F492126

General Info

Members Datasets Scaffolds Average Seq Length
1245 367 2490 190

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10986374|Ga0207708_109863742
Length 213
Sequence MRCRRCSACSNRRRFILMRDLTLTDVERLQTAAAADAFHMDEETFRAFYDRTARPVWAYLSRITGDRQLADDLLQETYYRFLRADRGYSSDAHRRNYLFRIATNLVRDGRRRRRPDLVAVPEETDPDALRSPDDVAGHTVLRADLSRAMASLSSREQAMLWLAYAQGSSHDEIAEALGLKTSSIKLLLFRARRRLARLLRGDDPAPAGERIRR

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
231 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
247 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
248 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
249 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
250 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
251 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
252 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
253 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
254 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
257 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
258 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
259 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
361 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
365 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 2.57
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 25.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10986374 3300026075 Bacteria 732
2 JGI24743J22301_10041785 3300001991 Bacteria 922
3 Ga0065712_10001425 3300005290 Bacteria 11319
4 Ga0065712_10001466 3300005290 Bacteria 6138
5 Ga0065712_10087531 3300005290 Bacteria 2571
6 Ga0065712_10120804 3300005290 Bacteria 1674
7 Ga0065712_10199682 3300005290 Unclassified 1113
8 Ga0065712_10228392 3300005290 Bacteria 1019
9 Ga0065712_10265115 3300005290 Bacteria 928
10 Ga0065715_10004672 3300005293 Bacteria 4638
11 Ga0065715_10014152 3300005293 Bacteria 2276
12 Ga0065715_10034745 3300005293 Unclassified 1423
13 Ga0065715_10100094 3300005293 Bacteria 3337
14 Ga0065715_10156913 3300005293 Bacteria 1655
15 Ga0065715_10401699 3300005293 Bacteria 881
16 Ga0065707_10092711 3300005295 Unclassified 3729
17 Ga0065707_10142124 3300005295 Bacteria 1759
18 Ga0070658_10175669 3300005327 Bacteria 1801
19 Ga0070676_10017287 3300005328 Bacteria 3992
20 Ga0070676_10060969 3300005328 Bacteria 2241
21 Ga0070676_10163335 3300005328 Unclassified 1435
22 Ga0070683_100033184 3300005329 Bacteria 4706
23 Ga0070690_100008400 3300005330 Bacteria 5945
24 Ga0070690_100008723 3300005330 Bacteria 5849
25 Ga0070690_100057885 3300005330 Bacteria 2488
26 Ga0070690_100100381 3300005330 Bacteria 1918
27 Ga0070690_100123056 3300005330 Bacteria 1743
28 Ga0070690_100127327 3300005330 Unclassified 1716
29 Ga0070670_100002235 3300005331 Bacteria 15919
30 Ga0070670_100008786 3300005331 Bacteria 8622
31 Ga0070670_100043002 3300005331 Bacteria 3884
32 Ga0070670_100064058 3300005331 Bacteria 3154
33 Ga0070670_100171175 3300005331 Unclassified 1883
34 Ga0070670_100589823 3300005331 Unclassified 994
35 Ga0070677_10000772 3300005333 Bacteria 10656
36 Ga0070677_10006220 3300005333 Bacteria 3964
37 Ga0070677_10013563 3300005333 Unclassified 2853
38 Ga0070677_10017008 3300005333 Bacteria 2597
39 Ga0070677_10080690 3300005333 Bacteria 1391
40 Ga0070677_10207619 3300005333 Bacteria 949
41 Ga0070677_10237691 3300005333 Bacteria 898
42 Ga0068869_100011211 3300005334 Bacteria 5873
43 Ga0068869_100014741 3300005334 Bacteria 5227
44 Ga0068869_100073561 3300005334 Bacteria 2534
45 Ga0068869_100487949 3300005334 Bacteria 1027
46 Ga0068869_100630795 3300005334 Unclassified 908
47 Ga0068869_100761597 3300005334 Bacteria 830
48 Ga0068869_100820566 3300005334 Unclassified 800
49 Ga0070666_10007972 3300005335 Bacteria 6548
50 Ga0070666_10014705 3300005335 Bacteria 4985
51 Ga0070666_10024305 3300005335 Bacteria 3946
52 Ga0070666_10031837 3300005335 Bacteria 3483
53 Ga0070666_10174796 3300005335 Unclassified 1505
54 Ga0070680_100173954 3300005336 Bacteria 1812
55 Ga0070680_100311822 3300005336 Bacteria 1335
56 Ga0070682_100480798 3300005337 Unclassified 958
57 Ga0068868_100011691 3300005338 Bacteria 6394
58 Ga0068868_100046177 3300005338 Unclassified 3410
59 Ga0068868_100088896 3300005338 Bacteria 2486
60 Ga0068868_100563628 3300005338 Bacteria 1005
61 Ga0068868_100672500 3300005338 Unclassified 924
62 Ga0068868_101044871 3300005338 Bacteria 749
63 Ga0070660_100589037 3300005339 Unclassified 929
64 Ga0070689_100051305 3300005340 Bacteria 3189
65 Ga0070689_100093153 3300005340 Bacteria 2377
66 Ga0070689_100269108 3300005340 Bacteria 1410
67 Ga0070689_100277490 3300005340 Bacteria 1389
68 Ga0070689_100452667 3300005340 Unclassified 1092
69 Ga0070689_100830268 3300005340 Unclassified 814
70 Ga0070691_10016828 3300005341 Unclassified 3363
71 Ga0070687_100017374 3300005343 Bacteria 3306
72 Ga0070687_100018319 3300005343 Bacteria 3237
73 Ga0070687_100021683 3300005343 Bacteria 3025
74 Ga0070687_100075765 3300005343 Unclassified 1820
75 Ga0070687_100148634 3300005343 Bacteria 1373
76 Ga0070687_100550856 3300005343 Bacteria 785
77 Ga0070687_100659143 3300005343 Bacteria 726
78 Ga0070661_100052734 3300005344 Bacteria 2977
79 Ga0070661_100251344 3300005344 Bacteria 1364
80 Ga0070661_100562919 3300005344 Bacteria 918
81 Ga0070692_10079946 3300005345 Bacteria 1759
82 Ga0070692_10088347 3300005345 Viruses 1681
83 Ga0070668_100010474 3300005347 Bacteria 6892
84 Ga0070668_100123145 3300005347 Bacteria 2075
85 Ga0070669_100001320 3300005353 Bacteria 17879
86 Ga0070669_100005676 3300005353 Bacteria 9003
87 Ga0070669_100059354 3300005353 Unclassified 2809
88 Ga0070669_100059574 3300005353 Unclassified 2803
89 Ga0070669_100063968 3300005353 Bacteria 2708
90 Ga0070669_100067143 3300005353 Bacteria 2645
91 Ga0070669_100149514 3300005353 Unclassified 1807
92 Ga0070669_100365976 3300005353 Unclassified 1173
93 Ga0070669_100441568 3300005353 Bacteria 1071
94 Ga0070675_100000041 3300005354 Bacteria 78345
95 Ga0070675_100000966 3300005354 Bacteria 20540
96 Ga0070675_100001113 3300005354 Bacteria 19368
97 Ga0070675_100019768 3300005354 Bacteria 5371
98 Ga0070675_100020745 3300005354 Bacteria 5244
99 Ga0070675_100025710 3300005354 Bacteria 4720
100 Ga0070675_100065265 3300005354 Bacteria 3010
101 Ga0070675_100084896 3300005354 Bacteria 2644
102 Ga0070675_100096968 3300005354 Bacteria 2478
103 Ga0070675_100106727 3300005354 Bacteria 2364
104 Ga0070675_100117366 3300005354 Bacteria 2258
105 Ga0070675_100221643 3300005354 Bacteria 1647
106 Ga0070675_100295681 3300005354 Bacteria 1426
107 Ga0070675_100701092 3300005354 Bacteria 922
108 Ga0070671_100010422 3300005355 Bacteria 7454
109 Ga0070671_100013948 3300005355 Bacteria 6485
110 Ga0070671_100077256 3300005355 Bacteria 2782
111 Ga0070671_100082788 3300005355 Bacteria 2683
112 Ga0070671_100123745 3300005355 Bacteria 2177
113 Ga0070671_100183739 3300005355 Bacteria 1771
114 Ga0070671_100318102 3300005355 Unclassified 1326
115 Ga0070671_100592848 3300005355 Bacteria 957
116 Ga0070671_100599072 3300005355 Bacteria 952
117 Ga0070674_100000975 3300005356 Bacteria 14912
118 Ga0070674_100029900 3300005356 Unclassified 3596
119 Ga0070674_100073012 3300005356 Bacteria 2431
120 Ga0070674_100159651 3300005356 Bacteria 1709
121 Ga0070674_100201967 3300005356 Bacteria 1535
122 Ga0070674_100672365 3300005356 Unclassified 882
123 Ga0070673_100003896 3300005364 Bacteria 9379
124 Ga0070673_100013593 3300005364 Bacteria 5640
125 Ga0070673_100048023 3300005364 Bacteria 3325
126 Ga0070673_100058958 3300005364 Unclassified 3037
127 Ga0070673_100098402 3300005364 Unclassified 2404
128 Ga0070673_100204355 3300005364 Unclassified 1702
129 Ga0070673_100221736 3300005364 Bacteria 1637
130 Ga0070673_100813635 3300005364 Bacteria 863
131 Ga0070673_100842139 3300005364 Unclassified 848
132 Ga0070688_100018439 3300005365 Unclassified 4027
133 Ga0070688_100021110 3300005365 Bacteria 3799
134 Ga0070688_100105490 3300005365 Bacteria 1865
135 Ga0070688_100113673 3300005365 Unclassified 1804
136 Ga0070688_100128879 3300005365 Unclassified 1704
137 Ga0070688_100764148 3300005365 Bacteria 753
138 Ga0070659_100135027 3300005366 Bacteria 2006
139 Ga0070659_100139449 3300005366 Bacteria 1974
140 Ga0070659_100149279 3300005366 Bacteria 1906
141 Ga0070659_100239826 3300005366 Unclassified 1500
142 Ga0070659_100347749 3300005366 Unclassified 1243
143 Ga0070667_100001662 3300005367 Bacteria 19859
144 Ga0070667_100042990 3300005367 Bacteria 3791
145 Ga0070667_100190019 3300005367 Bacteria 1819
146 Ga0070667_100323262 3300005367 Bacteria 1392
147 Ga0070709_10148887 3300005434 Unclassified 1616
148 Ga0070709_10406301 3300005434 Bacteria 1018
149 Ga0070714_100396568 3300005435 Unclassified 1303
150 Ga0070713_100076553 3300005436 Bacteria 2842
151 Ga0070713_100337680 3300005436 Unclassified 1395
152 Ga0070701_10009195 3300005438 Bacteria 4320
153 Ga0070701_10017328 3300005438 Bacteria 3365
154 Ga0070701_10118491 3300005438 Bacteria 1488
155 Ga0070701_10198865 3300005438 Unclassified 1183
156 Ga0070701_10548991 3300005438 Bacteria 758
157 Ga0070701_10782801 3300005438 Unclassified 649
158 Ga0070711_100082815 3300005439 Unclassified 2291
159 Ga0070705_100066205 3300005440 Bacteria 2166
160 Ga0070705_100101948 3300005440 Bacteria 1814
161 Ga0070705_100364958 3300005440 Bacteria 1058
162 Ga0070700_100002881 3300005441 Bacteria 8842
163 Ga0070700_100110496 3300005441 Bacteria 1827
164 Ga0070700_100280714 3300005441 Unclassified 1207
165 Ga0070700_100296829 3300005441 Bacteria 1178
166 Ga0070694_100037022 3300005444 Bacteria 3235
167 Ga0070694_100044691 3300005444 Unclassified 2965
168 Ga0070694_100283238 3300005444 Unclassified 1264
169 Ga0070694_100488482 3300005444 Bacteria 978
170 Ga0070708_100011343 3300005445 Bacteria 7247
171 Ga0070708_100266125 3300005445 Unclassified 1612
172 Ga0070663_100315008 3300005455 Bacteria 1256
173 Ga0070678_100012647 3300005456 Bacteria 5259
174 Ga0070678_100032193 3300005456 Unclassified 3627
175 Ga0070678_100080804 3300005456 Bacteria 2463
176 Ga0070678_100103734 3300005456 Bacteria 2210
177 Ga0070678_100106421 3300005456 Unclassified 2186
178 Ga0070678_100336324 3300005456 Bacteria 1294
179 Ga0070678_100360914 3300005456 Bacteria 1252
180 Ga0070662_100068747 3300005457 Bacteria 2605
181 Ga0070662_100092723 3300005457 Bacteria 2271
182 Ga0070662_100151407 3300005457 Bacteria 1806
183 Ga0070662_100160132 3300005457 Bacteria 1760
184 Ga0070662_100342683 3300005457 Bacteria 1223
185 Ga0070662_100751315 3300005457 Bacteria 827
186 Ga0070681_10002773 3300005458 Bacteria 16173
187 Ga0070681_10128282 3300005458 Bacteria 2469
188 Ga0070681_10836785 3300005458 Unclassified 838
189 Ga0068867_100016445 3300005459 Bacteria 5252
190 Ga0068867_100027611 3300005459 Unclassified 4081
191 Ga0068867_100037310 3300005459 Bacteria 3532
192 Ga0068867_100158324 3300005459 Bacteria 1784
193 Ga0068867_100593721 3300005459 Unclassified 965
194 Ga0068867_100839927 3300005459 Bacteria 822
195 Ga0070685_10015539 3300005466 Bacteria 4044
196 Ga0070685_10062897 3300005466 Bacteria 2177
197 Ga0070685_10087931 3300005466 Bacteria 1875
198 Ga0070685_10139490 3300005466 Bacteria 1525
199 Ga0070685_10348447 3300005466 Unclassified 1012
200 Ga0070706_100310608 3300005467 Bacteria 1471
201 Ga0070706_100453027 3300005467 Bacteria 1194
202 Ga0070707_100067781 3300005468 Bacteria 3434
203 Ga0070707_100125281 3300005468 Bacteria 2495
204 Ga0070707_100130192 3300005468 Bacteria 2447
205 Ga0070698_100063259 3300005471 Bacteria 3732
206 Ga0070699_100065554 3300005518 Bacteria 3152
207 Ga0070699_100082331 3300005518 Bacteria 2806
208 Ga0070699_100191586 3300005518 Bacteria 1817
209 Ga0070699_100267360 3300005518 Bacteria 1530
210 Ga0070699_100319368 3300005518 Bacteria 1395
