | 2936 |
| 1074 | Ga0501031_0318724 | 3300049568 | Unclassified | 1007 |
| 1075 | Ga0501033_0173114 | 3300049570 | Unclassified | 1550 |
| 1076 | Ga0501033_0201880 | 3300049570 | Bacteria | 1420 |
| 1077 | Ga0501034_0003394 | 3300049571 | Bacteria | 18190 |
| 1078 | Ga0501034_0060409 | 3300049571 | Bacteria | 3807 |
| 1079 | Ga0501034_0649303 | 3300049571 | Bacteria | 957 |
| 1080 | Ga0501036_0018454 | 3300049572 | Bacteria | 5845 |
| 1081 | Ga0501036_0078194 | 3300049572 | Bacteria | 2798 |
| 1082 | Ga0501036_0198880 | 3300049572 | Unclassified | 1686 |
| 1083 | Ga0501037_0481731 | 3300049573 | Unclassified | 843 |
| 1084 | Ga0501038_0013628 | 3300049574 | Bacteria | 7409 |
| 1085 | Ga0501039_0088951 | 3300049575 | Bacteria | 2406 |
| 1086 | Ga0501039_0089117 | 3300049575 | Unclassified | 2404 |
| 1087 | Ga0501040_0003805 | 3300049576 | Bacteria | 9788 |
| 1088 | Ga0501040_0019113 | 3300049576 | Unclassified | 4555 |
| 1089 | Ga0501040_0152674 | 3300049576 | Bacteria | 1630 |
| 1090 | Ga0501040_0535024 | 3300049576 | Unclassified | 845 |
| 1091 | Ga0501041_0004970 | 3300049577 | Bacteria | 7735 |
| 1092 | Ga0501041_0024483 | 3300049577 | Unclassified | 3624 |
| 1093 | Ga0501041_0097852 | 3300049577 | Bacteria | 1814 |
| 1094 | Ga0501042_0096735 | 3300049578 | Bacteria | 2121 |
| 1095 | Ga0501042_0119870 | 3300049578 | Bacteria | 1894 |
| 1096 | Ga0501042_0177871 | 3300049578 | Bacteria | 1534 |
| 1097 | Ga0501046_0033591 | 3300049580 | Unclassified | 4143 |
| 1098 | Ga0501048_0016465 | 3300049582 | Bacteria | 5450 |
| 1099 | Ga0501048_0019543 | 3300049582 | Bacteria | 4968 |
| 1100 | Ga0501048_0070672 | 3300049582 | Unclassified | 2465 |
| 1101 | Ga0501048_0960077 | 3300049582 | Bacteria | 615 |
| 1102 | Ga0501068_0096185 | 3300049584 | Unclassified | 1832 |
| 1103 | Ga0501069_0133777 | 3300049585 | Bacteria | 1421 |
| 1104 | Ga0501069_0552900 | 3300049585 | Unclassified | 689 |
| 1105 | Ga0501070_0140124 | 3300049586 | Bacteria | 1997 |
| 1106 | Ga0501070_0434571 | 3300049586 | Bacteria | 1059 |
| 1107 | Ga0501071_0046407 | 3300049587 | Unclassified | 3120 |
| 1108 | Ga0501071_0060085 | 3300049587 | Bacteria | 2751 |
| 1109 | Ga0501071_0477905 | 3300049587 | Unclassified | 955 |
| 1110 | Ga0501072_0003526 | 3300049588 | Bacteria | 11778 |
| 1111 | Ga0501072_0033073 | 3300049588 | Bacteria | 4051 |
| 1112 | Ga0501072_0038115 | 3300049588 | Unclassified | 3772 |
| 1113 | Ga0501072_0227476 | 3300049588 | Bacteria | 1486 |
| 1114 | Ga0501073_0376668 | 3300049589 | Unclassified | 980 |
| 1115 | Ga0501074_0117701 | 3300049590 | Unclassified | 1901 |
| 1116 | Ga0501074_0155635 | 3300049590 | Unclassified | 1633 |
| 1117 | Ga0501074_0209493 | 3300049590 | Bacteria | 1389 |
| 1118 | Ga0501074_0469196 | 3300049590 | Bacteria | 892 |
| 1119 | Ga0501075_0004400 | 3300049591 | Bacteria | 9538 |
| 1120 | Ga0501075_0006633 | 3300049591 | Bacteria | 7979 |
| 1121 | Ga0501075_0048129 | 3300049591 | Unclassified | 3204 |
| 1122 | Ga0501076_0022830 | 3300049592 | Bacteria | 4813 |
| 1123 | Ga0501076_0114745 | 3300049592 | Unclassified | 2180 |
| 1124 | Ga0501076_0274613 | 3300049592 | Bacteria | 1380 |
| 1125 | Ga0501076_0644805 | 3300049592 | Bacteria | 874 |
| 1126 | Ga0501076_0742055 | 3300049592 | Unclassified | 810 |
| 1127 | Ga0501079_0014210 | 3300049741 | Bacteria | 6070 |
| 1128 | Ga0501079_0153402 | 3300049741 | Unclassified | 1795 |
| 1129 | Ga0501079_0338486 | 3300049741 | Unclassified | 1178 |
| 1130 | Ga0501079_0404527 | 3300049741 | Bacteria | 1071 |
| 1131 | Ga0501080_0216326 | 3300049742 | Unclassified | 1755 |
| 1132 | Ga0501080_0638270 | 3300049742 | Bacteria | 943 |
| 1133 | Ga0501080_0908322 | 3300049742 | Bacteria | 767 |
| 1134 | Ga0501081_0003870 | 3300049743 | Bacteria | 9592 |
| 1135 | Ga0501081_0009942 | 3300049743 | Bacteria | 6200 |
| 1136 | Ga0501081_0259969 | 3300049743 | Unclassified | 1268 |
| 1137 | Ga0501081_0840136 | 3300049743 | Unclassified | 692 |
| 1138 | Ga0501083_0380196 | 3300049744 | Bacteria | 918 |
| 1139 | Ga0501035_0073918 | 3300049822 | Bacteria | 3016 |
| 1140 | Ga0501045_0062184 | 3300049824 | Unclassified | 2739 |
| 1141 | nmdc:mga03683_336904_c1 | 3300050489 | Bacteria | 712 |
| 1142 | nmdc:mga03683_497279_c1 | 3300050489 | Bacteria | 590 |
| 1143 | nmdc:mga00v17_193115_c1 | 3300050491 | Unclassified | 1315 |
| 1144 | nmdc:mga00v17_201110_c1 | 3300050491 | Unclassified | 1288 |
| 1145 | nmdc:mga00v17_64942_c1 | 3300050491 | Bacteria | 2250 |
| 1146 | nmdc:mga0yw44_16689_c1 | 3300050492 | Bacteria | 3975 |
| 1147 | nmdc:mga0k408_107010_c1 | 3300050493 | Unclassified | 1652 |
| 1148 | nmdc:mga0k408_157931_c1 | 3300050493 | Unclassified | 1351 |
| 1149 | nmdc:mga0k408_195362_c1 | 3300050493 | Bacteria | 1208 |
| 1150 | nmdc:mga0k408_54160_c1 | 3300050493 | Bacteria | 2325 |
| 1151 | nmdc:mga06z11_154619_c1 | 3300050494 | Unclassified | 1307 |
| 1152 | nmdc:mga06z11_8215_c1 | 3300050494 | Unclassified | 4338 |
| 1153 | nmdc:mga04h51_27808_c1 | 3300050495 | Unclassified | 1760 |
| 1154 | nmdc:mga07m45_133040_c1 | 3300050496 | Unclassified | 1439 |
| 1155 | nmdc:mga05p37_160587_c2 | 3300050507 | Bacteria | 2216 |
| 1156 | nmdc:mga05p37_20943_c1 | 3300050507 | Bacteria | 7914 |
| 1157 | nmdc:mga05p37_218066_c1 | 3300050507 | Bacteria | 2304 |
| 1158 | nmdc:mga05p37_239289_c1 | 3300050507 | Bacteria | 2184 |
| 1159 | nmdc:mga05p37_278947_c1 | 3300050507 | Unclassified | 1994 |
| 1160 | nmdc:mga05p37_331674_c1 | 3300050507 | Bacteria | 1797 |
| 1161 | nmdc:mga05p37_4230_c1 | 3300050507 | Bacteria | 16776 |
| 1162 | nmdc:mga05p37_4956_c1 | 3300050507 | Bacteria | 15599 |
| 1163 | nmdc:mga05p37_71906_c2 | 3300050507 | Bacteria | 2228 |
| 1164 | nmdc:mga05p37_84334_c1 | 3300050507 | Unclassified | 3914 |
| 1165 | nmdc:mga05p37_8475_c1 | 3300050507 | Bacteria | 12153 |
| 1166 | nmdc:mga05p37_93066_c1 | 3300050507 | Bacteria | 3714 |
| 1167 | nmdc:mga09592_102534_c1 | 3300050508 | Bacteria | 2451 |
| 1168 | nmdc:mga09592_135426_c1 | 3300050508 | Unclassified | 2121 |
| 1169 | nmdc:mga09592_15059_c1 | 3300050508 | Bacteria | 6317 |
| 1170 | nmdc:mga09592_21999_c1 | 3300050508 | Bacteria | 5260 |
| 1171 | nmdc:mga09592_258710_c1 | 3300050508 | Bacteria | 1509 |
| 1172 | nmdc:mga09592_333234_c1 | 3300050508 | Bacteria | 1314 |
| 1173 | nmdc:mga09592_507254_c1 | 3300050508 | Unclassified | 1038 |
| 1174 | nmdc:mga0qj67_112279_c1 | 3300050509 | Bacteria | 2200 |
| 1175 | nmdc:mga0qj67_12785_c1 | 3300050509 | Bacteria | 6330 |
| 1176 | nmdc:mga0qj67_1798_c1 | 3300050509 | Bacteria | 15154 |
| 1177 | nmdc:mga0qj67_29269_c1 | 3300050509 | Bacteria | 4278 |
| 1178 | nmdc:mga0qj67_35802_c1 | 3300050509 | Bacteria | 3882 |
| 1179 | nmdc:mga0qj67_388558_c1 | 3300050509 | Bacteria | 1126 |
| 1180 | nmdc:mga0qj67_561113_c1 | 3300050509 | Bacteria | 915 |
| 1181 | nmdc:mga0qj67_61694_c1 | 3300050509 | Bacteria | 2977 |
| 1182 | nmdc:mga06r32_1049459_c1 | 3300050510 | Unclassified | 766 |
| 1183 | nmdc:mga06r32_11945_c1 | 3300050510 | Bacteria | 7827 |
| 1184 | nmdc:mga06r32_18018_c1 | 3300050510 | Bacteria | 6457 |
| 1185 | nmdc:mga06r32_35149_c1 | 3300050510 | Unclassified | 4728 |
| 1186 | nmdc:mga06r32_40341_c1 | 3300050510 | Bacteria | 4431 |
| 1187 | nmdc:mga06r32_5033_c1 | 3300050510 | Bacteria | 11900 |
| 1188 | nmdc:mga06r32_57791_c1 | 3300050510 | Bacteria | 3727 |
| 1189 | nmdc:mga08y16_1002_c1 | 3300050511 | Bacteria | 27593 |
| 1190 | nmdc:mga08y16_1056393_c1 | 3300050511 | Unclassified | 789 |
| 1191 | nmdc:mga08y16_12963_c1 | 3300050511 | Bacteria | 8772 |
| 1192 | nmdc:mga08y16_1534_c1 | 3300050511 | Bacteria | 23216 |
| 1193 | nmdc:mga08y16_161581_c1 | 3300050511 | Bacteria | 2328 |
| 1194 | nmdc:mga08y16_17700_c1 | 3300050511 | Bacteria | 7506 |
| 1195 | nmdc:mga08y16_336218_c1 | 3300050511 | Bacteria | 1553 |
| 1196 | nmdc:mga08y16_350609_c1 | 3300050511 | Bacteria | 1516 |
| 1197 | nmdc:mga08y16_550157_c1 | 3300050511 | Bacteria | 1168 |
| 1198 | nmdc:mga08y16_621923_c1 | 3300050511 | Bacteria | 1087 |
| 1199 | nmdc:mga08y16_7021_c1 | 3300050511 | Bacteria | 11815 |
| 1200 | nmdc:mga0n895_1493399_c1 | 3300050512 | Unclassified | 642 |
| 1201 | nmdc:mga0n895_233435_c1 | 3300050512 | Bacteria | 1867 |
| 1202 | nmdc:mga0n895_304814_c1 | 3300050512 | Unclassified | 1615 |
| 1203 | nmdc:mga0n895_309808_c1 | 3300050512 | Bacteria | 1600 |
| 1204 | nmdc:mga0n895_34611_c1 | 3300050512 | Bacteria | 4864 |
| 1205 | nmdc:mga0n895_3785_c1 | 3300050512 | Bacteria | 12250 |
| 1206 | nmdc:mga0n895_433836_c1 | 3300050512 | Bacteria | 1327 |
| 1207 | nmdc:mga0rr50_10335_c1 | 3300050513 | Bacteria | 5919 |
| 1208 | nmdc:mga0rr50_113145_c1 | 3300050513 | Unclassified | 2150 |
| 1209 | nmdc:mga0rr50_213337_c1 | 3300050513 | Bacteria | 1591 |
| 1210 | nmdc:mga0rr50_213811_c1 | 3300050513 | Bacteria | 1590 |
| 1211 | nmdc:mga0rr50_22427_c1 | 3300050513 | Bacteria | 4334 |
| 1212 | nmdc:mga0rr50_65488_c1 | 3300050513 | Unclassified | 2753 |
| 1213 | nmdc:mga08x19_122027_c1 | 3300050514 | Bacteria | 1748 |
| 1214 | nmdc:mga08x19_12915_c1 | 3300050514 | Bacteria | 5040 |
| 1215 | nmdc:mga08x19_133278_c1 | 3300050514 | Bacteria | 1673 |
| 1216 | nmdc:mga08x19_611222_c1 | 3300050514 | Bacteria | 773 |
| 1217 | nmdc:mga08x19_67103_c1 | 3300050514 | Bacteria | 2333 |
| 1218 | nmdc:mga0a205_141176_c1 | 3300050515 | Bacteria | 2309 |
| 1219 | nmdc:mga0a205_161219_c1 | 3300050515 | Unclassified | 2139 |
| 1220 | nmdc:mga0a205_174004_c1 | 3300050515 | Bacteria | 2048 |
| 1221 | nmdc:mga0a205_321062_c1 | 3300050515 | Unclassified | 1419 |
| 1222 | nmdc:mga0a205_323190_c1 | 3300050515 | Bacteria | 1414 |
| 1223 | nmdc:mga0a205_5382_c1 | 3300050515 | Bacteria | 11543 |
| 1224 | nmdc:mga0a205_658155_c1 | 3300050515 | Bacteria | 899 |
| 1225 | nmdc:mga0a205_71331_c1 | 3300050515 | Bacteria | 3355 |
| 1226 | Ga0495601_0001335 | 3300053077 | Bacteria | 13555 |
| 1227 | Ga0495601_0030327 | 3300053077 | Unclassified | 3357 |
| 1228 | Ga0495595_0204153 | 3300053084 | Unclassified | 984 |
| 1229 | Ga0495595_0304173 | 3300053084 | Unclassified | 802 |
| 1230 | Ga0495595_0442846 | 3300053084 | Bacteria | 660 |
| 1231 | Ga0495619_0011070 | 3300053085 | Bacteria | 5674 |
| 1232 | Ga0500592_001337 | 3300053116 | Bacteria | 4003 |
| 1233 | Ga0500611_128845 | 3300053727 | Bacteria | 680 |
| 1234 | Ga0501084_0005602 | 3300054114 | Bacteria | 10312 |
| 1235 | Ga0501084_0075798 | 3300054114 | Unclassified | 2818 |
| 1236 | Ga0501084_0193662 | 3300054114 | Bacteria | 1715 |
| 1237 | Ga0501084_0710348 | 3300054114 | Unclassified | 848 |
| 1238 | Ga0590071_000058 | 3300059421 | Bacteria | 29618 |
| 1239 | Ga0590075_000441 | 3300059424 | Bacteria | 11222 |
| 1240 | Ga0590077_000552 | 3300059426 | Bacteria | 10343 |
| 1241 | Ga0501082_0117082 | 3300060353 | Bacteria | 2308 |
| 1242 | Ga0501082_0240714 | 3300060353 | Bacteria | 1575 |
| 1243 | Ga0501082_1356668 | 3300060353 | Unclassified | 621 |
| 1244 | Ga0530510_0038717 | 3300061734 | Unclassified | 3443 |
| 1245 | Ga0530510_0073268 | 3300061734 | Bacteria | 2486 |
| 1246 | Ga0207708_10986374 | |||
| 1247 | JGI24743J22301_10041785 | |||
| 1248 | Ga0065712_10001425 | |||
| 1249 | Ga0065712_10001466 | |||
| 1250 | Ga0065712_10087531 | |||
| 1251 | Ga0065712_10120804 | |||
| 1252 | Ga0065712_10199682 | |||
| 1253 | Ga0065712_10228392 | |||
| 1254 | Ga0065712_10265115 | |||
| 1255 | Ga0065715_10004672 | |||
| 1256 | Ga0065715_10014152 | |||
| 1257 | Ga0065715_10034745 | |||
| 1258 | Ga0065715_10100094 | |||
| 1259 | Ga0065715_10156913 | |||
| 1260 | Ga0065715_10401699 | |||
| 1261 | Ga0065707_10092711 | |||
| 1262 | Ga0065707_10142124 | |||
| 1263 | Ga0070658_10175669 | |||
| 1264 | Ga0070676_10017287 | |||
| 1265 | Ga0070676_10060969 | |||
| 1266 | Ga0070676_10163335 | |||
| 1267 | Ga0070683_100033184 | |||
| 1268 | Ga0070690_100008400 | |||
| 1269 | Ga0070690_100008723 | |||
| 1270 | Ga0070690_100057885 | |||
| 1271 | Ga0070690_100100381 | |||
| 1272 | Ga0070690_100123056 | |||
| 1273 | Ga0070690_100127327 | |||
| 1274 | Ga0070670_100002235 | |||
| 1275 | Ga0070670_100008786 | |||
| 1276 | Ga0070670_100043002 | |||
| 1277 | Ga0070670_100064058 | |||
| 1278 | Ga0070670_100171175 | |||
| 1279 | Ga0070670_100589823 | |||
| 1280 | Ga0070677_10000772 | |||
| 1281 | Ga0070677_10006220 | |||
| 1282 | Ga0070677_10013563 | |||
| 1283 | Ga0070677_10017008 | |||
| 1284 | Ga0070677_10080690 | |||
| 1285 | Ga0070677_10207619 | |||
| 1286 | Ga0070677_10237691 | |||
| 1287 | Ga0068869_100011211 | |||
| 1288 | Ga0068869_100014741 | |||
| 1289 | Ga0068869_100073561 | |||
| 1290 | Ga0068869_100487949 | |||
| 1291 | Ga0068869_100630795 | |||
| 1292 | Ga0068869_100761597 | |||
| 1293 | Ga0068869_100820566 | |||
| 1294 | Ga0070666_10007972 | |||
| 1295 | Ga0070666_10014705 | |||
| 1296 | Ga0070666_10024305 | |||
| 1297 | Ga0070666_10031837 | |||
| 1298 | Ga0070666_10174796 | |||
| 1299 | Ga0070680_100173954 | |||
| 1300 | Ga0070680_100311822 | |||
| 1301 | Ga0070682_100480798 | |||
| 1302 | Ga0068868_100011691 | |||
| 1303 | Ga0068868_100046177 | |||
| 1304 | Ga0068868_100088896 | |||
| 1305 | Ga0068868_100563628 | |||
| 1306 | Ga0068868_100672500 | |||
| 1307 | Ga0068868_101044871 | |||
| 1308 | Ga0070660_100589037 | |||
| 1309 | Ga0070689_100051305 | |||
| 1310 | Ga0070689_100093153 | |||
| 1311 | Ga0070689_100269108 | |||
| 1312 | Ga0070689_100277490 | |||
| 1313 | Ga0070689_100452667 | |||
| 1314 | Ga0070689_100830268 | |||
| 1315 | Ga0070691_10016828 | |||
| 1316 | Ga0070687_100017374 | |||