211 Ga0070699_100528942 3300005518 Bacteria 1072
212 Ga0070679_100278150 3300005530 Bacteria 1627
213 Ga0070684_100122026 3300005535 Unclassified 2345
214 Ga0070684_100432528 3300005535 Unclassified 1215
215 Ga0070697_100582902 3300005536 Bacteria 982
216 Ga0070697_100657686 3300005536 Bacteria 923
217 Ga0068853_100139726 3300005539 Bacteria 2174
218 Ga0068853_100520562 3300005539 Bacteria 1124
219 Ga0070672_100010398 3300005543 Bacteria 6455
220 Ga0070672_100040103 3300005543 Bacteria 3591
221 Ga0070672_100095539 3300005543 Bacteria 2404
222 Ga0070672_100120595 3300005543 Unclassified 2146
223 Ga0070672_100169190 3300005543 Unclassified 1816
224 Ga0070672_100174422 3300005543 Unclassified 1789
225 Ga0070672_100213634 3300005543 Bacteria 1616
226 Ga0070672_100276157 3300005543 Unclassified 1420
227 Ga0070672_100480868 3300005543 Bacteria 1072
228 Ga0070686_100024364 3300005544 Bacteria 3626
229 Ga0070686_100028194 3300005544 Bacteria 3404
230 Ga0070686_100051088 3300005544 Bacteria 2630
231 Ga0070686_100209760 3300005544 Bacteria 1401
232 Ga0070686_100332216 3300005544 Bacteria 1137
233 Ga0070686_100341679 3300005544 Bacteria 1122
234 Ga0070686_100369605 3300005544 Bacteria 1082
235 Ga0070695_100052916 3300005545 Bacteria 2610
236 Ga0070695_100094419 3300005545 Bacteria 2003
237 Ga0070695_100763016 3300005545 Bacteria 772
238 Ga0070695_100815177 3300005545 Bacteria 749
239 Ga0070696_100019995 3300005546 Bacteria 4539
240 Ga0070696_100612907 3300005546 Bacteria 879
241 Ga0070693_100247540 3300005547 Bacteria 1180
242 Ga0070665_100018260 3300005548 Bacteria 7035
243 Ga0070665_100105660 3300005548 Bacteria 2818
244 Ga0070665_100150467 3300005548 Bacteria 2330
245 Ga0070665_100238302 3300005548 Bacteria 1820
246 Ga0070704_100004428 3300005549 Bacteria 8113
247 Ga0070704_100020336 3300005549 Bacteria 4279
248 Ga0070704_100099608 3300005549 Bacteria 2186
249 Ga0070704_100566205 3300005549 Bacteria 995
250 Ga0070704_101086892 3300005549 Bacteria 726
251 Ga0068855_100136660 3300005563 Bacteria 2796
252 Ga0070664_100038559 3300005564 Bacteria 4023
253 Ga0070664_100080800 3300005564 Bacteria 2800
254 Ga0070664_100152348 3300005564 Unclassified 2042
255 Ga0070664_100157706 3300005564 Bacteria 2006
256 Ga0070664_100400368 3300005564 Unclassified 1255
257 Ga0070664_100622455 3300005564 Bacteria 1002
258 Ga0070664_100944925 3300005564 Unclassified 809
259 Ga0068857_100073910 3300005577 Bacteria 3038
260 Ga0068857_100185274 3300005577 Bacteria 1895
261 Ga0068854_100001952 3300005578 Bacteria 12592
262 Ga0068854_100009138 3300005578 Bacteria 6391
263 Ga0068854_100181412 3300005578 Bacteria 1645
264 Ga0068854_100238424 3300005578 Bacteria 1447
265 Ga0070702_100029033 3300005615 Bacteria 3003
266 Ga0070702_100031150 3300005615 Bacteria 2916
267 Ga0070702_100114318 3300005615 Unclassified 1679
268 Ga0070702_100117379 3300005615 Bacteria 1660
269 Ga0070702_100159646 3300005615 Bacteria 1456
270 Ga0070702_100985880 3300005615 Bacteria 666
271 Ga0068852_100014483 3300005616 Bacteria 6073
272 Ga0068852_100645653 3300005616 Unclassified 1065
273 Ga0068852_100840973 3300005616 Bacteria 933
274 Ga0068859_100001994 3300005617 Bacteria 20841
275 Ga0068859_100014294 3300005617 Bacteria 7962
276 Ga0068859_100060044 3300005617 Bacteria 3832
277 Ga0068859_100090633 3300005617 Bacteria 3108
278 Ga0068859_100090833 3300005617 Bacteria 3105
279 Ga0068859_100094523 3300005617 Bacteria 3041
280 Ga0068859_100240129 3300005617 Bacteria 1901
281 Ga0068859_100431179 3300005617 Bacteria 1415
282 Ga0068859_100453087 3300005617 Unclassified 1379
283 Ga0068859_100527499 3300005617 Bacteria 1276
284 Ga0068859_100618922 3300005617 Unclassified 1175
285 Ga0068859_100991028 3300005617 Bacteria 923
286 Ga0068859_101137338 3300005617 Unclassified 859
287 Ga0068859_101510468 3300005617 Unclassified 741
288 Ga0068864_100028317 3300005618 Bacteria 4734
289 Ga0068864_100035116 3300005618 Bacteria 4267
290 Ga0068864_100045694 3300005618 Bacteria 3757
291 Ga0068864_100097777 3300005618 Bacteria 2599
292 Ga0068864_100111429 3300005618 Bacteria 2438
293 Ga0068864_100165513 3300005618 Bacteria 2013
294 Ga0068864_100339027 3300005618 Unclassified 1416
295 Ga0068864_100560066 3300005618 Unclassified 1106
296 Ga0068864_100778261 3300005618 Bacteria 939
297 Ga0068866_10009040 3300005718 Unclassified 4222
298 Ga0068866_10197045 3300005718 Unclassified 1201
299 Ga0068861_100013994 3300005719 Bacteria 5624
300 Ga0068861_100044224 3300005719 Bacteria 3347
301 Ga0068861_100228247 3300005719 Bacteria 1577
302 Ga0068861_100261639 3300005719 Bacteria 1481
303 Ga0068861_100373319 3300005719 Bacteria 1258
304 Ga0068861_100535858 3300005719 Unclassified 1064
305 Ga0068861_100652814 3300005719 Unclassified 972
306 Ga0068861_101252054 3300005719 Bacteria 719
307 Ga0068861_101352461 3300005719 Unclassified 694
308 Ga0068861_101399310 3300005719 Bacteria 683
309 Ga0068870_10073291 3300005840 Bacteria 1873
310 Ga0068870_10099776 3300005840 Bacteria 1639
311 Ga0068870_10099790 3300005840 Unclassified 1639
312 Ga0068870_10185190 3300005840 Bacteria 1253
313 Ga0068870_10454214 3300005840 Bacteria 845
314 Ga0068863_100000686 3300005841 Bacteria 34055
315 Ga0068863_100030370 3300005841 Bacteria 5161
316 Ga0068863_100047497 3300005841 Bacteria 4071
317 Ga0068863_100089746 3300005841 Bacteria 2915
318 Ga0068863_100190317 3300005841 Bacteria 1972
319 Ga0068863_100579113 3300005841 Bacteria 1110
320 Ga0068863_100644068 3300005841 Bacteria 1051
321 Ga0068863_100820425 3300005841 Bacteria 928
322 Ga0068858_100009448 3300005842 Bacteria 9300
323 Ga0068858_100011524 3300005842 Bacteria 8343
324 Ga0068858_100106449 3300005842 Bacteria 2618
325 Ga0068858_100211026 3300005842 Bacteria 1837
326 Ga0068858_100539005 3300005842 Bacteria 1129
327 Ga0068858_100940366 3300005842 Unclassified 846
328 Ga0068860_100073558 3300005843 Bacteria 3249
329 Ga0068860_100183305 3300005843 Bacteria 2024
330 Ga0068860_100189619 3300005843 Bacteria 1989
331 Ga0068860_100240083 3300005843 Unclassified 1762
332 Ga0068860_100381527 3300005843 Unclassified 1391
333 Ga0068862_100003841 3300005844 Bacteria 12795
334 Ga0068862_100034545 3300005844 Bacteria 4279
335 Ga0068862_100047450 3300005844 Bacteria 3666
336 Ga0068862_100096158 3300005844 Unclassified 2585
337 Ga0068862_100231417 3300005844 Bacteria 1677
338 Ga0068862_100432253 3300005844 Bacteria 1237
339 Ga0068862_100726390 3300005844 Bacteria 964
340 Ga0068862_101471782 3300005844 Unclassified 686
341 Ga0081455_10049924 3300005937 Unclassified 3603
342 Ga0081455_10167809 3300005937 Bacteria 1675
343 Ga0070717_10175180 3300006028 Bacteria 1867
344 Ga0075365_10000686 3300006038 Bacteria 13598
345 Ga0075365_10124605 3300006038 Bacteria 1780
346 Ga0075368_10176244 3300006042 Unclassified 900
347 Ga0075363_100072433 3300006048 Unclassified 1874
348 Ga0075364_10071890 3300006051 Bacteria 2279
349 Ga0075364_10122807 3300006051 Bacteria 1739
350 Ga0075364_10328804 3300006051 Bacteria 1041
351 Ga0075432_10052427 3300006058 Bacteria 1441
352 Ga0070715_10022043 3300006163 Unclassified 2479
353 Ga0070716_100042763 3300006173 Bacteria 2531
354 Ga0075362_10295589 3300006177 Bacteria 803
355 Ga0075367_10123584 3300006178 Unclassified 1596
356 Ga0075366_10031369 3300006195 Bacteria 3127
357 Ga0075366_10050323 3300006195 Bacteria 2473
358 Ga0075366_10052416 3300006195 Unclassified 2424
359 Ga0075366_10135602 3300006195 Bacteria 1486
360 Ga0075366_10210083 3300006195 Bacteria 1185
361 Ga0097621_100001726 3300006237 Bacteria 14936
362 Ga0097621_100004004 3300006237 Bacteria 10214
363 Ga0097621_100015342 3300006237 Bacteria 5762
364 Ga0097621_100121588 3300006237 Bacteria 2214
365 Ga0097621_100179045 3300006237 Bacteria 1831
366 Ga0097621_100239490 3300006237 Unclassified 1586
367 Ga0097621_100250825 3300006237 Unclassified 1550
368 Ga0097621_100588768 3300006237 Bacteria 1016
369 Ga0075370_10044219 3300006353 Bacteria 2517
370 Ga0075370_10063181 3300006353 Bacteria 2110
371 Ga0068871_100025709 3300006358 Bacteria 4584
372 Ga0068871_100033333 3300006358 Bacteria 4078
373 Ga0068871_100035150 3300006358 Bacteria 3980
374 Ga0068871_100088656 3300006358 Bacteria 2574
375 Ga0068871_100169841 3300006358 Bacteria 1869
376 Ga0068871_100358602 3300006358 Unclassified 1291
377 Ga0068871_100383587 3300006358 Unclassified 1249
378 Ga0068871_100450951 3300006358 Bacteria 1153
379 Ga0068871_100539255 3300006358 Unclassified 1055
380 Ga0068871_100640983 3300006358 Bacteria 969
381 Ga0075428_100001137 3300006844 Bacteria 28418
382 Ga0075428_100008320 3300006844 Bacteria 11496
383 Ga0075428_100033183 3300006844 Bacteria 5700
384 Ga0075428_100145716 3300006844 Bacteria 2574
385 Ga0075428_100331019 3300006844 Bacteria 1636
386 Ga0075428_100459578 3300006844 Bacteria 1363
387 Ga0075428_100579289 3300006844 Unclassified 1199
388 Ga0075430_100058650 3300006846 Unclassified 3236
389 Ga0075430_100142674 3300006846 Bacteria 1995
390 Ga0075430_100215907 3300006846 Bacteria 1592
391 Ga0075430_100245059 3300006846 Bacteria 1485
392 Ga0075430_100266751 3300006846 Bacteria 1417
393 Ga0075431_100000264 3300006847 Bacteria 40417
394 Ga0075431_100002177 3300006847 Bacteria 18724
395 Ga0075431_100023284 3300006847 Bacteria 6336
396 Ga0075431_100044213 3300006847 Bacteria 4594
397 Ga0075431_100069929 3300006847 Bacteria 3621
398 Ga0075431_100071962 3300006847 Bacteria 3568
399 Ga0075431_101082462 3300006847 Unclassified 767
400 Ga0075431_101174703 3300006847 Unclassified 731
401 Ga0075433_10001958 3300006852 Bacteria 15487
402 Ga0075433_10055579 3300006852 Unclassified 3456
403 Ga0075433_10083029 3300006852 Bacteria 2827
404 Ga0075433_10105734 3300006852 Bacteria 2494
405 Ga0075433_10123040 3300006852 Bacteria 2304
406 Ga0075433_10175406 3300006852 Bacteria 1908
407 Ga0075434_100010137 3300006871 Bacteria 8825
408 Ga0075434_100065503 3300006871 Bacteria 3618
409 Ga0075434_100145562 3300006871 Bacteria 2390
410 Ga0075434_100167944 3300006871 Bacteria 2214
411 Ga0075434_100320579 3300006871 Bacteria 1570
412 Ga0075434_100385311 3300006871 Unclassified 1423
413 Ga0075429_100002904 3300006880 Bacteria 14530
414 Ga0075429_100003455 3300006880 Bacteria 13490
415 Ga0075429_100006362 3300006880 Bacteria 10219
416 Ga0075429_100073377 3300006880 Unclassified 2981
417 Ga0075429_100080189 3300006880 Unclassified 2845
418 Ga0075429_100587332 3300006880 Bacteria 976
419 Ga0075429_100718273 3300006880 Bacteria 875
420 Ga0075429_100980044 3300006880 Unclassified 739
421 Ga0068865_100026156 3300006881 Bacteria 3845
422 Ga0068865_100031202 3300006881 Unclassified 3552
423 Ga0068865_100036436 3300006881 Unclassified 3317
424 Ga0068865_100148678 3300006881 Bacteria 1775
425 Ga0068865_100332304 3300006881 Bacteria 1226
426 Ga0068865_100400066 3300006881 Unclassified 1125
427 Ga0068865_100681097 3300006881 Unclassified 877
428 Ga0068865_100830437 3300006881 Unclassified 799
429 Ga0075436_100015708 3300006914 Bacteria 5183
430 Ga0075436_100023330 3300006914 Bacteria 4249
431 Ga0075436_100028798 3300006914 Bacteria 3821
432 Ga0075436_100415496 3300006914 Unclassified 976
433 Ga0097620_100001994 3300006931 Bacteria 20841
434 Ga0097620_100014294 3300006931 Bacteria 7962
435 Ga0097620_100060046 3300006931 Bacteria 3832
436 Ga0097620_100090629 3300006931 Bacteria 3108
437 Ga0097620_100090831 3300006931 Bacteria 3105
438 Ga0097620_100094523 3300006931 Bacteria 3041
439 Ga0097620_100240141 3300006931 Bacteria 1901
440 Ga0097620_100431177 3300006931 Bacteria 1415
441 Ga0097620_100453104 3300006931 Unclassified 1379
442 Ga0097620_100527475 3300006931 Bacteria 1276
443 Ga0097620_100618863 3300006931 Unclassified 1175
444 Ga0097620_100991106 3300006931 Bacteria 923
445 Ga0097620_101137318 3300006931 Unclassified 859