| 1317 | Ga0070687_100018319 | |||
| 1318 | Ga0070687_100021683 | |||
| 1319 | Ga0070687_100075765 | |||
| 1320 | Ga0070687_100148634 | |||
| 1321 | Ga0070687_100550856 | |||
| 1322 | Ga0070687_100659143 | |||
| 1323 | Ga0070661_100052734 | |||
| 1324 | Ga0070661_100251344 | |||
| 1325 | Ga0070661_100562919 | |||
| 1326 | Ga0070692_10079946 | |||
| 1327 | Ga0070692_10088347 | |||
| 1328 | Ga0070668_100010474 | |||
| 1329 | Ga0070668_100123145 | |||
| 1330 | Ga0070669_100001320 | |||
| 1331 | Ga0070669_100005676 | |||
| 1332 | Ga0070669_100059354 | |||
| 1333 | Ga0070669_100059574 | |||
| 1334 | Ga0070669_100063968 | |||
| 1335 | Ga0070669_100067143 | |||
| 1336 | Ga0070669_100149514 | |||
| 1337 | Ga0070669_100365976 | |||
| 1338 | Ga0070669_100441568 | |||
| 1339 | Ga0070675_100000041 | |||
| 1340 | Ga0070675_100000966 | |||
| 1341 | Ga0070675_100001113 | |||
| 1342 | Ga0070675_100019768 | |||
| 1343 | Ga0070675_100020745 | |||
| 1344 | Ga0070675_100025710 | |||
| 1345 | Ga0070675_100065265 | |||
| 1346 | Ga0070675_100084896 | |||
| 1347 | Ga0070675_100096968 | |||
| 1348 | Ga0070675_100106727 | |||
| 1349 | Ga0070675_100117366 | |||
| 1350 | Ga0070675_100221643 | |||
| 1351 | Ga0070675_100295681 | |||
| 1352 | Ga0070675_100701092 | |||
| 1353 | Ga0070671_100010422 | |||
| 1354 | Ga0070671_100013948 | |||
| 1355 | Ga0070671_100077256 | |||
| 1356 | Ga0070671_100082788 | |||
| 1357 | Ga0070671_100123745 | |||
| 1358 | Ga0070671_100183739 | |||
| 1359 | Ga0070671_100318102 | |||
| 1360 | Ga0070671_100592848 | |||
| 1361 | Ga0070671_100599072 | |||
| 1362 | Ga0070674_100000975 | |||
| 1363 | Ga0070674_100029900 | |||
| 1364 | Ga0070674_100073012 | |||
| 1365 | Ga0070674_100159651 | |||
| 1366 | Ga0070674_100201967 | |||
| 1367 | Ga0070674_100672365 | |||
| 1368 | Ga0070673_100003896 | |||
| 1369 | Ga0070673_100013593 | |||
| 1370 | Ga0070673_100048023 | |||
| 1371 | Ga0070673_100058958 | |||
| 1372 | Ga0070673_100098402 | |||
| 1373 | Ga0070673_100204355 | |||
| 1374 | Ga0070673_100221736 | |||
| 1375 | Ga0070673_100813635 | |||
| 1376 | Ga0070673_100842139 | |||
| 1377 | Ga0070688_100018439 | |||
| 1378 | Ga0070688_100021110 | |||
| 1379 | Ga0070688_100105490 | |||
| 1380 | Ga0070688_100113673 | |||
| 1381 | Ga0070688_100128879 | |||
| 1382 | Ga0070688_100764148 | |||
| 1383 | Ga0070659_100135027 | |||
| 1384 | Ga0070659_100139449 | |||
| 1385 | Ga0070659_100149279 | |||
| 1386 | Ga0070659_100239826 | |||
| 1387 | Ga0070659_100347749 | |||
| 1388 | Ga0070667_100001662 | |||
| 1389 | Ga0070667_100042990 | |||
| 1390 | Ga0070667_100190019 | |||
| 1391 | Ga0070667_100323262 | |||
| 1392 | Ga0070709_10148887 | |||
| 1393 | Ga0070709_10406301 | |||
| 1394 | Ga0070714_100396568 | |||
| 1395 | Ga0070713_100076553 | |||
| 1396 | Ga0070713_100337680 | |||
| 1397 | Ga0070701_10009195 | |||
| 1398 | Ga0070701_10017328 | |||
| 1399 | Ga0070701_10118491 | |||
| 1400 | Ga0070701_10198865 | |||
| 1401 | Ga0070701_10548991 | |||
| 1402 | Ga0070701_10782801 | |||
| 1403 | Ga0070711_100082815 | |||
| 1404 | Ga0070705_100066205 | |||
| 1405 | Ga0070705_100101948 | |||
| 1406 | Ga0070705_100364958 | |||
| 1407 | Ga0070700_100002881 | |||
| 1408 | Ga0070700_100110496 | |||
| 1409 | Ga0070700_100280714 | |||
| 1410 | Ga0070700_100296829 | |||
| 1411 | Ga0070694_100037022 | |||
| 1412 | Ga0070694_100044691 | |||
| 1413 | Ga0070694_100283238 | |||
| 1414 | Ga0070694_100488482 | |||
| 1415 | Ga0070708_100011343 | |||
| 1416 | Ga0070708_100266125 | |||
| 1417 | Ga0070663_100315008 | |||
| 1418 | Ga0070678_100012647 | |||
| 1419 | Ga0070678_100032193 | |||
| 1420 | Ga0070678_100080804 | |||
| 1421 | Ga0070678_100103734 | |||
| 1422 | Ga0070678_100106421 | |||
| 1423 | Ga0070678_100336324 | |||
| 1424 | Ga0070678_100360914 | |||
| 1425 | Ga0070662_100068747 | |||
| 1426 | Ga0070662_100092723 | |||
| 1427 | Ga0070662_100151407 | |||
| 1428 | Ga0070662_100160132 | |||
| 1429 | Ga0070662_100342683 | |||
| 1430 | Ga0070662_100751315 | |||
| 1431 | Ga0070681_10002773 | |||
| 1432 | Ga0070681_10128282 | |||
| 1433 | Ga0070681_10836785 | |||
| 1434 | Ga0068867_100016445 | |||
| 1435 | Ga0068867_100027611 | |||
| 1436 | Ga0068867_100037310 | |||
| 1437 | Ga0068867_100158324 | |||
| 1438 | Ga0068867_100593721 | |||
| 1439 | Ga0068867_100839927 | |||
| 1440 | Ga0070685_10015539 | |||
| 1441 | Ga0070685_10062897 | |||
| 1442 | Ga0070685_10087931 | |||
| 1443 | Ga0070685_10139490 | |||
| 1444 | Ga0070685_10348447 | |||
| 1445 | Ga0070706_100310608 | |||
| 1446 | Ga0070706_100453027 | |||
| 1447 | Ga0070707_100067781 | |||
| 1448 | Ga0070707_100125281 | |||
| 1449 | Ga0070707_100130192 | |||
| 1450 | Ga0070698_100063259 | |||
| 1451 | Ga0070699_100065554 | |||
| 1452 | Ga0070699_100082331 | |||
| 1453 | Ga0070699_100191586 | |||
| 1454 | Ga0070699_100267360 | |||
| 1455 | Ga0070699_100319368 | |||
| 1456 | Ga0070699_100528942 | |||
| 1457 | Ga0070679_100278150 | |||
| 1458 | Ga0070684_100122026 | |||
| 1459 | Ga0070684_100432528 | |||
| 1460 | Ga0070697_100582902 | |||
| 1461 | Ga0070697_100657686 | |||
| 1462 | Ga0068853_100139726 | |||
| 1463 | Ga0068853_100520562 | |||
| 1464 | Ga0070672_100010398 | |||
| 1465 | Ga0070672_100040103 | |||
| 1466 | Ga0070672_100095539 | |||
| 1467 | Ga0070672_100120595 | |||
| 1468 | Ga0070672_100169190 | |||
| 1469 | Ga0070672_100174422 | |||
| 1470 | Ga0070672_100213634 | |||
| 1471 | Ga0070672_100276157 | |||
| 1472 | Ga0070672_100480868 | |||
| 1473 | Ga0070686_100024364 | |||
| 1474 | Ga0070686_100028194 | |||
| 1475 | Ga0070686_100051088 | |||
| 1476 | Ga0070686_100209760 | |||
| 1477 | Ga0070686_100332216 | |||
| 1478 | Ga0070686_100341679 | |||
| 1479 | Ga0070686_100369605 | |||
| 1480 | Ga0070695_100052916 | |||
| 1481 | Ga0070695_100094419 | |||
| 1482 | Ga0070695_100763016 | |||
| 1483 | Ga0070695_100815177 | |||
| 1484 | Ga0070696_100019995 | |||
| 1485 | Ga0070696_100612907 | |||
| 1486 | Ga0070693_100247540 | |||
| 1487 | Ga0070665_100018260 | |||
| 1488 | Ga0070665_100105660 | |||
| 1489 | Ga0070665_100150467 | |||
| 1490 | Ga0070665_100238302 | |||
| 1491 | Ga0070704_100004428 | |||
| 1492 | Ga0070704_100020336 | |||
| 1493 | Ga0070704_100099608 | |||
| 1494 | Ga0070704_100566205 | |||
| 1495 | Ga0070704_101086892 | |||
| 1496 | Ga0068855_100136660 | |||
| 1497 | Ga0070664_100038559 | |||
| 1498 | Ga0070664_100080800 | |||
| 1499 | Ga0070664_100152348 | |||
| 1500 | Ga0070664_100157706 | |||
| 1501 | Ga0070664_100400368 | |||
| 1502 | Ga0070664_100622455 | |||
| 1503 | Ga0070664_100944925 | |||
| 1504 | Ga0068857_100073910 | |||
| 1505 | Ga0068857_100185274 | |||
| 1506 | Ga0068854_100001952 | |||
| 1507 | Ga0068854_100009138 | |||
| 1508 | Ga0068854_100181412 | |||
| 1509 | Ga0068854_100238424 | |||