446 Ga0097620_101510774 3300006931 Unclassified 741
447 Ga0075435_100000143 3300007076 Bacteria 40414
448 Ga0075435_100026041 3300007076 Bacteria 4560
449 Ga0075435_100032672 3300007076 Bacteria 4111
450 Ga0075435_100043385 3300007076 Bacteria 3600
451 Ga0075435_100085897 3300007076 Unclassified 2590
452 Ga0075435_100108419 3300007076 Bacteria 2307
453 Ga0075435_100488442 3300007076 Bacteria 1064
454 Ga0105240_10032751 3300009093 Bacteria 6725
455 Ga0105240_10176047 3300009093 Bacteria 2529
456 Ga0105240_11031045 3300009093 Unclassified 878
457 Ga0105240_11379699 3300009093 Bacteria 741
458 Ga0111539_10000863 3300009094 Bacteria 39542
459 Ga0111539_10001510 3300009094 Bacteria 31058
460 Ga0111539_10001878 3300009094 Bacteria 27899
461 Ga0111539_10002502 3300009094 Bacteria 24351
462 Ga0111539_10019477 3300009094 Bacteria 8374
463 Ga0111539_10024974 3300009094 Bacteria 7324
464 Ga0111539_10138605 3300009094 Bacteria 2849
465 Ga0111539_10139310 3300009094 Bacteria 2841
466 Ga0111539_10277731 3300009094 Bacteria 1949
467 Ga0111539_10302208 3300009094 Bacteria 1862
468 Ga0111539_10406134 3300009094 Bacteria 1586
469 Ga0111539_10620462 3300009094 Unclassified 1259
470 Ga0111539_10826383 3300009094 Bacteria 1078
471 Ga0105245_10045126 3300009098 Bacteria 3935
472 Ga0105245_10444429 3300009098 Bacteria 1304
473 Ga0114129_10004403 3300009147 Bacteria 19866
474 Ga0114129_10006326 3300009147 Bacteria 16793
475 Ga0114129_10017377 3300009147 Bacteria 10243
476 Ga0114129_10018860 3300009147 Bacteria 9826
477 Ga0114129_10024344 3300009147 Bacteria 8578
478 Ga0114129_10074952 3300009147 Bacteria 4712
479 Ga0114129_10077917 3300009147 Unclassified 4610
480 Ga0114129_10090318 3300009147 Bacteria 4247
481 Ga0114129_10119362 3300009147 Unclassified 3632
482 Ga0114129_10141331 3300009147 Bacteria 3299
483 Ga0114129_10165241 3300009147 Unclassified 3021
484 Ga0114129_10192062 3300009147 Archaea 2772
485 Ga0114129_11616100 3300009147 Bacteria 793
486 Ga0105243_10016838 3300009148 Bacteria 5525
487 Ga0105243_10069469 3300009148 Bacteria 2842
488 Ga0105243_10374135 3300009148 Unclassified 1315
489 Ga0105243_11085762 3300009148 Unclassified 808
490 Ga0105243_11086379 3300009148 Unclassified 807
491 Ga0105243_11812897 3300009148 Unclassified 641
492 Ga0105241_10043620 3300009174 Bacteria 3397
493 Ga0105242_10009992 3300009176 Bacteria 7266
494 Ga0105242_10041319 3300009176 Bacteria 3719
495 Ga0105242_10054914 3300009176 Bacteria 3258
496 Ga0105248_10000243 3300009177 Bacteria 62970
497 Ga0105248_10017073 3300009177 Bacteria 7994
498 Ga0105248_10025998 3300009177 Bacteria 6511
499 Ga0105248_10046378 3300009177 Bacteria 4870
500 Ga0105248_10056375 3300009177 Bacteria 4408
501 Ga0105248_10136884 3300009177 Unclassified 2763
502 Ga0105248_10220619 3300009177 Unclassified 2135
503 Ga0105248_10250745 3300009177 Bacteria 1993
504 Ga0105248_10458448 3300009177 Bacteria 1437
505 Ga0105248_10676764 3300009177 Unclassified 1164
506 Ga0105248_10862059 3300009177 Bacteria 1022
507 Ga0105248_11170598 3300009177 Bacteria 869
508 Ga0105237_10877910 3300009545 Unclassified 904
509 Ga0105238_10010542 3300009551 Bacteria 9281
510 Ga0105238_10208692 3300009551 Bacteria 1929
511 Ga0105249_10009614 3300009553 Bacteria 8473
512 Ga0105249_10092474 3300009553 Bacteria 2832
513 Ga0105249_10178588 3300009553 Bacteria 2064
514 Ga0105249_11675024 3300009553 Unclassified 708
515 Ga0105239_10135613 3300010375 Bacteria 2740
516 Ga0105239_11115625 3300010375 Bacteria 908
517 Ga0105246_10226429 3300011119 Unclassified 1469
518 Ga0105246_10345440 3300011119 Bacteria 1218
519 Ga0157371_10247019 3300013102 Bacteria 1284
520 Ga0157370_10079849 3300013104 Bacteria 3081
521 Ga0157370_10320138 3300013104 Bacteria 1430
522 Ga0157369_10496811 3300013105 Bacteria 1262
523 Ga0157369_10513350 3300013105 Unclassified 1240
524 Ga0157374_10113917 3300013296 Bacteria 2603
525 Ga0157374_10254045 3300013296 Bacteria 1730
526 Ga0157378_10023312 3300013297 Bacteria 5448
527 Ga0157378_10151836 3300013297 Bacteria 2159
528 Ga0157378_10191924 3300013297 Bacteria 1927
529 Ga0157378_10252980 3300013297 Bacteria 1687
530 Ga0157378_10293176 3300013297 Bacteria 1572
531 Ga0163162_10005885 3300013306 Bacteria 11864
532 Ga0163162_10032921 3300013306 Bacteria 5148
533 Ga0163162_10056136 3300013306 Bacteria 3967
534 Ga0163162_10431291 3300013306 Unclassified 1450
535 Ga0163162_10445013 3300013306 Bacteria 1428
536 Ga0157375_10000157 3300013308 Bacteria 64518
537 Ga0157375_10005598 3300013308 Bacteria 10935
538 Ga0157375_10042515 3300013308 Bacteria 4398
539 Ga0157375_10075376 3300013308 Bacteria 3398
540 Ga0157375_10082389 3300013308 Unclassified 3259
541 Ga0157375_10197476 3300013308 Bacteria 2167
542 Ga0157375_10209186 3300013308 Bacteria 2108
543 Ga0157375_10247575 3300013308 Unclassified 1943
544 Ga0157375_10416127 3300013308 Bacteria 1510
545 Ga0157375_10449231 3300013308 Bacteria 1455
546 Ga0157375_10555034 3300013308 Unclassified 1310
547 Ga0157375_10712990 3300013308 Bacteria 1156
548 Ga0157375_11114325 3300013308 Bacteria 924
549 Ga0157375_12202309 3300013308 Unclassified 657
550 Ga0163163_10001712 3300014325 Bacteria 18499
551 Ga0163163_10022232 3300014325 Bacteria 6000
552 Ga0163163_10242089 3300014325 Bacteria 1854
553 Ga0163163_10254285 3300014325 Bacteria 1808
554 Ga0163163_10891453 3300014325 Unclassified 953
555 Ga0163163_10937332 3300014325 Unclassified 929
556 Ga0157380_10000377 3300014326 Bacteria 26856
557 Ga0157380_10012562 3300014326 Bacteria 6146
558 Ga0157380_10032399 3300014326 Bacteria 4020
559 Ga0157380_10103717 3300014326 Unclassified 2374
560 Ga0157380_10109354 3300014326 Unclassified 2319
561 Ga0157380_10286362 3300014326 Unclassified 1510
562 Ga0157380_10462442 3300014326 Bacteria 1222
563 Ga0157380_10549810 3300014326 Bacteria 1132
564 Ga0157380_10565719 3300014326 Bacteria 1118
565 Ga0157377_10016508 3300014745 Bacteria 3799
566 Ga0157377_10017173 3300014745 Bacteria 3739
567 Ga0157377_10022871 3300014745 Unclassified 3306
568 Ga0157377_10033863 3300014745 Bacteria 2791
569 Ga0157377_10055345 3300014745 Bacteria 2249
570 Ga0157377_10514667 3300014745 Unclassified 839
571 Ga0157379_10000094 3300014968 Bacteria 59552
572 Ga0157379_10045095 3300014968 Bacteria 3936
573 Ga0157376_10070534 3300014969 Bacteria 2966
574 Ga0157376_10133088 3300014969 Bacteria 2222
575 Ga0157376_10199253 3300014969 Bacteria 1841
576 Ga0157376_10205636 3300014969 Bacteria 1814
577 Ga0157376_10231921 3300014969 Bacteria 1715
578 Ga0157376_10351615 3300014969 Unclassified 1410
579 Ga0157376_10472887 3300014969 Bacteria 1227
580 Ga0163161_10067595 3300017792 Bacteria 2610
581 Ga0163161_10112660 3300017792 Bacteria 2035
582 Ga0163161_10305829 3300017792 Unclassified 1253
583 Ga0163161_10931516 3300017792 Unclassified 738
584 Ga0163161_11090587 3300017792 Bacteria 686
585 Ga0206349_1746695 3300020075 Bacteria 1461
586 Ga0206352_10238537 3300020078 Unclassified 1121
587 Ga0206350_10890321 3300020080 Unclassified 1797
588 Ga0206350_11229116 3300020080 Bacteria 1778
589 Ga0224712_10048712 3300022467 Unclassified 1637
590 Ga0207697_10002446 3300025315 Bacteria 9620
591 Ga0207697_10053017 3300025315 Bacteria 1679
592 Ga0207656_10013876 3300025321 Bacteria 3092
593 Ga0207656_10269448 3300025321 Bacteria 838
594 Ga0207682_10005509 3300025893 Bacteria 5155
595 Ga0207682_10008532 3300025893 Bacteria 4049
596 Ga0207682_10028997 3300025893 Bacteria 2212
597 Ga0207682_10168593 3300025893 Bacteria 995
598 Ga0207642_10173157 3300025899 Unclassified 1170
599 Ga0207642_10197180 3300025899 Unclassified 1109
600 Ga0207688_10002119 3300025901 Bacteria 10660
601 Ga0207688_10015491 3300025901 Bacteria 4134
602 Ga0207688_10017988 3300025901 Bacteria 3846
603 Ga0207688_10044651 3300025901 Bacteria 2470
604 Ga0207688_10205537 3300025901 Bacteria 1182
605 Ga0207688_10223183 3300025901 Bacteria 1136
606 Ga0207680_10006504 3300025903 Bacteria 5655
607 Ga0207680_10041886 3300025903 Unclassified 2675
608 Ga0207680_10155353 3300025903 Bacteria 1529
609 Ga0207680_10224199 3300025903 Bacteria 1290
610 Ga0207680_10330322 3300025903 Bacteria 1068
611 Ga0207647_10083612 3300025904 Bacteria 1911
612 Ga0207699_10324886 3300025906 Bacteria 1080
613 Ga0207645_10006284 3300025907 Bacteria 8539
614 Ga0207645_10015758 3300025907 Bacteria 5012
615 Ga0207645_10018352 3300025907 Bacteria 4604
616 Ga0207645_10265510 3300025907 Bacteria 1137
617 Ga0207645_10282600 3300025907 Bacteria 1102
618 Ga0207643_10000504 3300025908 Bacteria 24971
619 Ga0207643_10023869 3300025908 Bacteria 3374
620 Ga0207643_10025171 3300025908 Unclassified 3288
621 Ga0207643_10050749 3300025908 Bacteria 2353
622 Ga0207684_10380105 3300025910 Bacteria 1215
623 Ga0207707_10292363 3300025912 Bacteria 1409
624 Ga0207695_10246300 3300025913 Bacteria 1687
625 Ga0207695_10344338 3300025913 Bacteria 1378
626 Ga0207695_10592310 3300025913 Bacteria 990
627 Ga0207663_10150774 3300025916 Unclassified 1631
628 Ga0207660_10247083 3300025917 Bacteria 1407
629 Ga0207660_10513884 3300025917 Unclassified 972
630 Ga0207660_10748610 3300025917 Bacteria 797
631 Ga0207662_10003633 3300025918 Bacteria 7981
632 Ga0207662_10003706 3300025918 Bacteria 7915
633 Ga0207662_10007609 3300025918 Bacteria 5903
634 Ga0207662_10034337 3300025918 Bacteria 2960
635 Ga0207662_10072941 3300025918 Bacteria 2082
636 Ga0207662_10155479 3300025918 Bacteria 1457
637 Ga0207662_10174296 3300025918 Unclassified 1381
638 Ga0207662_10215120 3300025918 Bacteria 1249
639 Ga0207662_10491530 3300025918 Unclassified 844
640 Ga0207657_10189724 3300025919 Bacteria 1659
641 Ga0207657_10973590 3300025919 Unclassified 652
642 Ga0207649_10048813 3300025920 Bacteria 2611
643 Ga0207649_10174251 3300025920 Bacteria 1501
644 Ga0207649_10181047 3300025920 Bacteria 1475
645 Ga0207652_10539812 3300025921 Bacteria 1048
646 Ga0207652_10666928 3300025921 Bacteria 929
647 Ga0207646_10066022 3300025922 Bacteria 3230
648 Ga0207646_10410902 3300025922 Bacteria 1222
649 Ga0207681_10012475 3300025923 Bacteria 5244
650 Ga0207681_10020425 3300025923 Bacteria 4197
651 Ga0207681_10029586 3300025923 Bacteria 3560
652 Ga0207681_10044289 3300025923 Unclassified 2982
653 Ga0207681_10433839 3300025923 Unclassified 1066
654 Ga0207681_10573517 3300025923 Bacteria 930
655 Ga0207694_10049833 3300025924 Bacteria 3242
656 Ga0207650_10002282 3300025925 Bacteria 13376
657 Ga0207650_10012158 3300025925 Bacteria 5933
658 Ga0207650_10029076 3300025925 Bacteria 3969
659 Ga0207650_10043144 3300025925 Unclassified 3310
660 Ga0207650_10139685 3300025925 Unclassified 1903
661 Ga0207650_10472166 3300025925 Bacteria 1046
662 Ga0207650_10481983 3300025925 Bacteria 1035
663 Ga0207650_10509787 3300025925 Unclassified 1006
664 Ga0207659_10000562 3300025926 Bacteria 22290
665 Ga0207659_10001703 3300025926 Bacteria 13047
666 Ga0207659_10003966 3300025926 Bacteria 8930
667 Ga0207659_10008601 3300025926 Bacteria 6348
668 Ga0207659_10008609 3300025926 Bacteria 6345
669 Ga0207659_10012648 3300025926 Bacteria 5380
670 Ga0207659_10025134 3300025926 Unclassified 3998
671 Ga0207659_10027948 3300025926 Bacteria 3827
672 Ga0207659_10119951 3300025926 Bacteria 2014
673 Ga0207659_10131825 3300025926 Bacteria 1930
674 Ga0207659_10230165 3300025926 Bacteria 1494
675 Ga0207659_11123158 3300025926 Unclassified 676
676 Ga0207687_10127827 3300025927 Bacteria 1911
677 Ga0207700_10010397 3300025928 Bacteria 5870
678 Ga0207664_10207856 3300025929 Unclassified 1692
679 Ga0207644_10017499 3300025931 Bacteria 4842
680 Ga0207644_10038073 3300025931 Bacteria 3386
681 Ga0207644_10041886 3300025931 Bacteria 3242
682 Ga0207644_10060165 3300025931 Bacteria 2748
683 Ga0207644_10169812 3300025931 Bacteria 1702
684 Ga0207690_10282167 3300025932 Bacteria 1294
685 Ga0207690_10347892 3300025932 Unclassified 1171
686 Ga0207690_11080708 3300025932 Viruses 668
687 Ga0207706_10001744 3300025933 Bacteria 21354
688 Ga0207706_10011372 3300025933 Bacteria 8110
689 Ga0207706_10019140 3300025933 Bacteria 6159
690 Ga0207706_10087453 3300025933 Bacteria 2740
691 Ga0207706_10187264 3300025933 Bacteria 1817
692 Ga0207706_10257004 3300025933 Bacteria 1525
693 Ga0207706_10311570 3300025933 Bacteria 1370
694 Ga0207686_10013110 3300025934 Bacteria 4578
695 Ga0207686_10031969 3300025934 Bacteria 3129
696 Ga0207709_10043504 3300025935 Unclassified 2708
697 Ga0207709_10190881 3300025935 Unclassified 1455
698 Ga0207670_10053120 3300025936 Unclassified 2728
699 Ga0207670_10058305 3300025936 Bacteria 2622
700 Ga0207670_10121597 3300025936 Bacteria 1899
701 Ga0207670_10214103 3300025936 Bacteria 1471
702 Ga0207670_10300615 3300025936 Bacteria 1256
703 Ga0207669_10000046 3300025937 Bacteria 62654
704 Ga0207669_10005417 3300025937 Bacteria 5724
705 Ga0207669_10079882 3300025937 Bacteria 2090
706 Ga0207669_10093496 3300025937 Bacteria 1965
707 Ga0207669_10751398 3300025937 Bacteria 805
708 Ga0207669_10898358 3300025937 Bacteria 740
709 Ga0207704_10016619 3300025938 Bacteria 3787
710 Ga0207704_10036752 3300025938 Bacteria 2820
711 Ga0207704_10065346 3300025938 Unclassified 2277
712 Ga0207704_10655021 3300025938 Bacteria 865
713 Ga0207704_11074798 3300025938 Bacteria 683
714 Ga0207665_10114638 3300025939 Unclassified 1897
715 Ga0207691_10001339 3300025940 Bacteria 24573
716 Ga0207691_10005966 3300025940 Bacteria 11768
717 Ga0207691_10016966 3300025940 Bacteria 6910
718 Ga0207691_10024791 3300025940 Bacteria 5638
719 Ga0207691_10051009 3300025940 Bacteria 3785
720 Ga0207691_10067575 3300025940 Bacteria 3231
721 Ga0207691_10088911 3300025940 Unclassified 2770
722 Ga0207691_10089175 3300025940 Bacteria 2766
723 Ga0207691_10099770 3300025940 Bacteria 2592
724 Ga0207691_10152862 3300025940 Unclassified 2028
725 Ga0207691_10185243 3300025940 Unclassified 1818
726 Ga0207691_10229627 3300025940 Bacteria 1607
727 Ga0207691_10562834 3300025940 Unclassified 966
728 Ga0207691_10620048 3300025940 Bacteria 915
729 Ga0207691_10621913 3300025940 Unclassified 913
730 Ga0207711_10000570 3300025941 Bacteria 37542
731 Ga0207711_10026483 3300025941 Bacteria 4866
732 Ga0207711_10044603 3300025941 Bacteria 3786
733 Ga0207711_10048405 3300025941 Bacteria 3637
734 Ga0207711_10146429 3300025941 Unclassified 2128
735 Ga0207711_10148090 3300025941 Bacteria 2116
736 Ga0207711_10372205 3300025941 Bacteria 1325
737 Ga0207711_10417248 3300025941 Bacteria 1248
738 Ga0207711_11017775 3300025941 Bacteria 768
739 Ga0207711_11065547 3300025941 Bacteria 749
740 Ga0207689_10002152 3300025942 Bacteria 18532
741 Ga0207689_10007933 3300025942 Bacteria 9272
742 Ga0207689_10072939 3300025942 Bacteria 2820
743 Ga0207689_10078527 3300025942 Bacteria 2712
744 Ga0207689_10267269 3300025942 Bacteria 1416
745 Ga0207689_10284241 3300025942 Bacteria 1370
746 Ga0207689_10711130 3300025942 Bacteria 847
747 Ga0207661_10081711 3300025944 Bacteria 2670
748 Ga0207679_10027338 3300025945 Bacteria 3944
749 Ga0207679_10038212 3300025945 Bacteria 3419
750 Ga0207679_10084256 3300025945 Unclassified 2439
751 Ga0207679_10171446 3300025945 Bacteria 1787
752 Ga0207679_10307373 3300025945 Bacteria 1369
753 Ga0207679_10315704 3300025945 Bacteria 1351
754 Ga0207679_10455285 3300025945 Unclassified 1135
755 Ga0207679_10653057 3300025945 Unclassified 951
756 Ga0207667_10156356 3300025949 Bacteria 2346
757 Ga0207651_10002765 3300025960 Bacteria 8422
758 Ga0207651_10004530 3300025960 Bacteria 7021
759 Ga0207651_10008951 3300025960 Bacteria 5438
760 Ga0207651_10069210 3300025960 Unclassified 2491
761 Ga0207651_10103548 3300025960 Bacteria 2118
762 Ga0207651_10477790 3300025960 Bacteria 1074
763 Ga0207651_10764184 3300025960 Unclassified 855
764 Ga0207712_10005227 3300025961 Bacteria 8207
765 Ga0207712_10308001 3300025961 Bacteria 1302
766 Ga0207712_10402510 3300025961 Bacteria 1151
767 Ga0207712_10652384 3300025961 Unclassified 915
768 Ga0207668_10224120 3300025972 Bacteria 1512
769 Ga0207668_10710976 3300025972 Bacteria 884
770 Ga0207668_11242802 3300025972 Bacteria 670
771 Ga0207640_10632464 3300025981 Bacteria 910
772 Ga0207640_11442012 3300025981 Unclassified 617
773 Ga0207658_10001809 3300025986 Bacteria 16012
774 Ga0207658_10004182 3300025986 Bacteria 10057
775 Ga0207658_10019015 3300025986 Bacteria 4752
776 Ga0207658_10046295 3300025986 Bacteria 3176
777 Ga0207658_10177695 3300025986 Bacteria 1759
778 Ga0207658_10602860 3300025986 Bacteria 987
779 Ga0207677_10024856 3300026023 Bacteria 3728
780 Ga0207677_10178254 3300026023 Bacteria 1669
781 Ga0207677_10317732 3300026023 Bacteria 1293
782 Ga0207677_10540729 3300026023 Bacteria 1014
783 Ga0207677_10548257 3300026023 Unclassified 1007
784 Ga0207703_10021318 3300026035 Bacteria 5073
785 Ga0207703_10273489 3300026035 Bacteria 1531
786 Ga0207703_11112159 3300026035 Bacteria 759
787 Ga0207639_10193001 3300026041 Bacteria 1741
788 Ga0207639_10603402 3300026041 Bacteria 1012
789 Ga0207678_10140070 3300026067 Bacteria 2064
790 Ga0207678_10149473 3300026067 Bacteria 1994
791 Ga0207678_10526191 3300026067 Bacteria 1032
792 Ga0207678_10610587 3300026067 Bacteria 956
793 Ga0207708_10003860 3300026075 Bacteria 11028
794 Ga0207708_10031951 3300026075 Bacteria 3998
795 Ga0207708_10061192 3300026075 Unclassified 2874
796 Ga0207708_10104867 3300026075 Bacteria 2191
797 Ga0207708_10853132 3300026075 Bacteria 786
798 Ga0207641_10001737 3300026088 Bacteria 21033
799 Ga0207641_10012859 3300026088 Bacteria 6864
800 Ga0207641_10033218 3300026088 Bacteria 4287
801 Ga0207641_10328759 3300026088 Bacteria 1451
802 Ga0207641_10591142 3300026088 Bacteria 1086
803 Ga0207641_10688877 3300026088 Unclassified 1006
804 Ga0207641_10883811 3300026088 Bacteria 887
805 Ga0207648_10000406 3300026089 Bacteria 47912
806 Ga0207648_10001967 3300026089 Bacteria 22450
807 Ga0207648_10078570 3300026089 Bacteria 2879
808 Ga0207648_10504305 3300026089 Unclassified 1107
809 Ga0207648_10813938 3300026089 Unclassified 870
810 Ga0207648_11192386 3300026089 Unclassified 715
811 Ga0207676_10053072 3300026095 Unclassified 3172
812 Ga0207676_10090437 3300026095 Bacteria 2512
813 Ga0207676_10098634 3300026095 Bacteria 2416
814 Ga0207676_10102685 3300026095 Bacteria 2374
815 Ga0207676_10112249 3300026095 Bacteria 2283
816 Ga0207676_10231505 3300026095 Bacteria 1652
817 Ga0207676_10385286 3300026095 Bacteria 1306
818 Ga0207676_11266812 3300026095 Bacteria 732
819 Ga0207674_10021532 3300026116 Bacteria 6941
820 Ga0207674_10133016 3300026116 Bacteria 2450
821 Ga0207674_10323555 3300026116 Bacteria 1491
822 Ga0207675_100004384 3300026118 Bacteria 13641
823 Ga0207675_100005257 3300026118 Bacteria 12452
824 Ga0207675_100011559 3300026118 Bacteria 8254
825 Ga0207675_100088924 3300026118 Bacteria 2902
826 Ga0207675_100278461 3300026118 Bacteria 1625
827 Ga0207675_100369385 3300026118 Bacteria 1409
828 Ga0207675_100440432 3300026118 Bacteria 1290
829 Ga0207675_100672403 3300026118 Unclassified 1043
830 Ga0207683_10020732 3300026121 Bacteria 5624
831 Ga0207683_10026613 3300026121 Bacteria 4994
832 Ga0207683_10033110 3300026121 Bacteria 4489
833 Ga0207683_10049831 3300026121 Bacteria 3667
834 Ga0207683_10052214 3300026121 Unclassified 3582
835 Ga0207683_10083014 3300026121 Unclassified 2847
836 Ga0207683_10134784 3300026121 Bacteria 2223
837 Ga0207683_10141677 3300026121 Bacteria 2167
838 Ga0207683_10194589 3300026121 Bacteria 1842
839 Ga0207683_10347697 3300026121 Bacteria 1360
840 Ga0207683_10654751 3300026121 Bacteria 973
841 Ga0207698_10107111 3300026142 Bacteria 2333
842 Ga0207698_10240799 3300026142 Bacteria 1649
843 Ga0207698_10795415 3300026142 Bacteria 948
844 Ga0209995_1021268 3300027471 Unclassified 1075
845 Ga0209995_1021843 3300027471 Unclassified 1061
846 Ga0209968_1017417 3300027526 Bacteria 1146
847 Ga0207428_10004450 3300027907 Bacteria 13313
848 Ga0207428_10019879 3300027907 Bacteria 5719
849 Ga0207428_10056608 3300027907 Unclassified 3115
850 Ga0207428_10115662 3300027907 Unclassified 2060
851 Ga0207428_10217673 3300027907 Bacteria 1433
852 Ga0207428_10386187 3300027907 Bacteria 1026
853 Ga0268266_10026474 3300028379 Bacteria 4935
854 Ga0268266_10084162 3300028379 Unclassified 2777
855 Ga0268266_10339990 3300028379 Bacteria 1409
856 Ga0268266_10661553 3300028379 Bacteria 1006
857 Ga0268265_10225525 3300028380 Unclassified 1643
858 Ga0268265_10291426 3300028380 Unclassified 1465
859 Ga0268265_10326993 3300028380 Bacteria 1391
860 Ga0268265_10377243 3300028380 Unclassified 1303
861 Ga0268265_10544352 3300028380 Bacteria 1101
862 Ga0268265_10594225 3300028380 Unclassified 1057
863 Ga0268264_10002691 3300028381 Bacteria 15520
864 Ga0268264_10074468 3300028381 Bacteria 2884
865 Ga0268264_10362762 3300028381 Bacteria 1382
866 Ga0268264_10437228 3300028381 Bacteria 1265
867 Ga0268264_10525498 3300028381 Bacteria 1157
868 Ga0268264_10542218 3300028381 Bacteria 1140
869 Ga0268264_10907914 3300028381 Bacteria 884
870 Ga0268264_10913604 3300028381 Unclassified 881
871 Ga0307408_100154756 3300031548 Bacteria 1814
872 Ga0307408_100455000 3300031548 Bacteria 1111
873 Ga0307516_10407669 3300031730 Bacteria 1018
874 Ga0307405_10200528 3300031731 Unclassified 1449
875 Ga0307413_10063423 3300031824 Unclassified 2291
876 Ga0307410_10838689 3300031852 Unclassified 784
877 Ga0307406_10106255 3300031901 Unclassified 1923
878 Ga0307407_10070361 3300031903 Unclassified 2080
879 Ga0307407_10199389 3300031903 Bacteria 1340
880 Ga0307407_10259917 3300031903 Bacteria 1194
881 Ga0307409_100204253 3300031995 Unclassified 1770
882 Ga0307409_100545561 3300031995 Bacteria 1137
883 Ga0307409_101029004 3300031995 Bacteria 843
884 Ga0307409_101693629 3300031995 Bacteria 661
885 Ga0307416_100042027 3300032002 Bacteria 3565
886 Ga0307416_100752114 3300032002 Unclassified 1067
887 Ga0307416_101087484 3300032002 Bacteria 904
888 Ga0307416_101340545 3300032002 Unclassified 821
889 Ga0307414_10175792 3300032004 Bacteria 1717
890 Ga0307414_10768743 3300032004 Bacteria 877
891 Ga0307411_10103836 3300032005 Bacteria 2017
892 Ga0307411_10107278 3300032005 Bacteria 1990
893 Ga0307411_10295633 3300032005 Bacteria 1296
894 Ga0307411_11228603 3300032005 Unclassified 680
895 Ga0373930_0009710 3300034816 Unclassified 1707
896 Ga0373948_0054856 3300034817 Bacteria 864
897 Ga0373950_0038156 3300034818 Unclassified 911
898 Ga0373958_0000117 3300034819 Bacteria 8616
899 Ga0373958_0133263 3300034819 Bacteria 610
900 Ga0373938_0000089 3300034957 Bacteria 12374
901 Ga0373928_0114491 3300035084 Unclassified 717
902 Ga0373929_0000318 3300035085 Bacteria 8905
903 Ga0373934_0000231 3300035086 Bacteria 20333
904 Ga0373940_0000090 3300035088 Bacteria 10846
905 Ga0373949_0001074 3300035090 Bacteria 8350
906 Ga0373949_0022133 3300035090 Unclassified 1463
907 Ga0373951_0000324 3300035091 Bacteria 14868
908 Ga0373952_0000153 3300035092 Bacteria 10190
909 Ga0373923_0154539 3300035111 Unclassified 1044
910 Ga0373932_0000097 3300035112 Bacteria 23296
911 Ga0373932_0094743 3300035112 Unclassified 963
912 Ga0373932_0184376 3300035112 Unclassified 734
913 Ga0373939_0000186 3300035114 Bacteria 17245
914 Ga0373939_0041938 3300035114 Bacteria 1382
915 Ga0373945_0201557 3300035116 Unclassified 826
916 Ga0373953_0024611 3300035117 Archaea 2291
917 Ga0373953_0052976 3300035117 Unclassified 1643
918 Ga0373953_0122369 3300035117 Unclassified 1106
919 Ga0373956_0002311 3300035119 Bacteria 7844
920 Ga0373957_0002935 3300035120 Bacteria 4941
921 Ga0373960_0000411 3300035121 Bacteria 8397
922 Ga0373960_0236059 3300035121 Bacteria 659
923 Ga0373943_0008218 3300035170 Bacteria 4683