| 1510 | Ga0070702_100029033 | |||
| 1511 | Ga0070702_100031150 | |||
| 1512 | Ga0070702_100114318 | |||
| 1513 | Ga0070702_100117379 | |||
| 1514 | Ga0070702_100159646 | |||
| 1515 | Ga0070702_100985880 | |||
| 1516 | Ga0068852_100014483 | |||
| 1517 | Ga0068852_100645653 | |||
| 1518 | Ga0068852_100840973 | |||
| 1519 | Ga0068859_100001994 | |||
| 1520 | Ga0068859_100014294 | |||
| 1521 | Ga0068859_100060044 | |||
| 1522 | Ga0068859_100090633 | |||
| 1523 | Ga0068859_100090833 | |||
| 1524 | Ga0068859_100094523 | |||
| 1525 | Ga0068859_100240129 | |||
| 1526 | Ga0068859_100431179 | |||
| 1527 | Ga0068859_100453087 | |||
| 1528 | Ga0068859_100527499 | |||
| 1529 | Ga0068859_100618922 | |||
| 1530 | Ga0068859_100991028 | |||
| 1531 | Ga0068859_101137338 | |||
| 1532 | Ga0068859_101510468 | |||
| 1533 | Ga0068864_100028317 | |||
| 1534 | Ga0068864_100035116 | |||
| 1535 | Ga0068864_100045694 | |||
| 1536 | Ga0068864_100097777 | |||
| 1537 | Ga0068864_100111429 | |||
| 1538 | Ga0068864_100165513 | |||
| 1539 | Ga0068864_100339027 | |||
| 1540 | Ga0068864_100560066 | |||
| 1541 | Ga0068864_100778261 | |||
| 1542 | Ga0068866_10009040 | |||
| 1543 | Ga0068866_10197045 | |||
| 1544 | Ga0068861_100013994 | |||
| 1545 | Ga0068861_100044224 | |||
| 1546 | Ga0068861_100228247 | |||
| 1547 | Ga0068861_100261639 | |||
| 1548 | Ga0068861_100373319 | |||
| 1549 | Ga0068861_100535858 | |||
| 1550 | Ga0068861_100652814 | |||
| 1551 | Ga0068861_101252054 | |||
| 1552 | Ga0068861_101352461 | |||
| 1553 | Ga0068861_101399310 | |||
| 1554 | Ga0068870_10073291 | |||
| 1555 | Ga0068870_10099776 | |||
| 1556 | Ga0068870_10099790 | |||
| 1557 | Ga0068870_10185190 | |||
| 1558 | Ga0068870_10454214 | |||
| 1559 | Ga0068863_100000686 | |||
| 1560 | Ga0068863_100030370 | |||
| 1561 | Ga0068863_100047497 | |||
| 1562 | Ga0068863_100089746 | |||
| 1563 | Ga0068863_100190317 | |||
| 1564 | Ga0068863_100579113 | |||
| 1565 | Ga0068863_100644068 | |||
| 1566 | Ga0068863_100820425 | |||
| 1567 | Ga0068858_100009448 | |||
| 1568 | Ga0068858_100011524 | |||
| 1569 | Ga0068858_100106449 | |||
| 1570 | Ga0068858_100211026 | |||
| 1571 | Ga0068858_100539005 | |||
| 1572 | Ga0068858_100940366 | |||
| 1573 | Ga0068860_100073558 | |||
| 1574 | Ga0068860_100183305 | |||
| 1575 | Ga0068860_100189619 | |||
| 1576 | Ga0068860_100240083 | |||
| 1577 | Ga0068860_100381527 | |||
| 1578 | Ga0068862_100003841 | |||
| 1579 | Ga0068862_100034545 | |||
| 1580 | Ga0068862_100047450 | |||
| 1581 | Ga0068862_100096158 | |||
| 1582 | Ga0068862_100231417 | |||
| 1583 | Ga0068862_100432253 | |||
| 1584 | Ga0068862_100726390 | |||
| 1585 | Ga0068862_101471782 | |||
| 1586 | Ga0081455_10049924 | |||
| 1587 | Ga0081455_10167809 | |||
| 1588 | Ga0070717_10175180 | |||
| 1589 | Ga0075365_10000686 | |||
| 1590 | Ga0075365_10124605 | |||
| 1591 | Ga0075368_10176244 | |||
| 1592 | Ga0075363_100072433 | |||
| 1593 | Ga0075364_10071890 | |||
| 1594 | Ga0075364_10122807 | |||
| 1595 | Ga0075364_10328804 | |||
| 1596 | Ga0075432_10052427 | |||
| 1597 | Ga0070715_10022043 | |||
| 1598 | Ga0070716_100042763 | |||
| 1599 | Ga0075362_10295589 | |||
| 1600 | Ga0075367_10123584 | |||
| 1601 | Ga0075366_10031369 | |||
| 1602 | Ga0075366_10050323 | |||
| 1603 | Ga0075366_10052416 | |||
| 1604 | Ga0075366_10135602 | |||
| 1605 | Ga0075366_10210083 | |||
| 1606 | Ga0097621_100001726 | |||
| 1607 | Ga0097621_100004004 | |||
| 1608 | Ga0097621_100015342 | |||
| 1609 | Ga0097621_100121588 | |||
| 1610 | Ga0097621_100179045 | |||
| 1611 | Ga0097621_100239490 | |||
| 1612 | Ga0097621_100250825 | |||
| 1613 | Ga0097621_100588768 | |||
| 1614 | Ga0075370_10044219 | |||
| 1615 | Ga0075370_10063181 | |||
| 1616 | Ga0068871_100025709 | |||
| 1617 | Ga0068871_100033333 | |||
| 1618 | Ga0068871_100035150 | |||
| 1619 | Ga0068871_100088656 | |||
| 1620 | Ga0068871_100169841 | |||
| 1621 | Ga0068871_100358602 | |||
| 1622 | Ga0068871_100383587 | |||
| 1623 | Ga0068871_100450951 | |||
| 1624 | Ga0068871_100539255 | |||
| 1625 | Ga0068871_100640983 | |||
| 1626 | Ga0075428_100001137 | |||
| 1627 | Ga0075428_100008320 | |||
| 1628 | Ga0075428_100033183 | |||
| 1629 | Ga0075428_100145716 | |||
| 1630 | Ga0075428_100331019 | |||
| 1631 | Ga0075428_100459578 | |||
| 1632 | Ga0075428_100579289 | |||
| 1633 | Ga0075430_100058650 | |||
| 1634 | Ga0075430_100142674 | |||
| 1635 | Ga0075430_100215907 | |||
| 1636 | Ga0075430_100245059 | |||
| 1637 | Ga0075430_100266751 | |||
| 1638 | Ga0075431_100000264 | |||
| 1639 | Ga0075431_100002177 | |||
| 1640 | Ga0075431_100023284 | |||
| 1641 | Ga0075431_100044213 | |||
| 1642 | Ga0075431_100069929 | |||
| 1643 | Ga0075431_100071962 | |||
| 1644 | Ga0075431_101082462 | |||
| 1645 | Ga0075431_101174703 | |||
| 1646 | Ga0075433_10001958 | |||
| 1647 | Ga0075433_10055579 | |||
| 1648 | Ga0075433_10083029 | |||
| 1649 | Ga0075433_10105734 | |||
| 1650 | Ga0075433_10123040 | |||
| 1651 | Ga0075433_10175406 | |||
| 1652 | Ga0075434_100010137 | |||
| 1653 | Ga0075434_100065503 | |||
| 1654 | Ga0075434_100145562 | |||
| 1655 | Ga0075434_100167944 | |||
| 1656 | Ga0075434_100320579 | |||
| 1657 | Ga0075434_100385311 | |||
| 1658 | Ga0075429_100002904 | |||
| 1659 | Ga0075429_100003455 | |||
| 1660 | Ga0075429_100006362 | |||
| 1661 | Ga0075429_100073377 | |||
| 1662 | Ga0075429_100080189 | |||
| 1663 | Ga0075429_100587332 | |||
| 1664 | Ga0075429_100718273 | |||
| 1665 | Ga0075429_100980044 | |||
| 1666 | Ga0068865_100026156 | |||
| 1667 | Ga0068865_100031202 | |||
| 1668 | Ga0068865_100036436 | |||
| 1669 | Ga0068865_100148678 | |||
| 1670 | Ga0068865_100332304 | |||
| 1671 | Ga0068865_100400066 | |||
| 1672 | Ga0068865_100681097 | |||
| 1673 | Ga0068865_100830437 | |||
| 1674 | Ga0075436_100015708 | |||
| 1675 | Ga0075436_100023330 | |||
| 1676 | Ga0075436_100028798 | |||
| 1677 | Ga0075436_100415496 | |||
| 1678 | Ga0097620_100001994 | |||
| 1679 | Ga0097620_100014294 | |||
| 1680 | Ga0097620_100060046 | |||
| 1681 | Ga0097620_100090629 | |||
| 1682 | Ga0097620_100090831 | |||
| 1683 | Ga0097620_100094523 | |||
| 1684 | Ga0097620_100240141 | |||
| 1685 | Ga0097620_100431177 | |||
| 1686 | Ga0097620_100453104 | |||
| 1687 | Ga0097620_100527475 | |||
| 1688 | Ga0097620_100618863 | |||
| 1689 | Ga0097620_100991106 | |||
| 1690 | Ga0097620_101137318 | |||
| 1691 | Ga0097620_101510774 | |||
| 1692 | Ga0075435_100000143 | |||
| 1693 | Ga0075435_100026041 | |||
| 1694 | Ga0075435_100032672 | |||
| 1695 | Ga0075435_100043385 | |||
| 1696 | Ga0075435_100085897 | |||
| 1697 | Ga0075435_100108419 | |||
| 1698 | Ga0075435_100488442 | |||
| 1699 | Ga0105240_10032751 | |||
| 1700 | Ga0105240_10176047 | |||
| 1701 | Ga0105240_11031045 | |||
| 1702 | Ga0105240_11379699 | |||
| 1703 | Ga0111539_10000863 | |||