924 Ga0373946_0052851 3300035171 Unclassified 1705
925 Ga0373946_0136521 3300035171 Bacteria 1133
926 Ga0373955_0001686 3300035172 Bacteria 9447
927 Ga0373955_0600358 3300035172 Unclassified 674
928 Ga0373942_0123273 3300035207 Bacteria 812
929 Ga0373942_0205389 3300035207 Unclassified 655
930 Ga0373961_0004500 3300035241 Bacteria 3370
931 Ga0373961_0005962 3300035241 Bacteria 2927
932 Ga0373962_0000903 3300035242 Bacteria 6789
933 Ga0373962_0022498 3300035242 Bacteria 1672
934 Ga0373962_0054654 3300035242 Unclassified 1158
935 Ga0373924_0024094 3300035410 Unclassified 2395
936 Ga0373931_0000899 3300035691 Bacteria 12585
937 Ga0373931_0074711 3300035691 Bacteria 1857
938 Ga0373931_0177519 3300035691 Bacteria 1259
939 Ga0373935_0102755 3300035692 Unclassified 1886
940 Ga0373927_0058119 3300035695 Unclassified 2501
941 Ga0373933_0032115 3300035724 Bacteria 3050
942 Ga0373933_0067655 3300035724 Unclassified 2168
943 Ga0373947_0006250 3300035725 Bacteria 6925
944 Ga0373937_0000754 3300036401 Bacteria 27969
945 Ga0373937_0054986 3300036401 Bacteria 3653
946 Ga0373937_0207500 3300036401 Unclassified 1843
947 Ga0373937_0784497 3300036401 Unclassified 900
948 Ga0373937_0848123 3300036401 Bacteria 862
949 Ga0373937_1086821 3300036401 Unclassified 748
950 Ga0373925_0014515 3300037068 Bacteria 5694
951 Ga0373925_0317100 3300037068 Unclassified 1261
952 Ga0395900_0626532 3300037418 Bacteria 1014
953 Ga0395898_1434220 3300037466 Bacteria 617
954 Ga0436364_0766115 3300037853 Unclassified 1621
955 Ga0436365_0920024 3300039437 Bacteria 1573
956 Ga0436363_0770679 3300039450 Bacteria 1081
957 Ga0439453_0018744 3300041408 Bacteria 1226
958 Ga0450920_008136 3300042122 Bacteria 1913
959 Ga0450920_053990 3300042122 Bacteria 808
960 Ga0450923_033576 3300042125 Bacteria 1055
961 Ga0450923_072948 3300042125 Bacteria 763
962 Ga0450894_006397 3300042131 Bacteria 1519
963 Ga0450895_005024 3300042132 Bacteria 1058
964 Ga0450896_004202 3300042133 Bacteria 1948
965 Ga0450896_011157 3300042133 Bacteria 1263
966 Ga0450896_012559 3300042133 Bacteria 1199
967 Ga0450906_038422 3300042145 Bacteria 845
968 Ga0439458_0063582 3300042157 Bacteria 924
969 Ga0450908_008084 3300042184 Unclassified 1973
970 Ga0450908_038218 3300042184 Bacteria 832
971 Ga0450908_039236 3300042184 Bacteria 821
972 Ga0439434_0091513 3300042435 Unclassified 973
973 Ga0439435_0002337 3300042436 Unclassified 3744
974 Ga0439435_0022536 3300042436 Bacteria 1645
975 Ga0439435_0061092 3300042436 Bacteria 1098
976 Ga0439435_0116445 3300042436 Bacteria 833
977 Ga0439444_0088411 3300042437 Bacteria 688
978 Ga0439460_0048231 3300042461 Unclassified 1270
979 Ga0439460_0184487 3300042461 Unclassified 706
980 Ga0450918_067527 3300042531 Bacteria 668
981 Ga0451577_0064556 3300042876 Bacteria 3265
982 Ga0451576_0101356 3300045051 Bacteria 2994
983 Ga0451576_0639658 3300045051 Bacteria 1118
984 Ga0495592_0011747 3300046454 Bacteria 6633
985 Ga0495603_0244308 3300046455 Bacteria 1034
986 Ga0495603_0457422 3300046455 Bacteria 731
987 Ga0495629_0086549 3300046459 Bacteria 2186
988 Ga0495629_0207074 3300046459 Bacteria 1355
989 Ga0495638_0084454 3300046460 Bacteria 1921
990 Ga0495651_0171601 3300046462 Archaea 1544
991 Ga0495653_0327596 3300046463 Bacteria 991
992 Ga0495580_0126714 3300046472 Bacteria 1772
993 Ga0495582_0169544 3300046473 Bacteria 1243
994 Ga0495582_0195985 3300046473 Unclassified 1153
995 Ga0495664_0161975 3300046477 Unclassified 1357
996 Ga0495585_0402274 3300046492 Bacteria 659
997 Ga0495594_0210922 3300046499 Bacteria 1107
998 Ga0495608_0021077 3300046511 Bacteria 4476
999 Ga0495628_0008926 3300046516 Bacteria 8575
1000 Ga0495630_0014918 3300046517 Bacteria 5666
1001 Ga0495663_0172109 3300046525 Unclassified 747
1002 Ga0495642_0286678 3300046528 Bacteria 721
1003 Ga0495652_0061937 3300046529 Unclassified 3157
1004 Ga0495640_0229910 3300046533 Bacteria 1167
1005 Ga0495586_0041000 3300046535 Archaea 2493
1006 Ga0495586_0045676 3300046535 Bacteria 2361
1007 Ga0495587_0142413 3300046536 Bacteria 1368
1008 Ga0495598_0001701 3300046537 Bacteria 4413
1009 Ga0495598_0058503 3300046537 Bacteria 1182
1010 Ga0495621_0002944 3300046539 Bacteria 4640
1011 Ga0495621_0043534 3300046539 Bacteria 1584
1012 Ga0495645_0021246 3300046543 Unclassified 4690
1013 Ga0495645_0096591 3300046543 Bacteria 2105
1014 Ga0495667_0235338 3300046559 Bacteria 1167
1015 Ga0495656_0019412 3300046615 Unclassified 2624
1016 Ga0495635_0189583 3300046663 Unclassified 1396
1017 Ga0495659_0051572 3300046664 Bacteria 1499
1018 Ga0495659_0118879 3300046664 Unclassified 1039
1019 Ga0495659_0181957 3300046664 Bacteria 856
1020 Ga0495659_0221778 3300046664 Bacteria 781
1021 Ga0495657_0123357 3300046675 Unclassified 1630
1022 Ga0495647_0031369 3300046681 Unclassified 1976
1023 Ga0495658_0118485 3300046683 Bacteria 1599
1024 Ga0495669_0018284 3300046684 Bacteria 3012
1025 Ga0495669_0193953 3300046684 Bacteria 970
1026 Ga0495669_0349706 3300046684 Bacteria 714
1027 Ga0495613_0001137 3300046689 Bacteria 20241
1028 Ga0495613_0066686 3300046689 Bacteria 2628
1029 Ga0495613_0184772 3300046689 Bacteria 1475
1030 Ga0495670_0102190 3300046691 Bacteria 1477
1031 Ga0495670_0208711 3300046691 Unclassified 1036
1032 Ga0495600_0176397 3300046809 Unclassified 1378
1033 Ga0495600_0524723 3300046809 Unclassified 726
1034 Ga0495581_0062421 3300047315 Bacteria 2153
1035 Ga0495604_0019458 3300047317 Bacteria 5434
1036 Ga0495636_0140934 3300047318 Bacteria 1077
1037 Ga0495636_0251190 3300047318 Unclassified 818
1038 Ga0495674_0029085 3300047319 Bacteria 5034
1039 Ga0495684_0000105 3300047471 Bacteria 59779
1040 Ga0495684_0073898 3300047471 Bacteria 2590
1041 Ga0496100_0033152 3300048903 Bacteria 3230
1042 Ga0496101_0325812 3300048904 Unclassified 1205
1043 Ga0496101_0573680 3300048904 Bacteria 892
1044 Ga0496102_0029100 3300048905 Bacteria 4939
1045 Ga0496103_0034029 3300048906 Unclassified 3115
1046 Ga0496103_0547796 3300048906 Unclassified 739
1047 Ga0496104_0093682 3300048907 Unclassified 2873
1048 Ga0496104_0550687 3300048907 Unclassified 1064
1049 Ga0496106_0021008 3300048909 Bacteria 4846
1050 Ga0496106_0035262 3300048909 Bacteria 3741
1051 Ga0496106_0409201 3300048909 Unclassified 1090
1052 Ga0496106_0495610 3300048909 Bacteria 981
1053 Ga0496106_0646302 3300048909 Unclassified 845
1054 Ga0496106_0778122 3300048909 Bacteria 760
1055 Ga0496107_0035276 3300048910 Bacteria 3586
1056 Ga0496107_0504659 3300048910 Bacteria 897
1057 Ga0496108_0069842 3300048911 Unclassified 2964
1058 Ga0496108_0203464 3300048911 Bacteria 1718
1059 Ga0496108_0326893 3300048911 Bacteria 1337
1060 Ga0496108_0392625 3300048911 Unclassified 1212
1061 Ga0496109_0056691 3300048912 Unclassified 3575
1062 Ga0496109_0144174 3300048912 Bacteria 2228
1063 Ga0496109_0655800 3300048912 Bacteria 986
1064 Ga0496110_0046746 3300048913 Bacteria 3787
1065 Ga0496110_0176173 3300048913 Bacteria 1941
1066 Ga0496110_0271202 3300048913 Bacteria 1545
1067 Ga0496112_0013866 3300048915 Bacteria 7456
1068 Ga0496112_0109520 3300048915 Bacteria 2732
1069 Ga0496112_0247050 3300048915 Bacteria 1736
1070 Ga0496113_0058750 3300048916 Unclassified 2895
1071 Ga0496113_0906206 3300048916 Unclassified 697
1072 Ga0496114_0000887 3300048917 Bacteria 22393
1073 Ga0501031_0043361 3300049568 Bacteria 2936
1074 Ga0501031_0318724 3300049568 Unclassified 1007
1075 Ga0501033_0173114 3300049570 Unclassified 1550
1076 Ga0501033_0201880 3300049570 Bacteria 1420
1077 Ga0501034_0003394 3300049571 Bacteria 18190
1078 Ga0501034_0060409 3300049571 Bacteria 3807
1079 Ga0501034_0649303 3300049571 Bacteria 957
1080 Ga0501036_0018454 3300049572 Bacteria 5845
1081 Ga0501036_0078194 3300049572 Bacteria 2798
1082 Ga0501036_0198880 3300049572 Unclassified 1686
1083 Ga0501037_0481731 3300049573 Unclassified 843
1084 Ga0501038_0013628 3300049574 Bacteria 7409
1085 Ga0501039_0088951 3300049575 Bacteria 2406
1086 Ga0501039_0089117 3300049575 Unclassified 2404
1087 Ga0501040_0003805 3300049576 Bacteria 9788
1088 Ga0501040_0019113 3300049576 Unclassified 4555
1089 Ga0501040_0152674 3300049576 Bacteria 1630
1090 Ga0501040_0535024 3300049576 Unclassified 845
1091 Ga0501041_0004970 3300049577 Bacteria 7735
1092 Ga0501041_0024483 3300049577 Unclassified 3624
1093 Ga0501041_0097852 3300049577 Bacteria 1814
1094 Ga0501042_0096735 3300049578 Bacteria 2121
1095 Ga0501042_0119870 3300049578 Bacteria 1894
1096 Ga0501042_0177871 3300049578 Bacteria 1534
1097 Ga0501046_0033591 3300049580 Unclassified 4143
1098 Ga0501048_0016465 3300049582 Bacteria 5450
1099 Ga0501048_0019543 3300049582 Bacteria 4968
1100 Ga0501048_0070672 3300049582 Unclassified 2465
1101 Ga0501048_0960077 3300049582 Bacteria 615
1102 Ga0501068_0096185 3300049584 Unclassified 1832
1103 Ga0501069_0133777 3300049585 Bacteria 1421
1104 Ga0501069_0552900 3300049585 Unclassified 689
1105 Ga0501070_0140124 3300049586 Bacteria 1997
1106 Ga0501070_0434571 3300049586 Bacteria 1059
1107 Ga0501071_0046407 3300049587 Unclassified 3120
1108 Ga0501071_0060085 3300049587 Bacteria 2751
1109 Ga0501071_0477905 3300049587 Unclassified 955
1110 Ga0501072_0003526 3300049588 Bacteria 11778
1111 Ga0501072_0033073 3300049588 Bacteria 4051
1112 Ga0501072_0038115 3300049588 Unclassified 3772
1113 Ga0501072_0227476 3300049588 Bacteria 1486
1114 Ga0501073_0376668 3300049589 Unclassified 980
1115 Ga0501074_0117701 3300049590 Unclassified 1901
1116 Ga0501074_0155635 3300049590 Unclassified 1633
1117 Ga0501074_0209493 3300049590 Bacteria 1389
1118 Ga0501074_0469196 3300049590 Bacteria 892
1119 Ga0501075_0004400 3300049591 Bacteria 9538
1120 Ga0501075_0006633 3300049591 Bacteria 7979
1121 Ga0501075_0048129 3300049591 Unclassified 3204
1122 Ga0501076_0022830 3300049592 Bacteria 4813
1123 Ga0501076_0114745 3300049592 Unclassified 2180
1124 Ga0501076_0274613 3300049592 Bacteria 1380
1125 Ga0501076_0644805 3300049592 Bacteria 874
1126 Ga0501076_0742055 3300049592 Unclassified 810
1127 Ga0501079_0014210 3300049741 Bacteria 6070
1128 Ga0501079_0153402 3300049741 Unclassified 1795
1129 Ga0501079_0338486 3300049741 Unclassified 1178
1130 Ga0501079_0404527 3300049741 Bacteria 1071
1131 Ga0501080_0216326 3300049742 Unclassified 1755
1132 Ga0501080_0638270 3300049742 Bacteria 943
1133 Ga0501080_0908322 3300049742 Bacteria 767
1134 Ga0501081_0003870 3300049743 Bacteria 9592
1135 Ga0501081_0009942 3300049743 Bacteria 6200
1136 Ga0501081_0259969 3300049743 Unclassified 1268
1137 Ga0501081_0840136 3300049743 Unclassified 692
1138 Ga0501083_0380196 3300049744 Bacteria 918
1139 Ga0501035_0073918 3300049822 Bacteria 3016
1140 Ga0501045_0062184 3300049824 Unclassified 2739
1141 nmdc:mga03683_336904_c1 3300050489 Bacteria 712
1142 nmdc:mga03683_497279_c1 3300050489 Bacteria 590
1143 nmdc:mga00v17_193115_c1 3300050491 Unclassified 1315
1144 nmdc:mga00v17_201110_c1 3300050491 Unclassified 1288
1145 nmdc:mga00v17_64942_c1 3300050491 Bacteria 2250
1146 nmdc:mga0yw44_16689_c1 3300050492 Bacteria 3975
1147 nmdc:mga0k408_107010_c1 3300050493 Unclassified 1652
1148 nmdc:mga0k408_157931_c1 3300050493 Unclassified 1351
1149 nmdc:mga0k408_195362_c1 3300050493 Bacteria 1208
1150 nmdc:mga0k408_54160_c1 3300050493 Bacteria 2325
1151 nmdc:mga06z11_154619_c1 3300050494 Unclassified 1307
1152 nmdc:mga06z11_8215_c1 3300050494 Unclassified 4338
1153 nmdc:mga04h51_27808_c1 3300050495 Unclassified 1760
1154 nmdc:mga07m45_133040_c1 3300050496 Unclassified 1439
1155 nmdc:mga05p37_160587_c2 3300050507 Bacteria 2216
1156 nmdc:mga05p37_20943_c1 3300050507 Bacteria 7914
1157 nmdc:mga05p37_218066_c1 3300050507 Bacteria 2304
1158 nmdc:mga05p37_239289_c1 3300050507 Bacteria 2184
1159 nmdc:mga05p37_278947_c1 3300050507 Unclassified 1994
1160 nmdc:mga05p37_331674_c1 3300050507 Bacteria 1797
1161 nmdc:mga05p37_4230_c1 3300050507 Bacteria 16776
1162 nmdc:mga05p37_4956_c1 3300050507 Bacteria 15599
1163 nmdc:mga05p37_71906_c2 3300050507 Bacteria 2228
1164 nmdc:mga05p37_84334_c1 3300050507 Unclassified 3914
1165 nmdc:mga05p37_8475_c1 3300050507 Bacteria 12153
1166 nmdc:mga05p37_93066_c1 3300050507 Bacteria 3714
1167 nmdc:mga09592_102534_c1 3300050508 Bacteria 2451
1168 nmdc:mga09592_135426_c1 3300050508 Unclassified 2121
1169 nmdc:mga09592_15059_c1 3300050508 Bacteria 6317
1170 nmdc:mga09592_21999_c1 3300050508 Bacteria 5260
1171 nmdc:mga09592_258710_c1 3300050508 Bacteria 1509
1172 nmdc:mga09592_333234_c1 3300050508 Bacteria 1314
1173 nmdc:mga09592_507254_c1 3300050508 Unclassified 1038
1174 nmdc:mga0qj67_112279_c1 3300050509 Bacteria 2200
1175 nmdc:mga0qj67_12785_c1 3300050509 Bacteria 6330
1176 nmdc:mga0qj67_1798_c1 3300050509 Bacteria 15154
1177 nmdc:mga0qj67_29269_c1 3300050509 Bacteria 4278
1178 nmdc:mga0qj67_35802_c1 3300050509 Bacteria 3882
1179 nmdc:mga0qj67_388558_c1 3300050509 Bacteria 1126
1180 nmdc:mga0qj67_561113_c1 3300050509 Bacteria 915
1181 nmdc:mga0qj67_61694_c1 3300050509 Bacteria 2977
1182 nmdc:mga06r32_1049459_c1 3300050510 Unclassified 766
1183 nmdc:mga06r32_11945_c1 3300050510 Bacteria 7827
1184 nmdc:mga06r32_18018_c1 3300050510 Bacteria 6457
1185 nmdc:mga06r32_35149_c1 3300050510 Unclassified 4728
1186 nmdc:mga06r32_40341_c1 3300050510 Bacteria 4431
1187 nmdc:mga06r32_5033_c1 3300050510 Bacteria 11900
1188 nmdc:mga06r32_57791_c1 3300050510 Bacteria 3727
1189 nmdc:mga08y16_1002_c1 3300050511 Bacteria 27593
1190 nmdc:mga08y16_1056393_c1 3300050511 Unclassified 789
1191 nmdc:mga08y16_12963_c1 3300050511 Bacteria 8772
1192 nmdc:mga08y16_1534_c1 3300050511 Bacteria 23216
1193 nmdc:mga08y16_161581_c1 3300050511 Bacteria 2328
1194 nmdc:mga08y16_17700_c1 3300050511 Bacteria 7506
1195 nmdc:mga08y16_336218_c1 3300050511 Bacteria 1553
1196 nmdc:mga08y16_350609_c1 3300050511 Bacteria 1516
1197 nmdc:mga08y16_550157_c1 3300050511 Bacteria 1168
1198 nmdc:mga08y16_621923_c1 3300050511 Bacteria 1087
1199 nmdc:mga08y16_7021_c1 3300050511 Bacteria 11815
1200 nmdc:mga0n895_1493399_c1 3300050512 Unclassified 642
1201 nmdc:mga0n895_233435_c1 3300050512 Bacteria 1867
1202 nmdc:mga0n895_304814_c1 3300050512 Unclassified 1615
1203 nmdc:mga0n895_309808_c1 3300050512 Bacteria 1600
1204 nmdc:mga0n895_34611_c1 3300050512 Bacteria 4864
1205 nmdc:mga0n895_3785_c1 3300050512 Bacteria 12250
1206 nmdc:mga0n895_433836_c1 3300050512 Bacteria 1327
1207 nmdc:mga0rr50_10335_c1 3300050513 Bacteria 5919
1208 nmdc:mga0rr50_113145_c1 3300050513 Unclassified 2150
1209 nmdc:mga0rr50_213337_c1 3300050513 Bacteria 1591
1210 nmdc:mga0rr50_213811_c1 3300050513 Bacteria 1590
1211 nmdc:mga0rr50_22427_c1 3300050513 Bacteria 4334
1212 nmdc:mga0rr50_65488_c1 3300050513 Unclassified 2753
1213 nmdc:mga08x19_122027_c1 3300050514 Bacteria 1748
1214 nmdc:mga08x19_12915_c1 3300050514 Bacteria 5040
1215 nmdc:mga08x19_133278_c1 3300050514 Bacteria 1673
1216 nmdc:mga08x19_611222_c1 3300050514 Bacteria 773
1217 nmdc:mga08x19_67103_c1 3300050514 Bacteria 2333
1218 nmdc:mga0a205_141176_c1 3300050515 Bacteria 2309
1219 nmdc:mga0a205_161219_c1 3300050515 Unclassified 2139
1220 nmdc:mga0a205_174004_c1 3300050515 Bacteria 2048
1221 nmdc:mga0a205_321062_c1 3300050515 Unclassified 1419
1222 nmdc:mga0a205_323190_c1 3300050515 Bacteria 1414
1223 nmdc:mga0a205_5382_c1 3300050515 Bacteria 11543
1224 nmdc:mga0a205_658155_c1 3300050515 Bacteria 899
1225 nmdc:mga0a205_71331_c1 3300050515 Bacteria 3355
1226 Ga0495601_0001335 3300053077 Bacteria 13555
1227 Ga0495601_0030327 3300053077 Unclassified 3357
1228 Ga0495595_0204153 3300053084 Unclassified 984
1229 Ga0495595_0304173 3300053084 Unclassified 802
1230 Ga0495595_0442846 3300053084 Bacteria 660
1231 Ga0495619_0011070 3300053085 Bacteria 5674
1232 Ga0500592_001337 3300053116 Bacteria 4003
1233 Ga0500611_128845 3300053727 Bacteria 680
1234 Ga0501084_0005602 3300054114 Bacteria 10312
1235 Ga0501084_0075798 3300054114 Unclassified 2818
1236 Ga0501084_0193662 3300054114 Bacteria 1715
1237 Ga0501084_0710348 3300054114 Unclassified 848
1238 Ga0590071_000058 3300059421 Bacteria 29618
1239 Ga0590075_000441 3300059424 Bacteria 11222
1240 Ga0590077_000552 3300059426 Bacteria 10343
1241 Ga0501082_0117082 3300060353 Bacteria 2308
1242 Ga0501082_0240714 3300060353 Bacteria 1575
1243 Ga0501082_1356668 3300060353 Unclassified 621
1244 Ga0530510_0038717 3300061734 Unclassified 3443
1245 Ga0530510_0073268 3300061734 Bacteria 2486
1246 Ga0207708_10986374
1247 JGI24743J22301_10041785
1248 Ga0065712_10001425
1249 Ga0065712_10001466
1250 Ga0065712_10087531
1251 Ga0065712_10120804
1252 Ga0065712_10199682
1253 Ga0065712_10228392
1254 Ga0065712_10265115
1255 Ga0065715_10004672
1256 Ga0065715_10014152
1257 Ga0065715_10034745
1258 Ga0065715_10100094
1259 Ga0065715_10156913
1260 Ga0065715_10401699
1261 Ga0065707_10092711
1262 Ga0065707_10142124
1263 Ga0070658_10175669
1264 Ga0070676_10017287
1265 Ga0070676_10060969
1266 Ga0070676_10163335
1267 Ga0070683_100033184
1268 Ga0070690_100008400
1269 Ga0070690_100008723
1270 Ga0070690_100057885
1271 Ga0070690_100100381
1272 Ga0070690_100123056
1273 Ga0070690_100127327
1274 Ga0070670_100002235
1275 Ga0070670_100008786
1276 Ga0070670_100043002
1277 Ga0070670_100064058
1278 Ga0070670_100171175
1279 Ga0070670_100589823
1280 Ga0070677_10000772
1281 Ga0070677_10006220
1282 Ga0070677_10013563
1283 Ga0070677_10017008
1284 Ga0070677_10080690
1285 Ga0070677_10207619
1286 Ga0070677_10237691
1287 Ga0068869_100011211
1288 Ga0068869_100014741
1289 Ga0068869_100073561
1290 Ga0068869_100487949
1291 Ga0068869_100630795
1292 Ga0068869_100761597
1293 Ga0068869_100820566
1294 Ga0070666_10007972
1295 Ga0070666_10014705
1296 Ga0070666_10024305
1297 Ga0070666_10031837
1298 Ga0070666_10174796
1299 Ga0070680_100173954
1300 Ga0070680_100311822
1301 Ga0070682_100480798
1302 Ga0068868_100011691
1303 Ga0068868_100046177
1304 Ga0068868_100088896
1305 Ga0068868_100563628
1306 Ga0068868_100672500
1307 Ga0068868_101044871
1308 Ga0070660_100589037
1309 Ga0070689_100051305
1310 Ga0070689_100093153
1311 Ga0070689_100269108
1312 Ga0070689_100277490
1313 Ga0070689_100452667
1314 Ga0070689_100830268
1315 Ga0070691_10016828
1316 Ga0070687_100017374
1317 Ga0070687_100018319
1318 Ga0070687_100021683
1319 Ga0070687_100075765
1320 Ga0070687_100148634
1321 Ga0070687_100550856
1322 Ga0070687_100659143
1323 Ga0070661_100052734
1324 Ga0070661_100251344
1325 Ga0070661_100562919
1326 Ga0070692_10079946
1327 Ga0070692_10088347
1328 Ga0070668_100010474
1329 Ga0070668_100123145
1330 Ga0070669_100001320
1331 Ga0070669_100005676
1332 Ga0070669_100059354
1333 Ga0070669_100059574
1334 Ga0070669_100063968
1335 Ga0070669_100067143
1336 Ga0070669_100149514
1337 Ga0070669_100365976
1338 Ga0070669_100441568
1339 Ga0070675_100000041
1340 Ga0070675_100000966
1341 Ga0070675_100001113
1342 Ga0070675_100019768
1343 Ga0070675_100020745
1344 Ga0070675_100025710
1345 Ga0070675_100065265
1346 Ga0070675_100084896
1347 Ga0070675_100096968
1348 Ga0070675_100106727
1349 Ga0070675_100117366
1350 Ga0070675_100221643
1351 Ga0070675_100295681
1352 Ga0070675_100701092
1353 Ga0070671_100010422
1354 Ga0070671_100013948
1355 Ga0070671_100077256
1356 Ga0070671_100082788
1357 Ga0070671_100123745
1358 Ga0070671_100183739
1359 Ga0070671_100318102
1360 Ga0070671_100592848
1361 Ga0070671_100599072
1362 Ga0070674_100000975
1363 Ga0070674_100029900
1364 Ga0070674_100073012
1365 Ga0070674_100159651
1366 Ga0070674_100201967
1367 Ga0070674_100672365
1368 Ga0070673_100003896
1369 Ga0070673_100013593
1370 Ga0070673_100048023
1371 Ga0070673_100058958
1372 Ga0070673_100098402
1373 Ga0070673_100204355
1374 Ga0070673_100221736
1375 Ga0070673_100813635
1376 Ga0070673_100842139
1377 Ga0070688_100018439
1378 Ga0070688_100021110
1379 Ga0070688_100105490
1380 Ga0070688_100113673
1381 Ga0070688_100128879
1382 Ga0070688_100764148
1383 Ga0070659_100135027
1384 Ga0070659_100139449
1385 Ga0070659_100149279
1386 Ga0070659_100239826
1387 Ga0070659_100347749
1388 Ga0070667_100001662
1389 Ga0070667_100042990
1390 Ga0070667_100190019
1391 Ga0070667_100323262
1392 Ga0070709_10148887
1393 Ga0070709_10406301
1394 Ga0070714_100396568
1395 Ga0070713_100076553
1396 Ga0070713_100337680
1397 Ga0070701_10009195
1398 Ga0070701_10017328
1399 Ga0070701_10118491
1400 Ga0070701_10198865
1401 Ga0070701_10548991
1402 Ga0070701_10782801
1403 Ga0070711_100082815
1404 Ga0070705_100066205
1405 Ga0070705_100101948
1406 Ga0070705_100364958
1407 Ga0070700_100002881
1408 Ga0070700_100110496
1409 Ga0070700_100280714
1410 Ga0070700_100296829
1411 Ga0070694_100037022
1412 Ga0070694_100044691
1413 Ga0070694_100283238
1414 Ga0070694_100488482
1415 Ga0070708_100011343
1416 Ga0070708_100266125
1417 Ga0070663_100315008
1418 Ga0070678_100012647
1419 Ga0070678_100032193
1420 Ga0070678_100080804
1421 Ga0070678_100103734
1422 Ga0070678_100106421
1423 Ga0070678_100336324
1424 Ga0070678_100360914
1425 Ga0070662_100068747
1426 Ga0070662_100092723
1427 Ga0070662_100151407
1428 Ga0070662_100160132
1429 Ga0070662_100342683
1430 Ga0070662_100751315
1431 Ga0070681_10002773
1432 Ga0070681_10128282
1433 Ga0070681_10836785
1434 Ga0068867_100016445
1435 Ga0068867_100027611
1436 Ga0068867_100037310
1437 Ga0068867_100158324
1438 Ga0068867_100593721
1439 Ga0068867_100839927
1440 Ga0070685_10015539
1441 Ga0070685_10062897
1442 Ga0070685_10087931
1443 Ga0070685_10139490
1444 Ga0070685_10348447
1445 Ga0070706_100310608
1446 Ga0070706_100453027
1447 Ga0070707_100067781
1448 Ga0070707_100125281
1449 Ga0070707_100130192
1450 Ga0070698_100063259
1451 Ga0070699_100065554
1452 Ga0070699_100082331
1453 Ga0070699_100191586
1454 Ga0070699_100267360
1455 Ga0070699_100319368
1456 Ga0070699_100528942
1457 Ga0070679_100278150
1458 Ga0070684_100122026
1459 Ga0070684_100432528
1460 Ga0070697_100582902
1461 Ga0070697_100657686
1462 Ga0068853_100139726
1463 Ga0068853_100520562
1464 Ga0070672_100010398
1465 Ga0070672_100040103
1466 Ga0070672_100095539
1467 Ga0070672_100120595
1468 Ga0070672_100169190
1469 Ga0070672_100174422
1470 Ga0070672_100213634
1471 Ga0070672_100276157
1472 Ga0070672_100480868
1473 Ga0070686_100024364
1474 Ga0070686_100028194
1475 Ga0070686_100051088
1476 Ga0070686_100209760
1477 Ga0070686_100332216
1478 Ga0070686_100341679
1479 Ga0070686_100369605
1480 Ga0070695_100052916
1481 Ga0070695_100094419
1482 Ga0070695_100763016
1483 Ga0070695_100815177
1484 Ga0070696_100019995
1485 Ga0070696_100612907
1486 Ga0070693_100247540
1487 Ga0070665_100018260
1488 Ga0070665_100105660
1489 Ga0070665_100150467
1490 Ga0070665_100238302
1491 Ga0070704_100004428
1492 Ga0070704_100020336
1493 Ga0070704_100099608
1494 Ga0070704_100566205
1495 Ga0070704_101086892
1496 Ga0068855_100136660
1497 Ga0070664_100038559
1498 Ga0070664_100080800
1499 Ga0070664_100152348
1500 Ga0070664_100157706
1501 Ga0070664_100400368
1502 Ga0070664_100622455
1503 Ga0070664_100944925
1504 Ga0068857_100073910
1505 Ga0068857_100185274
1506 Ga0068854_100001952
1507 Ga0068854_100009138
1508 Ga0068854_100181412
1509 Ga0068854_100238424
1510 Ga0070702_100029033
1511 Ga0070702_100031150
1512 Ga0070702_100114318
1513 Ga0070702_100117379
1514 Ga0070702_100159646
1515 Ga0070702_100985880
1516 Ga0068852_100014483
1517 Ga0068852_100645653
1518 Ga0068852_100840973
1519 Ga0068859_100001994
1520 Ga0068859_100014294
1521 Ga0068859_100060044
1522 Ga0068859_100090633
1523 Ga0068859_100090833
1524 Ga0068859_100094523
1525 Ga0068859_100240129
1526 Ga0068859_100431179
1527 Ga0068859_100453087
1528 Ga0068859_100527499
1529 Ga0068859_100618922
1530 Ga0068859_100991028
1531 Ga0068859_101137338
1532 Ga0068859_101510468
1533 Ga0068864_100028317
1534 Ga0068864_100035116
1535 Ga0068864_100045694