| 1704 | Ga0111539_10001510 | |||
| 1705 | Ga0111539_10001878 | |||
| 1706 | Ga0111539_10002502 | |||
| 1707 | Ga0111539_10019477 | |||
| 1708 | Ga0111539_10024974 | |||
| 1709 | Ga0111539_10138605 | |||
| 1710 | Ga0111539_10139310 | |||
| 1711 | Ga0111539_10277731 | |||
| 1712 | Ga0111539_10302208 | |||
| 1713 | Ga0111539_10406134 | |||
| 1714 | Ga0111539_10620462 | |||
| 1715 | Ga0111539_10826383 | |||
| 1716 | Ga0105245_10045126 | |||
| 1717 | Ga0105245_10444429 | |||
| 1718 | Ga0114129_10004403 | |||
| 1719 | Ga0114129_10006326 | |||
| 1720 | Ga0114129_10017377 | |||
| 1721 | Ga0114129_10018860 | |||
| 1722 | Ga0114129_10024344 | |||
| 1723 | Ga0114129_10074952 | |||
| 1724 | Ga0114129_10077917 | |||
| 1725 | Ga0114129_10090318 | |||
| 1726 | Ga0114129_10119362 | |||
| 1727 | Ga0114129_10141331 | |||
| 1728 | Ga0114129_10165241 | |||
| 1729 | Ga0114129_10192062 | |||
| 1730 | Ga0114129_11616100 | |||
| 1731 | Ga0105243_10016838 | |||
| 1732 | Ga0105243_10069469 | |||
| 1733 | Ga0105243_10374135 | |||
| 1734 | Ga0105243_11085762 | |||
| 1735 | Ga0105243_11086379 | |||
| 1736 | Ga0105243_11812897 | |||
| 1737 | Ga0105241_10043620 | |||
| 1738 | Ga0105242_10009992 | |||
| 1739 | Ga0105242_10041319 | |||
| 1740 | Ga0105242_10054914 | |||
| 1741 | Ga0105248_10000243 | |||
| 1742 | Ga0105248_10017073 | |||
| 1743 | Ga0105248_10025998 | |||
| 1744 | Ga0105248_10046378 | |||
| 1745 | Ga0105248_10056375 | |||
| 1746 | Ga0105248_10136884 | |||
| 1747 | Ga0105248_10220619 | |||
| 1748 | Ga0105248_10250745 | |||
| 1749 | Ga0105248_10458448 | |||
| 1750 | Ga0105248_10676764 | |||
| 1751 | Ga0105248_10862059 | |||
| 1752 | Ga0105248_11170598 | |||
| 1753 | Ga0105237_10877910 | |||
| 1754 | Ga0105238_10010542 | |||
| 1755 | Ga0105238_10208692 | |||
| 1756 | Ga0105249_10009614 | |||
| 1757 | Ga0105249_10092474 | |||
| 1758 | Ga0105249_10178588 | |||
| 1759 | Ga0105249_11675024 | |||
| 1760 | Ga0105239_10135613 | |||
| 1761 | Ga0105239_11115625 | |||
| 1762 | Ga0105246_10226429 | |||
| 1763 | Ga0105246_10345440 | |||
| 1764 | Ga0157371_10247019 | |||
| 1765 | Ga0157370_10079849 | |||
| 1766 | Ga0157370_10320138 | |||
| 1767 | Ga0157369_10496811 | |||
| 1768 | Ga0157369_10513350 | |||
| 1769 | Ga0157374_10113917 | |||
| 1770 | Ga0157374_10254045 | |||
| 1771 | Ga0157378_10023312 | |||
| 1772 | Ga0157378_10151836 | |||
| 1773 | Ga0157378_10191924 | |||
| 1774 | Ga0157378_10252980 | |||
| 1775 | Ga0157378_10293176 | |||
| 1776 | Ga0163162_10005885 | |||
| 1777 | Ga0163162_10032921 | |||
| 1778 | Ga0163162_10056136 | |||
| 1779 | Ga0163162_10431291 | |||
| 1780 | Ga0163162_10445013 | |||
| 1781 | Ga0157375_10000157 | |||
| 1782 | Ga0157375_10005598 | |||
| 1783 | Ga0157375_10042515 | |||
| 1784 | Ga0157375_10075376 | |||
| 1785 | Ga0157375_10082389 | |||
| 1786 | Ga0157375_10197476 | |||
| 1787 | Ga0157375_10209186 | |||
| 1788 | Ga0157375_10247575 | |||
| 1789 | Ga0157375_10416127 | |||
| 1790 | Ga0157375_10449231 | |||
| 1791 | Ga0157375_10555034 | |||
| 1792 | Ga0157375_10712990 | |||
| 1793 | Ga0157375_11114325 | |||
| 1794 | Ga0157375_12202309 | |||
| 1795 | Ga0163163_10001712 | |||
| 1796 | Ga0163163_10022232 | |||
| 1797 | Ga0163163_10242089 | |||
| 1798 | Ga0163163_10254285 | |||
| 1799 | Ga0163163_10891453 | |||
| 1800 | Ga0163163_10937332 | |||
| 1801 | Ga0157380_10000377 | |||
| 1802 | Ga0157380_10012562 | |||
| 1803 | Ga0157380_10032399 | |||
| 1804 | Ga0157380_10103717 | |||
| 1805 | Ga0157380_10109354 | |||
| 1806 | Ga0157380_10286362 | |||
| 1807 | Ga0157380_10462442 | |||
| 1808 | Ga0157380_10549810 | |||
| 1809 | Ga0157380_10565719 | |||
| 1810 | Ga0157377_10016508 | |||
| 1811 | Ga0157377_10017173 | |||
| 1812 | Ga0157377_10022871 | |||
| 1813 | Ga0157377_10033863 | |||
| 1814 | Ga0157377_10055345 | |||
| 1815 | Ga0157377_10514667 | |||
| 1816 | Ga0157379_10000094 | |||
| 1817 | Ga0157379_10045095 | |||
| 1818 | Ga0157376_10070534 | |||
| 1819 | Ga0157376_10133088 | |||
| 1820 | Ga0157376_10199253 | |||
| 1821 | Ga0157376_10205636 | |||
| 1822 | Ga0157376_10231921 | |||
| 1823 | Ga0157376_10351615 | |||
| 1824 | Ga0157376_10472887 | |||
| 1825 | Ga0163161_10067595 | |||
| 1826 | Ga0163161_10112660 | |||
| 1827 | Ga0163161_10305829 | |||
| 1828 | Ga0163161_10931516 | |||
| 1829 | Ga0163161_11090587 | |||
| 1830 | Ga0206349_1746695 | |||
| 1831 | Ga0206352_10238537 | |||
| 1832 | Ga0206350_10890321 | |||
| 1833 | Ga0206350_11229116 | |||
| 1834 | Ga0224712_10048712 | |||
| 1835 | Ga0207697_10002446 | |||
| 1836 | Ga0207697_10053017 | |||
| 1837 | Ga0207656_10013876 | |||
| 1838 | Ga0207656_10269448 | |||
| 1839 | Ga0207682_10005509 | |||
| 1840 | Ga0207682_10008532 | |||
| 1841 | Ga0207682_10028997 | |||
| 1842 | Ga0207682_10168593 | |||
| 1843 | Ga0207642_10173157 | |||
| 1844 | Ga0207642_10197180 | |||
| 1845 | Ga0207688_10002119 | |||
| 1846 | Ga0207688_10015491 | |||
| 1847 | Ga0207688_10017988 | |||
| 1848 | Ga0207688_10044651 | |||
| 1849 | Ga0207688_10205537 | |||
| 1850 | Ga0207688_10223183 | |||
| 1851 | Ga0207680_10006504 | |||
| 1852 | Ga0207680_10041886 | |||
| 1853 | Ga0207680_10155353 | |||
| 1854 | Ga0207680_10224199 | |||
| 1855 | Ga0207680_10330322 | |||
| 1856 | Ga0207647_10083612 | |||
| 1857 | Ga0207699_10324886 | |||
| 1858 | Ga0207645_10006284 | |||
| 1859 | Ga0207645_10015758 | |||
| 1860 | Ga0207645_10018352 | |||
| 1861 | Ga0207645_10265510 | |||
| 1862 | Ga0207645_10282600 | |||
| 1863 | Ga0207643_10000504 | |||
| 1864 | Ga0207643_10023869 | |||
| 1865 | Ga0207643_10025171 | |||
| 1866 | Ga0207643_10050749 | |||
| 1867 | Ga0207684_10380105 | |||
| 1868 | Ga0207707_10292363 | |||
| 1869 | Ga0207695_10246300 | |||
| 1870 | Ga0207695_10344338 | |||
| 1871 | Ga0207695_10592310 | |||
| 1872 | Ga0207663_10150774 | |||
| 1873 | Ga0207660_10247083 | |||
| 1874 | Ga0207660_10513884 | |||
| 1875 | Ga0207660_10748610 | |||
| 1876 | Ga0207662_10003633 | |||
| 1877 | Ga0207662_10003706 | |||
| 1878 | Ga0207662_10007609 | |||
| 1879 | Ga0207662_10034337 | |||
| 1880 | Ga0207662_10072941 | |||
| 1881 | Ga0207662_10155479 | |||
| 1882 | Ga0207662_10174296 | |||
| 1883 | Ga0207662_10215120 | |||
| 1884 | Ga0207662_10491530 | |||
| 1885 | Ga0207657_10189724 | |||
| 1886 | Ga0207657_10973590 | |||
| 1887 | Ga0207649_10048813 | |||
| 1888 | Ga0207649_10174251 | |||
| 1889 | Ga0207649_10181047 | |||
| 1890 | Ga0207652_10539812 | |||
| 1891 | Ga0207652_10666928 | |||
| 1892 | Ga0207646_10066022 | |||
| 1893 | Ga0207646_10410902 | |||
| 1894 | Ga0207681_10012475 | |||
| 1895 | Ga0207681_10020425 | |||
| 1896 | Ga0207681_10029586 | |||
| 1897 | Ga0207681_10044289 | |||
| 1898 | Ga0207681_10433839 | |||
| 1899 | Ga0207681_10573517 | |||
| 1900 | Ga0207694_10049833 | |||
| 1901 | Ga0207650_10002282 | |||