1536 Ga0068864_100097777
1537 Ga0068864_100111429
1538 Ga0068864_100165513
1539 Ga0068864_100339027
1540 Ga0068864_100560066
1541 Ga0068864_100778261
1542 Ga0068866_10009040
1543 Ga0068866_10197045
1544 Ga0068861_100013994
1545 Ga0068861_100044224
1546 Ga0068861_100228247
1547 Ga0068861_100261639
1548 Ga0068861_100373319
1549 Ga0068861_100535858
1550 Ga0068861_100652814
1551 Ga0068861_101252054
1552 Ga0068861_101352461
1553 Ga0068861_101399310
1554 Ga0068870_10073291
1555 Ga0068870_10099776
1556 Ga0068870_10099790
1557 Ga0068870_10185190
1558 Ga0068870_10454214
1559 Ga0068863_100000686
1560 Ga0068863_100030370
1561 Ga0068863_100047497
1562 Ga0068863_100089746
1563 Ga0068863_100190317
1564 Ga0068863_100579113
1565 Ga0068863_100644068
1566 Ga0068863_100820425
1567 Ga0068858_100009448
1568 Ga0068858_100011524
1569 Ga0068858_100106449
1570 Ga0068858_100211026
1571 Ga0068858_100539005
1572 Ga0068858_100940366
1573 Ga0068860_100073558
1574 Ga0068860_100183305
1575 Ga0068860_100189619
1576 Ga0068860_100240083
1577 Ga0068860_100381527
1578 Ga0068862_100003841
1579 Ga0068862_100034545
1580 Ga0068862_100047450
1581 Ga0068862_100096158
1582 Ga0068862_100231417
1583 Ga0068862_100432253
1584 Ga0068862_100726390
1585 Ga0068862_101471782
1586 Ga0081455_10049924
1587 Ga0081455_10167809
1588 Ga0070717_10175180
1589 Ga0075365_10000686
1590 Ga0075365_10124605
1591 Ga0075368_10176244
1592 Ga0075363_100072433
1593 Ga0075364_10071890
1594 Ga0075364_10122807
1595 Ga0075364_10328804
1596 Ga0075432_10052427
1597 Ga0070715_10022043
1598 Ga0070716_100042763
1599 Ga0075362_10295589
1600 Ga0075367_10123584
1601 Ga0075366_10031369
1602 Ga0075366_10050323
1603 Ga0075366_10052416
1604 Ga0075366_10135602
1605 Ga0075366_10210083
1606 Ga0097621_100001726
1607 Ga0097621_100004004
1608 Ga0097621_100015342
1609 Ga0097621_100121588
1610 Ga0097621_100179045
1611 Ga0097621_100239490
1612 Ga0097621_100250825
1613 Ga0097621_100588768
1614 Ga0075370_10044219
1615 Ga0075370_10063181
1616 Ga0068871_100025709
1617 Ga0068871_100033333
1618 Ga0068871_100035150
1619 Ga0068871_100088656
1620 Ga0068871_100169841
1621 Ga0068871_100358602
1622 Ga0068871_100383587
1623 Ga0068871_100450951
1624 Ga0068871_100539255
1625 Ga0068871_100640983
1626 Ga0075428_100001137
1627 Ga0075428_100008320
1628 Ga0075428_100033183
1629 Ga0075428_100145716
1630 Ga0075428_100331019
1631 Ga0075428_100459578
1632 Ga0075428_100579289
1633 Ga0075430_100058650
1634 Ga0075430_100142674
1635 Ga0075430_100215907
1636 Ga0075430_100245059
1637 Ga0075430_100266751
1638 Ga0075431_100000264
1639 Ga0075431_100002177
1640 Ga0075431_100023284
1641 Ga0075431_100044213
1642 Ga0075431_100069929
1643 Ga0075431_100071962
1644 Ga0075431_101082462
1645 Ga0075431_101174703
1646 Ga0075433_10001958
1647 Ga0075433_10055579
1648 Ga0075433_10083029
1649 Ga0075433_10105734
1650 Ga0075433_10123040
1651 Ga0075433_10175406
1652 Ga0075434_100010137
1653 Ga0075434_100065503
1654 Ga0075434_100145562
1655 Ga0075434_100167944
1656 Ga0075434_100320579
1657 Ga0075434_100385311
1658 Ga0075429_100002904
1659 Ga0075429_100003455
1660 Ga0075429_100006362
1661 Ga0075429_100073377
1662 Ga0075429_100080189
1663 Ga0075429_100587332
1664 Ga0075429_100718273
1665 Ga0075429_100980044
1666 Ga0068865_100026156
1667 Ga0068865_100031202
1668 Ga0068865_100036436
1669 Ga0068865_100148678
1670 Ga0068865_100332304
1671 Ga0068865_100400066
1672 Ga0068865_100681097
1673 Ga0068865_100830437
1674 Ga0075436_100015708
1675 Ga0075436_100023330
1676 Ga0075436_100028798
1677 Ga0075436_100415496
1678 Ga0097620_100001994
1679 Ga0097620_100014294
1680 Ga0097620_100060046
1681 Ga0097620_100090629
1682 Ga0097620_100090831
1683 Ga0097620_100094523
1684 Ga0097620_100240141
1685 Ga0097620_100431177
1686 Ga0097620_100453104
1687 Ga0097620_100527475
1688 Ga0097620_100618863
1689 Ga0097620_100991106
1690 Ga0097620_101137318
1691 Ga0097620_101510774
1692 Ga0075435_100000143
1693 Ga0075435_100026041
1694 Ga0075435_100032672
1695 Ga0075435_100043385
1696 Ga0075435_100085897
1697 Ga0075435_100108419
1698 Ga0075435_100488442
1699 Ga0105240_10032751
1700 Ga0105240_10176047
1701 Ga0105240_11031045
1702 Ga0105240_11379699
1703 Ga0111539_10000863
1704 Ga0111539_10001510
1705 Ga0111539_10001878
1706 Ga0111539_10002502
1707 Ga0111539_10019477
1708 Ga0111539_10024974
1709 Ga0111539_10138605
1710 Ga0111539_10139310
1711 Ga0111539_10277731
1712 Ga0111539_10302208
1713 Ga0111539_10406134
1714 Ga0111539_10620462
1715 Ga0111539_10826383
1716 Ga0105245_10045126
1717 Ga0105245_10444429
1718 Ga0114129_10004403
1719 Ga0114129_10006326
1720 Ga0114129_10017377
1721 Ga0114129_10018860
1722 Ga0114129_10024344
1723 Ga0114129_10074952
1724 Ga0114129_10077917
1725 Ga0114129_10090318
1726 Ga0114129_10119362
1727 Ga0114129_10141331
1728 Ga0114129_10165241
1729 Ga0114129_10192062
1730 Ga0114129_11616100
1731 Ga0105243_10016838
1732 Ga0105243_10069469
1733 Ga0105243_10374135
1734 Ga0105243_11085762
1735 Ga0105243_11086379
1736 Ga0105243_11812897
1737 Ga0105241_10043620
1738 Ga0105242_10009992
1739 Ga0105242_10041319
1740 Ga0105242_10054914
1741 Ga0105248_10000243
1742 Ga0105248_10017073
1743 Ga0105248_10025998
1744 Ga0105248_10046378
1745 Ga0105248_10056375
1746 Ga0105248_10136884
1747 Ga0105248_10220619
1748 Ga0105248_10250745
1749 Ga0105248_10458448
1750 Ga0105248_10676764
1751 Ga0105248_10862059
1752 Ga0105248_11170598
1753 Ga0105237_10877910
1754 Ga0105238_10010542
1755 Ga0105238_10208692
1756 Ga0105249_10009614
1757 Ga0105249_10092474
1758 Ga0105249_10178588
1759 Ga0105249_11675024
1760 Ga0105239_10135613
1761 Ga0105239_11115625
1762 Ga0105246_10226429
1763 Ga0105246_10345440
1764 Ga0157371_10247019
1765 Ga0157370_10079849
1766 Ga0157370_10320138
1767 Ga0157369_10496811
1768 Ga0157369_10513350
1769 Ga0157374_10113917
1770 Ga0157374_10254045
1771 Ga0157378_10023312
1772 Ga0157378_10151836
1773 Ga0157378_10191924
1774 Ga0157378_10252980
1775 Ga0157378_10293176
1776 Ga0163162_10005885
1777 Ga0163162_10032921
1778 Ga0163162_10056136
1779 Ga0163162_10431291
1780 Ga0163162_10445013
1781 Ga0157375_10000157
1782 Ga0157375_10005598
1783 Ga0157375_10042515
1784 Ga0157375_10075376
1785 Ga0157375_10082389
1786 Ga0157375_10197476
1787 Ga0157375_10209186
1788 Ga0157375_10247575
1789 Ga0157375_10416127
1790 Ga0157375_10449231
1791 Ga0157375_10555034
1792 Ga0157375_10712990
1793 Ga0157375_11114325
1794 Ga0157375_12202309
1795 Ga0163163_10001712
1796 Ga0163163_10022232
1797 Ga0163163_10242089
1798 Ga0163163_10254285
1799 Ga0163163_10891453
1800 Ga0163163_10937332
1801 Ga0157380_10000377
1802 Ga0157380_10012562
1803 Ga0157380_10032399
1804 Ga0157380_10103717
1805 Ga0157380_10109354
1806 Ga0157380_10286362
1807 Ga0157380_10462442
1808 Ga0157380_10549810
1809 Ga0157380_10565719
1810 Ga0157377_10016508
1811 Ga0157377_10017173
1812 Ga0157377_10022871
1813 Ga0157377_10033863
1814 Ga0157377_10055345
1815 Ga0157377_10514667
1816 Ga0157379_10000094
1817 Ga0157379_10045095
1818 Ga0157376_10070534
1819 Ga0157376_10133088
1820 Ga0157376_10199253
1821 Ga0157376_10205636
1822 Ga0157376_10231921
1823 Ga0157376_10351615
1824 Ga0157376_10472887
1825 Ga0163161_10067595
1826 Ga0163161_10112660
1827 Ga0163161_10305829
1828 Ga0163161_10931516
1829 Ga0163161_11090587
1830 Ga0206349_1746695
1831 Ga0206352_10238537
1832 Ga0206350_10890321
1833 Ga0206350_11229116
1834 Ga0224712_10048712
1835 Ga0207697_10002446
1836 Ga0207697_10053017
1837 Ga0207656_10013876
1838 Ga0207656_10269448
1839 Ga0207682_10005509
1840 Ga0207682_10008532
1841 Ga0207682_10028997
1842 Ga0207682_10168593
1843 Ga0207642_10173157
1844 Ga0207642_10197180
1845 Ga0207688_10002119
1846 Ga0207688_10015491
1847 Ga0207688_10017988
1848 Ga0207688_10044651
1849 Ga0207688_10205537
1850 Ga0207688_10223183
1851 Ga0207680_10006504
1852 Ga0207680_10041886
1853 Ga0207680_10155353
1854 Ga0207680_10224199
1855 Ga0207680_10330322
1856 Ga0207647_10083612
1857 Ga0207699_10324886
1858 Ga0207645_10006284
1859 Ga0207645_10015758
1860 Ga0207645_10018352
1861 Ga0207645_10265510
1862 Ga0207645_10282600
1863 Ga0207643_10000504
1864 Ga0207643_10023869
1865 Ga0207643_10025171
1866 Ga0207643_10050749
1867 Ga0207684_10380105
1868 Ga0207707_10292363
1869 Ga0207695_10246300
1870 Ga0207695_10344338
1871 Ga0207695_10592310
1872 Ga0207663_10150774
1873 Ga0207660_10247083
1874 Ga0207660_10513884
1875 Ga0207660_10748610
1876 Ga0207662_10003633
1877 Ga0207662_10003706
1878 Ga0207662_10007609
1879 Ga0207662_10034337
1880 Ga0207662_10072941
1881 Ga0207662_10155479
1882 Ga0207662_10174296
1883 Ga0207662_10215120
1884 Ga0207662_10491530
1885 Ga0207657_10189724
1886 Ga0207657_10973590
1887 Ga0207649_10048813
1888 Ga0207649_10174251
1889 Ga0207649_10181047
1890 Ga0207652_10539812
1891 Ga0207652_10666928
1892 Ga0207646_10066022
1893 Ga0207646_10410902
1894 Ga0207681_10012475
1895 Ga0207681_10020425
1896 Ga0207681_10029586
1897 Ga0207681_10044289
1898 Ga0207681_10433839
1899 Ga0207681_10573517
1900 Ga0207694_10049833
1901 Ga0207650_10002282
1902 Ga0207650_10012158
1903 Ga0207650_10029076
1904 Ga0207650_10043144
1905 Ga0207650_10139685
1906 Ga0207650_10472166
1907 Ga0207650_10481983
1908 Ga0207650_10509787
1909 Ga0207659_10000562
1910 Ga0207659_10001703
1911 Ga0207659_10003966
1912 Ga0207659_10008601
1913 Ga0207659_10008609
1914 Ga0207659_10012648
1915 Ga0207659_10025134
1916 Ga0207659_10027948
1917 Ga0207659_10119951
1918 Ga0207659_10131825
1919 Ga0207659_10230165
1920 Ga0207659_11123158
1921 Ga0207687_10127827
1922 Ga0207700_10010397
1923 Ga0207664_10207856
1924 Ga0207644_10017499
1925 Ga0207644_10038073
1926 Ga0207644_10041886
1927 Ga0207644_10060165
1928 Ga0207644_10169812
1929 Ga0207690_10282167
1930 Ga0207690_10347892
1931 Ga0207690_11080708
1932 Ga0207706_10001744
1933 Ga0207706_10011372
1934 Ga0207706_10019140
1935 Ga0207706_10087453
1936 Ga0207706_10187264
1937 Ga0207706_10257004
1938 Ga0207706_10311570
1939 Ga0207686_10013110
1940 Ga0207686_10031969
1941 Ga0207709_10043504
1942 Ga0207709_10190881
1943 Ga0207670_10053120
1944 Ga0207670_10058305
1945 Ga0207670_10121597
1946 Ga0207670_10214103
1947 Ga0207670_10300615
1948 Ga0207669_10000046
1949 Ga0207669_10005417
1950 Ga0207669_10079882
1951 Ga0207669_10093496
1952 Ga0207669_10751398
1953 Ga0207669_10898358
1954 Ga0207704_10016619
1955 Ga0207704_10036752
1956 Ga0207704_10065346
1957 Ga0207704_10655021
1958 Ga0207704_11074798
1959 Ga0207665_10114638
1960 Ga0207691_10001339
1961 Ga0207691_10005966
1962 Ga0207691_10016966
1963 Ga0207691_10024791
1964 Ga0207691_10051009
1965 Ga0207691_10067575
1966 Ga0207691_10088911
1967 Ga0207691_10089175
1968 Ga0207691_10099770
1969 Ga0207691_10152862
1970 Ga0207691_10185243
1971 Ga0207691_10229627
1972 Ga0207691_10562834
1973 Ga0207691_10620048
1974 Ga0207691_10621913
1975 Ga0207711_10000570
1976 Ga0207711_10026483
1977 Ga0207711_10044603
1978 Ga0207711_10048405
1979 Ga0207711_10146429
1980 Ga0207711_10148090
1981 Ga0207711_10372205
1982 Ga0207711_10417248
1983 Ga0207711_11017775
1984 Ga0207711_11065547
1985 Ga0207689_10002152
1986 Ga0207689_10007933
1987 Ga0207689_10072939
1988 Ga0207689_10078527
1989 Ga0207689_10267269
1990 Ga0207689_10284241
1991 Ga0207689_10711130
1992 Ga0207661_10081711
1993 Ga0207679_10027338
1994 Ga0207679_10038212
1995 Ga0207679_10084256
1996 Ga0207679_10171446
1997 Ga0207679_10307373
1998 Ga0207679_10315704
1999 Ga0207679_10455285
2000 Ga0207679_10653057
2001 Ga0207667_10156356
2002 Ga0207651_10002765
2003 Ga0207651_10004530
2004 Ga0207651_10008951
2005 Ga0207651_10069210
2006 Ga0207651_10103548
2007 Ga0207651_10477790
2008 Ga0207651_10764184
2009 Ga0207712_10005227
2010 Ga0207712_10308001
2011 Ga0207712_10402510
2012 Ga0207712_10652384
2013 Ga0207668_10224120
2014 Ga0207668_10710976
2015 Ga0207668_11242802
2016 Ga0207640_10632464
2017 Ga0207640_11442012
2018 Ga0207658_10001809
2019 Ga0207658_10004182
2020 Ga0207658_10019015
2021 Ga0207658_10046295
2022 Ga0207658_10177695
2023 Ga0207658_10602860
2024 Ga0207677_10024856
2025 Ga0207677_10178254
2026 Ga0207677_10317732
2027 Ga0207677_10540729
2028 Ga0207677_10548257
2029 Ga0207703_10021318
2030 Ga0207703_10273489
2031 Ga0207703_11112159
2032 Ga0207639_10193001
2033 Ga0207639_10603402
2034 Ga0207678_10140070
2035 Ga0207678_10149473
2036 Ga0207678_10526191
2037 Ga0207678_10610587
2038 Ga0207708_10003860
2039 Ga0207708_10031951
2040 Ga0207708_10061192
2041 Ga0207708_10104867
2042 Ga0207708_10853132
2043 Ga0207641_10001737
2044 Ga0207641_10012859
2045 Ga0207641_10033218
2046 Ga0207641_10328759
2047 Ga0207641_10591142
2048 Ga0207641_10688877
2049 Ga0207641_10883811
2050 Ga0207648_10000406
2051 Ga0207648_10001967
2052 Ga0207648_10078570
2053 Ga0207648_10504305
2054 Ga0207648_10813938
2055 Ga0207648_11192386
2056 Ga0207676_10053072
2057 Ga0207676_10090437
2058 Ga0207676_10098634
2059 Ga0207676_10102685
2060 Ga0207676_10112249
2061 Ga0207676_10231505
2062 Ga0207676_10385286
2063 Ga0207676_11266812
2064 Ga0207674_10021532
2065 Ga0207674_10133016
2066 Ga0207674_10323555
2067 Ga0207675_100004384
2068 Ga0207675_100005257
2069 Ga0207675_100011559
2070 Ga0207675_100088924
2071 Ga0207675_100278461
2072 Ga0207675_100369385
2073 Ga0207675_100440432
2074 Ga0207675_100672403
2075 Ga0207683_10020732
2076 Ga0207683_10026613
2077 Ga0207683_10033110
2078 Ga0207683_10049831
2079 Ga0207683_10052214
2080 Ga0207683_10083014
2081 Ga0207683_10134784
2082 Ga0207683_10141677
2083 Ga0207683_10194589
2084 Ga0207683_10347697
2085 Ga0207683_10654751
2086 Ga0207698_10107111
2087 Ga0207698_10240799
2088 Ga0207698_10795415
2089 Ga0209995_1021268
2090 Ga0209995_1021843
2091 Ga0209968_1017417
2092 Ga0207428_10004450
2093 Ga0207428_10019879
2094 Ga0207428_10056608
2095 Ga0207428_10115662
2096 Ga0207428_10217673
2097 Ga0207428_10386187
2098 Ga0268266_10026474
2099 Ga0268266_10084162
2100 Ga0268266_10339990
2101 Ga0268266_10661553
2102 Ga0268265_10225525
2103 Ga0268265_10291426
2104 Ga0268265_10326993
2105 Ga0268265_10377243
2106 Ga0268265_10544352
2107 Ga0268265_10594225
2108 Ga0268264_10002691
2109 Ga0268264_10074468
2110 Ga0268264_10362762
2111 Ga0268264_10437228
2112 Ga0268264_10525498
2113 Ga0268264_10542218
2114 Ga0268264_10907914
2115 Ga0268264_10913604
2116 Ga0307408_100154756
2117 Ga0307408_100455000
2118 Ga0307516_10407669
2119 Ga0307405_10200528
2120 Ga0307413_10063423
2121 Ga0307410_10838689
2122 Ga0307406_10106255
2123 Ga0307407_10070361
2124 Ga0307407_10199389
2125 Ga0307407_10259917
2126 Ga0307409_100204253
2127 Ga0307409_100545561
2128 Ga0307409_101029004
2129 Ga0307409_101693629
2130 Ga0307416_100042027
2131 Ga0307416_100752114
2132 Ga0307416_101087484
2133 Ga0307416_101340545
2134 Ga0307414_10175792
2135 Ga0307414_10768743
2136 Ga0307411_10103836
2137 Ga0307411_10107278
2138 Ga0307411_10295633
2139 Ga0307411_11228603
2140 Ga0373930_0009710
2141 Ga0373948_0054856
2142 Ga0373950_0038156
2143 Ga0373958_0000117
2144 Ga0373958_0133263
2145 Ga0373938_0000089
2146 Ga0373928_0114491
2147 Ga0373929_0000318
2148 Ga0373934_0000231
2149 Ga0373940_0000090
2150 Ga0373949_0001074
2151 Ga0373949_0022133
2152 Ga0373951_0000324
2153 Ga0373952_0000153
2154 Ga0373923_0154539
2155 Ga0373932_0000097
2156 Ga0373932_0094743
2157 Ga0373932_0184376
2158 Ga0373939_0000186
2159 Ga0373939_0041938
2160 Ga0373945_0201557
2161 Ga0373953_0024611
2162 Ga0373953_0052976
2163 Ga0373953_0122369
2164 Ga0373956_0002311
2165 Ga0373957_0002935
2166 Ga0373960_0000411
2167 Ga0373960_0236059
2168 Ga0373943_0008218
2169 Ga0373946_0052851
2170 Ga0373946_0136521
2171 Ga0373955_0001686
2172 Ga0373955_0600358
2173 Ga0373942_0123273
2174 Ga0373942_0205389
2175 Ga0373961_0004500
2176 Ga0373961_0005962
2177 Ga0373962_0000903
2178 Ga0373962_0022498
2179 Ga0373962_0054654
2180 Ga0373924_0024094
2181 Ga0373931_0000899
2182 Ga0373931_0074711
2183 Ga0373931_0177519
2184 Ga0373935_0102755
2185 Ga0373927_0058119
2186 Ga0373933_0032115
2187 Ga0373933_0067655
2188 Ga0373947_0006250
2189 Ga0373937_0000754
2190 Ga0373937_0054986
2191 Ga0373937_0207500
2192 Ga0373937_0784497
2193 Ga0373937_0848123
2194 Ga0373937_1086821
2195 Ga0373925_0014515
2196 Ga0373925_0317100
2197 Ga0395900_0626532
2198 Ga0395898_1434220
2199 Ga0436364_0766115
2200 Ga0436365_0920024
2201 Ga0436363_0770679
2202 Ga0439453_0018744
2203 Ga0450920_008136
2204 Ga0450920_053990
2205 Ga0450923_033576
2206 Ga0450923_072948
2207 Ga0450894_006397
2208 Ga0450895_005024
2209 Ga0450896_004202
2210 Ga0450896_011157
2211 Ga0450896_012559
2212 Ga0450906_038422
2213 Ga0439458_0063582
2214 Ga0450908_008084
2215 Ga0450908_038218
2216 Ga0450908_039236
2217 Ga0439434_0091513
2218 Ga0439435_0002337
2219 Ga0439435_0022536
2220 Ga0439435_0061092
2221 Ga0439435_0116445
2222 Ga0439444_0088411
2223 Ga0439460_0048231
2224 Ga0439460_0184487
2225 Ga0450918_067527
2226 Ga0451577_0064556
2227 Ga0451576_0101356
2228 Ga0451576_0639658
2229 Ga0495592_0011747
2230 Ga0495603_0244308
2231 Ga0495603_0457422
2232 Ga0495629_0086549
2233 Ga0495629_0207074
2234 Ga0495638_0084454
2235 Ga0495651_0171601
2236 Ga0495653_0327596
2237 Ga0495580_0126714
2238 Ga0495582_0169544
2239 Ga0495582_0195985
2240 Ga0495664_0161975
2241 Ga0495585_0402274
2242 Ga0495594_0210922
2243 Ga0495608_0021077
2244 Ga0495628_0008926
2245 Ga0495630_0014918
2246 Ga0495663_0172109
2247 Ga0495642_0286678
2248 Ga0495652_0061937
2249 Ga0495640_0229910
2250 Ga0495586_0041000
2251 Ga0495586_0045676
2252 Ga0495587_0142413
2253 Ga0495598_0001701
2254 Ga0495598_0058503
2255 Ga0495621_0002944
2256 Ga0495621_0043534
2257 Ga0495645_0021246
2258 Ga0495645_0096591
2259 Ga0495667_0235338
2260 Ga0495656_0019412
2261 Ga0495635_0189583
2262 Ga0495659_0051572
2263 Ga0495659_0118879
2264 Ga0495659_0181957
2265 Ga0495659_0221778
2266 Ga0495657_0123357
2267 Ga0495647_0031369
2268 Ga0495658_0118485
2269 Ga0495669_0018284
2270 Ga0495669_0193953
2271 Ga0495669_0349706
2272 Ga0495613_0001137
2273 Ga0495613_0066686
2274 Ga0495613_0184772
2275 Ga0495670_0102190
2276 Ga0495670_0208711
2277 Ga0495600_0176397
2278 Ga0495600_0524723
2279 Ga0495581_0062421
2280 Ga0495604_0019458
2281 Ga0495636_0140934
2282 Ga0495636_0251190
2283 Ga0495674_0029085
2284 Ga0495684_0000105
2285 Ga0495684_0073898
2286 Ga0496100_0033152
2287 Ga0496101_0325812
2288 Ga0496101_0573680
2289 Ga0496102_0029100
2290 Ga0496103_0034029
2291 Ga0496103_0547796
2292 Ga0496104_0093682
2293 Ga0496104_0550687
2294 Ga0496106_0021008
2295 Ga0496106_0035262
2296 Ga0496106_0409201
2297 Ga0496106_0495610
2298 Ga0496106_0646302
2299 Ga0496106_0778122
2300 Ga0496107_0035276
2301 Ga0496107_0504659
2302 Ga0496108_0069842
2303 Ga0496108_0203464
2304 Ga0496108_0326893
2305 Ga0496108_0392625
2306 Ga0496109_0056691
2307 Ga0496109_0144174
2308 Ga0496109_0655800
2309 Ga0496110_0046746
2310 Ga0496110_0176173
2311 Ga0496110_0271202
2312 Ga0496112_0013866
2313 Ga0496112_0109520
2314 Ga0496112_0247050
2315 Ga0496113_0058750
2316 Ga0496113_0906206
2317 Ga0496114_0000887
2318 Ga0501031_0043361
2319 Ga0501031_0318724
2320 Ga0501033_0173114
2321 Ga0501033_0201880
2322 Ga0501034_0003394
2323 Ga0501034_0060409
2324 Ga0501034_0649303
2325 Ga0501036_0018454
2326 Ga0501036_0078194
2327 Ga0501036_0198880
2328 Ga0501037_0481731
2329 Ga0501038_0013628
2330 Ga0501039_0088951
2331 Ga0501039_0089117
2332 Ga0501040_0003805
2333 Ga0501040_0019113
2334 Ga0501040_0152674
2335 Ga0501040_0535024
2336 Ga0501041_0004970
2337 Ga0501041_0024483
2338 Ga0501041_0097852
2339 Ga0501042_0096735
2340 Ga0501042_0119870
2341 Ga0501042_0177871
2342 Ga0501046_0033591
2343 Ga0501048_0016465
2344 Ga0501048_0019543
2345 Ga0501048_0070672
2346 Ga0501048_0960077
2347 Ga0501068_0096185
2348 Ga0501069_0133777
2349 Ga0501069_0552900
2350 Ga0501070_0140124
2351 Ga0501070_0434571
2352 Ga0501071_0046407
2353 Ga0501071_0060085
2354 Ga0501071_0477905
2355 Ga0501072_0003526
2356 Ga0501072_0033073
2357 Ga0501072_0038115
2358 Ga0501072_0227476
2359 Ga0501073_0376668
2360 Ga0501074_0117701
2361 Ga0501074_0155635
2362 Ga0501074_0209493
2363 Ga0501074_0469196
2364 Ga0501075_0004400
2365 Ga0501075_0006633
2366 Ga0501075_0048129
2367 Ga0501076_0022830
2368 Ga0501076_0114745
2369 Ga0501076_0274613
2370 Ga0501076_0644805
2371 Ga0501076_0742055
2372 Ga0501079_0014210
2373 Ga0501079_0153402
2374 Ga0501079_0338486
2375 Ga0501079_0404527
2376 Ga0501080_0216326
2377 Ga0501080_0638270
2378 Ga0501080_0908322
2379 Ga0501081_0003870
2380 Ga0501081_0009942
2381 Ga0501081_0259969
2382 Ga0501081_0840136
2383 Ga0501083_0380196
2384 Ga0501035_0073918
2385 Ga0501045_0062184
2386 nmdc:mga03683_336904_c1
2387 nmdc:mga03683_497279_c1
2388 nmdc:mga00v17_193115_c1
2389 nmdc:mga00v17_201110_c1
2390 nmdc:mga00v17_64942_c1
2391 nmdc:mga0yw44_16689_c1
2392 nmdc:mga0k408_107010_c1
2393 nmdc:mga0k408_157931_c1
2394 nmdc:mga0k408_195362_c1
2395 nmdc:mga0k408_54160_c1
2396 nmdc:mga06z11_154619_c1
2397 nmdc:mga06z11_8215_c1
2398 nmdc:mga04h51_27808_c1
2399 nmdc:mga07m45_133040_c1
2400 nmdc:mga05p37_160587_c2
2401 nmdc:mga05p37_20943_c1
2402 nmdc:mga05p37_218066_c1
2403 nmdc:mga05p37_239289_c1
2404 nmdc:mga05p37_278947_c1
2405 nmdc:mga05p37_331674_c1
2406 nmdc:mga05p37_4230_c1
2407 nmdc:mga05p37_4956_c1
2408 nmdc:mga05p37_71906_c2
2409 nmdc:mga05p37_84334_c1
2410 nmdc:mga05p37_8475_c1
2411 nmdc:mga05p37_93066_c1
2412 nmdc:mga09592_102534_c1
2413 nmdc:mga09592_135426_c1
2414 nmdc:mga09592_15059_c1
2415 nmdc:mga09592_21999_c1
2416 nmdc:mga09592_258710_c1
2417 nmdc:mga09592_333234_c1
2418 nmdc:mga09592_507254_c1
2419 nmdc:mga0qj67_112279_c1
2420 nmdc:mga0qj67_12785_c1
2421 nmdc:mga0qj67_1798_c1
2422 nmdc:mga0qj67_29269_c1
2423 nmdc:mga0qj67_35802_c1
2424 nmdc:mga0qj67_388558_c1
2425 nmdc:mga0qj67_561113_c1
2426 nmdc:mga0qj67_61694_c1
2427 nmdc:mga06r32_1049459_c1
2428 nmdc:mga06r32_11945_c1
2429 nmdc:mga06r32_18018_c1
2430 nmdc:mga06r32_35149_c1
2431 nmdc:mga06r32_40341_c1
2432 nmdc:mga06r32_5033_c1
2433 nmdc:mga06r32_57791_c1
2434 nmdc:mga08y16_1002_c1
2435 nmdc:mga08y16_1056393_c1
2436 nmdc:mga08y16_12963_c1
2437 nmdc:mga08y16_1534_c1
2438 nmdc:mga08y16_161581_c1
2439 nmdc:mga08y16_17700_c1
2440 nmdc:mga08y16_336218_c1
2441 nmdc:mga08y16_350609_c1
2442 nmdc:mga08y16_550157_c1
2443 nmdc:mga08y16_621923_c1
2444 nmdc:mga08y16_7021_c1
2445 nmdc:mga0n895_1493399_c1
2446 nmdc:mga0n895_233435_c1
2447 nmdc:mga0n895_304814_c1
2448 nmdc:mga0n895_309808_c1
2449 nmdc:mga0n895_34611_c1
2450 nmdc:mga0n895_3785_c1
2451 nmdc:mga0n895_433836_c1
2452 nmdc:mga0rr50_10335_c1
2453 nmdc:mga0rr50_113145_c1
2454 nmdc:mga0rr50_213337_c1
2455 nmdc:mga0rr50_213811_c1
2456 nmdc:mga0rr50_22427_c1
2457 nmdc:mga0rr50_65488_c1
2458 nmdc:mga08x19_122027_c1
2459 nmdc:mga08x19_12915_c1
2460 nmdc:mga08x19_133278_c1
2461 nmdc:mga08x19_611222_c1
2462 nmdc:mga08x19_67103_c1
2463 nmdc:mga0a205_141176_c1
2464 nmdc:mga0a205_161219_c1
2465 nmdc:mga0a205_174004_c1
2466 nmdc:mga0a205_321062_c1
2467 nmdc:mga0a205_323190_c1
2468 nmdc:mga0a205_5382_c1
2469 nmdc:mga0a205_658155_c1
2470 nmdc:mga0a205_71331_c1
2471 Ga0495601_0001335
2472 Ga0495601_0030327
2473 Ga0495595_0204153
2474 Ga0495595_0304173
2475 Ga0495595_0442846
2476 Ga0495619_0011070
2477 Ga0500592_001337
2478 Ga0500611_128845
2479 Ga0501084_0005602
2480 Ga0501084_0075798
2481 Ga0501084_0193662
2482 Ga0501084_0710348
2483 Ga0590071_000058
2484 Ga0590075_000441
2485 Ga0590077_000552
2486 Ga0501082_0117082
2487 Ga0501082_0240714
2488 Ga0501082_1356668
2489 Ga0530510_0038717
2490 Ga0530510_0073268

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

148

197

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

142

195

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

48

115

0.94

Map