| 1902 | Ga0207650_10012158 | |||
| 1903 | Ga0207650_10029076 | |||
| 1904 | Ga0207650_10043144 | |||
| 1905 | Ga0207650_10139685 | |||
| 1906 | Ga0207650_10472166 | |||
| 1907 | Ga0207650_10481983 | |||
| 1908 | Ga0207650_10509787 | |||
| 1909 | Ga0207659_10000562 | |||
| 1910 | Ga0207659_10001703 | |||
| 1911 | Ga0207659_10003966 | |||
| 1912 | Ga0207659_10008601 | |||
| 1913 | Ga0207659_10008609 | |||
| 1914 | Ga0207659_10012648 | |||
| 1915 | Ga0207659_10025134 | |||
| 1916 | Ga0207659_10027948 | |||
| 1917 | Ga0207659_10119951 | |||
| 1918 | Ga0207659_10131825 | |||
| 1919 | Ga0207659_10230165 | |||
| 1920 | Ga0207659_11123158 | |||
| 1921 | Ga0207687_10127827 | |||
| 1922 | Ga0207700_10010397 | |||
| 1923 | Ga0207664_10207856 | |||
| 1924 | Ga0207644_10017499 | |||
| 1925 | Ga0207644_10038073 | |||
| 1926 | Ga0207644_10041886 | |||
| 1927 | Ga0207644_10060165 | |||
| 1928 | Ga0207644_10169812 | |||
| 1929 | Ga0207690_10282167 | |||
| 1930 | Ga0207690_10347892 | |||
| 1931 | Ga0207690_11080708 | |||
| 1932 | Ga0207706_10001744 | |||
| 1933 | Ga0207706_10011372 | |||
| 1934 | Ga0207706_10019140 | |||
| 1935 | Ga0207706_10087453 | |||
| 1936 | Ga0207706_10187264 | |||
| 1937 | Ga0207706_10257004 | |||
| 1938 | Ga0207706_10311570 | |||
| 1939 | Ga0207686_10013110 | |||
| 1940 | Ga0207686_10031969 | |||
| 1941 | Ga0207709_10043504 | |||
| 1942 | Ga0207709_10190881 | |||
| 1943 | Ga0207670_10053120 | |||
| 1944 | Ga0207670_10058305 | |||
| 1945 | Ga0207670_10121597 | |||
| 1946 | Ga0207670_10214103 | |||
| 1947 | Ga0207670_10300615 | |||
| 1948 | Ga0207669_10000046 | |||
| 1949 | Ga0207669_10005417 | |||
| 1950 | Ga0207669_10079882 | |||
| 1951 | Ga0207669_10093496 | |||
| 1952 | Ga0207669_10751398 | |||
| 1953 | Ga0207669_10898358 | |||
| 1954 | Ga0207704_10016619 | |||
| 1955 | Ga0207704_10036752 | |||
| 1956 | Ga0207704_10065346 | |||
| 1957 | Ga0207704_10655021 | |||
| 1958 | Ga0207704_11074798 | |||
| 1959 | Ga0207665_10114638 | |||
| 1960 | Ga0207691_10001339 | |||
| 1961 | Ga0207691_10005966 | |||
| 1962 | Ga0207691_10016966 | |||
| 1963 | Ga0207691_10024791 | |||
| 1964 | Ga0207691_10051009 | |||
| 1965 | Ga0207691_10067575 | |||
| 1966 | Ga0207691_10088911 | |||
| 1967 | Ga0207691_10089175 | |||
| 1968 | Ga0207691_10099770 | |||
| 1969 | Ga0207691_10152862 | |||
| 1970 | Ga0207691_10185243 | |||
| 1971 | Ga0207691_10229627 | |||
| 1972 | Ga0207691_10562834 | |||
| 1973 | Ga0207691_10620048 | |||
| 1974 | Ga0207691_10621913 | |||
| 1975 | Ga0207711_10000570 | |||
| 1976 | Ga0207711_10026483 | |||
| 1977 | Ga0207711_10044603 | |||
| 1978 | Ga0207711_10048405 | |||
| 1979 | Ga0207711_10146429 | |||
| 1980 | Ga0207711_10148090 | |||
| 1981 | Ga0207711_10372205 | |||
| 1982 | Ga0207711_10417248 | |||
| 1983 | Ga0207711_11017775 | |||
| 1984 | Ga0207711_11065547 | |||
| 1985 | Ga0207689_10002152 | |||
| 1986 | Ga0207689_10007933 | |||
| 1987 | Ga0207689_10072939 | |||
| 1988 | Ga0207689_10078527 | |||
| 1989 | Ga0207689_10267269 | |||
| 1990 | Ga0207689_10284241 | |||
| 1991 | Ga0207689_10711130 | |||
| 1992 | Ga0207661_10081711 | |||
| 1993 | Ga0207679_10027338 | |||
| 1994 | Ga0207679_10038212 | |||
| 1995 | Ga0207679_10084256 | |||
| 1996 | Ga0207679_10171446 | |||
| 1997 | Ga0207679_10307373 | |||
| 1998 | Ga0207679_10315704 | |||
| 1999 | Ga0207679_10455285 | |||
| 2000 | Ga0207679_10653057 | |||
| 2001 | Ga0207667_10156356 | |||
| 2002 | Ga0207651_10002765 | |||
| 2003 | Ga0207651_10004530 | |||
| 2004 | Ga0207651_10008951 | |||
| 2005 | Ga0207651_10069210 | |||
| 2006 | Ga0207651_10103548 | |||
| 2007 | Ga0207651_10477790 | |||
| 2008 | Ga0207651_10764184 | |||
| 2009 | Ga0207712_10005227 | |||
| 2010 | Ga0207712_10308001 | |||
| 2011 | Ga0207712_10402510 | |||
| 2012 | Ga0207712_10652384 | |||
| 2013 | Ga0207668_10224120 | |||
| 2014 | Ga0207668_10710976 | |||
| 2015 | Ga0207668_11242802 | |||
| 2016 | Ga0207640_10632464 | |||
| 2017 | Ga0207640_11442012 | |||
| 2018 | Ga0207658_10001809 | |||
| 2019 | Ga0207658_10004182 | |||
| 2020 | Ga0207658_10019015 | |||
| 2021 | Ga0207658_10046295 | |||
| 2022 | Ga0207658_10177695 | |||
| 2023 | Ga0207658_10602860 | |||
| 2024 | Ga0207677_10024856 | |||
| 2025 | Ga0207677_10178254 | |||
| 2026 | Ga0207677_10317732 | |||
| 2027 | Ga0207677_10540729 | |||
| 2028 | Ga0207677_10548257 | |||
| 2029 | Ga0207703_10021318 | |||
| 2030 | Ga0207703_10273489 | |||
| 2031 | Ga0207703_11112159 | |||
| 2032 | Ga0207639_10193001 | |||
| 2033 | Ga0207639_10603402 | |||
| 2034 | Ga0207678_10140070 | |||
| 2035 | Ga0207678_10149473 | |||
| 2036 | Ga0207678_10526191 | |||
| 2037 | Ga0207678_10610587 | |||
| 2038 | Ga0207708_10003860 | |||
| 2039 | Ga0207708_10031951 | |||
| 2040 | Ga0207708_10061192 | |||
| 2041 | Ga0207708_10104867 | |||
| 2042 | Ga0207708_10853132 | |||
| 2043 | Ga0207641_10001737 | |||
| 2044 | Ga0207641_10012859 | |||
| 2045 | Ga0207641_10033218 | |||
| 2046 | Ga0207641_10328759 | |||
| 2047 | Ga0207641_10591142 | |||
| 2048 | Ga0207641_10688877 | |||
| 2049 | Ga0207641_10883811 | |||
| 2050 | Ga0207648_10000406 | |||
| 2051 | Ga0207648_10001967 | |||
| 2052 | Ga0207648_10078570 | |||
| 2053 | Ga0207648_10504305 | |||
| 2054 | Ga0207648_10813938 | |||
| 2055 | Ga0207648_11192386 | |||
| 2056 | Ga0207676_10053072 | |||
| 2057 | Ga0207676_10090437 | |||
| 2058 | Ga0207676_10098634 | |||
| 2059 | Ga0207676_10102685 | |||
| 2060 | Ga0207676_10112249 | |||
| 2061 | Ga0207676_10231505 | |||
| 2062 | Ga0207676_10385286 | |||
| 2063 | Ga0207676_11266812 | |||
| 2064 | Ga0207674_10021532 | |||
| 2065 | Ga0207674_10133016 | |||
| 2066 | Ga0207674_10323555 | |||
| 2067 | Ga0207675_100004384 | |||
| 2068 | Ga0207675_100005257 | |||
| 2069 | Ga0207675_100011559 | |||
| 2070 | Ga0207675_100088924 | |||
| 2071 | Ga0207675_100278461 | |||
| 2072 | Ga0207675_100369385 | |||
| 2073 | Ga0207675_100440432 | |||
| 2074 | Ga0207675_100672403 | |||
| 2075 | Ga0207683_10020732 | |||
| 2076 | Ga0207683_10026613 | |||
| 2077 | Ga0207683_10033110 | |||
| 2078 | Ga0207683_10049831 | |||
| 2079 | Ga0207683_10052214 | |||
| 2080 | Ga0207683_10083014 | |||
| 2081 | Ga0207683_10134784 | |||
| 2082 | Ga0207683_10141677 | |||
| 2083 | Ga0207683_10194589 | |||
| 2084 | Ga0207683_10347697 | |||
| 2085 | Ga0207683_10654751 | |||
| 2086 | Ga0207698_10107111 | |||
| 2087 | Ga0207698_10240799 | |||
| 2088 | Ga0207698_10795415 | |||
| 2089 | Ga0209995_1021268 | |||
| 2090 | Ga0209995_1021843 | |||
| 2091 | Ga0209968_1017417 | |||
| 2092 | Ga0207428_10004450 | |||
| 2093 | Ga0207428_10019879 | |||
| 2094 | Ga0207428_10056608 | |||
| 2095 | Ga0207428_10115662 | |||
| 2096 | Ga0207428_10217673 | |||
| 2097 | Ga0207428_10386187 | |||
| 2098 | Ga0268266_10026474 | |||
| 2099 | Ga0268266_10084162 | |||
| 2100 | Ga0268266_10339990 | |||
| 2101 | Ga0268266_10661553 | |||
| 2102 | Ga0268265_10225525 | |||
| 2103 | Ga0268265_10291426 | |||
| 2104 | Ga0268265_10326993 | |||
| 2105 | Ga0268265_10377243 | |||
| 2106 | Ga0268265_10544352 | |||
| 2107 | Ga0268265_10594225 | |||
| 2108 | Ga0268264_10002691 | |||
| 2109 | Ga0268264_10074468 | |||
| 2110 | Ga0268264_10362762 | |||
| 2111 | Ga0268264_10437228 | |||
| 2112 | Ga0268264_10525498 | |||
| 2113 | Ga0268264_10542218 | |||
| 2114 | Ga0268264_10907914 | |||
| 2115 | Ga0268264_10913604 | |||
| 2116 | Ga0307408_100154756 | |||
| 2117 | Ga0307408_100455000 | |||
| 2118 | Ga0307516_10407669 | |||
| 2119 | Ga0307405_10200528 | |||
| 2120 | Ga0307413_10063423 | |||
| 2121 | Ga0307410_10838689 | |||
| 2122 | Ga0307406_10106255 | |||
| 2123 | Ga0307407_10070361 | |||
| 2124 | Ga0307407_10199389 | |||
| 2125 | Ga0307407_10259917 | |||
| 2126 | Ga0307409_100204253 | |||
| 2127 | Ga0307409_100545561 | |||
| 2128 | Ga0307409_101029004 | |||
| 2129 | Ga0307409_101693629 | |||
| 2130 | Ga0307416_100042027 | |||
| 2131 | Ga0307416_100752114 | |||
| 2132 | Ga0307416_101087484 | |||
| 2133 | Ga0307416_101340545 | |||
| 2134 | Ga0307414_10175792 | |||
| 2135 | Ga0307414_10768743 | |||
| 2136 | Ga0307411_10103836 | |||
| 2137 | Ga0307411_10107278 | |||
| 2138 | Ga0307411_10295633 | |||
| 2139 | Ga0307411_11228603 | |||
| 2140 | Ga0373930_0009710 | |||
| 2141 | Ga0373948_0054856 | |||
| 2142 | Ga0373950_0038156 | |||
| 2143 | Ga0373958_0000117 | |||
| 2144 | Ga0373958_0133263 | |||
| 2145 | Ga0373938_0000089 | |||
| 2146 | Ga0373928_0114491 | |||
| 2147 | Ga0373929_0000318 | |||
| 2148 | Ga0373934_0000231 | |||
| 2149 | Ga0373940_0000090 | |||
| 2150 | Ga0373949_0001074 | |||
| 2151 | Ga0373949_0022133 | |||
| 2152 | Ga0373951_0000324 | |||
| 2153 | Ga0373952_0000153 | |||
| 2154 | Ga0373923_0154539 | |||
| 2155 | Ga0373932_0000097 | |||
| 2156 | Ga0373932_0094743 | |||
| 2157 | Ga0373932_0184376 | |||
| 2158 | Ga0373939_0000186 | |||
| 2159 | Ga0373939_0041938 | |||
| 2160 | Ga0373945_0201557 | |||
| 2161 | Ga0373953_0024611 | |||
| 2162 | Ga0373953_0052976 | |||
| 2163 | Ga0373953_0122369 | |||
| 2164 | Ga0373956_0002311 | |||
| 2165 | Ga0373957_0002935 | |||
| 2166 | Ga0373960_0000411 | |||
| 2167 | Ga0373960_0236059 | |||
| 2168 | Ga0373943_0008218 | |||
| 2169 | Ga0373946_0052851 | |||
| 2170 | Ga0373946_0136521 | |||
| 2171 | Ga0373955_0001686 | |||
| 2172 | Ga0373955_0600358 | |||
| 2173 | Ga0373942_0123273 | |||
| 2174 | Ga0373942_0205389 | |||
| 2175 | Ga0373961_0004500 | |||
| 2176 | Ga0373961_0005962 | |||
| 2177 | Ga0373962_0000903 | |||
| 2178 | Ga0373962_0022498 | |||
| 2179 | Ga0373962_0054654 | |||
| 2180 | Ga0373924_0024094 | |||
| 2181 | Ga0373931_0000899 | |||
| 2182 | Ga0373931_0074711 | |||
| 2183 | Ga0373931_0177519 | |||
| 2184 | Ga0373935_0102755 | |||
| 2185 | Ga0373927_0058119 | |||
| 2186 | Ga0373933_0032115 | |||
| 2187 | Ga0373933_0067655 | |||
| 2188 | Ga0373947_0006250 | |||
| 2189 | Ga0373937_0000754 | |||
| 2190 | Ga0373937_0054986 | |||
| 2191 | Ga0373937_0207500 | |||
| 2192 | Ga0373937_0784497 | |||
| 2193 | Ga0373937_0848123 | |||
| 2194 | Ga0373937_1086821 | |||
| 2195 | Ga0373925_0014515 | |||
| 2196 | Ga0373925_0317100 | |||
| 2197 | Ga0395900_0626532 | |||
| 2198 | Ga0395898_1434220 | |||
| 2199 | Ga0436364_0766115 | |||
| 2200 | Ga0436365_0920024 | |||
| 2201 | Ga0436363_0770679 | |||
| 2202 | Ga0439453_0018744 | |||
| 2203 | Ga0450920_008136 | |||
| 2204 | Ga0450920_053990 | |||
| 2205 | Ga0450923_033576 | |||
| 2206 | Ga0450923_072948 | |||
| 2207 | Ga0450894_006397 | |||
| 2208 | Ga0450895_005024 | |||
| 2209 | Ga0450896_004202 | |||
| 2210 | Ga0450896_011157 | |||
| 2211 | Ga0450896_012559 | |||
| 2212 | Ga0450906_038422 | |||
| 2213 | Ga0439458_0063582 | |||
| 2214 | Ga0450908_008084 | |||
| 2215 | Ga0450908_038218 | |||
| 2216 | Ga0450908_039236 | |||
| 2217 | Ga0439434_0091513 | |||
| 2218 | Ga0439435_0002337 | |||
| 2219 | Ga0439435_0022536 | |||
| 2220 | Ga0439435_0061092 | |||
| 2221 | Ga0439435_0116445 | |||
| 2222 | Ga0439444_0088411 | |||
| 2223 | Ga0439460_0048231 | |||
| 2224 | Ga0439460_0184487 | |||
| 2225 | Ga0450918_067527 | |||
| 2226 | Ga0451577_0064556 | |||
| 2227 | Ga0451576_0101356 | |||
| 2228 | Ga0451576_0639658 | |||
| 2229 | Ga0495592_0011747 | |||
| 2230 | Ga0495603_0244308 | |||
| 2231 | Ga0495603_0457422 | |||
| 2232 | Ga0495629_0086549 | |||
| 2233 | Ga0495629_0207074 | |||
| 2234 | Ga0495638_0084454 | |||
| 2235 | Ga0495651_0171601 | |||
| 2236 | Ga0495653_0327596 | |||
| 2237 | Ga0495580_0126714 | |||
| 2238 | Ga0495582_0169544 | |||
| 2239 | Ga0495582_0195985 | |||
| 2240 | Ga0495664_0161975 | |||
| 2241 | Ga0495585_0402274 | |||
| 2242 | Ga0495594_0210922 | |||
| 2243 | Ga0495608_0021077 | |||
| 2244 | Ga0495628_0008926 | |||
| 2245 | Ga0495630_0014918 | |||
| 2246 | Ga0495663_0172109 | |||
| 2247 | Ga0495642_0286678 | |||
| 2248 | Ga0495652_0061937 | |||
| 2249 | Ga0495640_0229910 | |||
| 2250 | Ga0495586_0041000 | |||
| 2251 | Ga0495586_0045676 | |||
| 2252 | Ga0495587_0142413 | |||
| 2253 | Ga0495598_0001701 | |||
| 2254 | Ga0495598_0058503 | |||
| 2255 | Ga0495621_0002944 | |||
| 2256 | Ga0495621_0043534 | |||
| 2257 | Ga0495645_0021246 | |||
| 2258 | Ga0495645_0096591 | |||
| 2259 | Ga0495667_0235338 | |||
| 2260 | Ga0495656_0019412 | |||
| 2261 | Ga0495635_0189583 | |||
| 2262 | Ga0495659_0051572 | |||
| 2263 | Ga0495659_0118879 | |||
| 2264 | Ga0495659_0181957 | |||
| 2265 | Ga0495659_0221778 | |||
| 2266 | Ga0495657_0123357 | |||
| 2267 | Ga0495647_0031369 | |||
| 2268 | Ga0495658_0118485 | |||
| 2269 | Ga0495669_0018284 | |||
| 2270 | Ga0495669_0193953 | |||
| 2271 | Ga0495669_0349706 | |||
| 2272 | Ga0495613_0001137 | |||
| 2273 | Ga0495613_0066686 | |||
| 2274 | Ga0495613_0184772 | |||
| 2275 | Ga0495670_0102190 | |||
| 2276 | Ga0495670_0208711 | |||
| 2277 | Ga0495600_0176397 | |||
| 2278 | Ga0495600_0524723 | |||
| 2279 | Ga0495581_0062421 | |||
| 2280 | Ga0495604_0019458 | |||
| 2281 | Ga0495636_0140934 | |||
| 2282 | Ga0495636_0251190 | |||
| 2283 | Ga0495674_0029085 | |||
| 2284 | Ga0495684_0000105 | |||
| 2285 | Ga0495684_0073898 | |||
| 2286 | Ga0496100_0033152 | |||
| 2287 | Ga0496101_0325812 | |||
| 2288 | Ga0496101_0573680 | |||
| 2289 | Ga0496102_0029100 | |||
| 2290 | Ga0496103_0034029 | |||
| 2291 | Ga0496103_0547796 | |||
| 2292 | Ga0496104_0093682 | |||
| 2293 | Ga0496104_0550687 | |||
| 2294 | Ga0496106_0021008 | |||
| 2295 | Ga0496106_0035262 | |||
| 2296 | Ga0496106_0409201 | |||
| 2297 | Ga0496106_0495610 | |||
| 2298 | Ga0496106_0646302 | |||
| 2299 | Ga0496106_0778122 | |||
| 2300 | Ga0496107_0035276 | |||
| 2301 | Ga0496107_0504659 | |||
| 2302 | Ga0496108_0069842 | |||
| 2303 | Ga0496108_0203464 | |||
| 2304 | Ga0496108_0326893 | |||
| 2305 | Ga0496108_0392625 | |||
| 2306 | Ga0496109_0056691 | |||
| 2307 | Ga0496109_0144174 | |||
| 2308 | Ga0496109_0655800 | |||
| 2309 | Ga0496110_0046746 | |||
| 2310 | Ga0496110_0176173 | |||
| 2311 | Ga0496110_0271202 | |||
| 2312 | Ga0496112_0013866 | |||
| 2313 | Ga0496112_0109520 | |||
| 2314 | Ga0496112_0247050 | |||
| 2315 | Ga0496113_0058750 | |||
| 2316 | Ga0496113_0906206 | |||
| 2317 | Ga0496114_0000887 | |||
| 2318 | Ga0501031_0043361 | |||
| 2319 | Ga0501031_0318724 | |||
| 2320 | Ga0501033_0173114 | |||
| 2321 | Ga0501033_0201880 | |||
| 2322 | Ga0501034_0003394 | |||
| 2323 | Ga0501034_0060409 | |||
| 2324 | Ga0501034_0649303 | |||
| 2325 | Ga0501036_0018454 | |||
| 2326 | Ga0501036_0078194 | |||
| 2327 | Ga0501036_0198880 | |||
| 2328 | Ga0501037_0481731 | |||
| 2329 | Ga0501038_0013628 | |||
| 2330 | Ga0501039_0088951 | |||
| 2331 | Ga0501039_0089117 | |||
| 2332 | Ga0501040_0003805 | |||
| 2333 | Ga0501040_0019113 | |||
| 2334 | Ga0501040_0152674 | |||
| 2335 | Ga0501040_0535024 | |||
| 2336 | Ga0501041_0004970 | |||
| 2337 | Ga0501041_0024483 | |||
| 2338 | Ga0501041_0097852 | |||
| 2339 | Ga0501042_0096735 | |||
| 2340 | Ga0501042_0119870 | |||
| 2341 | Ga0501042_0177871 | |||
| 2342 | Ga0501046_0033591 | |||
| 2343 | Ga0501048_0016465 | |||
| 2344 | Ga0501048_0019543 | |||
| 2345 | Ga0501048_0070672 | |||
| 2346 | Ga0501048_0960077 | |||
| 2347 | Ga0501068_0096185 | |||
| 2348 | Ga0501069_0133777 | |||
| 2349 | Ga0501069_0552900 | |||
| 2350 | Ga0501070_0140124 | |||
| 2351 | Ga0501070_0434571 | |||
| 2352 | Ga0501071_0046407 | |||
| 2353 | Ga0501071_0060085 | |||
| 2354 | Ga0501071_0477905 | |||
| 2355 | Ga0501072_0003526 | |||
| 2356 | Ga0501072_0033073 | |||
| 2357 | Ga0501072_0038115 | |||
| 2358 | Ga0501072_0227476 | |||
| 2359 | Ga0501073_0376668 | |||
| 2360 | Ga0501074_0117701 | |||
| 2361 | Ga0501074_0155635 | |||
| 2362 | Ga0501074_0209493 | |||
| 2363 | Ga0501074_0469196 | |||
| 2364 | Ga0501075_0004400 | |||
| 2365 | Ga0501075_0006633 | |||
| 2366 | Ga0501075_0048129 | |||
| 2367 | Ga0501076_0022830 | |||
| 2368 | Ga0501076_0114745 | |||
| 2369 | Ga0501076_0274613 | |||
| 2370 | Ga0501076_0644805 | |||
| 2371 | Ga0501076_0742055 | |||
| 2372 | Ga0501079_0014210 | |||
| 2373 | Ga0501079_0153402 | |||
| 2374 | Ga0501079_0338486 | |||
| 2375 | Ga0501079_0404527 | |||
| 2376 | Ga0501080_0216326 | |||
| 2377 | Ga0501080_0638270 | |||
| 2378 | Ga0501080_0908322 | |||
| 2379 | Ga0501081_0003870 | |||
| 2380 | Ga0501081_0009942 | |||
| 2381 | Ga0501081_0259969 | |||
| 2382 | Ga0501081_0840136 | |||
| 2383 | Ga0501083_0380196 | |||
| 2384 | Ga0501035_0073918 | |||
| 2385 | Ga0501045_0062184 | |||
| 2386 | nmdc:mga03683_336904_c1 | |||
| 2387 | nmdc:mga03683_497279_c1 | |||
| 2388 | nmdc:mga00v17_193115_c1 | |||
| 2389 | nmdc:mga00v17_201110_c1 | |||
| 2390 | nmdc:mga00v17_64942_c1 | |||
| 2391 | nmdc:mga0yw44_16689_c1 | |||
| 2392 | nmdc:mga0k408_107010_c1 | |||
| 2393 | nmdc:mga0k408_157931_c1 | |||
| 2394 | nmdc:mga0k408_195362_c1 | |||
| 2395 | nmdc:mga0k408_54160_c1 | |||
| 2396 | nmdc:mga06z11_154619_c1 | |||
| 2397 | nmdc:mga06z11_8215_c1 | |||
| 2398 | nmdc:mga04h51_27808_c1 | |||
| 2399 | nmdc:mga07m45_133040_c1 | |||
| 2400 | nmdc:mga05p37_160587_c2 | |||
| 2401 | nmdc:mga05p37_20943_c1 | |||
| 2402 | nmdc:mga05p37_218066_c1 | |||
| 2403 | nmdc:mga05p37_239289_c1 | |||
| 2404 | nmdc:mga05p37_278947_c1 | |||
| 2405 | nmdc:mga05p37_331674_c1 | |||
| 2406 | nmdc:mga05p37_4230_c1 | |||
| 2407 | nmdc:mga05p37_4956_c1 | |||
| 2408 | nmdc:mga05p37_71906_c2 | |||
| 2409 | nmdc:mga05p37_84334_c1 | |||
| 2410 | nmdc:mga05p37_8475_c1 | |||
| 2411 | nmdc:mga05p37_93066_c1 | |||
| 2412 | nmdc:mga09592_102534_c1 | |||
| 2413 | nmdc:mga09592_135426_c1 | |||
| 2414 | nmdc:mga09592_15059_c1 | |||
| 2415 | nmdc:mga09592_21999_c1 | |||
| 2416 | nmdc:mga09592_258710_c1 | |||
| 2417 | nmdc:mga09592_333234_c1 | |||
| 2418 | nmdc:mga09592_507254_c1 | |||
| 2419 | nmdc:mga0qj67_112279_c1 | |||
| 2420 | nmdc:mga0qj67_12785_c1 | |||
| 2421 | nmdc:mga0qj67_1798_c1 | |||
| 2422 | nmdc:mga0qj67_29269_c1 | |||
| 2423 | nmdc:mga0qj67_35802_c1 | |||
| 2424 | nmdc:mga0qj67_388558_c1 | |||
| 2425 | nmdc:mga0qj67_561113_c1 | |||
| 2426 | nmdc:mga0qj67_61694_c1 | |||
| 2427 | nmdc:mga06r32_1049459_c1 | |||
| 2428 | nmdc:mga06r32_11945_c1 | |||
| 2429 | nmdc:mga06r32_18018_c1 | |||
| 2430 | nmdc:mga06r32_35149_c1 | |||
| 2431 | nmdc:mga06r32_40341_c1 | |||
| 2432 | nmdc:mga06r32_5033_c1 | |||
| 2433 | nmdc:mga06r32_57791_c1 | |||
| 2434 | nmdc:mga08y16_1002_c1 | |||
| 2435 | nmdc:mga08y16_1056393_c1 | |||
| 2436 | nmdc:mga08y16_12963_c1 | |||
| 2437 | nmdc:mga08y16_1534_c1 | |||
| 2438 | nmdc:mga08y16_161581_c1 | |||
| 2439 | nmdc:mga08y16_17700_c1 | |||
| 2440 | nmdc:mga08y16_336218_c1 | |||
| 2441 | nmdc:mga08y16_350609_c1 | |||
| 2442 | nmdc:mga08y16_550157_c1 | |||
| 2443 | nmdc:mga08y16_621923_c1 | |||
| 2444 | nmdc:mga08y16_7021_c1 | |||
| 2445 | nmdc:mga0n895_1493399_c1 | |||
| 2446 | nmdc:mga0n895_233435_c1 | |||
| 2447 | nmdc:mga0n895_304814_c1 | |||
| 2448 | nmdc:mga0n895_309808_c1 | |||
| 2449 | nmdc:mga0n895_34611_c1 | |||
| 2450 | nmdc:mga0n895_3785_c1 | |||
| 2451 | nmdc:mga0n895_433836_c1 | |||
| 2452 | nmdc:mga0rr50_10335_c1 | |||
| 2453 | nmdc:mga0rr50_113145_c1 | |||
| 2454 | nmdc:mga0rr50_213337_c1 | |||
| 2455 | nmdc:mga0rr50_213811_c1 | |||
| 2456 | nmdc:mga0rr50_22427_c1 | |||
| 2457 | nmdc:mga0rr50_65488_c1 | |||
| 2458 | nmdc:mga08x19_122027_c1 | |||
| 2459 | nmdc:mga08x19_12915_c1 | |||
| 2460 | nmdc:mga08x19_133278_c1 | |||
| 2461 | nmdc:mga08x19_611222_c1 | |||
| 2462 | nmdc:mga08x19_67103_c1 | |||
| 2463 | nmdc:mga0a205_141176_c1 | |||
| 2464 | nmdc:mga0a205_161219_c1 | |||
| 2465 | nmdc:mga0a205_174004_c1 | |||
| 2466 | nmdc:mga0a205_321062_c1 | |||
| 2467 | nmdc:mga0a205_323190_c1 | |||
| 2468 | nmdc:mga0a205_5382_c1 | |||
| 2469 | nmdc:mga0a205_658155_c1 | |||
| 2470 | nmdc:mga0a205_71331_c1 | |||
| 2471 | Ga0495601_0001335 | |||
| 2472 | Ga0495601_0030327 | |||
| 2473 | Ga0495595_0204153 | |||
| 2474 | Ga0495595_0304173 | |||
| 2475 | Ga0495595_0442846 | |||
| 2476 | Ga0495619_0011070 | |||
| 2477 | Ga0500592_001337 | |||
| 2478 | Ga0500611_128845 | |||
| 2479 | Ga0501084_0005602 | |||
| 2480 | Ga0501084_0075798 | |||
| 2481 | Ga0501084_0193662 | |||
| 2482 | Ga0501084_0710348 | |||
| 2483 | Ga0590071_000058 | |||
| 2484 | Ga0590075_000441 | |||
| 2485 | Ga0590077_000552 | |||
| 2486 | Ga0501082_0117082 | |||
| 2487 | Ga0501082_0240714 | |||
| 2488 | Ga0501082_1356668 | |||
| 2489 | Ga0530510_0038717 | |||
| 2490 | Ga0530510_0073268 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy